3KTMA

Structure of the heparin-induced e1-dimer of the amyloid precursor protein (app)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
175
structure length
175
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAIEGRKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein
publication title Structure and biochemical analysis of the heparin-induced E1 dimer of the amyloid precursor protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, signaling protein
total genus 32
structure length 175
sequence length 175
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 3ktmA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 3ktmA01
4PQDA 1OWTA 3KTMA 2FK2A 4JFNA 2M05A 2FJZA 2FMAA 1MWPA 2FK3A 2FK1A 4PWQA 2FKLA
chains in the Genus database with same CATH superfamily
4ECWA 1BGWA 5KFSA 2UVRA 1KEEA 4A3FG 4ED7A 2AU0A 4IRCA 2FE3A 1SEIA 5FLXW 2W70A 5IP9G 5KFAA 2JA7A 3RB0A 4DR1H 4Q8EA 4ETSA 1GSAA 5JVLA 4EFEA 4XYMB 4DR4H 1B6SA 3K5IA 3OUZA 2R8JA 4DL4A 2YL2A 2ZDGA 2R8IA 2YZMA 4A3JG 3PVXA 3RB3A 2B63G 2YRXA 4JV0A 3TQTA 4JFNA 3GTJA 1R9TA 2NUAB 2VQEH 3H40A 2CZGA 3V6JA 4GC6A 2W6ZA 4MTDA 2DPJA 3JSLA 3KXYT 2E2IA 4A3KG 5L1LA 3FMAA 2X0SA 4TQSA 3PZPA 5IT9W 2IBKA 2KSWA 3ORRA 2NU7B 3QFFA 1V51A 1C3OA 2JEFA 3PW0A 4EYIB 1MWPA 5KT3A 4F4YA 3K3VA 4WD3A 4HNTA 2R7LA 4GC7A 2YZGA 2FPPB 3MR2A 4JYAH 3N42B 3CVZA 2J6UA 4KHPH 3RTXA 5DG9A 4X64H 2VA2A 4JI1H 4MV3A 3G6XA 1GSHA 2IA6A 4O3SA 2W9BA 3KHHA 4ED1A 1N33H 3N41B 4DUYH 5KFZA 4A3BG 3GTOA 2SCUB 3R5HA 4IWXA 1XMOH 3N40P 1K1SA 2FMAA 2YW2A 3HOWG 4JV1A 3BABA 4WBNF 3TINA 3PR5B 1RK5A 3Q2OA 2Y0SE 1T3NA 1E4FT 4YJ3F 1BNCA 1FKAH 2VQDA 4RB1A 3HBLA 4IAJA 5IYDG 2PBZA 3Q1KA 4UCOA 5KG3A 4B3RH 1DV1A 4HYKA 2VUMG 4BBRG 1MZBA 1UNNC 2V5AA 1SFOA 1UC9A 2HGSA 4LSXA 5KT4A 4ZQIA 5EWGA 4FS1A 1FJGH 5IYCG 5KFCA 2JA6G 1E4EA 4QWBA 5C4XG 4DL3A 5HV6A 1JLLB 1JDEA 1WH2A 3GLKA 3MR3A 4LF4H 1T94A 1EZ1A 4MV4A 2UXDH 2W9CA 5KFLA 3VMMA 4RNOA 4O3NA 4R7RA 5C3EG 1XNQH 3GTQA 2R6FA 4TV8F 2M05A 4O3PA 5KFFA 1IOVA 3T5LA 3I4MG 4DL2A 4DV6H 3HOYG 5KKNB 3T1HH 3BA9A 5DLFA 5KG5A 4DR6H 4G3IA 4YQWA 3NGDA 3FDSA 4J9MA 3IN5A 5KFIA 3GTLA 2V58A 1O75A 3RAXA 2ASLA 3GTPA 1EHIA 4EG0A 4ECQA 4O2AF 4MAMA 4R8UB 4RNNA 2R86A 2ZJTA 4ZOLF 3RIZA 3LP8A 2C00A 5IP7G 5DQIA 2DIKA 4QWEA 4EEYA 2V4QA 3BG5A 3G6YA 2ASJA 3HB9A 4RNMA 2HJWA 4MA5A 1WCMG 2V9WA 2CQYA 4Q0YA 4F50A 4JI0H 3J80W 3TIGA 1GO3E 4TQRA 2W6QA 4ED0A 3GIDA 3T5KA 5BPHA 3V6HA 5JVDF 4OX9H 4JI6H 4K0KH 3PW5A 4LH7A 4LFBH 3RJ0A 4Q43A 3BQ1A 3L4KA 4IRKA 4A93G 5T14A 3G6VA 3WO1A 2BQ3A 2VUMA 1I7NA 5LP6F 1RJRA 3GTGA 3GTKA 2C2DA 2O03A 1GSOA 3MJFA 2JA6A 4RAYA 4QIWE 3RUPA 4YY3H 2NU6B 3K3PA 2FPIB 3JRXA 4DV0H 3PO2G 3WO0A 1TWCA 5EDWA 1XNRH 2DLNA 1KBLA 3BJYA 3VPDA 5KFWA 4DL6A 4MV1A 3MWMA 2J6TA 2V59A 2YZNA 2HVRA 5KFVA 2J6SA 1CE8A 4C2MA 5KFMA 4RB0A 2VR1A 4Y8VB 5FPRA 5KFRA 1S9FA 4Q8FA 3RFCA 3J7AK 1P8LA 5BR8H 3GIKA 4AQYH 2UUBH 3RGZA 2YRWA 4LF7H 1VAJA 1V4YA 3HOUG 2R7NA 5DLGA 1Z2NX 3N43B 2ALZA 5CA1F 1DV2A 2R8HA 2ZDHA 4PDBA 3JZIA 5LYJF 5GONF 4C5BA 4HQ6A 4F4XA 4UCTA 5FPOA 1I7LA 4A2BA 4EEQA 5KFDA 2IP4A 4DV5H 3HKZE 4MV7A 4O4IF 4MTEA 5KFKA 5C5JA 3QZ8A 2W8LA 2ASDA 2FLNA 4RZQA 4BWSC 4JI5H 1Y1VG 4RAZA 2RDJA 4J0MA 1M7JA 2QYZA 4UFZA 5EOYA 1WCMA 4UCRA 1J5EH 2YCHA 3KAJA 2FK2A 4XX0B 4DUZH 2Y0SA 2C2RA 3AYHB 2BQUA 2DWCA 2W57A 4QW9A 1Y1WG 4B3SH 3OHAA 1CQJB 1ULZA 2C35B 3IG0A 1XMQH 3QZ7A 3H3VH 4ECRA 4IWYA 5KFJA 3Q8RB 3TQ1A 2Q2UA 2RDIA 3RF2A 1AUXA 3U9TA 3RB6A 1HR0H 1OWTA 2R93G 2QK4A 5FD6A 3Q8QB 4I4TF 1CQIB 1AUVA 2FK3A 2R82A 4O4LF 3KALA 2WYOA 2XGQA 3SI8A 1KC7A 2Q2TA 4JUZA 5KFOA 4LF5H 3C0FB 1M0WA 2GLTA 4DV3H 2R7KA 4GKKH 4YBZB 2UU9H 3ETJA 4R8UA 4X65H 2VUGA 3PR4A 4EBDA 4L1KA 2XIGA 2MCTA 4A3IG 3H0GG 1SYXB 4M9UA 5I47A 1S97A 4I55F 4EBCA 4IHJF 5C1PA 4RB2C 2FK1A 5DGAA 1EUDB 3BQ0A 4NXMH 4JI3H 1KJJA 4YR0A 2JEIA 3RBDA 4QW8A 1SCUB 3T5JA 4B3MH 5DQGA 4I50F 2HHHH 4QJFA 2XD4A 3GILA 4F4WA 4GLXA 4ECUA 5KFPA 2I80A 1TWFA 1Y1VA 5EWEA 5DG7A 4O3QA 5KFGA 5F9NA 2YU9A 3JSNA 3GV8B 2GPWA 2CKZB 2BQRA 4BBSG 3RBEA 3BQ2A 2NU8B 4X66H 1JDBB 4RUCA 4ED2A 2R84A 3F8NA 2C28A 3KHLA 3E5NA 3SE7A 2FPGB 3MFIA 1IOWA 1BXRA 4J9PA 1Y1WA 3RV3A 4JI7H 5J2UF 3BA8A 1WR2A 3BAAA 4J9RA 2BR0A 4JI8H 1HNXH 5IYZF 4MV9A 1TWHA 3RB4A 3G8CA 4RUAA 2HVQA 3WNZA 2R93A 2UVVA 4QIWA 5DGBA 2E5LH 4LF8H 4ECXA 3N6XA 3GV5B 4NLGA 3HOZG 1I50A 4X62H 3RV4A 4ECZA 2FLLA 1I6UA 4A2AA 2W6MA 1KJ8A 1WSCA 3R5FA 5KFTA 4M7EA 3MWDA 3GQCA 2DZDA 3GIMA 1PK8A 4DL7A 4U6PA 4DV2H 2AGQA 5KG2A 4FU0A 4A3LG 1K1QA 1S0NA 3DF7A 4EYHB 4MA0A 5D1OB 4C5CA 3H0GA 4XZ3B 3V6KA 4HNUA 1IBMH 2IMWP 3KHGA 4QWCA 4APMA 5C44G 3MR6A 5JH7F 5IYBG 3MWEA 4YB8B 5EWFA 4FBTA 1TA8A 4J9OA 1HNZH 4O3OA 2W71A 3HKZA 5D8DA 3LMLA 2B63A 3T5HA 4C5AA 1VKZA 5J2TF 4PWQA 2CW8A 3R5XA 3M9MB 4BY7G 3OSPA 4YR3A 1GLVA 1PX2A 4BXXG 2XC9A 4O2BF 2FLPA 4A3GG 5CB4F 4LF6H 1L2ZA 2RGRA 5KT6A 4DL5A 3R23A 1W93A 4J9NA 1S03G 2V4RA 5KT5A 4UCVA 1RJPA 3PN1A 3EPGA 5L1KA 1S0OA 2UVWA 3GIIA 5KFYA 3EYYA 3EPIA 2FP4B 2C22A 1B04A 5C8YF 2AGPA 5FD5A 3KHRA 4AYBE 1T36A 1M6VA 2W6PA 1HNWH 2VA3A 1DIKA 1JKJB 1TWAA 4YJ2F 1IBKH 5CAEB 5LOVF 2R92G 5LL6b 4ME6A 5KFQA 1TWGA 4EGQA 2VQFH 4DR2H 4A3MG 5IWAH 2AGOA 1VS0A 3CQZA 4JI4H 2PMZE 3OTOH 1S68A 3L4JA 4Q44A 3OHBA 5EZYF 2I8CA 1KJQA 2JA5G 3GIJA 4CC5A 2NU9B 5KG6A 2W6OA 5C1OA 5CA0F 3HXLA 4QWDA 4ECYA 3RAQA 2JEGA 3MR5A 3UFXB 2OWOA 3VPCA 5HBRB 1EUCB 2FJZA 2W9AA 1W96A 3HOVG 1VBGA 1KJIA 4IRDA 3U9SA 3OSNA 3ORQA 4YP3A 4QWAA 1RYRA 1C30A 3FKIG 3KTMA 1UC8A 4YAKB 3KAKA 5L1IA 4ZI7F 3VPBA 4XYLB 3V4SA 2RF4A 3RGXA 2HVSA 4O4HF 5KG4A 1B6RA 4UCUA 5KG1A 4RU9A 5H80A 2UUCH 2JEJA 4A3EG 4TV9F 5KG7A 2WE6A 4YAJB 2C2EA 4A3DG 1JXLA 2UUAH 2W8KA 1RK6A 1GGOA 5BMVF 5KT2A 1KJ9A 2AQ4A 1JX4A 4ECTA 2R87A 4ED3A 3GIPA 4A3CG 5A2QW 2R8KA 5LMUH 3M4IA 4IR9A 2VPSA 5KT7A 5F9LA 4EGJA 1N32H 4DV7H 2NVXA 2RGVA 4JV5H 4GKJH 3N44B 3PW2A 3J81W 2F4VH 1N34H 4FM9A 4HR7A 4Q45A 1VBHA 4E4TA 3GIQA 2FB9A 5JQWA 4ED8A 3PO3G 3OUUA 1K83A 4ECVA 5KFXA 1ZETA 5LA6F 2PVPA 3M9NB 4LSAA 2ATLA 4DLKA 4LMYA 3UQ8A 1Y14B 1BJTA 4DV1H 1DGSA 3LWBA 2WTFA 2R92A 2OH2A 2CW7A 5D1OA 2PN1A 2WAQA 4TUYF 3PW4A 2WDTA 3I4NG 1AN7A 4J9SA 4FBUA 5KFNA 1JIHA 1I94H 2W6NA 3GTMA 1N48A 1A9XA 2JA5A 4JI2H 4EBEA 3Q8SB 1A0IA 3T1YH 2UXCH 3H4DA 5KFHA 4LH6A 3M9OB 4FS2A 1X9NA 2R7ZG 2P0AA 4MV8A 2R85A 4DR5H 4U7CA 2W7PA 5KX5F 2WB1A 2W7OA 5FJ8G 4CC6A 2ZM6H 1N56A 4PQDA 2XCLA 4IR1A 4LFCH 3FKIA 4B3TH 2W9BB 2UXBH 1ZHQA 2XGPA 3PW7A 2JA7G 1CS0A 3HOXG 1EYZA 1ZQ7A 2WAQE 5JUMA 5FLMG 4ED6A 1FVIA 4LFAH 2DPIA 4RB3C 4JV2A 4J9LA 1Z2PX 2I87A 4IZOA 2VPQA 3ETHA 3H20A 5KFUA 4HNVA 5KFEA 4LF9H 1XDNA 1B33N 5BPFA 5D1PA 5KG0A 2J9GA 2R7MA 2WB1E 1E4EB 1I3QA 2OLSA 3N8DA 3L2PA 4AYBA 5L9XA 2W9CB 2R8GA 2YS6A 4O3RA 4UCSA 4J9KA 2YYAA 4J9QA 5K2MA 3GV7B 3H4BA 1V9PA 5LMNH 1RYSA 3I12A 1IBLH 4YR2A 2UVUA 2JA8G 5L1JA 1RJQA 5KFBA 4DR7H 1ZHSA 2NVYA 4I7HA 5LXTF 5DG8A 3TIIA 3Q8PB 1S0MA 1N36H 2PMZA 2E2HA 4MV6A 4DV4H 4F4ZA 1S10A 1M0TA 1Z2OX 1GYFA 2GPSA 4DR3H 4ECSA 3JAMW 3MFHA 1TAEA 2ZDQA 4BY1G 4RZRA 4EFBA 2XCAA 5DQHA 4ZHQF 4YHHH 2XCPA 3V4ZA 2YS7A 1E4GT 3JRWA 2R7ZA 3K5HA 2VOBA 4NXNH 2FKLA
chains in the Genus database with same CATH topology
4PQDA 1OWTA 3KTMA 2FK2A 4JFNA 2M05A 2FJZA 2FMAA 1MWPA 2FK3A 2FK1A 4PWQA 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQD A;  1OWT A;  3KTM A;  2FK2 A;  4JFN A;  2M05 A;  2FJZ A;  2FMA A;  1MWP A;  2FK3 A;  2FK1 A;  4PWQ A;  2FKL A; 
#chains in the Genus database with same CATH topology
 4ECW A;  1BGW A;  5KFS A;  2UVR A;  1KEE A;  4A3F G;  4ED7 A;  2AU0 A;  4IRC A;  2FE3 A;  1SEI A;  5FLX W;  2W70 A;  5IP9 G;  5KFA A;  2JA7 A;  3RB0 A;  4DR1 H;  4Q8E A;  4ETS A;  1GSA A;  5JVL A;  4EFE A;  4XYM B;  4DR4 H;  1B6S A;  3K5I A;  3OUZ A;  2R8J A;  4DL4 A;  2YL2 A;  2ZDG A;  2R8I A;  2YZM A;  4A3J G;  3PVX A;  3RB3 A;  2B63 G;  2YRX A;  4JV0 A;  3TQT A;  4JFN A;  3GTJ A;  1R9T A;  2NUA B;  2VQE H;  3H40 A;  2CZG A;  3V6J A;  4GC6 A;  2W6Z A;  4MTD A;  2DPJ A;  3JSL A;  3KXY T;  2E2I A;  4A3K G;  5L1L A;  3FMA A;  2X0S A;  4TQS A;  3PZP A;  5IT9 W;  2IBK A;  2KSW A;  3ORR A;  2NU7 B;  3QFF A;  1V51 A;  1C3O A;  2JEF A;  3PW0 A;  4EYI B;  1MWP A;  5KT3 A;  4F4Y A;  3K3V A;  4WD3 A;  4HNT A;  2R7L A;  4GC7 A;  2YZG A;  2FPP B;  3MR2 A;  4JYA H;  3N42 B;  3CVZ A;  2J6U A;  4KHP H;  3RTX A;  5DG9 A;  4X64 H;  2VA2 A;  4JI1 H;  4MV3 A;  3G6X A;  1GSH A;  2IA6 A;  4O3S A;  2W9B A;  3KHH A;  4ED1 A;  1N33 H;  3N41 B;  4DUY H;  5KFZ A;  4A3B G;  3GTO A;  2SCU B;  3R5H A;  4IWX A;  1XMO H;  3N40 P;  1K1S A;  2FMA A;  2YW2 A;  3HOW G;  4JV1 A;  3BAB A;  4WBN F;  3TIN A;  3PR5 B;  1RK5 A;  3Q2O A;  2Y0S E;  1T3N A;  1E4F T;  4YJ3 F;  1BNC A;  1FKA H;  2VQD A;  4RB1 A;  3HBL A;  4IAJ A;  5IYD G;  2PBZ A;  3Q1K A;  4UCO A;  5KG3 A;  4B3R H;  1DV1 A;  4HYK A;  2VUM G;  4BBR G;  1MZB A;  1UNN C;  2V5A A;  1SFO A;  1UC9 A;  2HGS A;  4LSX A;  5KT4 A;  4ZQI A;  5EWG A;  4FS1 A;  1FJG H;  5IYC G;  5KFC A;  2JA6 G;  1E4E A;  4QWB A;  5C4X G;  4DL3 A;  5HV6 A;  1JLL B;  1JDE A;  1WH2 A;  3GLK A;  3MR3 A;  4LF4 H;  1T94 A;  1EZ1 A;  4MV4 A;  2UXD H;  2W9C A;  5KFL A;  3VMM A;  4RNO A;  4O3N A;  4R7R A;  5C3E G;  1XNQ H;  3GTQ A;  2R6F A;  4TV8 F;  2M05 A;  4O3P A;  5KFF A;  1IOV A;  3T5L A;  3I4M G;  4DL2 A;  4DV6 H;  3HOY G;  5KKN B;  3T1H H;  3BA9 A;  5DLF A;  5KG5 A;  4DR6 H;  4G3I A;  4YQW A;  3NGD A;  3FDS A;  4J9M A;  3IN5 A;  5KFI A;  3GTL A;  2V58 A;  1O75 A;  3RAX A;  2ASL A;  3GTP A;  1EHI A;  4EG0 A;  4ECQ A;  4O2A F;  4MAM A;  4R8U B;  4RNN A;  2R86 A;  2ZJT A;  4ZOL F;  3RIZ A;  3LP8 A;  2C00 A;  5IP7 G;  5DQI A;  2DIK A;  4QWE A;  4EEY A;  2V4Q A;  3BG5 A;  3G6Y A;  2ASJ A;  3HB9 A;  4RNM A;  2HJW A;  4MA5 A;  1WCM G;  2V9W A;  2CQY A;  4Q0Y A;  4F50 A;  4JI0 H;  3J80 W;  3TIG A;  1GO3 E;  4TQR A;  2W6Q A;  4ED0 A;  3GID A;  3T5K A;  5BPH A;  3V6H A;  5JVD F;  4OX9 H;  4JI6 H;  4K0K H;  3PW5 A;  4LH7 A;  4LFB H;  3RJ0 A;  4Q43 A;  3BQ1 A;  3L4K A;  4IRK A;  4A93 G;  5T14 A;  3G6V A;  3WO1 A;  2BQ3 A;  2VUM A;  1I7N A;  5LP6 F;  1RJR A;  3GTG A;  3GTK A;  2C2D A;  2O03 A;  1GSO A;  3MJF A;  2JA6 A;  4RAY A;  4QIW E;  3RUP A;  4YY3 H;  2NU6 B;  3K3P A;  2FPI B;  3JRX A;  4DV0 H;  3PO2 G;  3WO0 A;  1TWC A;  5EDW A;  1XNR H;  2DLN A;  1KBL A;  3BJY A;  3VPD A;  5KFW A;  4DL6 A;  4MV1 A;  3MWM A;  2J6T A;  2V59 A;  2YZN A;  2HVR A;  5KFV A;  2J6S A;  1CE8 A;  4C2M A;  5KFM A;  4RB0 A;  2VR1 A;  4Y8V B;  5FPR A;  5KFR A;  1S9F A;  4Q8F A;  3RFC A;  3J7A K;  1P8L A;  5BR8 H;  3GIK A;  4AQY H;  2UUB H;  3RGZ A;  2YRW A;  4LF7 H;  1VAJ A;  1V4Y A;  3HOU G;  2R7N A;  5DLG A;  1Z2N X;  3N43 B;  2ALZ A;  5CA1 F;  1DV2 A;  2R8H A;  2ZDH A;  4PDB A;  3JZI A;  5LYJ F;  5GON F;  4C5B A;  4HQ6 A;  4F4X A;  4UCT A;  5FPO A;  1I7L A;  4A2B A;  4EEQ A;  5KFD A;  2IP4 A;  4DV5 H;  3HKZ E;  4MV7 A;  4O4I F;  4MTE A;  5KFK A;  5C5J A;  3QZ8 A;  2W8L A;  2ASD A;  2FLN A;  4RZQ A;  4BWS C;  4JI5 H;  1Y1V G;  4RAZ A;  2RDJ A;  4J0M A;  1M7J A;  2QYZ A;  4UFZ A;  5EOY A;  1WCM A;  4UCR A;  1J5E H;  2YCH A;  3KAJ A;  2FK2 A;  4XX0 B;  4DUZ H;  2Y0S A;  2C2R A;  3AYH B;  2BQU A;  2DWC A;  2W57 A;  4QW9 A;  1Y1W G;  4B3S H;  3OHA A;  1CQJ B;  1ULZ A;  2C35 B;  3IG0 A;  1XMQ H;  3QZ7 A;  3H3V H;  4ECR A;  4IWY A;  5KFJ A;  3Q8R B;  3TQ1 A;  2Q2U A;  2RDI A;  3RF2 A;  1AUX A;  3U9T A;  3RB6 A;  1HR0 H;  1OWT A;  2R93 G;  2QK4 A;  5FD6 A;  3Q8Q B;  4I4T F;  1CQI B;  1AUV A;  2FK3 A;  2R82 A;  4O4L F;  3KAL A;  2WYO A;  2XGQ A;  3SI8 A;  1KC7 A;  2Q2T A;  4JUZ A;  5KFO A;  4LF5 H;  3C0F B;  1M0W A;  2GLT A;  4DV3 H;  2R7K A;  4GKK H;  4YBZ B;  2UU9 H;  3ETJ A;  4R8U A;  4X65 H;  2VUG A;  3PR4 A;  4EBD A;  4L1K A;  2XIG A;  2MCT A;  4A3I G;  3H0G G;  1SYX B;  4M9U A;  5I47 A;  1S97 A;  4I55 F;  4EBC A;  4IHJ F;  5C1P A;  4RB2 C;  2FK1 A;  5DGA A;  1EUD B;  3BQ0 A;  4NXM H;  4JI3 H;  1KJJ A;  4YR0 A;  2JEI A;  3RBD A;  4QW8 A;  1SCU B;  3T5J A;  4B3M H;  5DQG A;  4I50 F;  2HHH H;  4QJF A;  2XD4 A;  3GIL A;  4F4W A;  4GLX A;  4ECU A;  5KFP A;  2I80 A;  1TWF A;  1Y1V A;  5EWE A;  5DG7 A;  4O3Q A;  5KFG A;  5F9N A;  2YU9 A;  3JSN A;  3GV8 B;  2GPW A;  2CKZ B;  2BQR A;  4BBS G;  3RBE A;  3BQ2 A;  2NU8 B;  4X66 H;  1JDB B;  4RUC A;  4ED2 A;  2R84 A;  3F8N A;  2C28 A;  3KHL A;  3E5N A;  3SE7 A;  2FPG B;  3MFI A;  1IOW A;  1BXR A;  4J9P A;  1Y1W A;  3RV3 A;  4JI7 H;  5J2U F;  3BA8 A;  1WR2 A;  3BAA A;  4J9R A;  2BR0 A;  4JI8 H;  1HNX H;  5IYZ F;  4MV9 A;  1TWH A;  3RB4 A;  3G8C A;  4RUA A;  2HVQ A;  3WNZ A;  2R93 A;  2UVV A;  4QIW A;  5DGB A;  2E5L H;  4LF8 H;  4ECX A;  3N6X A;  3GV5 B;  4NLG A;  3HOZ G;  1I50 A;  4X62 H;  3RV4 A;  4ECZ A;  2FLL A;  1I6U A;  4A2A A;  2W6M A;  1KJ8 A;  1WSC A;  3R5F A;  5KFT A;  4M7E A;  3MWD A;  3GQC A;  2DZD A;  3GIM A;  1PK8 A;  4DL7 A;  4U6P A;  4DV2 H;  2AGQ A;  5KG2 A;  4FU0 A;  4A3L G;  1K1Q A;  1S0N A;  3DF7 A;  4EYH B;  4MA0 A;  5D1O B;  4C5C A;  3H0G A;  4XZ3 B;  3V6K A;  4HNU A;  1IBM H;  2IMW P;  3KHG A;  4QWC A;  4APM A;  5C44 G;  3MR6 A;  5JH7 F;  5IYB G;  3MWE A;  4YB8 B;  5EWF A;  4FBT A;  1TA8 A;  4J9O A;  1HNZ H;  4O3O A;  2W71 A;  3HKZ A;  5D8D A;  3LML A;  2B63 A;  3T5H A;  4C5A A;  1VKZ A;  5J2T F;  4PWQ A;  2CW8 A;  3R5X A;  3M9M B;  4BY7 G;  3OSP A;  4YR3 A;  1GLV A;  1PX2 A;  4BXX G;  2XC9 A;  4O2B F;  2FLP A;  4A3G G;  5CB4 F;  4LF6 H;  1L2Z A;  2RGR A;  5KT6 A;  4DL5 A;  3R23 A;  1W93 A;  4J9N A;  1S03 G;  2V4R A;  5KT5 A;  4UCV A;  1RJP A;  3PN1 A;  3EPG A;  5L1K A;  1S0O A;  2UVW A;  3GII A;  5KFY A;  3EYY A;  3EPI A;  2FP4 B;  2C22 A;  1B04 A;  5C8Y F;  2AGP A;  5FD5 A;  3KHR A;  4AYB E;  1T36 A;  1M6V A;  2W6P A;  1HNW H;  2VA3 A;  1DIK A;  1JKJ B;  1TWA A;  4YJ2 F;  1IBK H;  5CAE B;  5LOV F;  2R92 G;  5LL6 b;  4ME6 A;  5KFQ A;  1TWG A;  4EGQ A;  2VQF H;  4DR2 H;  4A3M G;  5IWA H;  2AGO A;  1VS0 A;  3CQZ A;  4JI4 H;  2PMZ E;  3OTO H;  1S68 A;  3L4J A;  4Q44 A;  3OHB A;  5EZY F;  2I8C A;  1KJQ A;  2JA5 G;  3GIJ A;  4CC5 A;  2NU9 B;  5KG6 A;  2W6O A;  5C1O A;  5CA0 F;  3HXL A;  4QWD A;  4ECY A;  3RAQ A;  2JEG A;  3MR5 A;  3UFX B;  2OWO A;  3VPC A;  5HBR B;  1EUC B;  2FJZ A;  2W9A A;  1W96 A;  3HOV G;  1VBG A;  1KJI A;  4IRD A;  3U9S A;  3OSN A;  3ORQ A;  4YP3 A;  4QWA A;  1RYR A;  1C30 A;  3FKI G;  3KTM A;  1UC8 A;  4YAK B;  3KAK A;  5L1I A;  4ZI7 F;  3VPB A;  4XYL B;  3V4S A;  2RF4 A;  3RGX A;  2HVS A;  4O4H F;  5KG4 A;  1B6R A;  4UCU A;  5KG1 A;  4RU9 A;  5H80 A;  2UUC H;  2JEJ A;  4A3E G;  4TV9 F;  5KG7 A;  2WE6 A;  4YAJ B;  2C2E A;  4A3D G;  1JXL A;  2UUA H;  2W8K A;  1RK6 A;  1GGO A;  5BMV F;  5KT2 A;  1KJ9 A;  2AQ4 A;  1JX4 A;  4ECT A;  2R87 A;  4ED3 A;  3GIP A;  4A3C G;  5A2Q W;  2R8K A;  5LMU H;  3M4I A;  4IR9 A;  2VPS A;  5KT7 A;  5F9L A;  4EGJ A;  1N32 H;  4DV7 H;  2NVX A;  2RGV A;  4JV5 H;  4GKJ H;  3N44 B;  3PW2 A;  3J81 W;  2F4V H;  1N34 H;  4FM9 A;  4HR7 A;  4Q45 A;  1VBH A;  4E4T A;  3GIQ A;  2FB9 A;  5JQW A;  4ED8 A;  3PO3 G;  3OUU A;  1K83 A;  4ECV A;  5KFX A;  1ZET A;  5LA6 F;  2PVP A;  3M9N B;  4LSA A;  2ATL A;  4DLK A;  4LMY A;  3UQ8 A;  1Y14 B;  1BJT A;  4DV1 H;  1DGS A;  3LWB A;  2WTF A;  2R92 A;  2OH2 A;  2CW7 A;  5D1O A;  2PN1 A;  2WAQ A;  4TUY F;  3PW4 A;  2WDT A;  3I4N G;  1AN7 A;  4J9S A;  4FBU A;  5KFN A;  1JIH A;  1I94 H;  2W6N A;  3GTM A;  1N48 A;  1A9X A;  2JA5 A;  4JI2 H;  4EBE A;  3Q8S B;  1A0I A;  3T1Y H;  2UXC H;  3H4D A;  5KFH A;  4LH6 A;  3M9O B;  4FS2 A;  1X9N A;  2R7Z G;  2P0A A;  4MV8 A;  2R85 A;  4DR5 H;  4U7C A;  2W7P A;  5KX5 F;  2WB1 A;  2W7O A;  5FJ8 G;  4CC6 A;  2ZM6 H;  1N56 A;  4PQD A;  2XCL A;  4IR1 A;  4LFC H;  3FKI A;  4B3T H;  2W9B B;  2UXB H;  1ZHQ A;  2XGP A;  3PW7 A;  2JA7 G;  1CS0 A;  3HOX G;  1EYZ A;  1ZQ7 A;  2WAQ E;  5JUM A;  5FLM G;  4ED6 A;  1FVI A;  4LFA H;  2DPI A;  4RB3 C;  4JV2 A;  4J9L A;  1Z2P X;  2I87 A;  4IZO A;  2VPQ A;  3ETH A;  3H20 A;  5KFU A;  4HNV A;  5KFE A;  4LF9 H;  1XDN A;  1B33 N;  5BPF A;  5D1P A;  5KG0 A;  2J9G A;  2R7M A;  2WB1 E;  1E4E B;  1I3Q A;  2OLS A;  3N8D A;  3L2P A;  4AYB A;  5L9X A;  2W9C B;  2R8G A;  2YS6 A;  4O3R A;  4UCS A;  4J9K A;  2YYA A;  4J9Q A;  5K2M A;  3GV7 B;  3H4B A;  1V9P A;  5LMN H;  1RYS A;  3I12 A;  1IBL H;  4YR2 A;  2UVU A;  2JA8 G;  5L1J A;  1RJQ A;  5KFB A;  4DR7 H;  1ZHS A;  2NVY A;  4I7H A;  5LXT F;  5DG8 A;  3TII A;  3Q8P B;  1S0M A;  1N36 H;  2PMZ A;  2E2H A;  4MV6 A;  4DV4 H;  4F4Z A;  1S10 A;  1M0T A;  1Z2O X;  1GYF A;  2GPS A;  4DR3 H;  4ECS A;  3JAM W;  3MFH A;  1TAE A;  2ZDQ A;  4BY1 G;  4RZR A;  4EFB A;  2XCA A;  5DQH A;  4ZHQ F;  4YHH H;  2XCP A;  3V4Z A;  2YS7 A;  1E4G T;  3JRW A;  2R7Z A;  3K5H A;  2VOB A;  4NXN H;  2FKL A; 
#chains in the Genus database with same CATH homology
 4PQD A;  1OWT A;  3KTM A;  2FK2 A;  4JFN A;  2M05 A;  2FJZ A;  2FMA A;  1MWP A;  2FK3 A;  2FK1 A;  4PWQ A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...