3KTMA

Structure of the heparin-induced e1-dimer of the amyloid precursor protein (app)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
175
structure length
175
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAIEGRKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid beta A4 protein
publication title Structure and biochemical analysis of the heparin-induced E1 dimer of the amyloid precursor protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, signaling protein
total genus 32
structure length 175
sequence length 175
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 3ktmA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 3ktmA01
4PQDA 2FKLA 2FK2A 1MWPA 2FK3A 2FK1A 4JFNA 2M05A 3KTMA 2FJZA 4PWQA 2FMAA 1OWTA
chains in the Genus database with same CATH superfamily
2YW2A 4A3JG 1BGWA 1FVIA 5H80A 2V58A 3L2PA 4ECQA 1KBLA 4FS1A 2DZDA 4I4TF 3G6XA 2FMAA 1S68A 4LFCH 2ZDHA 5C5JA 1S97A 3H3VH 5KFFA 2XGQA 2E2IA 1WSCA 3RGXA 5KFZA 5LYJF 3N6XA 4U7CA 3RBDA 4GKJH 1KJJA 1TWHA 4DLKA 1X9NA 3BABA 4UCRA 5FJ8G 2W6QA 3LMLA 5EZYF 3G6YA 2Q2UA 3RJ0A 4YP3A 2AGQA 2V59A 2VPQA 2R93G 1DGSA 4UFZA 4DUYH 2ZDQA 5D1PA 4MV6A 2UVWA 1GO3E 4YBZB 5EWGA 2VUGA 3OTOH 3JAMW 2VUMA 4ECRA 1JDBB 4R7RA 1E4EA 2YZNA 1BJTA 5KFAA 4LF7H 2R7LA 3MFIA 5DGAA 2IA6A 2V5AA 4O3OA 3RUPA 1JDEA 3U9TA 5LOVF 3GTGA 4UCUA 1TA8A 2YZMA 1N34H 4A3GG 2C35B 3GTJA 3BA9A 3KAJA 4JV1A 1M6VA 3RGZA 5KG5A 3H4BA 1C3OA 2R92A 3MR2A 2OH2A 2ZM6H 3V4ZA 3H0GG 2YCHA 1ZETA 1GSOA 3ORRA 4FU0A 1XMQH 4YR3A 1M0WA 4C5BA 4GC7A 4BY1G 5LXTF 4JV5H 2SCUB 5L1LA 2WE6A 3DF7A 3TQ1A 2E5LH 3KAKA 2WAQA 1JLLB 2VPSA 4C2MA 2V4QA 3GTOA 2BR0A 4EGQA 4Q8FA 5FD6A 3H4DA 1A0IA 1UC9A 4LSAA 4HNVA 1CS0A 5IWAH 1Z2OX 2CZGA 5LL6b 4QW9A 1ZHSA 3GQCA 1V51A 1FJGH 2FK1A 1EUDB 3BAAA 4UCSA 5KFSA 4A2AA 4X64H 3V6JA 2YS7A 3OSPA 2J6UA 2R87A 2HVQA 2W6MA 2NVYA 3KXYT 3Q8PB 4ECZA 3IG0A 2IP4A 2JEFA 5L9XA 2R84A 5LMUH 4JV2A 2YRWA 2R8KA 4DV6H 1A9XA 4ME6A 1KEEA 5K2MA 4EBEA 2DPIA 4HYKA 4LFBH 4F4XA 1ULZA 3M9NB 4CC5A 4ECTA 4DV0H 5IP9G 5FPRA 5KFVA 4AQYH 2OWOA 3PR5B 1WCMG 2FPPB 1RJQA 3IN5A 1OWTA 5KT6A 4LF8H 4LFAH 5KG7A 2W9BA 4F4YA 2W6OA 1GSHA 1RJRA 4IZOA 2FE3A 4DR4H 2QYZA 4XZ3B 4HNTA 4ED6A 1HNWH 4F50A 1XNQH 3SI8A 2FKLA 3ORQA 4O3SA 4WD3A 3FDSA 4ED8A 4I50F 4DR6H 4IAJA 4MV9A 5JVDF 1AN7A 2R92G 4ZI7F 3PW4A 5EWFA 5L1JA 4FM9A 4J9PA 3Q1KA 3RB6A 3GTKA 1KC7A 3BG5A 4NLGA 5LMNH 2PMZA 3GIKA 1HR0H 2YYAA 2RDJA 2JA5G 4ECSA 3PW7A 1ZQ7A 4DV7H 3HOUG 1Z2NX 3RTXA 2NU6B 5DQIA 2WB1E 2BQ3A 1VBGA 3TIGA 4DR7H 2UUAH 4YQWA 1KJ8A 4O4LF 3MR5A 4DV3H 2VQEH 5DG7A 5A2QW 1RYSA 4KHPH 2YZGA 4WBNF 1IOVA 4RUAA 5CB4F 1WR2A 3MJFA 3J80W 5DLGA 1T94A 4Q45A 1I7NA 5KG3A 2DWCA 2UU9H 2CW8A 4ZOLF 2W7PA 3GIDA 3JSNA 4K0KH 4UCVA 2JEGA 4YR2A 2VR1A 3RV4A 2ASJA 3OUZA 2AU0A 4A3IG 1I94H 2DPJA 3ETJA 1IOWA 2FLPA 2JA6A 3BQ2A 4PDBA 1VS0A 4TV9F 3HOXG 2O03A 3BQ0A 4LF5H 4MV1A 3QZ8A 1VAJA 5JH7F 2V4RA 4DL2A 4EGJA 1N32H 1TWCA 5F9LA 2FLLA 2R85A 4BBSG 3HKZE 4LH6A 2R82A 3FKIG 1JKJB 3QZ7A 1GGOA 2W7OA 2AGPA 4RAZA 4ZHQF 1RK6A 3HBLA 3LWBA 5CA1F 1EHIA 1CE8A 4IWYA 4X66H 4EYHB 2Q2TA 4IRCA 4JI7H 2JA8G 3MR3A 4M9UA 2NVXA 5KFYA 3R5FA 2ATLA 4APMA 4XX0B 4YB8B 4J9SA 1MWPA 2W57A 4JYAH 1M0TA 1XNRH 3MR6A 3K3VA 2W8LA 1S0OA 3KHGA 4AYBA 1CQJB 1I50A 4MTDA 3OSNA 3KHLA 1T3NA 4QW8A 4RZRA 3GV5B 5KFMA 4MV4A 1KJQA 1UC8A 3CVZA 3PO3G 2XD4A 2FK3A 1B33N 3AYHB 5KFCA 4RNOA 3PR4A 3GTQA 3GTMA 1W96A 3OHBA 2DIKA 1JXLA 3HOVG 2C2RA 2CQYA 3R5HA 4ECXA 3R23A 2ASLA 1B6RA 3M9MB 1PX2A 4QIWE 5KX5F 2XCAA 4TQRA 1Y1WG 5JVLA 2UUBH 2CW7A 1HNXH 2JA6G 5I47A 5KFXA 1XDNA 2R7KA 4QWDA 4F4WA 3HOWG 4J9NA 4GLXA 3GIPA 4O3NA 1ZHQA 5KFGA 2W8KA 1V9PA 3KALA 5DQHA 4GC6A 4YHHH 3MWDA 5KFTA 1SEIA 3CQZA 4TV8F 5KFUA 1RK5A 4R8UB 3LP8A 3Q8QB 5DLFA 3PW5A 2GPWA 3N41B 5KKNB 3MFHA 4EYIB 3HOYG 1GSAA 5JUMA 5FLXW 2ASDA 2FJZA 1JIHA 4I7HA 3N42B 2W71A 5CA0F 4MV8A 1IBMH 2J9GA 2HHHH 4UCOA 2Y0SE 5CAEB 5KT2A 2C2EA 4MV3A 1EYZA 1HNZH 4DR5H 2UXCH 3EPGA 3BQ1A 3I4MG 5D8DA 2W9CB 2R8JA 1BNCA 5C44G 4FBUA 3F8NA 4RU9A 3T1HH 4G3IA 4YR0A 1SCUB 3K5IA 2VUMG 3K3PA 1V4YA 4ED0A 4A3BG 4RUCA 2JA7A 3JSLA 5BPFA 4DL3A 3FMAA 1K1SA 1C30A 1TAEA 3R5XA 5D1OB 3L4JA 3OUUA 4ED2A 2YU9A 4O2BF 3V6HA 4BBRG 1B6SA 5KFJA 5IYZF 2NU8B 4DL4A 2F4VH 4XYLB 2OLSA 2FPGB 2C22A 4IR9A 4MA5A 4J9MA 1BXRA 1RJPA 3V6KA 3M4IA 4MA0A 4BY7G 2R7NA 3RIZA 2HVRA 1J5EH 4LMYA 4HQ6A 1B04A 4B3SH 4EBDA 4JI5H 4B3RH 3HOZG 4RB1A 3PVXA 2C2DA 2W6ZA 4DV1H 2E2HA 3T1YH 3SE7A 5L1IA 2FB9A 3T5HA 4JI8H 5KT5A 1N48A 3RFCA 2XGPA 4DR1H 1T36A 1S0NA 5IT9W 4PWQA 1P8LA 5BMVF 4O3PA 3HB9A 3TQTA 4RB3C 3BJYA 3WO0A 1IBKH 4JFNA 1E4EB 3GV8B 4ECVA 5KFRA 2GPSA 5FPOA 4GKKH 4A3DG 5EOYA 4YAKB 4J9OA 5KFKA 2WB1A 2BQUA 2XIGA 3T5KA 2UVVA 5J2TF 2IMWP 4MAMA 4M7EA 5IP7G 4FS2A 2PVPA 3PN1A 4DV5H 3TINA 4EG0A 5F9NA 5KFOA 4BWSC 4IRKA 4DR3H 3H20A 3N43B 2JEIA 1Z2PX 4Q44A 5DG9A 1M7JA 2WDTA 4ECYA 5DQGA 2UXDH 4EFBA 3VPDA 4DV2H 3H0GA 4JI6H 5KG4A 3GIJA 5C4XG 2HJWA 4A3MG 4J9QA 2UUCH 2YL2A 3J81W 3I12A 3QFFA 4DL5A 5KFHA 5T14A 1TWAA 1TWFA 5KT4A 4JI3H 1MZBA 5C8YF 2PN1A 4F4ZA 4ECUA 3GTLA 3UFXB 1S10A 3HKZA 4JI1H 1K1QA 5C3EG 2GLTA 1FKAH 4QWCA 4E4TA 4YAJB 3GIQA 3U9SA 3PZPA 2NU7B 1I7LA 4RB0A 4O3QA 3RB0A 4EBCA 1SYXB 3PW2A 4ZQIA 2W9BB 3N44B 4I55F 1L2ZA 3ETHA 1UNNC 5IYCG 4O3RA 3G8CA 4JI4H 2UVUA 5KG2A 1O75A 2KSWA 2W6NA 3HXLA 5LP6F 3K5HA 3RAXA 2ALZA 3WNZA 1WCMA 4RB2C 3KHHA 1KJ9A 4EEYA 1R9TA 3BA8A 4O4IF 5KT3A 4BXXG 3UQ8A 3EYYA 2WAQE 5KG0A 3OHAA 4A3LG 4PQDA 2I80A 3RV3A 4RZQA 2R7ZA 2DLNA 3JRWA 4MV7A 3L4KA 2W6PA 5J2UF 4JI2H 3J7AK 4RAYA 5DGBA 5DG8A 2X0SA 1N36H 2I87A 2M05A 5HBRB 1Y1VA 1JX4A 2HVSA 1GYFA 4X65H 2R86A 3E5NA 4QIWA 4YJ3F 4MTEA 4QWEA 3M9OB 5BR8H 2AGOA 4XYMB 5EDWA 3G6VA 2JA5A 2YRXA 3TIIA 4DV4H 1PK8A 2VA2A 2R8GA 2UXBH 4IHJF 5BPHA 3EPIA 5KFDA 4HR7A 5IYDG 2PBZA 4ED7A 3WO1A 2VQDA 5C1OA 4B3TH 2W70A 2J6TA 4A2BA 1VKZA 2NU9B 4Q43A 1K83A 4NXNH 4ETSA 2C00A 2YS6A 4TUYF 3T5LA 2NUAB 3VPBA 2HGSA 2QK4A 1E4FT 4NXMH 5JQWA 2P0AA 1W93A 4A93G 4HNUA 3PW0A 3JZIA 5KG6A 5KFBA 2R8IA 3Q8RB 3PO2G 5KFIA 4IR1A 1DV2A 2BQRA 4LF4H 2B63A 4RNNA 5L1KA 1TWGA 2J6SA 4O2AF 3KHRA 4J9RA 3JRXA 4X62H 2Y0SA 2W9AA 2PMZE 3Q8SB 1EUCB 1S9FA 4JI0H 5KFLA 2WTFA 2VA3A 1S03G 4Y8VB 4U6PA 1AUVA 3NGDA 4A3FG 3H40A 5HV6A 4JV0A 2R7ZG 1I6UA 1GLVA 1Y14B 4LH7A 3MWEA 5C1PA 3FKIA 1EZ1A 3N8DA 2RF4A 5FD5A 3RB4A 1S0MA 4Q0YA 3V4SA 4QWAA 5KFQA 1CQIB 4J0MA 1DIKA 1KJIA 3C0FB 5KFWA 2JEJA 1Y1VG 2ZJTA 4DL6A 2R7MA 4B3MH 4J9LA 4Q8EA 5KFEA 3VPCA 2XCLA 4YY3H 1DV1A 5FLMG 4IRDA 3Q2OA 3RB3A 1N33H 4C5CA 3N40P 1E4GT 2XC9A 2WYOA 2XCPA 2R93A 4QWBA 2RGRA 4R8UA 3MWMA 1SFOA 4QJFA 4EEQA 2RGVA 4RNMA 2FK2A 4YJ2F 4TQSA 4ECWA 4LF6H 1N56A 4JUZA 1IBLH 2MCTA 1RYRA 4ED1A 4OX9H 4DL7A 2I8CA 4IWXA 5EWEA 4EFEA 5KFPA 2VOBA 4ED3A 5KFNA 1VBHA 2AQ4A 2JA7G 3VMMA 4A3EG 4C5AA 2FP4B 4FBTA 3I4NG 2ZDGA 2V9WA 2VQFH 4DUZH 3GIMA 2R8HA 3RF2A 4UCTA 5IYBG 2C28A 2B63G 1I3QA 1Y1WA 4J9KA 3RAQA 4A3KG 1WH2A 4O4HF 4A3CG 2W9CA 4LF9H 3GTPA 2CKZB 2R6FA 3KTMA 3T5JA 4DR2H 5LA6F 4L1KA 4LSXA 3GV7B 1XMOH 2FLNA 1AUXA 5D1OA 5KT7A 4CC6A 3GIIA 3RBEA 2RDIA 5GONF 5KG1A 2IBKA 4AYBE 2FPIB 3GILA 3GLKA 2UVRA
chains in the Genus database with same CATH topology
4PQDA 2FKLA 2FK2A 1MWPA 2FK3A 2FK1A 4JFNA 2M05A 3KTMA 2FJZA 4PWQA 2FMAA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PQD A;  2FKL A;  2FK2 A;  1MWP A;  2FK3 A;  2FK1 A;  4JFN A;  2M05 A;  3KTM A;  2FJZ A;  4PWQ A;  2FMA A;  1OWT A; 
#chains in the Genus database with same CATH topology
 2YW2 A;  4A3J G;  1BGW A;  1FVI A;  5H80 A;  2V58 A;  3L2P A;  4ECQ A;  1KBL A;  4FS1 A;  2DZD A;  4I4T F;  3G6X A;  2FMA A;  1S68 A;  4LFC H;  2ZDH A;  5C5J A;  1S97 A;  3H3V H;  5KFF A;  2XGQ A;  2E2I A;  1WSC A;  3RGX A;  5KFZ A;  5LYJ F;  3N6X A;  4U7C A;  3RBD A;  4GKJ H;  1KJJ A;  1TWH A;  4DLK A;  1X9N A;  3BAB A;  4UCR A;  5FJ8 G;  2W6Q A;  3LML A;  5EZY F;  3G6Y A;  2Q2U A;  3RJ0 A;  4YP3 A;  2AGQ A;  2V59 A;  2VPQ A;  2R93 G;  1DGS A;  4UFZ A;  4DUY H;  2ZDQ A;  5D1P A;  4MV6 A;  2UVW A;  1GO3 E;  4YBZ B;  5EWG A;  2VUG A;  3OTO H;  3JAM W;  2VUM A;  4ECR A;  1JDB B;  4R7R A;  1E4E A;  2YZN A;  1BJT A;  5KFA A;  4LF7 H;  2R7L A;  3MFI A;  5DGA A;  2IA6 A;  2V5A A;  4O3O A;  3RUP A;  1JDE A;  3U9T A;  5LOV F;  3GTG A;  4UCU A;  1TA8 A;  2YZM A;  1N34 H;  4A3G G;  2C35 B;  3GTJ A;  3BA9 A;  3KAJ A;  4JV1 A;  1M6V A;  3RGZ A;  5KG5 A;  3H4B A;  1C3O A;  2R92 A;  3MR2 A;  2OH2 A;  2ZM6 H;  3V4Z A;  3H0G G;  2YCH A;  1ZET A;  1GSO A;  3ORR A;  4FU0 A;  1XMQ H;  4YR3 A;  1M0W A;  4C5B A;  4GC7 A;  4BY1 G;  5LXT F;  4JV5 H;  2SCU B;  5L1L A;  2WE6 A;  3DF7 A;  3TQ1 A;  2E5L H;  3KAK A;  2WAQ A;  1JLL B;  2VPS A;  4C2M A;  2V4Q A;  3GTO A;  2BR0 A;  4EGQ A;  4Q8F A;  5FD6 A;  3H4D A;  1A0I A;  1UC9 A;  4LSA A;  4HNV A;  1CS0 A;  5IWA H;  1Z2O X;  2CZG A;  5LL6 b;  4QW9 A;  1ZHS A;  3GQC A;  1V51 A;  1FJG H;  2FK1 A;  1EUD B;  3BAA A;  4UCS A;  5KFS A;  4A2A A;  4X64 H;  3V6J A;  2YS7 A;  3OSP A;  2J6U A;  2R87 A;  2HVQ A;  2W6M A;  2NVY A;  3KXY T;  3Q8P B;  4ECZ A;  3IG0 A;  2IP4 A;  2JEF A;  5L9X A;  2R84 A;  5LMU H;  4JV2 A;  2YRW A;  2R8K A;  4DV6 H;  1A9X A;  4ME6 A;  1KEE A;  5K2M A;  4EBE A;  2DPI A;  4HYK A;  4LFB H;  4F4X A;  1ULZ A;  3M9N B;  4CC5 A;  4ECT A;  4DV0 H;  5IP9 G;  5FPR A;  5KFV A;  4AQY H;  2OWO A;  3PR5 B;  1WCM G;  2FPP B;  1RJQ A;  3IN5 A;  1OWT A;  5KT6 A;  4LF8 H;  4LFA H;  5KG7 A;  2W9B A;  4F4Y A;  2W6O A;  1GSH A;  1RJR A;  4IZO A;  2FE3 A;  4DR4 H;  2QYZ A;  4XZ3 B;  4HNT A;  4ED6 A;  1HNW H;  4F50 A;  1XNQ H;  3SI8 A;  2FKL A;  3ORQ A;  4O3S A;  4WD3 A;  3FDS A;  4ED8 A;  4I50 F;  4DR6 H;  4IAJ A;  4MV9 A;  5JVD F;  1AN7 A;  2R92 G;  4ZI7 F;  3PW4 A;  5EWF A;  5L1J A;  4FM9 A;  4J9P A;  3Q1K A;  3RB6 A;  3GTK A;  1KC7 A;  3BG5 A;  4NLG A;  5LMN H;  2PMZ A;  3GIK A;  1HR0 H;  2YYA A;  2RDJ A;  2JA5 G;  4ECS A;  3PW7 A;  1ZQ7 A;  4DV7 H;  3HOU G;  1Z2N X;  3RTX A;  2NU6 B;  5DQI A;  2WB1 E;  2BQ3 A;  1VBG A;  3TIG A;  4DR7 H;  2UUA H;  4YQW A;  1KJ8 A;  4O4L F;  3MR5 A;  4DV3 H;  2VQE H;  5DG7 A;  5A2Q W;  1RYS A;  4KHP H;  2YZG A;  4WBN F;  1IOV A;  4RUA A;  5CB4 F;  1WR2 A;  3MJF A;  3J80 W;  5DLG A;  1T94 A;  4Q45 A;  1I7N A;  5KG3 A;  2DWC A;  2UU9 H;  2CW8 A;  4ZOL F;  2W7P A;  3GID A;  3JSN A;  4K0K H;  4UCV A;  2JEG A;  4YR2 A;  2VR1 A;  3RV4 A;  2ASJ A;  3OUZ A;  2AU0 A;  4A3I G;  1I94 H;  2DPJ A;  3ETJ A;  1IOW A;  2FLP A;  2JA6 A;  3BQ2 A;  4PDB A;  1VS0 A;  4TV9 F;  3HOX G;  2O03 A;  3BQ0 A;  4LF5 H;  4MV1 A;  3QZ8 A;  1VAJ A;  5JH7 F;  2V4R A;  4DL2 A;  4EGJ A;  1N32 H;  1TWC A;  5F9L A;  2FLL A;  2R85 A;  4BBS G;  3HKZ E;  4LH6 A;  2R82 A;  3FKI G;  1JKJ B;  3QZ7 A;  1GGO A;  2W7O A;  2AGP A;  4RAZ A;  4ZHQ F;  1RK6 A;  3HBL A;  3LWB A;  5CA1 F;  1EHI A;  1CE8 A;  4IWY A;  4X66 H;  4EYH B;  2Q2T A;  4IRC A;  4JI7 H;  2JA8 G;  3MR3 A;  4M9U A;  2NVX A;  5KFY A;  3R5F A;  2ATL A;  4APM A;  4XX0 B;  4YB8 B;  4J9S A;  1MWP A;  2W57 A;  4JYA H;  1M0T A;  1XNR H;  3MR6 A;  3K3V A;  2W8L A;  1S0O A;  3KHG A;  4AYB A;  1CQJ B;  1I50 A;  4MTD A;  3OSN A;  3KHL A;  1T3N A;  4QW8 A;  4RZR A;  3GV5 B;  5KFM A;  4MV4 A;  1KJQ A;  1UC8 A;  3CVZ A;  3PO3 G;  2XD4 A;  2FK3 A;  1B33 N;  3AYH B;  5KFC A;  4RNO A;  3PR4 A;  3GTQ A;  3GTM A;  1W96 A;  3OHB A;  2DIK A;  1JXL A;  3HOV G;  2C2R A;  2CQY A;  3R5H A;  4ECX A;  3R23 A;  2ASL A;  1B6R A;  3M9M B;  1PX2 A;  4QIW E;  5KX5 F;  2XCA A;  4TQR A;  1Y1W G;  5JVL A;  2UUB H;  2CW7 A;  1HNX H;  2JA6 G;  5I47 A;  5KFX A;  1XDN A;  2R7K A;  4QWD A;  4F4W A;  3HOW G;  4J9N A;  4GLX A;  3GIP A;  4O3N A;  1ZHQ A;  5KFG A;  2W8K A;  1V9P A;  3KAL A;  5DQH A;  4GC6 A;  4YHH H;  3MWD A;  5KFT A;  1SEI A;  3CQZ A;  4TV8 F;  5KFU A;  1RK5 A;  4R8U B;  3LP8 A;  3Q8Q B;  5DLF A;  3PW5 A;  2GPW A;  3N41 B;  5KKN B;  3MFH A;  4EYI B;  3HOY G;  1GSA A;  5JUM A;  5FLX W;  2ASD A;  2FJZ A;  1JIH A;  4I7H A;  3N42 B;  2W71 A;  5CA0 F;  4MV8 A;  1IBM H;  2J9G A;  2HHH H;  4UCO A;  2Y0S E;  5CAE B;  5KT2 A;  2C2E A;  4MV3 A;  1EYZ A;  1HNZ H;  4DR5 H;  2UXC H;  3EPG A;  3BQ1 A;  3I4M G;  5D8D A;  2W9C B;  2R8J A;  1BNC A;  5C44 G;  4FBU A;  3F8N A;  4RU9 A;  3T1H H;  4G3I A;  4YR0 A;  1SCU B;  3K5I A;  2VUM G;  3K3P A;  1V4Y A;  4ED0 A;  4A3B G;  4RUC A;  2JA7 A;  3JSL A;  5BPF A;  4DL3 A;  3FMA A;  1K1S A;  1C30 A;  1TAE A;  3R5X A;  5D1O B;  3L4J A;  3OUU A;  4ED2 A;  2YU9 A;  4O2B F;  3V6H A;  4BBR G;  1B6S A;  5KFJ A;  5IYZ F;  2NU8 B;  4DL4 A;  2F4V H;  4XYL B;  2OLS A;  2FPG B;  2C22 A;  4IR9 A;  4MA5 A;  4J9M A;  1BXR A;  1RJP A;  3V6K A;  3M4I A;  4MA0 A;  4BY7 G;  2R7N A;  3RIZ A;  2HVR A;  1J5E H;  4LMY A;  4HQ6 A;  1B04 A;  4B3S H;  4EBD A;  4JI5 H;  4B3R H;  3HOZ G;  4RB1 A;  3PVX A;  2C2D A;  2W6Z A;  4DV1 H;  2E2H A;  3T1Y H;  3SE7 A;  5L1I A;  2FB9 A;  3T5H A;  4JI8 H;  5KT5 A;  1N48 A;  3RFC A;  2XGP A;  4DR1 H;  1T36 A;  1S0N A;  5IT9 W;  4PWQ A;  1P8L A;  5BMV F;  4O3P A;  3HB9 A;  3TQT A;  4RB3 C;  3BJY A;  3WO0 A;  1IBK H;  4JFN A;  1E4E B;  3GV8 B;  4ECV A;  5KFR A;  2GPS A;  5FPO A;  4GKK H;  4A3D G;  5EOY A;  4YAK B;  4J9O A;  5KFK A;  2WB1 A;  2BQU A;  2XIG A;  3T5K A;  2UVV A;  5J2T F;  2IMW P;  4MAM A;  4M7E A;  5IP7 G;  4FS2 A;  2PVP A;  3PN1 A;  4DV5 H;  3TIN A;  4EG0 A;  5F9N A;  5KFO A;  4BWS C;  4IRK A;  4DR3 H;  3H20 A;  3N43 B;  2JEI A;  1Z2P X;  4Q44 A;  5DG9 A;  1M7J A;  2WDT A;  4ECY A;  5DQG A;  2UXD H;  4EFB A;  3VPD A;  4DV2 H;  3H0G A;  4JI6 H;  5KG4 A;  3GIJ A;  5C4X G;  2HJW A;  4A3M G;  4J9Q A;  2UUC H;  2YL2 A;  3J81 W;  3I12 A;  3QFF A;  4DL5 A;  5KFH A;  5T14 A;  1TWA A;  1TWF A;  5KT4 A;  4JI3 H;  1MZB A;  5C8Y F;  2PN1 A;  4F4Z A;  4ECU A;  3GTL A;  3UFX B;  1S10 A;  3HKZ A;  4JI1 H;  1K1Q A;  5C3E G;  2GLT A;  1FKA H;  4QWC A;  4E4T A;  4YAJ B;  3GIQ A;  3U9S A;  3PZP A;  2NU7 B;  1I7L A;  4RB0 A;  4O3Q A;  3RB0 A;  4EBC A;  1SYX B;  3PW2 A;  4ZQI A;  2W9B B;  3N44 B;  4I55 F;  1L2Z A;  3ETH A;  1UNN C;  5IYC G;  4O3R A;  3G8C A;  4JI4 H;  2UVU A;  5KG2 A;  1O75 A;  2KSW A;  2W6N A;  3HXL A;  5LP6 F;  3K5H A;  3RAX A;  2ALZ A;  3WNZ A;  1WCM A;  4RB2 C;  3KHH A;  1KJ9 A;  4EEY A;  1R9T A;  3BA8 A;  4O4I F;  5KT3 A;  4BXX G;  3UQ8 A;  3EYY A;  2WAQ E;  5KG0 A;  3OHA A;  4A3L G;  4PQD A;  2I80 A;  3RV3 A;  4RZQ A;  2R7Z A;  2DLN A;  3JRW A;  4MV7 A;  3L4K A;  2W6P A;  5J2U F;  4JI2 H;  3J7A K;  4RAY A;  5DGB A;  5DG8 A;  2X0S A;  1N36 H;  2I87 A;  2M05 A;  5HBR B;  1Y1V A;  1JX4 A;  2HVS A;  1GYF A;  4X65 H;  2R86 A;  3E5N A;  4QIW A;  4YJ3 F;  4MTE A;  4QWE A;  3M9O B;  5BR8 H;  2AGO A;  4XYM B;  5EDW A;  3G6V A;  2JA5 A;  2YRX A;  3TII A;  4DV4 H;  1PK8 A;  2VA2 A;  2R8G A;  2UXB H;  4IHJ F;  5BPH A;  3EPI A;  5KFD A;  4HR7 A;  5IYD G;  2PBZ A;  4ED7 A;  3WO1 A;  2VQD A;  5C1O A;  4B3T H;  2W70 A;  2J6T A;  4A2B A;  1VKZ A;  2NU9 B;  4Q43 A;  1K83 A;  4NXN H;  4ETS A;  2C00 A;  2YS6 A;  4TUY F;  3T5L A;  2NUA B;  3VPB A;  2HGS A;  2QK4 A;  1E4F T;  4NXM H;  5JQW A;  2P0A A;  1W93 A;  4A93 G;  4HNU A;  3PW0 A;  3JZI A;  5KG6 A;  5KFB A;  2R8I A;  3Q8R B;  3PO2 G;  5KFI A;  4IR1 A;  1DV2 A;  2BQR A;  4LF4 H;  2B63 A;  4RNN A;  5L1K A;  1TWG A;  2J6S A;  4O2A F;  3KHR A;  4J9R A;  3JRX A;  4X62 H;  2Y0S A;  2W9A A;  2PMZ E;  3Q8S B;  1EUC B;  1S9F A;  4JI0 H;  5KFL A;  2WTF A;  2VA3 A;  1S03 G;  4Y8V B;  4U6P A;  1AUV A;  3NGD A;  4A3F G;  3H40 A;  5HV6 A;  4JV0 A;  2R7Z G;  1I6U A;  1GLV A;  1Y14 B;  4LH7 A;  3MWE A;  5C1P A;  3FKI A;  1EZ1 A;  3N8D A;  2RF4 A;  5FD5 A;  3RB4 A;  1S0M A;  4Q0Y A;  3V4S A;  4QWA A;  5KFQ A;  1CQI B;  4J0M A;  1DIK A;  1KJI A;  3C0F B;  5KFW A;  2JEJ A;  1Y1V G;  2ZJT A;  4DL6 A;  2R7M A;  4B3M H;  4J9L A;  4Q8E A;  5KFE A;  3VPC A;  2XCL A;  4YY3 H;  1DV1 A;  5FLM G;  4IRD A;  3Q2O A;  3RB3 A;  1N33 H;  4C5C A;  3N40 P;  1E4G T;  2XC9 A;  2WYO A;  2XCP A;  2R93 A;  4QWB A;  2RGR A;  4R8U A;  3MWM A;  1SFO A;  4QJF A;  4EEQ A;  2RGV A;  4RNM A;  2FK2 A;  4YJ2 F;  4TQS A;  4ECW A;  4LF6 H;  1N56 A;  4JUZ A;  1IBL H;  2MCT A;  1RYR A;  4ED1 A;  4OX9 H;  4DL7 A;  2I8C A;  4IWX A;  5EWE A;  4EFE A;  5KFP A;  2VOB A;  4ED3 A;  5KFN A;  1VBH A;  2AQ4 A;  2JA7 G;  3VMM A;  4A3E G;  4C5A A;  2FP4 B;  4FBT A;  3I4N G;  2ZDG A;  2V9W A;  2VQF H;  4DUZ H;  3GIM A;  2R8H A;  3RF2 A;  4UCT A;  5IYB G;  2C28 A;  2B63 G;  1I3Q A;  1Y1W A;  4J9K A;  3RAQ A;  4A3K G;  1WH2 A;  4O4H F;  4A3C G;  2W9C A;  4LF9 H;  3GTP A;  2CKZ B;  2R6F A;  3KTM A;  3T5J A;  4DR2 H;  5LA6 F;  4L1K A;  4LSX A;  3GV7 B;  1XMO H;  2FLN A;  1AUX A;  5D1O A;  5KT7 A;  4CC6 A;  3GII A;  3RBE A;  2RDI A;  5GON F;  5KG1 A;  2IBK A;  4AYB E;  2FPI B;  3GIL A;  3GLK A;  2UVR A; 
#chains in the Genus database with same CATH homology
 4PQD A;  2FKL A;  2FK2 A;  1MWP A;  2FK3 A;  2FK1 A;  4JFN A;  2M05 A;  3KTM A;  2FJZ A;  4PWQ A;  2FMA A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...