3KTMA

Structure of the heparin-induced e1-dimer of the amyloid precursor protein (app)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
175
structure length
175
Chain Sequence
LLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAIEGRKLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biochemical analysis of the heparin-induced E1 dimer of the amyloid precursor protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion, signaling protein
molecule keywords Amyloid beta A4 protein
total genus 32
structure length 175
sequence length 175
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02177 APP_N Amyloid A4 N-terminal heparin-binding
A PF12924 APP_Cu_bd Copper-binding of amyloid precursor, CuBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 3ktmA02
3.90.570.10 Alpha Beta Alpha-Beta Complex Sugar Binding Protein, Amyloid A4 Protein; Chain A Amyloidogenic glycoprotein, heparin-binding domain 3ktmA01
4PWQA 4JFNA 2FK3A 3KTMA 2FKLA 1MWPA 2FJZA 4PQDA 2FK1A 2FK2A 2M05A 2FMAA 1OWTA
chains in the Genus database with same CATH superfamily
2JEFA 2WDTA 2CQYA 3L2PA 5F9NA 1TWCA 2NU8B 2R7ZG 4ED2A 2R8IA 5DLFA 5DG7A 5KG4A 1UNNC 3RV4A 4APMA 4HNUA 1BXRA 3T1YH 2ZJTA 2RDJA 4IRCA 5EOYA 2WTFA 2B63A 3HB9A 4DL5A 5KG3A 3M9MB 4GLXA 3RBEA 3G6VA 4O4LF 2HGSA 3PO3G 4YR3A 2ALZA 3GV7B 5KFNA 5C44G 5C5JA 1JLLB 4R8UA 1JIHA 1TA8A 1S0NA 2VQDA 1BNCA 2XIGA 2YRXA 5BMVF 2YZMA 4DR6H 3JRXA 1N48A 5KG0A 1I50A 3PW0A 3EYYA 3GLKA 5KFOA 4J0MA 5K2MA 4JYAH 1E4EB 4IWYA 3PZPA 1Y1VG 2FE3A 1JDEA 4YY3H 3LP8A 3U9TA 3JRWA 4DL4A 1IOVA 2VUGA 4MV4A 3RIZA 3GTOA 3GIDA 5KFTA 4MV1A 4LH6A 1M0TA 1BGWA 2Y0SE 4YAJB 4AYBE 5KT5A 2QYZA 5L1JA 2BR0A 3K3PA 4JV5H 2W6ZA 2NU9B 3IN5A 5IYZF 4J9OA 3N43B 3FDSA 1V51A 4IAJA 5BPFA 4LSXA 1KC7A 3I4MG 3Q8QB 3R23A 4RAYA 5BR8H 3GTGA 2DZDA 2ASDA 4ECWA 4B3SH 1Y14B 3TQTA 3UFXB 2VA3A 1RJQA 4WBNF 4DR4H 5FPOA 1K1QA 2NU6B 3GV5B 4A3KG 2E2IA 4LSAA 1AUXA 5IYCG 3GIKA 4F4ZA 4Q8EA 3PR4A 2R7KA 5CA0F 1S9FA 3M9NB 1KJ8A 5DG8A 5JUMA 1EHIA 4RAZA 2RF4A 3MWMA 4QIWE 1KEEA 5KFEA 5KT7A 4YHHH 4ECVA 3QFFA 2ATLA 5FJ8G 4ED7A 3H3VH 3JSLA 1CQJB 3HOYG 3HOWG 3RB3A 5CB4F 2RGRA 1ULZA 2W57A 1JX4A 3IG0A 4QW9A 2FLPA 1E4EA 5J2TF 2I80A 4ED1A 5KFWA 1HNWH 3PO2G 1E4FT 2FJZA 2V5AA 5IT9W 3BG5A 4FM9A 2JA7A 3H40A 4JI0H 2UXBH 2XD4A 4AQYH 2UXDH 2FKLA 2YS7A 3GILA 4DR1H 2VOBA 3GIMA 3H4BA 4Q43A 4LF4H 3N42B 1ZHSA 4ECZA 1FVIA 1S97A 3GIIA 1MWPA 5KFJA 3T5LA 2R92A 4O4HF 3QZ7A 1EUCB 3N41B 2R85A 1I3QA 1RK5A 1XDNA 4PWQA 2J6TA 5EWGA 4LFAH 1W96A 3N44B 2NUAB 4MV7A 4O4IF 3TINA 2W6OA 2UXCH 4J9MA 2CW7A 2I8CA 2XC9A 3V6HA 4YAKB 5LXTF 2YZGA 1KJQA 1M0WA 2WE6A 2NU7B 2R86A 2YRWA 3Q2OA 2VUMA 5KFPA 4MV9A 4XX0B 3FKIA 4O3PA 5KFZA 4ED8A 2R8KA 4RB0A 2AGQA 3OTOH 5F9LA 4QIWA 4YJ2F 5FD6A 4A2BA 2J9GA 1DGSA 4M7EA 3V4SA 4EYHB 3OHAA 2W7OA 2PMZA 1C3OA 2GPSA 4TUYF 4ECSA 4IR9A 2C00A 4JI7H 1Z2NX 1UC8A 2WAQE 2X0SA 1T94A 4OX9H 1EZ1A 4MV6A 2W7PA 2NVYA 2RGVA 3MR3A 5IP9G 4A3BG 1I7LA 1SEIA 4DR3H 1N36H 2PBZA 4Q0YA 2XGQA 4JI5H 4GKKH 3MWEA 1VBGA 5DQGA 4ED6A 1I6UA 4J9NA 4A93G 2E2HA 2AGPA 2ASLA 3RGZA 3RB6A 2JEGA 4XYMB 2JEIA 1RJPA 3Q1KA 5KT2A 5KFIA 2V4RA 2E5LH 3BQ0A 4JV0A 1JKJB 4E4TA 2DPIA 3HOVG 2Q2UA 4RNOA 4A3JG 4EEYA 3ETHA 2V4QA 2IMWP 1V9PA 2JA5G 4TV9F 1M7JA 2DPJA 2CKZB 2UVVA 4HYKA 2YL2A 5I47A 3V4ZA 2HVSA 1S03G 4IHJF 2YU9A 1I7NA 4Y8VB 3TIIA 5C1OA 1A9XA 2R92G 2FPGB 2VPSA 5CAEB 5LL6b 5IYBG 2UVWA 3H0GA 2ZM6H 3GTLA 5HBRB 1PK8A 2FB9A 1JDBB 3M9OB 2C28A 4R7RA 2JA6G 4K0KH 2R84A 3N40P 3RAQA 5GONF 3EPGA 3T5KA 4ZHQF 3RAXA 3GTPA 4FBUA 5BPHA 1VKZA 4HQ6A 3UQ8A 5IYDG 3L4KA 3MWDA 5DGAA 4LH7A 5D1OA 1N32H 3ORQA 4DUZH 1Y1VA 3VPBA 4EFEA 5KKNB 2W9BA 2RDIA 3HKZE 1W93A 2HJWA 5D8DA 4DR5H 4EBEA 1CS0A 4MAMA 4M9UA 4FU0A 2O03A 2VQEH 5KFBA 2B63G 3R5HA 2DIKA 2YZNA 4C5AA 5C8YF 1KBLA 4QWEA 2FK1A 3PW7A 2KSWA 2F4VH 1KJIA 2PVPA 2R93A 4QWCA 2CW8A 4DV1H 1GGOA 4A3EG 2PN1A 1GYFA 2YYAA 1Z2OX 4DL7A 3KALA 1B6RA 1BJTA 1GLVA 5D1PA 4A3GG 3K3VA 4UFZA 5LP6F 1VS0A 4TV8F 3Q8PB 3HOXG 1IBKH 4ECUA 2GLTA 4PQDA 3Q8SB 2BQ3A 3LWBA 5KFUA 5KFSA 4KHPH 3MR6A 4LFBH 2JEJA 4UCSA 1AUVA 5FLXW 1IBMH 2R87A 4O3NA 1Z2PX 3VPCA 5LYJF 3T1HH 5KG6A 4BY1G 3PVXA 2W8KA 3HBLA 2W6MA 3M4IA 2R8JA 4RNMA 2R7MA 3AYHB 5FLMG 2V9WA 4ECQA 2W6QA 2W9BB 4ECXA 1EUDB 2YS6A 3SE7A 4C2MA 5KFKA 1C30A 3R5FA 4ECTA 3T5HA 2XCAA 4A3FG 2W71A 3BQ2A 5IP7G 2BQUA 4G3IA 1Y1WG 4JFNA 4J9SA 1SYXB 3PW4A 3JAMW 3I4NG 3BA9A 4MV3A 4YB8B 3OSPA 5FD5A 2ZDQA 4ED3A 3QZ8A 3OUUA 4DUYH 4DL3A 1KJ9A 4ZQIA 4X62H 3E5NA 3N8DA 3MFIA 3KAJA 2C35B 4IRDA 3GTJA 4RUCA 2C22A 4Q44A 4ETSA 4Q45A 2W6NA 2W70A 2HVRA 3BJYA 4UCRA 3VPDA 1KJJA 4Q8FA 4RB2C 1FJGH 2QK4A 4J9QA 2YW2A 3GTQA 3H4DA 4B3RH 2R7NA 5DGBA 1ZETA 4B3TH 4TQRA 1GSHA 3GTMA 2AQ4A 4HR7A 3KXYT 5JVLA 4EGJA 4I4TF 4L1KA 4LF9H 4RZQA 2WAQA 2XGPA 3PR5B 4YBZB 2OH2A 4RB1A 2PMZE 4X65H 1O75A 2JA7G 1DIKA 3G6YA 3ORRA 4UCTA 2W8LA 2VQFH 1S10A 1DV1A 4HNTA 4RZRA 4DR7H 3RBDA 2UUBH 1K1SA 4MV8A 3MR5A 2FLLA 1WCMA 4I55F 4X66H 1IBLH 5KT3A 1RYSA 4NLGA 5KFQA 3J7AK 1XNRH 3J80W 5LMUH 3KHRA 4ME6A 3GTKA 1GSOA 1VAJA 1CE8A 1N34H 3GIQA 5FPRA 3GIJA 5KG7A 1CQIB 4U6PA 5EZYF 3VMMA 1HNZH 3BQ1A 5KX5F 2Y0SA 4A3CG 4DV4H 4LF5H 4RUAA 3U9SA 3OSNA 2FPIB 4YJ3F 2XCPA 4JV1A 1ZHQA 3BAAA 2FK2A 3PW2A 2BQRA 1S68A 5DQHA 2WB1A 3WO0A 4DL2A 5KFCA 4BY7G 1TWHA 1XMQH 3KHLA 2DLNA 5KFXA 3DF7A 1TWGA 2J6SA 4JV2A 1FKAH 4ZOLF 4U7CA 1M6VA 3GIPA 5L1IA 4HNVA 1RYRA 1Y1WA 3KAKA 1R9TA 1RJRA 5L9XA 4F50A 4UCUA 2R93G 2FK3A 3NGDA 1TWAA 4MTDA 2VR1A 2JA5A 5LMNH 5KFDA 5EWFA 2MCTA 1N56A 4O3RA 1B33N 4GKJH 5KFHA 5C1PA 2FP4B 3JZIA 4RB3C 1ZQ7A 4YR2A 3MFHA 3KHGA 1UC9A 5KFLA 3TQ1A 1JXLA 5JVDF 3GQCA 3RB0A 1V4YA 1B6SA 5KG5A 1PX2A 5H80A 5J2UF 3HOUG 4O2AF 5KG2A 1IOWA 3PN1A 4MA5A 4RNNA 2W9CB 5KFGA 4A2AA 3J81W 5KFFA 3KHHA 1DV2A 4EBDA 4B3MH 1GO3E 1XMOH 2ZDGA 4EG0A 2XCLA 4BXXG 3BA8A 5A2QW 5C3EG 5L1KA 4J9LA 2R7ZA 1A0IA 2WB1E 3WO1A 5KFYA 5JQWA 3EPIA 4J9PA 1S0OA 5T14A 4FS1A 3FKIG 3T5JA 1I94H 4EEQA 3SI8A 4DV7H 1GSAA 4ECYA 4PDBA 1E4GT 4XYLB 3L4JA 5DG9A 2W9AA 4JI8H 4DV6H 1RK6A 2R8GA 5EWEA 3RGXA 5EDWA 3RF2A 4I50F 1TWFA 1HNXH 3R5XA 4QWAA 3H0GG 1WSCA 4O2BF 1TAEA 4A3LG 4FBTA 2Q2TA 2W9CA 2FMAA 2HHHH 3RV3A 3Q8RB 1B04A 4LFCH 4GC6A 3V6KA 1XNQH 2IBKA 3HKZA 2I87A 2FLNA 1P8LA 4DLKA 2WYOA 4JI2H 3OHBA 2VUMG 2NVXA 4QWBA 1K83A 4DV0H 4YR0A 4NXMH 1WR2A 3F8NA 3HOZG 4IRKA 4NXNH 4MTEA 5CA1F 2UVRA 2FPPB 4MA0A 4X64H 4DV2H 3JSNA 1OWTA 1SCUB 2IA6A 1X9NA 2DWCA 2UU9H 2CZGA 4TQSA 2R7LA 4O3QA 3WNZA 2GPWA 1T3NA 3LMLA 2OLSA 2R6FA 2JA8G 3PW5A 4YP3A 4C5CA 1WCMG 5LOVF 2AGOA 5DLGA 5KFMA 4EGQA 4UCOA 5KT6A 2R8HA 4CC5A 4DV3H 2C2RA 2V59A 4EFBA 4J9KA 4JI6H 3V6JA 4A3IG 4F4YA 1EYZA 3RFCA 1SFOA 3RB4A 3OUZA 4LF6H 4LF8H 3MJFA 2UUAH 3I12A 2JA6A 2ZDHA 4IWXA 3CVZA 5LA6F 4R8UB 4BWSC 3G6XA 2C2EA 5D1OB 5KFRA 3RJ0A 2UUCH 4EBCA 2SCUB 4WD3A 3MR2A 3H20A 4DR2H 4C5BA 4DL6A 2R82A 2AU0A 4LMYA 3G8CA 4ZI7F 2IP4A 4O3OA 5L1LA 2VPQA 1L2ZA 4JUZA 4A3DG 5DQIA 2VA2A 2OWOA 4CC6A 4EYIB 2HVQA 3FMAA 1N33H 4BBRG 4QJFA 3RTXA 3ETJA 4ED0A 3C0FB 3RUPA 2C2DA 3N6XA 4RU9A 3K5IA 4DV5H 3HXLA 4UCVA 1J5EH 3CQZA 3GV8B 3BABA 4GC7A 1WH2A 2M05A 4YQWA 1S0MA 2J6UA 4IZOA 4BBSG 4F4WA 4ECRA 4JI4H 5IWAH 1AN7A 5HV6A 4FS2A 1MZBA 2YCHA 2ASJA 2UVUA 1HR0H 4JI1H 3KTMA 5KT4A 4QWDA 4JI3H 2V58A 3TIGA 5JH7F 2W6PA 3K5HA 4O3SA 5KG1A 2P0AA 1T36A 4IR1A 4LF7H 5KFAA 4XZ3B 4F4XA 4QW8A 4I7HA 5KFVA 5C4XG 4AYBA 4A3MG 4J9RA 1VBHA
chains in the Genus database with same CATH topology
4PWQA 4JFNA 2FK3A 3KTMA 2FKLA 1MWPA 2FJZA 4PQDA 2FK1A 2FK2A 2M05A 2FMAA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PWQ A;  4JFN A;  2FK3 A;  3KTM A;  2FKL A;  1MWP A;  2FJZ A;  4PQD A;  2FK1 A;  2FK2 A;  2M05 A;  2FMA A;  1OWT A; 
#chains in the Genus database with same CATH topology
 2JEF A;  2WDT A;  2CQY A;  3L2P A;  5F9N A;  1TWC A;  2NU8 B;  2R7Z G;  4ED2 A;  2R8I A;  5DLF A;  5DG7 A;  5KG4 A;  1UNN C;  3RV4 A;  4APM A;  4HNU A;  1BXR A;  3T1Y H;  2ZJT A;  2RDJ A;  4IRC A;  5EOY A;  2WTF A;  2B63 A;  3HB9 A;  4DL5 A;  5KG3 A;  3M9M B;  4GLX A;  3RBE A;  3G6V A;  4O4L F;  2HGS A;  3PO3 G;  4YR3 A;  2ALZ A;  3GV7 B;  5KFN A;  5C44 G;  5C5J A;  1JLL B;  4R8U A;  1JIH A;  1TA8 A;  1S0N A;  2VQD A;  1BNC A;  2XIG A;  2YRX A;  5BMV F;  2YZM A;  4DR6 H;  3JRX A;  1N48 A;  5KG0 A;  1I50 A;  3PW0 A;  3EYY A;  3GLK A;  5KFO A;  4J0M A;  5K2M A;  4JYA H;  1E4E B;  4IWY A;  3PZP A;  1Y1V G;  2FE3 A;  1JDE A;  4YY3 H;  3LP8 A;  3U9T A;  3JRW A;  4DL4 A;  1IOV A;  2VUG A;  4MV4 A;  3RIZ A;  3GTO A;  3GID A;  5KFT A;  4MV1 A;  4LH6 A;  1M0T A;  1BGW A;  2Y0S E;  4YAJ B;  4AYB E;  5KT5 A;  2QYZ A;  5L1J A;  2BR0 A;  3K3P A;  4JV5 H;  2W6Z A;  2NU9 B;  3IN5 A;  5IYZ F;  4J9O A;  3N43 B;  3FDS A;  1V51 A;  4IAJ A;  5BPF A;  4LSX A;  1KC7 A;  3I4M G;  3Q8Q B;  3R23 A;  4RAY A;  5BR8 H;  3GTG A;  2DZD A;  2ASD A;  4ECW A;  4B3S H;  1Y14 B;  3TQT A;  3UFX B;  2VA3 A;  1RJQ A;  4WBN F;  4DR4 H;  5FPO A;  1K1Q A;  2NU6 B;  3GV5 B;  4A3K G;  2E2I A;  4LSA A;  1AUX A;  5IYC G;  3GIK A;  4F4Z A;  4Q8E A;  3PR4 A;  2R7K A;  5CA0 F;  1S9F A;  3M9N B;  1KJ8 A;  5DG8 A;  5JUM A;  1EHI A;  4RAZ A;  2RF4 A;  3MWM A;  4QIW E;  1KEE A;  5KFE A;  5KT7 A;  4YHH H;  4ECV A;  3QFF A;  2ATL A;  5FJ8 G;  4ED7 A;  3H3V H;  3JSL A;  1CQJ B;  3HOY G;  3HOW G;  3RB3 A;  5CB4 F;  2RGR A;  1ULZ A;  2W57 A;  1JX4 A;  3IG0 A;  4QW9 A;  2FLP A;  1E4E A;  5J2T F;  2I80 A;  4ED1 A;  5KFW A;  1HNW H;  3PO2 G;  1E4F T;  2FJZ A;  2V5A A;  5IT9 W;  3BG5 A;  4FM9 A;  2JA7 A;  3H40 A;  4JI0 H;  2UXB H;  2XD4 A;  4AQY H;  2UXD H;  2FKL A;  2YS7 A;  3GIL A;  4DR1 H;  2VOB A;  3GIM A;  3H4B A;  4Q43 A;  4LF4 H;  3N42 B;  1ZHS A;  4ECZ A;  1FVI A;  1S97 A;  3GII A;  1MWP A;  5KFJ A;  3T5L A;  2R92 A;  4O4H F;  3QZ7 A;  1EUC B;  3N41 B;  2R85 A;  1I3Q A;  1RK5 A;  1XDN A;  4PWQ A;  2J6T A;  5EWG A;  4LFA H;  1W96 A;  3N44 B;  2NUA B;  4MV7 A;  4O4I F;  3TIN A;  2W6O A;  2UXC H;  4J9M A;  2CW7 A;  2I8C A;  2XC9 A;  3V6H A;  4YAK B;  5LXT F;  2YZG A;  1KJQ A;  1M0W A;  2WE6 A;  2NU7 B;  2R86 A;  2YRW A;  3Q2O A;  2VUM A;  5KFP A;  4MV9 A;  4XX0 B;  3FKI A;  4O3P A;  5KFZ A;  4ED8 A;  2R8K A;  4RB0 A;  2AGQ A;  3OTO H;  5F9L A;  4QIW A;  4YJ2 F;  5FD6 A;  4A2B A;  2J9G A;  1DGS A;  4M7E A;  3V4S A;  4EYH B;  3OHA A;  2W7O A;  2PMZ A;  1C3O A;  2GPS A;  4TUY F;  4ECS A;  4IR9 A;  2C00 A;  4JI7 H;  1Z2N X;  1UC8 A;  2WAQ E;  2X0S A;  1T94 A;  4OX9 H;  1EZ1 A;  4MV6 A;  2W7P A;  2NVY A;  2RGV A;  3MR3 A;  5IP9 G;  4A3B G;  1I7L A;  1SEI A;  4DR3 H;  1N36 H;  2PBZ A;  4Q0Y A;  2XGQ A;  4JI5 H;  4GKK H;  3MWE A;  1VBG A;  5DQG A;  4ED6 A;  1I6U A;  4J9N A;  4A93 G;  2E2H A;  2AGP A;  2ASL A;  3RGZ A;  3RB6 A;  2JEG A;  4XYM B;  2JEI A;  1RJP A;  3Q1K A;  5KT2 A;  5KFI A;  2V4R A;  2E5L H;  3BQ0 A;  4JV0 A;  1JKJ B;  4E4T A;  2DPI A;  3HOV G;  2Q2U A;  4RNO A;  4A3J G;  4EEY A;  3ETH A;  2V4Q A;  2IMW P;  1V9P A;  2JA5 G;  4TV9 F;  1M7J A;  2DPJ A;  2CKZ B;  2UVV A;  4HYK A;  2YL2 A;  5I47 A;  3V4Z A;  2HVS A;  1S03 G;  4IHJ F;  2YU9 A;  1I7N A;  4Y8V B;  3TII A;  5C1O A;  1A9X A;  2R92 G;  2FPG B;  2VPS A;  5CAE B;  5LL6 b;  5IYB G;  2UVW A;  3H0G A;  2ZM6 H;  3GTL A;  5HBR B;  1PK8 A;  2FB9 A;  1JDB B;  3M9O B;  2C28 A;  4R7R A;  2JA6 G;  4K0K H;  2R84 A;  3N40 P;  3RAQ A;  5GON F;  3EPG A;  3T5K A;  4ZHQ F;  3RAX A;  3GTP A;  4FBU A;  5BPH A;  1VKZ A;  4HQ6 A;  3UQ8 A;  5IYD G;  3L4K A;  3MWD A;  5DGA A;  4LH7 A;  5D1O A;  1N32 H;  3ORQ A;  4DUZ H;  1Y1V A;  3VPB A;  4EFE A;  5KKN B;  2W9B A;  2RDI A;  3HKZ E;  1W93 A;  2HJW A;  5D8D A;  4DR5 H;  4EBE A;  1CS0 A;  4MAM A;  4M9U A;  4FU0 A;  2O03 A;  2VQE H;  5KFB A;  2B63 G;  3R5H A;  2DIK A;  2YZN A;  4C5A A;  5C8Y F;  1KBL A;  4QWE A;  2FK1 A;  3PW7 A;  2KSW A;  2F4V H;  1KJI A;  2PVP A;  2R93 A;  4QWC A;  2CW8 A;  4DV1 H;  1GGO A;  4A3E G;  2PN1 A;  1GYF A;  2YYA A;  1Z2O X;  4DL7 A;  3KAL A;  1B6R A;  1BJT A;  1GLV A;  5D1P A;  4A3G G;  3K3V A;  4UFZ A;  5LP6 F;  1VS0 A;  4TV8 F;  3Q8P B;  3HOX G;  1IBK H;  4ECU A;  2GLT A;  4PQD A;  3Q8S B;  2BQ3 A;  3LWB A;  5KFU A;  5KFS A;  4KHP H;  3MR6 A;  4LFB H;  2JEJ A;  4UCS A;  1AUV A;  5FLX W;  1IBM H;  2R87 A;  4O3N A;  1Z2P X;  3VPC A;  5LYJ F;  3T1H H;  5KG6 A;  4BY1 G;  3PVX A;  2W8K A;  3HBL A;  2W6M A;  3M4I A;  2R8J A;  4RNM A;  2R7M A;  3AYH B;  5FLM G;  2V9W A;  4ECQ A;  2W6Q A;  2W9B B;  4ECX A;  1EUD B;  2YS6 A;  3SE7 A;  4C2M A;  5KFK A;  1C30 A;  3R5F A;  4ECT A;  3T5H A;  2XCA A;  4A3F G;  2W71 A;  3BQ2 A;  5IP7 G;  2BQU A;  4G3I A;  1Y1W G;  4JFN A;  4J9S A;  1SYX B;  3PW4 A;  3JAM W;  3I4N G;  3BA9 A;  4MV3 A;  4YB8 B;  3OSP A;  5FD5 A;  2ZDQ A;  4ED3 A;  3QZ8 A;  3OUU A;  4DUY H;  4DL3 A;  1KJ9 A;  4ZQI A;  4X62 H;  3E5N A;  3N8D A;  3MFI A;  3KAJ A;  2C35 B;  4IRD A;  3GTJ A;  4RUC A;  2C22 A;  4Q44 A;  4ETS A;  4Q45 A;  2W6N A;  2W70 A;  2HVR A;  3BJY A;  4UCR A;  3VPD A;  1KJJ A;  4Q8F A;  4RB2 C;  1FJG H;  2QK4 A;  4J9Q A;  2YW2 A;  3GTQ A;  3H4D A;  4B3R H;  2R7N A;  5DGB A;  1ZET A;  4B3T H;  4TQR A;  1GSH A;  3GTM A;  2AQ4 A;  4HR7 A;  3KXY T;  5JVL A;  4EGJ A;  4I4T F;  4L1K A;  4LF9 H;  4RZQ A;  2WAQ A;  2XGP A;  3PR5 B;  4YBZ B;  2OH2 A;  4RB1 A;  2PMZ E;  4X65 H;  1O75 A;  2JA7 G;  1DIK A;  3G6Y A;  3ORR A;  4UCT A;  2W8L A;  2VQF H;  1S10 A;  1DV1 A;  4HNT A;  4RZR A;  4DR7 H;  3RBD A;  2UUB H;  1K1S A;  4MV8 A;  3MR5 A;  2FLL A;  1WCM A;  4I55 F;  4X66 H;  1IBL H;  5KT3 A;  1RYS A;  4NLG A;  5KFQ A;  3J7A K;  1XNR H;  3J80 W;  5LMU H;  3KHR A;  4ME6 A;  3GTK A;  1GSO A;  1VAJ A;  1CE8 A;  1N34 H;  3GIQ A;  5FPR A;  3GIJ A;  5KG7 A;  1CQI B;  4U6P A;  5EZY F;  3VMM A;  1HNZ H;  3BQ1 A;  5KX5 F;  2Y0S A;  4A3C G;  4DV4 H;  4LF5 H;  4RUA A;  3U9S A;  3OSN A;  2FPI B;  4YJ3 F;  2XCP A;  4JV1 A;  1ZHQ A;  3BAA A;  2FK2 A;  3PW2 A;  2BQR A;  1S68 A;  5DQH A;  2WB1 A;  3WO0 A;  4DL2 A;  5KFC A;  4BY7 G;  1TWH A;  1XMQ H;  3KHL A;  2DLN A;  5KFX A;  3DF7 A;  1TWG A;  2J6S A;  4JV2 A;  1FKA H;  4ZOL F;  4U7C A;  1M6V A;  3GIP A;  5L1I A;  4HNV A;  1RYR A;  1Y1W A;  3KAK A;  1R9T A;  1RJR A;  5L9X A;  4F50 A;  4UCU A;  2R93 G;  2FK3 A;  3NGD A;  1TWA A;  4MTD A;  2VR1 A;  2JA5 A;  5LMN H;  5KFD A;  5EWF A;  2MCT A;  1N56 A;  4O3R A;  1B33 N;  4GKJ H;  5KFH A;  5C1P A;  2FP4 B;  3JZI A;  4RB3 C;  1ZQ7 A;  4YR2 A;  3MFH A;  3KHG A;  1UC9 A;  5KFL A;  3TQ1 A;  1JXL A;  5JVD F;  3GQC A;  3RB0 A;  1V4Y A;  1B6S A;  5KG5 A;  1PX2 A;  5H80 A;  5J2U F;  3HOU G;  4O2A F;  5KG2 A;  1IOW A;  3PN1 A;  4MA5 A;  4RNN A;  2W9C B;  5KFG A;  4A2A A;  3J81 W;  5KFF A;  3KHH A;  1DV2 A;  4EBD A;  4B3M H;  1GO3 E;  1XMO H;  2ZDG A;  4EG0 A;  2XCL A;  4BXX G;  3BA8 A;  5A2Q W;  5C3E G;  5L1K A;  4J9L A;  2R7Z A;  1A0I A;  2WB1 E;  3WO1 A;  5KFY A;  5JQW A;  3EPI A;  4J9P A;  1S0O A;  5T14 A;  4FS1 A;  3FKI G;  3T5J A;  1I94 H;  4EEQ A;  3SI8 A;  4DV7 H;  1GSA A;  4ECY A;  4PDB A;  1E4G T;  4XYL B;  3L4J A;  5DG9 A;  2W9A A;  4JI8 H;  4DV6 H;  1RK6 A;  2R8G A;  5EWE A;  3RGX A;  5EDW A;  3RF2 A;  4I50 F;  1TWF A;  1HNX H;  3R5X A;  4QWA A;  3H0G G;  1WSC A;  4O2B F;  1TAE A;  4A3L G;  4FBT A;  2Q2T A;  2W9C A;  2FMA A;  2HHH H;  3RV3 A;  3Q8R B;  1B04 A;  4LFC H;  4GC6 A;  3V6K A;  1XNQ H;  2IBK A;  3HKZ A;  2I87 A;  2FLN A;  1P8L A;  4DLK A;  2WYO A;  4JI2 H;  3OHB A;  2VUM G;  2NVX A;  4QWB A;  1K83 A;  4DV0 H;  4YR0 A;  4NXM H;  1WR2 A;  3F8N A;  3HOZ G;  4IRK A;  4NXN H;  4MTE A;  5CA1 F;  2UVR A;  2FPP B;  4MA0 A;  4X64 H;  4DV2 H;  3JSN A;  1OWT A;  1SCU B;  2IA6 A;  1X9N A;  2DWC A;  2UU9 H;  2CZG A;  4TQS A;  2R7L A;  4O3Q A;  3WNZ A;  2GPW A;  1T3N A;  3LML A;  2OLS A;  2R6F A;  2JA8 G;  3PW5 A;  4YP3 A;  4C5C A;  1WCM G;  5LOV F;  2AGO A;  5DLG A;  5KFM A;  4EGQ A;  4UCO A;  5KT6 A;  2R8H A;  4CC5 A;  4DV3 H;  2C2R A;  2V59 A;  4EFB A;  4J9K A;  4JI6 H;  3V6J A;  4A3I G;  4F4Y A;  1EYZ A;  3RFC A;  1SFO A;  3RB4 A;  3OUZ A;  4LF6 H;  4LF8 H;  3MJF A;  2UUA H;  3I12 A;  2JA6 A;  2ZDH A;  4IWX A;  3CVZ A;  5LA6 F;  4R8U B;  4BWS C;  3G6X A;  2C2E A;  5D1O B;  5KFR A;  3RJ0 A;  2UUC H;  4EBC A;  2SCU B;  4WD3 A;  3MR2 A;  3H20 A;  4DR2 H;  4C5B A;  4DL6 A;  2R82 A;  2AU0 A;  4LMY A;  3G8C A;  4ZI7 F;  2IP4 A;  4O3O A;  5L1L A;  2VPQ A;  1L2Z A;  4JUZ A;  4A3D G;  5DQI A;  2VA2 A;  2OWO A;  4CC6 A;  4EYI B;  2HVQ A;  3FMA A;  1N33 H;  4BBR G;  4QJF A;  3RTX A;  3ETJ A;  4ED0 A;  3C0F B;  3RUP A;  2C2D A;  3N6X A;  4RU9 A;  3K5I A;  4DV5 H;  3HXL A;  4UCV A;  1J5E H;  3CQZ A;  3GV8 B;  3BAB A;  4GC7 A;  1WH2 A;  2M05 A;  4YQW A;  1S0M A;  2J6U A;  4IZO A;  4BBS G;  4F4W A;  4ECR A;  4JI4 H;  5IWA H;  1AN7 A;  5HV6 A;  4FS2 A;  1MZB A;  2YCH A;  2ASJ A;  2UVU A;  1HR0 H;  4JI1 H;  3KTM A;  5KT4 A;  4QWD A;  4JI3 H;  2V58 A;  3TIG A;  5JH7 F;  2W6P A;  3K5H A;  4O3S A;  5KG1 A;  2P0A A;  1T36 A;  4IR1 A;  4LF7 H;  5KFA A;  4XZ3 B;  4F4X A;  4QW8 A;  4I7H A;  5KFV A;  5C4X G;  4AYB A;  4A3M G;  4J9R A;  1VBH A; 
#chains in the Genus database with same CATH homology
 4PWQ A;  4JFN A;  2FK3 A;  3KTM A;  2FKL A;  1MWP A;  2FJZ A;  4PQD A;  2FK1 A;  2FK2 A;  2M05 A;  2FMA A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...