3KUDB

Complex of ras-gdp with rafrbd(a85k)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
NTIRVFLPNKQRTVVNVRNGMSLHDCLMKKLKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title What makes Ras an efficient molecular switch: a computational, biophysical, and structural study of Ras-GDP interactions with mutants of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein/transferase
total genus 12
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kudB00
4B95A 2KQSA 4BKGA 5KHQA 5TR5A 1KLVA 1K8RB 4G0NB 1M94A 1RRBA 2FCNA 2MRPA 3NY5A 1YX5B 4WQOB 2KWVB 4TV3A 1WJUA 2JUOA 3A9JA 4IM2A 3DBRI 4ICUA 3VAWA 4NJ7A 3WAMA 2L76A 2NCNA 2D3GA 2O6VB 4E3CA 2KDBA 3RZWC 3EFUA 2C7MB 3W1SA 2MBEA 1GJZA 3H6NA 1BT0A 3P2BA 1EF1A 2RD0A 1V86A 4K81A 1KM7A 3VH3B 2NBWB 4MGZE 1P0RA 2KOXA 1C1YB 3ZDMC 5AZFA 3UQAA 4I6PA 3DVGY 1EUVB 1UBQA 2JXXA 3PS6A 3PGEA 4ZRKA 2BKRB 3NOBA 4DK5A 2O2VA 4KZCA 1IYFA 2BKFA 1UH6A 3PV1A 2CHZA 3IHPC 4GN1A 2MW5A 1WRDB 3B0AA 3PSEB 4PYZA 3VQIA 3L10B 4HDOA 1WJNA 2C7NB 4HLEA 2KVRA 4BKSD 4ZRIA 1Q1OA 3ZTDA 2W9NA 3DVGX 2KDIA 2L3ZA 3R7QA 2LI5A 3PRZA 4PS8A 4OVVA 2DZJA 2IY1B 4B9KA 2GBKA 3DOWA 4FHJA 5IAAC 1RAXA 1NDDA 4W9CA 2AWTA 2DYMA 2FIDA 2LGXA 1WR1A 2MP2B 3KUCB 2LVOA 1E8YA 2KDEB 2LGDA 2N9PC 1RLFA 2D11A 4GDKA 1V5TA 4NQLB 2KO3A 2KX0A 3AU5A 3PTFC 3QC8B 2FNJB 3N32A 4MM3A 5DCNA 2K6QA 1P3QU 1V81A 2K8HA 5G55A 4N9F4 3SU8X 5JZEB 4FBJB 3H7PB 1GNUA 1E5WA 1C3TA 3APDA 3CSFA 2JRIB 3ZNHB 3AI5A 2A4ZA 1OTRB 1TGZB 3N30A 3VTWA 3AU4A 4WJNA 2VRRB 1OQYA 4M8NA 1OEYJ 1U4AA 2V1YA 2JWZA 4HK2A 1E90A 4A3OA 2WDTB 2YVCA 3VUXA 4NY0A 3PT2B 4MJSB 2ZCBA 2KTRA 2RGFA 1WYWB 4A3PA 2DZMA 2XEWA 2AL6A 2N7DA 3A33B 3PPAA 4WWPA 2FAZA 3JW0X 1WZ0A 3HIZA 5E6PA 2NVUI 2NBUA 4HPLB 1XT9B 1LM8B 3A1QA 1MG8A 2ASQA 3PZDA 4NAWB 5CX3A 4W9FA 4JLCA 3PVLA 4FJYA 3ZRFA 4LJOB 5BO4B 2Z59B 4XC2A 2G4DB 4CHKA 1WM3A 4DHZE 4W9HA 1E8WA 4I6LB 4WJOA 2GMIC 3L54A 2YLMA 2RPQA 3RCZA 3PRPB 3DPDA 3V6EB 2EKEC 1WF9A 3VTUA 4IM0A 3WAPA 2FCSA 4G3XB 3SD5A 2KNBA 4MSMB 4IWOA 2CHXA 1WR6E 1GC7A 2GBMA 1WXMA 1WE6A 2JY6A 5D2MB 2PE9A 3PHXB 2KMCA 1R4MI 4DXAB 3ZIMA 3X0WA 2A5UA 1TTNA 3L13A 4LJPB 1WZ3A 3A9JB 1P1AA 2EMSA 4NJ6A 3VUYA 4ASWC 5LXIB 2AEHA 3APFA 2KWUB 4BFRA 3UQBA 4W9EA 3JYUA 5DPSA 3TMPB 3RD2A 1H4RA 3PLVA 3ZW3A 1UBIA 1WH3A 1YJ1A 2JPHA 2J0MA 2KQ7A 5L95C 3UGBB 3TJPA 5J18A 4PS7A 1LXDA 3ECIA 4MEMA 4NNJB 3DVNU 3PHWB 1KOTA 3ZUNA 4MGIE 2KC2A 1J8CA 2R2QA 3ML9A 2NR2A 3T9LA 1YD8U 3X23A 2KFKA 3L16A 2N4FA 4BVUC 1X1MA 2O2VB 2K6DB 2J0JA 3UINB 1GC6A 2MBHA 1S1QB 2ZNVB 3WANA 3QX1A 3RUIB 2PPHA 2G3QB 2DZIA 1L7YA 3IFWB 2IY0B 2JZZA 2Z0EB 4JL9A 4CO7A 2KANA 2L05A 4AJWA 1TZ1A 3ZNZB 5J2RA 3Q3FA 3QK0A 4HCNB 3BY4B 1WJ6A 3V6CB 5EDSA 2LUEA 2DYBA 2JRHA 4KZ0A 4W9IA 4RM8A 3VH4B 4DBGA 2D07B 3A9KA 4W9DA 3TBLD 4AWJA 2CHWA 2IBIB 3MTNB 2CS4A 2K8BA 4II3B 2K8CA 5LLIA 1YQBA 1WFYA 1I42A 2PE6B 2L8JA 1V6EA 3TCAA 3WALA 2AYOB 1WXAA 1WGGA 2K25A 2KX3A 4GDKB 3ZNID 4BOSC 2XK5A 4YL8A 3JVZX 3ZDTA 5D94A 1IPGA 4LDTD 2KJHB 4M0WB 4ANVA 2LXCA 2Z0DB 3QWZB 3T8MA 1EF5A 5JHAA 1V49A 1UD7A 4PYUA 3ZNGC 3K9PB 1AARA 2R2OA 4E74A 5HKHA 2RR9A 4HDQA 3H9DA 4IG7B 4DHJD 4TKNA 4BBNC 1F9JA 3HM6X 2AL3A 2LJ5A 4AUQC 4URKA 1KJTA 2NPTA 2IO1B 1UZXB 1D3ZA 4IC7B 2FCMA 3SDLC 3QJZA 4FN2A 3HHMA 2KTRB 4BBNF 3KUZA 1H8CA 1WI0A 3QHTA 4K1RB 4A20A 3RYTA 2DAJA 1G6JA 3VTVA 3U30A 4KSLC 2LRWA 4BOZB 4EUTA 4XZ4A 1J19A 2HE7A 3OLMD 3D32A 2MBOA 4DWFA 1OEYA 1WJ4A 1NBFC 2MBBB 4I6NB 1JRUA 1OGWA 3A1QB 2N1VA 2EMTA 3BINA 3IG3A 5G2NA 1WMHA 3V60A 4K7SA 2C7HA 3OJ4B 1ISNA 2DX5B 4K7WA 2QHOA 3H1UA 3TIXA 2M1MA 1LFDA 2L0TA 3N3KB 3R7RA 3EC8A 4WJQA 4FULA 4GB9A 3HM3A 1TBEA 3ML8A 3MJWA 1WGYA 5C1ZA 4FLHA 1FXTB 1NI2A 2KK8A 4ANUA 3IBEA 3UF8A 4HPMB 4NPNA 2ZCCA 2PEAA 2V3SA 3S2AA 2JVCA 1WM2A 2RSUA 1IP9A 4GDLB 4EKUA 3H7SA 5E6NA 3NS8A 3W1SC 2WYQA 4GGQA 2MWSB 1V2YA 3GZNI 3QAQA 2GOWA 1UELA 2LVPA 2IZVB 4DHJB 2MX2A 4IW0A 4K7UA 3QCAA 4WJPA 3ZLZA 2BGFA 1R4NI 4HJKA 2V4LA 4MGYE 4EZLA 4JIOU 2BWFA 2ZVNA 3IVFA 2LZ6A 3A4RA 3APCA 2FIFA 3RT3B 4GDLA 5J17A 4LCDE 2XBBC 4X57B 2ZNVC 1L2NA 2LGYA 2OOBB 3DVNV 4ZYNA 4DDID 4XX5A 4BKTA 1WE7A 3CMMB 2OJRA 3JSVA 2JZ3B 2J0KA 5GMVA 3GOEA 2C60A 2CKHB 3M3JA 3QA8A 4RM9A 2KFKB 2J7QB 2BYVE 4M8MA 5CHFA 4JGHB 1V9JA 4EZKA 3AULA 3L0WB 1WX8A 4WWNA 2GBRA 1SE9A 5JH5C 2NBVB 1Q5WB 1Z2MA 3B1LX 2UWQA 5L83A 1LQBA 4HXDA 4MSQB 3VVWB 1V5OA 1Z5SB 3OJ3A 2KD0A 1YX6B 2WX0A 2BYEA 4MELA 2K39A 2KTFA 1RFAA 2KHWB 2NS5A 2ZPYA 5CHVC 2KJRA 4GOCA 3A9KB 5C23A 4HVBA 2WX1A 2GBNA 1E7UA 1ZW7A 4OVUA 4ZRJA 2KN5A 4GIVA 4TUUA 1WXVA 4MDKE 2I1JA 2G4SA 2XK5B 1ZKHA 3DBHI 3EHVA 1E7VA 1SIFA 5IA7A 4ANWA 4WWOA 4W9JA 4F1SA 3MHSD 2Y5BB 3QQ8B 1WGDA 4IM3A 4ZDVA 1VCBA 2KC1A 4II2B 3ZRCA 4G11A 2L0FA 1Q0WB 1WY8A 1WX9A 2MCNB 4F8CB 1PQSA 3ZO5B 2REXA 2KFJA 2MSED 4AJYB 3W1YA 3DBLI 2LWPA 2NPTB 3R3MA 3WIMA 2BYFA 2O6VA 4F7ZA 3Q3JA 3KH0A 2KLGA 4B6WA 2JT4B 2LXAA 1V80A 2M4NA 3EECA 4EZJA 1SGHA 2DENB 2KWCA 1UGMA 2GBJA 3DBSA 4HWIB 3KYCD 4FJVB 4HCPB 4FA6A 2CU1A 2FCQA 3CSTA 1WMHB 5E6OA 3DQVA 3L17A 4NQKE 4AP4C 2KJ6A 4W9KA 1CMXB 5JHBA 3UIPB 1A5RA 2MA9B 4P7IA 3U8ZA 3ZTCA 3KW5B 3PLUA 4ANXA 3RULA 4TQ1A 2G45B 3DDCB 1VD2A 3PRMB 2N9EB 4KDLB 3ZKJC 2HTHA 1GUAB 2N7EA 1WIAA 3M95A 1EO6A 3ONSA 2B3AA 3R66C 4WAAA 4IWQA 3VUWA 1P98A 3L08A 4FHKA 5DPWA 4MGKE 2KZRA 1P9DU 2N1WA 3U7DA 2D2QA 2MP2A 3O65B 3V61A 4AOFA 3VFKA 2CR5A 2ZVOA 2HJ8A 2IO3B 2DYOA 1QZEA 5CTRC 2MBQA 2MLBA 4IWPA 2IO2B 2ZPNA 2LRUA 5D6JB 1E8XA 4GU2A 2DAFA 2DHZA 5DPRA 4EOYA 4DDGD 4E71A 2BWES 1YIWA 3VXWA 3UIOB 4LDTB 5KHOA 3DCGA 3C0RB 4ICVA 3H7PA 4GSWA 2ZJDA 2C9WB 3WAOA 3RZFA 3AXCA 1WXSA 2ZEQA 4EEWA 4EFOA 3NZSA 2IO0B 2KDFB 2M0XA 4PS3A 4KVGB 2BPSA 3JSVB 2KMAA 2UYZB 2LVQA 3KYDD 3NHEB 4KV2A 2L00B 5FR6A 1WX7A 4RMAA 4IUMB 2O6VD 4TQ0A 2IYDB 4G50A 3K9OB 2I1KA 3LDZE 4MJSA 3TL5A 2KXJA 5LXHA 3VDZA 3OAWA 2JF5A 2L7RA 3HK0A 4GMVA 4BKSA 4KIKB 2LD9A 1E8ZA 3ZVVA 2M8SA 3CF6E 3KUDB 4FADA 4NAWA 4W9LA 2HD5B 1GG3A 2ZZPB 2KLCA 1WGRA 2M17A 3B08A 3LJ3A 1XQQA 1XD3B 3V62A 4CYEA 3NZUA 1J0GA 4KDIC 3PREA 2FUHB 1Y8RC 3M63B 4JQWC 3KVFB 2N9XA 5CHWA 2LASA 4FJZA 5AZHA 2C5LC 5AEKB 4KIKA 5DPTA 1ZGUB 2PJHA 3SHQA 3I3TB 1T0YA 2BF8B 3ENEA 3A4SC 2K1FA 3QARA 1WGHA 2D10A 2DZKA 4GXBA 3M62B 2MQJA 4MH0E 3ALBA 4DHZB 3VHTC 5D7GA 2KKCA 1S3SG 4J6IA 4KSKC 2WWZA 3QIJA 5AZGA 3WA0A 1I35A 1HE8A 4W9GA
chains in the Genus database with same CATH superfamily
2MJEA 2KQSA 5KHQA 3ZJVA 2KWVB 4TV3A 1WJUA 3A9JA 2UU7A 3DBRI 4IM2A 1UUPA 2O6VB 4JPSA 2KDBA 3Q6BA 2C7MB 1GJZA 2YEPF 1EF1A 1V86A 1D5ZC 2NBWB 2KOXA 5AZFA 1EUVB 2K5PA 3PGEA 4D2KA 1XCTL 1MI0A 2O2VA 2BKFA 1UH6A 3PV1A 4DWFA 1ET9A 3VQIA 3BWUD 3DHIC 2KDIA 1ZDVA 3PRZA 4OVVA 1KLUD 2GBKA 1XCQL 1RAXA 3AEFB 4W9CA 2IJ0A 2DYMA 3FC4A 1WR1A 3GB1A 1JWSD 3J9CA 2KX0A 3PTFC 2FNJB 3N32A 2K6QA 1P3QU 5G55A 4FBJB 3H7PB 1IBXA 4H2AA 3APDA 3CSFA 2KVZA 3C19A 2PIAA 1TGZB 1E7PB 1QLBB 1L5PA 1E90A 4A3OA 2G1EA 2JYEA 1I4GA 3PT2B 1N60A 3A33B 1WXQA 2VZKB 2NVUI 2NBUA 2WP9B 4HPLB 1XT9B 2ASQA 2WU5B 4JLCA 4RGTA 3ZRFA 4MACA 5BO4B 4XC2A 1I4QA 4GLSC 2YLMA 4K3CA 1N61A 3AE4B 3WAPA 4G3XB 2CHXA 2GLSA 1GC7A 4C4VB 3U52E 1WE6A 2CJNA 2JY6A 4RGOS 5D2MB 5E6JA 3AE9B 2PLPA 3L13A 4LJPB 1WZ3A 3H8HA 4NJ6A 4WWMA 1TS2A 1QT9A 1TT5B 1MVKA 3ZW3A 1UBIA 3UGBB 1VR9A 3Q3OC 4WH4A 2L32A 3PHWB 3X23A 2N4FA 2PW9A 2BQQA 3BYTB 1A70A 3QX1A 5H92C 2G3QB 4A6QA 1MFWA 2Z0EB 2L05A 3ZNZB 3Q3FA 5EE1A 1L4ZB 1C9FA 3EGRA 4KZ0A 2JRHA 4DBGA 3VH4B 1EU3A 3A9KA 4W9DA 3W2DA 1YQ4B 2CHWA 1T0SC 5LLIA 1YQBA 1I42A 2PE6B 2KN4A 3WALA 3ETRA 4GDKB 2KX3A 2AQ3B 3ZNID 1HZ6A 1P7EA 5D94A 2Z0DB 3Q2AC 1EF5A 3AE1B 3SFEB 2FE8A 1V8CA 3K9PB 4DXGA 1YMHE 4KKIA 3RMKC 4BBNC 4ZHOA 4AUQC 1D3ZA 4IC7B 3SDLC 1ZP0B 2KTRB 2B76B 3QHTA 1G6JA 1AWDA 4EUTA 4XZ4A 2HE7A 2ZW0A 2KDMA 4ZYSA 2PKOA 1WJ4A 4I6NB 2EMTA 3P4QB 5G2NA 1KFYB 1CZPA 2QHOA 1LFDA 2KYWA 3KWVA 4BZAA 4FULA 4GB9A 3UF8A 4HPMB 4NPNA 2JVCA 1VDVA 4GDLB 5HG2A 3DWGC 1JQ4A 1V2YA 3GZNI 1ENFA 5IN7A 1UELA 3ZLZA 3QCAA 2BGFA 2JX5A 2ZVNA 2V3PA 2LZ6A 4GDLA 5J17A 2XBBC 2WU2B 5EE3A 3DVNV 4ZYNA 4DDID 1R4NB 3CMMB 3N1ZC 1C4AA 5AUKA 5GMVA 2W54A 2KFKB 4RNAA 2J7QB 2BYVE 5D3IB 5MPOA 1FRRA 4OZAA 1V9JA 3AULA 3L0WB 1WX8A 2JZPA 4A90A 1Q5WB 3B1LX 2WLBA 1EU4A 1LQBA 4RF0A 4HXDA 1V5OA 1Z5SB 1VLBA 5CHVC 2PMVA 2KJRA 2ACZB 5C23A 2V3NA 1V97A 1E7UA 3AE7B 2AQ1B 3AEGB 1ZKHA 3W5UB 4ACFA 4W9JA 4REZA 3QQ8B 4ZDVA 1FXIA 2QSDA 2BYTA 3LYYA 2V4IB 4IDIA 3ZRCA 1NENB 3MJ5A 1EWCA 1WY8A 2OJWA 3FAHA 1K53A 2REXA 2BYFA 1GAQB 4JWSC 2BW2A 3U7ZA 1DOYA 1FM0D 1FFVA 2WGSA 3TEZA 1NI3A 2LXAA 2QC8A 3Q3NC 1WYGA 4HWIB 2JWUA 5T8IA 4FA6A 2CU1A 2FCQA 1N62A 5E6OA 2KJ6A 2MA9B 3ZTCA 4PK1A 2G45B 3PRMB 4KDLB 4LK0M 2HTHA 2N7EA 1N5XA 3R66C 5DPWA 3L08A 3O65B 1HTQA 3VR9B 2CR5A 3VR8B 2HJ8A 2IO3B 3B2FA 1QZEA 2WXLA 5CTRC 2MBQA 1Y56A 2IO2B 4L1BA 2AQ2B 4E71A 3VXWA 2N0SB 3BK1A 5KHOA 2WXPA 3DCGA 3MC8A 4ICVA 2ZJDA 3RZFA 2IPKD 1WXSA 3AXCA 3B2GA 2ZEQA 4EFOA 3GE8C 2IO0B 2M0XA 3Q8EA 5C3JB 2BPSA 1L6UA 3JSVB 3KYDD 2LVQA 2KAJA 4HROA 2W82A 3DHHC 4P16A 3K9OB 4MJSA 3C8YA 1ZXIA 2Y3AA 1K50A 3OAWA 2JF5A 1UNSA 3HK0A 2RDBC 4KGTA 2M8SA 3KUDB 4NAWA 4W9LA 1T0RC 2KLCA 1VZ7A 3TEXA 2M17A 1D5MC 3MC0B 4JQWC 2ONQA 2C5LC 4NZLB 5DPTA 2Y5CA 1YJIA 1T0YA 3ENEA 1FIQA 1F2RC 2DZKA 4DHZB 5D7GA 4KSKC 5C2TB 3WA0A 4W9GA 5TR5A 4G0NB 1M94A 3NY5A 4OZBA 3PZ7A 4ICUA 3VAWA 4NJ7A 2L76A 3GS2A 4HRSA 2NCNA 4HPPA 3NS1A 3OG5A 3ZYYX 4ARCA 3H6NA 1BT0A 3P2BA 2RD0A 3VH3B 1P0RA 3ZDMC 2M0AA 1ZE3D 3DVGY 3PS6A 3NOBA 4KZCA 3RNBC 2GB1A 2CHZA 4GN1A 2MW5A 1WRDB 3FILA 3L10B 4HDOA 1D4BA 3R7QA 1LO5D 2DZJA 3DOWA 5IAAC 1YNTE 1JWBD 2MP2B 3RN9C 1TKYA 2LVOA 1E8YA 2KDEB 2LGDA 2I38A 1TKEA 2IGHA 1RLFA 2D11A 1GB4A 4WURA 1MPEA 3AB5A 3SU8X 4N9F4 5JZEB 2BVCA 3WCQA 2WXKA 1HZ5A 3AI5A 1UGJA 3VTWA 4WJNA 2VRRB 4M8NA 1U4AA 2JWZA 4S0RA 4A55A 1JALA 1V1PA 2D3BA 1SJED 3VUXA 2ZCBA 1FEHA 3NRZA 2XEWA 2N7DA 2BT6A 3PPAA 3JW0X 4KGRA 3B9JA 2RDGA 3A1QA 1LM8B 1QOAA 4LLGM 1RYJA 5IP4D 4FJYA 4LJOB 2Z59B 5EE9A 2G4DB 1WM3A 1TYGB 2GMIC 3L54A 2E6XA 4J3OD 2RPQA 3PRPB 5GXGB 2EKEC 3VTUA 3P4RB 1TS4A 4TSSA 3MP9A 1I7HA 1WR6E 1GB1A 2G9HD 2QDFA 2PE9A 2JU6X 3PHXB 1CK1A 3ZIMA 1QQRA 2A5UA 3A9JB 2EMSA 1N63A 2MJDA 4C80A 4BFRA 2KWUB 3UQBA 4W9EA 3JYUA 4XYCA 1H4RA 4M00A 1FCCC 1R4MB 2LEKA 2J0MA 2KQ7A 2WXJA 5L95C 1HQRD 3NVYA 2K22A 3ECIA 3DVNU 3ZUNA 4L2YA 2BTEA 1UF0A 3T9LA 1L0XB 2O2VB 3SFDB 4YWGG 1HA5A 4LNNA 1L7YA 3IFWB 2LJIA 1BUIC 4CO7A 2KANA 2SEBD 1PUTA 4L23A 1WJ6A 1SSNA 4YTNB 1XLNA 3TBLD 4DQOC 4AWJA 2CS4A 2K8BA 4II3B 3IT4B 1WFYA 3AM9A 2L8JA 1WXAA 4KKJA 2XK5A 3JVZX 2HJ1A 4ANVA 4M0WB 2LXCA 3OWEB 1PFDA 1FFUA 1V49A 2OHFA 4PYUA 1IBXB 3BIID 3IXSA 1AARA 4E74A 2RR9A 4DHJD 3HM6X 4M0WA 2RPVA 2NPTA 1OQQA 4B0MA 2FCMA 3QJZA 4FN2A 4BBNF 3KUZA 1H8CA 1WI0A 4A20A 3P63A 1QKZA 3U30A 4KSLC 2LRWA 1OEYA 1NBFC 1JRUA 3IG3A 1I4HA 1WMHA 4YT0B 3AE6B 2MEKA 3OJ4B 1KLGD 5H8YE 3H1UA 2M1MA 1AW7A 1KH0A 3R7RA 3EC8A 3BVMA 1BMLC 4WJQA 2PVOD 3HM3A 2QIEB 4FLHA 1FXTB 1TIFA 4RCOA 2V9HA 4HEA1 4EKUA 3H7SA 3KQ4A 5E6NA 4ZHPA 5BYSA 2WYQA 2MWSB 3QAQA 2K9XA 2IZVB 1QOBA 4IW0A 4K7UA 1R4NI 2V4LA 4EZLA 2BWFA 3A4RA 3RNAC 2FIFA 1FRDA 2KT7A 2OOBB 1M4VA 2TSSA 2OJRA 2M56B 1XF5L 3M3JA 4RM9A 2JQRB 5FKAC 4M8MA 5CHFA 1PGAA 4EZKA 3TEYA 4M02A 5JH5C 1Z2MA 4WAFA 2UWQA 1LGRA 3VVWB 4YTPB 2KD0A 2BYEA 4EE2A 2K39A 2KTFA 4YSZB 3A9KB 1C4PA 4HVBA 1E10A 2GBNA 3Q14C 4XDDA 3PO0A 4ZRJA 2KN5A 4JX1C 3BYYB 4TUUA 1ZDXA 2H88B 2I1JA 2G4SA 2DBYA 1JRPA 2WXHA 1V1OA 2W55A 1SBBB 2GI9A 2Y5BB 5LNK1 1WGDA 1D6EC 1STEA 1PGBA 1DYQA 3ZO5B 1UWMA 3W1YA 3R3MA 3Q3JA 1SE4A 1DOIA 2KLGA 4B6WA 2JT4B 1D5XC 1MHXA 1V80A 1WSPA 2M4NA 3EECA 4EZJA 3DBLB 4TMAB 2GBJA 1JW9D 4P1CC 1JWAD 2R61A 3L17A 4NQKE 4LNFA 1WWTA 3UIPB 1A5RA 1FD6A 1L0YB 3KW5B 4TQ1A 3KLSX 1VD2A 3ZQ4A 4BKTA 3ONSA 1EO6A 3VUWA 1NYRA 4FHKA 4MGKE 3U7DA 1RM6C 2XNAC 4AOFA 1GPXA 2WXMA 2MLBA 4IWPA 4FXCA 2LRUA 2DAFA 4DDGD 1IUEA 4LDTB 3C0RB 4XWWA 2C9WB 3TUOA 3ZGZA 4MH8A 2KDFB 4AS1A 1XLPA 4PS3A 4P6VF 1JROA 2L00B 1NEKB 2O6VD 3NVWA 4RH6A 3NG0A 3N1YC 3IT6B 5LXHA 1ZOYB 1PGXA 3ZVVA 2Q5WD 3CF6E 2PVGC 2HTME 3BVZA 2ZZPB 1JCKB 3LJ3A 1XD3B 4KDIC 1T5XD 1WRIA 2FUHB 4OHJA 2LASA 2ON8A 1C76A 3MC9A 4FJZA 5AZHA 5AEKB 2NTSA 1ZPSA 1SE2A 1TZOA 4MH0E 2LGIA 4J6IA 5AZGA 4FADA 3E9SA 4WQMA 1F52A 1K8RB 2FCNA 1RRBA 2MRPA 1YX5B 1XXGA 2WQYB 2D3GA 4USAA 3RZWC 5G5GA 3W1SA 2MBEA 3ZXRA 1B1ZA 1SIJA 4K81A 1KRHA 1KM7A 2Z8LA 2EELA 1C1YB 4ZRQA 2MHJA 4B0EA 1UBQA 2JXXA 2XN9C 4ZRKA 4DK5A 4NAMA 2NTTA 1IYFA 3IHPC 3B0AA 4PYZA 2J4XA 4HLEA 2C7NB 2OEDA 4BKSD 2V0GA 2VZKD 2W9NA 3DVGX 2L3ZA 2I2YA 3BZDB 2IY1B 4FHJA 1NDDA 4DXFA 2AWTA 2FIDA 1DGJA 3KUCB 3Q8FA 2KWDA 2X38A 4OVZA 3V3XA 4PT5A 1V5TA 2KO3A 4MM3A 5DCNA 2WXRA 1V81A 2K8HA 3TSSA 1F0ZA 3T3OA 1K52A 1GNUA 1C3TA 1T3QA 3I57A 2IGDA 1L6VA 2A4ZA 1OTRB 2INCC 3N30A 4M01A 1OQYA 2V1YA 4XDCA 4HK2A 3NZ3A 1J7BA 2W3SA 4AQ7A 3FKYA 2WDTB 2L1AA 2YVCA 4MJSB 2AL6A 4WWPA 2FAZA 4UDUC 5BMIA 3HIZA 5E6PA 4N6EB 4N59A 4NAWB 4NJCA 4W9FA 3PVLA 3AECB 4KGSA 1ROEA 4W9HA 1E8WA 4I6LB 2IDYA 4WJOA 2WDRB 1YN4A 3GE3C 1BXTA 1P7FA 2RMMA 2FCSA 4MSMB 4IWOA 2GBMA 1WXMA 2N9LA 2WNMA 1R4MI 4DXAB 2K0PA 3X0WA 3EUB2 3VUYA 4ASWC 1CJEA 1CQVA 2AEHA 4YXDB 2QEJC 5DPSA 2CJOA 3RD2A 1YJ1A 1YN5A 2DLBA 4PS7A 1C78A 1LXDA 4MGIE 2KC2A 3ML9A 1VRAB 5HI1A 3L16A 4CQNA 4BVUC 2K6DB 2J0JA 3UINB 2MBHA 1HEZE 3RUIB 2DZIA 3FILB 3RNEC 2M19A 4HJGE 1TZ1A 3MHZA 3QK0A 3W5VB 4HCNB 2LUEA 2DYBA 4RM8A 2K3UA 2D07B 3P42A 1PDXA 4YSYB 2WDQB 2J42A 2K8CA 3N1XC 1FO4A 3DWMA 1V6EA 2AYOB 2K25A 1WGGA 4BOSC 3AE2B 1AN8A 4YL8A 1IPGA 4LDTD 2KJHB 5JHAA 1SB3C 3AEAB 3NVVA 3UI3A 2R2OA 4HDQA 3H9DA 4RGMA 4TKNA 1Q10A 2LJ5A 1V1PB 2IO1B 1UZXB 1IGDA 3AEDB 4HKZE 2KQ4X 4K1RB 4US8A 2DAJA 4BOZB 1J19A 3D32A 2MBOA 2CU3A 3ZXVA 2MBBB 3A1QB 3Q69A 2N1VA 1GOZA 3R8BA 1T0QC 4P1BC 2EKIA 2C7HA 2SAKA 4K7WA 2L0TA 3TEWA 3MJWA 5C1ZA 3SEBA 2KK8A 4ANUA 1EWYC 2ZCCA 2V3SA 3S2AA 1WM2A 1IP9A 3NS8A 2QCZA 3W1SC 4GGQA 2INNE 4HKQA 2WS3B 2LVPA 1JWMD 4WJPA 4K3BA 4MGYE 4HJKA 4JIOU 1MHHE 3IVFA 3APCA 1DOXA 3RT3B 4LCDE 1ET6A 2ZNVC 1L2NA 1RFKA 2LGYA 2J0KA 3GOEA 2C60A 3QA8A 1QILA 2N7JA 3GP7A 3BK2A 2NBVB 5L83A 3Q8CA 1YX6B 4MELA 2NS5A 2ZPYA 3SR6A 4GOCA 2J52A 1N5WA 1ZW7A 2BB6A 4GIVA 4Q2JA 1SEBD 4MDKE 2XK5B 3EA6A 4WIPA 1SIFA 5IA7A 3P4PB 4ANWA 3MHSD 1F2RI 2KC1A 3DBHB 2MCNB 1PQSA 4C56C 2WXFA 4AJYB 2MSED 3DBLI 5EE0A 2LWPA 2NPTB 2BS2B 3EFCA 1SJHD 2D5GA 3BVGA 2O6VA 4N58A 2L52A 2DWQA 2KWCA 5IOIA 2JSVX 3KWLA 3O13A 3DBSA 4XGAB 1XEEA 3KYCD 1ZXHA 1L4DB 1WMHB 3DQVA 4W9KA 5JHBA 3I63C 5HFYA 4P7IA 4ANXA 3RULA 1VJKA 3DDCB 3ZKJC 2N9EB 4JWUC 2N9KA 1GUAB 1WIAA 3M95A 4WAAA 2B3AA 2J53A 4IWQA 3U4EG 1P98A 2IGGA 2KZRA 1P9DU 2N1WA 2D2QA 2ZVOA 3AV8A 2LHDA 3CWIA 2DYOA 5D6JB 5DPRA 1E8XA 4GU2A 3CIRB 2BWES 3UIOB 1VZ6A 1TY0A 2FBWB 2VH2A 3H7PA 3URYA 1YQ3B 3NZSA 5BYQA 5I4DA 3P4SB 1TJEA 2UYZB 5FR6A 1QOFA 1WX7A 4RMAA 4IUMB 4A8XC 4TQ0A 2IYDB 4G50A 3LDZE 2I1KA 4ITKA 3TL5A 3VDZA 5FK9C 4BKSA 3Q3MC 4KIKB 2LD9A 2LHEA 1E8ZA 1C79A 3HRDD 2HD5B 3I9V1 1WGRA 3LB8C 3B08A 3V62A 1XQQA 1IGCA 1I4XA 2QJLA 1Y8RC 5CHWA 4KIKA 3SHQA 3I3TB 2BF8B 4O1NA 2FUG1 1WGHA 1FMAD 4RF1A 4GXBA 3M62B 3ALBA 1QOGA 2KKCA 4C4VA 1S3SG 3QIJA 5IKCM 4B95A 4BKGA 1KLVA 4WQOB 4R3DA 2JUOA 2WXNA 1FCLA 2WXOA 3WAMA 2BS3B 3IAS1 4E3CA 2H89B 3R2TA 3EFUA 2MH7A 3NJTA 3U2SC 4LNOA 3DBRB 4MGZE 3UQAA 2WHIA 1YJJA 2INDC 4I6PA 4IKGA 4XWTA 3RFZB 5IO9A 1J7CA 2BKRB 3PSEB 1WJNA 3DHGC 2KVRA 4ZRIA 1Q1OA 3ZTDA 4A9AA 2LI5A 4PS8A 5HHDG 4B9KA 1OFFA 2LGXA 1J7AA 2N9PC 1YN3A 5BMGA 3HUIA 4GDKA 4NQLB 3AU5A 3QC8B 1QF6A 3RNCC 1E5WA 2D3CA 2JRIB 3ZNHB 1EM7A 2KMMA 2WXIA 2W3RA 3AU4A 1OEYJ 1TS3A 4NY0A 2KTRA 2RGFA 1WYWB 3I5JC 4A3PA 2DZMA 1UWXA 1PYWD 1KTKA 2ZW1A 1WZ0A 2L83A 1MG8A 3PZDA 5CX3A 3AE5B 4CHKA 2LUMA 4DHZE 4IOIE 5AUIA 3ZJTA 3RCZA 1E0ZA 3DPDA 3V6EB 1XO3A 1WF9A 4IM0A 3SD5A 2KNBA 5JXVA 1R7SA 3RI7C 1HXYD 1L0VB 2KMCA 4JE3B 1MJDA 2D3AA 1TTNA 1P1AA 2QILA 5LXIB 3APFA 3TMPB 1XLOA 3PLVA 3IAM1 1ACCA 1WH3A 2JPHA 4ZOHC 2ICIA 3TJPA 5J18A 4MEMA 4NNJB 1KOTA 1J8CA 2R2QA 2NR2A 1YD8U 2KFKA 1N6ZA 1X1MA 3WANA 4LNIA 1GC6A 2ZNVB 1S1QB 2PPHA 1FNVA 3LXFA 2IY0B 2JZZA 5G5HA 4JL9A 4RGNA 4AJWA 1FNUA 5J2RA 1TKGA 2E3TA 1TY2A 3BY4B 3V6CB 5EDSA 3W9CB 4W9IA 3NVZA 2WXQA 2IBIB 3MTNB 1JWUD 3AH7A 3Q8BA 3TCAA 3ZJUA 4MM3B 3ZDTA 1E6EB 2HDEA 3QWZB 3T8MA 1UD7A 3ZNGC 1KF6B 5HKHA 4IG7B 1ESFA 1F9JA 2AL3A 4S17A 4URKA 1KJTA 5D3DA 3HHMA 1B9RA 3RYTA 2BS4B 3VTVA 4US9A 3OLMD 1OGWA 2GRIA 3BINA 2JXTA 3V60A 3V05A 4K7SA 1ISNA 2DX5B 3TIXA 3P1MA 2JYTA 3N3KB 3N9YC 3AEEB 1TBEA 2WDVB 5BYRA 3ML8A 1WGYA 4ARIA 2Y5PA 1NI2A 4ZRPA 3IBEA 2PEAA 2RSUA 1F1HA 1SXTA 3Q8AA 3RNFC 3R2IA 2GOWA 4DHJB 3T3NA 2MX2A 1NVID 4YSXB 3GZNB 4X57B 1JMLA 4XX5A 1WE7A 3N20C 3JSVA 2JZ3B 1I4PA 2CKHB 2BB5A 2X8XX 4JGHB 4OZCA 4OW0A 4WWNA 2GBRA 1SE9A 3MFGA 1SE3A 4MSQB 3AN1A 3OJ3A 2WX0A 1T6BX 1RFAA 2KHWB 4KX6B 1HTOA 2WX1A 1AYFA 1ZUD2 4OVUA 1WXVA 4C00A 4QAYA 1E9MA 4LTUA 3DBHI 3EHVA 1E7VA 4F1SA 4WWOA 3RNGC 4LNKA 4IM3A 4C7YA 3AEBB 1VCBA 4II2B 3AE3B 1OQRA 4G11A 1C4CA 2L0FA 4XE0A 1Q0WB 2QMTA 1WX9A 4F8CB 2KFJA 3WIMA 4F7ZA 1F77A 3KH0A 2INPE 1SGHA 2DENB 1UGMA 2YEPB 4FJVB 3L4PA 2KACA 4HCPB 5TSSA 3CSTA 4AP4C 3HVDA 1CMXB 3U8ZA 3PLUA 3ABVB 3RPFC 3NUHB 2VH1A 2LMCA 1C77A 3V61A 2MP2A 3VFKA 1YOVB 2ZPNA 5FR3A 1TS5A 2DHZA 4EOYA 2NMQA 1YIWA 3E56A 5BMHA 1MG4A 4GSWA 1K51A 3WAOA 4YTMB 2AX5A 4EEWA 2LGSA 4KVGB 2KMAA 3NHEB 4MT5A 4KV2A 1VZ8A 3HVZA 2RDHA 1FXAA 1FNWA 2KXJA 1RWSA 2LFIA 2L7RA 4GMVA 3VRAB 2MJ3A 1NYQA 1GG3A 1SF0A 3PZ8A 4CYEA 3AE8B 3NZUA 2DNFA 4BAXA 1J0GA 3PREA 3M63B 2WXGA 3KVFB 2N9XA 1I4RA 3AMZA 1ZGUB 4RFBA 2PJHA 2BBCA 3A4SC 2K1FA 3QARA 4C7ZA 1FPYA 2D10A 2MQJA 1WGKA 3VHTC 2PTLA 2WWZA 1I35A 3VRBB 1HE8A 1XLQA
chains in the Genus database with same CATH topology
4B95A 2KQSA 4BKGA 5KHQA 5TR5A 1KLVA 1K8RB 4G0NB 1M94A 1RRBA 2FCNA 2MRPA 3NY5A 1YX5B 4WQOB 2KWVB 4TV3A 1WJUA 2JUOA 3A9JA 4IM2A 3DBRI 4ICUA 3VAWA 4NJ7A 3WAMA 2L76A 2NCNA 2D3GA 2O6VB 4E3CA 2KDBA 3RZWC 3EFUA 2C7MB 3W1SA 2MBEA 1GJZA 3H6NA 1BT0A 3P2BA 1EF1A 2RD0A 1V86A 4K81A 1KM7A 3VH3B 2NBWB 4MGZE 1P0RA 2KOXA 1C1YB 3ZDMC 5AZFA 3UQAA 4I6PA 3DVGY 1EUVB 1UBQA 2JXXA 3PS6A 3PGEA 4ZRKA 2BKRB 3NOBA 4DK5A 2O2VA 4KZCA 1IYFA 2BKFA 1UH6A 3PV1A 2CHZA 3IHPC 4GN1A 2MW5A 1WRDB 3B0AA 3PSEB 4PYZA 3VQIA 3L10B 4HDOA 1WJNA 2C7NB 4HLEA 2KVRA 4BKSD 4ZRIA 1Q1OA 3ZTDA 2W9NA 3DVGX 2KDIA 2L3ZA 3R7QA 2LI5A 3PRZA 4PS8A 4OVVA 2DZJA 2IY1B 4B9KA 2GBKA 3DOWA 4FHJA 5IAAC 1RAXA 1NDDA 4W9CA 2AWTA 2DYMA 2FIDA 2LGXA 1WR1A 2MP2B 3KUCB 2LVOA 1E8YA 2KDEB 2LGDA 2N9PC 1RLFA 2D11A 4GDKA 1V5TA 4NQLB 2KO3A 2KX0A 3AU5A 3PTFC 3QC8B 2FNJB 3N32A 4MM3A 5DCNA 2K6QA 1P3QU 1V81A 2K8HA 5G55A 4N9F4 3SU8X 5JZEB 4FBJB 3H7PB 1GNUA 1E5WA 1C3TA 3APDA 3CSFA 2JRIB 3ZNHB 3AI5A 2A4ZA 1OTRB 1TGZB 3N30A 3VTWA 3AU4A 4WJNA 2VRRB 1OQYA 4M8NA 1OEYJ 1U4AA 2V1YA 2JWZA 4HK2A 1E90A 4A3OA 2WDTB 2YVCA 3VUXA 4NY0A 3PT2B 4MJSB 2ZCBA 2KTRA 2RGFA 1WYWB 4A3PA 2DZMA 2XEWA 2AL6A 2N7DA 3A33B 3PPAA 4WWPA 2FAZA 3JW0X 1WZ0A 3HIZA 5E6PA 2NVUI 2NBUA 4HPLB 1XT9B 1LM8B 3A1QA 1MG8A 2ASQA 3PZDA 4NAWB 5CX3A 4W9FA 4JLCA 3PVLA 4FJYA 3ZRFA 4LJOB 5BO4B 2Z59B 4XC2A 2G4DB 4CHKA 1WM3A 4DHZE 4W9HA 1E8WA 4I6LB 4WJOA 2GMIC 3L54A 2YLMA 2RPQA 3RCZA 3PRPB 3DPDA 3V6EB 2EKEC 1WF9A 3VTUA 4IM0A 3WAPA 2FCSA 4G3XB 3SD5A 2KNBA 4MSMB 4IWOA 2CHXA 1WR6E 1GC7A 2GBMA 1WXMA 1WE6A 2JY6A 5D2MB 2PE9A 3PHXB 2KMCA 1R4MI 4DXAB 3ZIMA 3X0WA 2A5UA 1TTNA 3L13A 4LJPB 1WZ3A 3A9JB 1P1AA 2EMSA 4NJ6A 3VUYA 4ASWC 5LXIB 2AEHA 3APFA 2KWUB 4BFRA 3UQBA 4W9EA 3JYUA 5DPSA 3TMPB 3RD2A 1H4RA 3PLVA 3ZW3A 1UBIA 1WH3A 1YJ1A 2JPHA 2J0MA 2KQ7A 5L95C 3UGBB 3TJPA 5J18A 4PS7A 1LXDA 3ECIA 4MEMA 4NNJB 3DVNU 3PHWB 1KOTA 3ZUNA 4MGIE 2KC2A 1J8CA 2R2QA 3ML9A 2NR2A 3T9LA 1YD8U 3X23A 2KFKA 3L16A 2N4FA 4BVUC 1X1MA 2O2VB 2K6DB 2J0JA 3UINB 1GC6A 2MBHA 1S1QB 2ZNVB 3WANA 3QX1A 3RUIB 2PPHA 2G3QB 2DZIA 1L7YA 3IFWB 2IY0B 2JZZA 2Z0EB 4JL9A 4CO7A 2KANA 2L05A 4AJWA 1TZ1A 3ZNZB 5J2RA 3Q3FA 3QK0A 4HCNB 3BY4B 1WJ6A 3V6CB 5EDSA 2LUEA 2DYBA 2JRHA 4KZ0A 4W9IA 4RM8A 3VH4B 4DBGA 2D07B 3A9KA 4W9DA 3TBLD 4AWJA 2CHWA 2IBIB 3MTNB 2CS4A 2K8BA 4II3B 2K8CA 5LLIA 1YQBA 1WFYA 1I42A 2PE6B 2L8JA 1V6EA 3TCAA 3WALA 2AYOB 1WXAA 1WGGA 2K25A 2KX3A 4GDKB 3ZNID 4BOSC 2XK5A 4YL8A 3JVZX 3ZDTA 5D94A 1IPGA 4LDTD 2KJHB 4M0WB 4ANVA 2LXCA 2Z0DB 3QWZB 3T8MA 1EF5A 5JHAA 1V49A 1UD7A 4PYUA 3ZNGC 3K9PB 1AARA 2R2OA 4E74A 5HKHA 2RR9A 4HDQA 3H9DA 4IG7B 4DHJD 4TKNA 4BBNC 1F9JA 3HM6X 2AL3A 2LJ5A 4AUQC 4URKA 1KJTA 2NPTA 2IO1B 1UZXB 1D3ZA 4IC7B 2FCMA 3SDLC 3QJZA 4FN2A 3HHMA 2KTRB 4BBNF 3KUZA 1H8CA 1WI0A 3QHTA 4K1RB 4A20A 3RYTA 2DAJA 1G6JA 3VTVA 3U30A 4KSLC 2LRWA 4BOZB 4EUTA 4XZ4A 1J19A 2HE7A 3OLMD 3D32A 2MBOA 4DWFA 1OEYA 1WJ4A 1NBFC 2MBBB 4I6NB 1JRUA 1OGWA 3A1QB 2N1VA 2EMTA 3BINA 3IG3A 5G2NA 1WMHA 3V60A 4K7SA 2C7HA 3OJ4B 1ISNA 2DX5B 4K7WA 2QHOA 3H1UA 3TIXA 2M1MA 1LFDA 2L0TA 3N3KB 3R7RA 3EC8A 4WJQA 4FULA 4GB9A 3HM3A 1TBEA 3ML8A 3MJWA 1WGYA 5C1ZA 4FLHA 1FXTB 1NI2A 2KK8A 4ANUA 3IBEA 3UF8A 4HPMB 4NPNA 2ZCCA 2PEAA 2V3SA 3S2AA 2JVCA 1WM2A 2RSUA 1IP9A 4GDLB 4EKUA 3H7SA 5E6NA 3NS8A 3W1SC 2WYQA 4GGQA 2MWSB 1V2YA 3GZNI 3QAQA 2GOWA 1UELA 2LVPA 2IZVB 4DHJB 2MX2A 4IW0A 4K7UA 3QCAA 4WJPA 3ZLZA 2BGFA 1R4NI 4HJKA 2V4LA 4MGYE 4EZLA 4JIOU 2BWFA 2ZVNA 3IVFA 2LZ6A 3A4RA 3APCA 2FIFA 3RT3B 4GDLA 5J17A 4LCDE 2XBBC 4X57B 2ZNVC 1L2NA 2LGYA 2OOBB 3DVNV 4ZYNA 4DDID 4XX5A 4BKTA 1WE7A 3CMMB 2OJRA 3JSVA 2JZ3B 2J0KA 5GMVA 3GOEA 2C60A 2CKHB 3M3JA 3QA8A 4RM9A 2KFKB 2J7QB 2BYVE 4M8MA 5CHFA 4JGHB 1V9JA 4EZKA 3AULA 3L0WB 1WX8A 4WWNA 2GBRA 1SE9A 5JH5C 2NBVB 1Q5WB 1Z2MA 3B1LX 2UWQA 5L83A 1LQBA 4HXDA 4MSQB 3VVWB 1V5OA 1Z5SB 3OJ3A 2KD0A 1YX6B 2WX0A 2BYEA 4MELA 2K39A 2KTFA 1RFAA 2KHWB 2NS5A 2ZPYA 5CHVC 2KJRA 4GOCA 3A9KB 5C23A 4HVBA 2WX1A 2GBNA 1E7UA 1ZW7A 4OVUA 4ZRJA 2KN5A 4GIVA 4TUUA 1WXVA 4MDKE 2I1JA 2G4SA 2XK5B 1ZKHA 3DBHI 3EHVA 1E7VA 1SIFA 5IA7A 4ANWA 4WWOA 4W9JA 4F1SA 3MHSD 2Y5BB 3QQ8B 1WGDA 4IM3A 4ZDVA 1VCBA 2KC1A 4II2B 3ZRCA 4G11A 2L0FA 1Q0WB 1WY8A 1WX9A 2MCNB 4F8CB 1PQSA 3ZO5B 2REXA 2KFJA 2MSED 4AJYB 3W1YA 3DBLI 2LWPA 2NPTB 3R3MA 3WIMA 2BYFA 2O6VA 4F7ZA 3Q3JA 3KH0A 2KLGA 4B6WA 2JT4B 2LXAA 1V80A 2M4NA 3EECA 4EZJA 1SGHA 2DENB 2KWCA 1UGMA 2GBJA 3DBSA 4HWIB 3KYCD 4FJVB 4HCPB 4FA6A 2CU1A 2FCQA 3CSTA 1WMHB 5E6OA 3DQVA 3L17A 4NQKE 4AP4C 2KJ6A 4W9KA 1CMXB 5JHBA 3UIPB 1A5RA 2MA9B 4P7IA 3U8ZA 3ZTCA 3KW5B 3PLUA 4ANXA 3RULA 4TQ1A 2G45B 3DDCB 1VD2A 3PRMB 2N9EB 4KDLB 3ZKJC 2HTHA 1GUAB 2N7EA 1WIAA 3M95A 1EO6A 3ONSA 2B3AA 3R66C 4WAAA 4IWQA 3VUWA 1P98A 3L08A 4FHKA 5DPWA 4MGKE 2KZRA 1P9DU 2N1WA 3U7DA 2D2QA 2MP2A 3O65B 3V61A 4AOFA 3VFKA 2CR5A 2ZVOA 2HJ8A 2IO3B 2DYOA 1QZEA 5CTRC 2MBQA 2MLBA 4IWPA 2IO2B 2ZPNA 2LRUA 5D6JB 1E8XA 4GU2A 2DAFA 2DHZA 5DPRA 4EOYA 4DDGD 4E71A 2BWES 1YIWA 3VXWA 3UIOB 4LDTB 5KHOA 3DCGA 3C0RB 4ICVA 3H7PA 4GSWA 2ZJDA 2C9WB 3WAOA 3RZFA 3AXCA 1WXSA 2ZEQA 4EEWA 4EFOA 3NZSA 2IO0B 2KDFB 2M0XA 4PS3A 4KVGB 2BPSA 3JSVB 2KMAA 2UYZB 2LVQA 3KYDD 3NHEB 4KV2A 2L00B 5FR6A 1WX7A 4RMAA 4IUMB 2O6VD 4TQ0A 2IYDB 4G50A 3K9OB 2I1KA 3LDZE 4MJSA 3TL5A 2KXJA 5LXHA 3VDZA 3OAWA 2JF5A 2L7RA 3HK0A 4GMVA 4BKSA 4KIKB 2LD9A 1E8ZA 3ZVVA 2M8SA 3CF6E 3KUDB 4FADA 4NAWA 4W9LA 2HD5B 1GG3A 2ZZPB 2KLCA 1WGRA 2M17A 3B08A 3LJ3A 1XQQA 1XD3B 3V62A 4CYEA 3NZUA 1J0GA 4KDIC 3PREA 2FUHB 1Y8RC 3M63B 4JQWC 3KVFB 2N9XA 5CHWA 2LASA 4FJZA 5AZHA 2C5LC 5AEKB 4KIKA 5DPTA 1ZGUB 2PJHA 3SHQA 3I3TB 1T0YA 2BF8B 3ENEA 3A4SC 2K1FA 3QARA 1WGHA 2D10A 2DZKA 4GXBA 3M62B 2MQJA 4MH0E 3ALBA 4DHZB 3VHTC 5D7GA 2KKCA 1S3SG 4J6IA 4KSKC 2WWZA 3QIJA 5AZGA 3WA0A 1I35A 1HE8A 4W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B95 A;  2KQS A;  4BKG A;  5KHQ A;  5TR5 A;  1KLV A;  1K8R B;  4G0N B;  1M94 A;  1RRB A;  2FCN A;  2MRP A;  3NY5 A;  1YX5 B;  4WQO B;  2KWV B;  4TV3 A;  1WJU A;  2JUO A;  3A9J A;  4IM2 A;  3DBR I;  4ICU A;  3VAW A;  4NJ7 A;  3WAM A;  2L76 A;  2NCN A;  2D3G A;  2O6V B;  4E3C A;  2KDB A;  3RZW C;  3EFU A;  2C7M B;  3W1S A;  2MBE A;  1GJZ A;  3H6N A;  1BT0 A;  3P2B A;  1EF1 A;  2RD0 A;  1V86 A;  4K81 A;  1KM7 A;  3VH3 B;  2NBW B;  4MGZ E;  1P0R A;  2KOX A;  1C1Y B;  3ZDM C;  5AZF A;  3UQA A;  4I6P A;  3DVG Y;  1EUV B;  1UBQ A;  2JXX A;  3PS6 A;  3PGE A;  4ZRK A;  2BKR B;  3NOB A;  4DK5 A;  2O2V A;  4KZC A;  1IYF A;  2BKF A;  1UH6 A;  3PV1 A;  2CHZ A;  3IHP C;  4GN1 A;  2MW5 A;  1WRD B;  3B0A A;  3PSE B;  4PYZ A;  3VQI A;  3L10 B;  4HDO A;  1WJN A;  2C7N B;  4HLE A;  2KVR A;  4BKS D;  4ZRI A;  1Q1O A;  3ZTD A;  2W9N A;  3DVG X;  2KDI A;  2L3Z A;  3R7Q A;  2LI5 A;  3PRZ A;  4PS8 A;  4OVV A;  2DZJ A;  2IY1 B;  4B9K A;  2GBK A;  3DOW A;  4FHJ A;  5IAA C;  1RAX A;  1NDD A;  4W9C A;  2AWT A;  2DYM A;  2FID A;  2LGX A;  1WR1 A;  2MP2 B;  3KUC B;  2LVO A;  1E8Y A;  2KDE B;  2LGD A;  2N9P C;  1RLF A;  2D11 A;  4GDK A;  1V5T A;  4NQL B;  2KO3 A;  2KX0 A;  3AU5 A;  3PTF C;  3QC8 B;  2FNJ B;  3N32 A;  4MM3 A;  5DCN A;  2K6Q A;  1P3Q U;  1V81 A;  2K8H A;  5G55 A;  4N9F 4;  3SU8 X;  5JZE B;  4FBJ B;  3H7P B;  1GNU A;  1E5W A;  1C3T A;  3APD A;  3CSF A;  2JRI B;  3ZNH B;  3AI5 A;  2A4Z A;  1OTR B;  1TGZ B;  3N30 A;  3VTW A;  3AU4 A;  4WJN A;  2VRR B;  1OQY A;  4M8N A;  1OEY J;  1U4A A;  2V1Y A;  2JWZ A;  4HK2 A;  1E90 A;  4A3O A;  2WDT B;  2YVC A;  3VUX A;  4NY0 A;  3PT2 B;  4MJS B;  2ZCB A;  2KTR A;  2RGF A;  1WYW B;  4A3P A;  2DZM A;  2XEW A;  2AL6 A;  2N7D A;  3A33 B;  3PPA A;  4WWP A;  2FAZ A;  3JW0 X;  1WZ0 A;  3HIZ A;  5E6P A;  2NVU I;  2NBU A;  4HPL B;  1XT9 B;  1LM8 B;  3A1Q A;  1MG8 A;  2ASQ A;  3PZD A;  4NAW B;  5CX3 A;  4W9F A;  4JLC A;  3PVL A;  4FJY A;  3ZRF A;  4LJO B;  5BO4 B;  2Z59 B;  4XC2 A;  2G4D B;  4CHK A;  1WM3 A;  4DHZ E;  4W9H A;  1E8W A;  4I6L B;  4WJO A;  2GMI C;  3L54 A;  2YLM A;  2RPQ A;  3RCZ A;  3PRP B;  3DPD A;  3V6E B;  2EKE C;  1WF9 A;  3VTU A;  4IM0 A;  3WAP A;  2FCS A;  4G3X B;  3SD5 A;  2KNB A;  4MSM B;  4IWO A;  2CHX A;  1WR6 E;  1GC7 A;  2GBM A;  1WXM A;  1WE6 A;  2JY6 A;  5D2M B;  2PE9 A;  3PHX B;  2KMC A;  1R4M I;  4DXA B;  3ZIM A;  3X0W A;  2A5U A;  1TTN A;  3L13 A;  4LJP B;  1WZ3 A;  3A9J B;  1P1A A;  2EMS A;  4NJ6 A;  3VUY A;  4ASW C;  5LXI B;  2AEH A;  3APF A;  2KWU B;  4BFR A;  3UQB A;  4W9E A;  3JYU A;  5DPS A;  3TMP B;  3RD2 A;  1H4R A;  3PLV A;  3ZW3 A;  1UBI A;  1WH3 A;  1YJ1 A;  2JPH A;  2J0M A;  2KQ7 A;  5L95 C;  3UGB B;  3TJP A;  5J18 A;  4PS7 A;  1LXD A;  3ECI A;  4MEM A;  4NNJ B;  3DVN U;  3PHW B;  1KOT A;  3ZUN A;  4MGI E;  2KC2 A;  1J8C A;  2R2Q A;  3ML9 A;  2NR2 A;  3T9L A;  1YD8 U;  3X23 A;  2KFK A;  3L16 A;  2N4F A;  4BVU C;  1X1M A;  2O2V B;  2K6D B;  2J0J A;  3UIN B;  1GC6 A;  2MBH A;  1S1Q B;  2ZNV B;  3WAN A;  3QX1 A;  3RUI B;  2PPH A;  2G3Q B;  2DZI A;  1L7Y A;  3IFW B;  2IY0 B;  2JZZ A;  2Z0E B;  4JL9 A;  4CO7 A;  2KAN A;  2L05 A;  4AJW A;  1TZ1 A;  3ZNZ B;  5J2R A;  3Q3F A;  3QK0 A;  4HCN B;  3BY4 B;  1WJ6 A;  3V6C B;  5EDS A;  2LUE A;  2DYB A;  2JRH A;  4KZ0 A;  4W9I A;  4RM8 A;  3VH4 B;  4DBG A;  2D07 B;  3A9K A;  4W9D A;  3TBL D;  4AWJ A;  2CHW A;  2IBI B;  3MTN B;  2CS4 A;  2K8B A;  4II3 B;  2K8C A;  5LLI A;  1YQB A;  1WFY A;  1I42 A;  2PE6 B;  2L8J A;  1V6E A;  3TCA A;  3WAL A;  2AYO B;  1WXA A;  1WGG A;  2K25 A;  2KX3 A;  4GDK B;  3ZNI D;  4BOS C;  2XK5 A;  4YL8 A;  3JVZ X;  3ZDT A;  5D94 A;  1IPG A;  4LDT D;  2KJH B;  4M0W B;  4ANV A;  2LXC A;  2Z0D B;  3QWZ B;  3T8M A;  1EF5 A;  5JHA A;  1V49 A;  1UD7 A;  4PYU A;  3ZNG C;  3K9P B;  1AAR A;  2R2O A;  4E74 A;  5HKH A;  2RR9 A;  4HDQ A;  3H9D A;  4IG7 B;  4DHJ D;  4TKN A;  4BBN C;  1F9J A;  3HM6 X;  2AL3 A;  2LJ5 A;  4AUQ C;  4URK A;  1KJT A;  2NPT A;  2IO1 B;  1UZX B;  1D3Z A;  4IC7 B;  2FCM A;  3SDL C;  3QJZ A;  4FN2 A;  3HHM A;  2KTR B;  4BBN F;  3KUZ A;  1H8C A;  1WI0 A;  3QHT A;  4K1R B;  4A20 A;  3RYT A;  2DAJ A;  1G6J A;  3VTV A;  3U30 A;  4KSL C;  2LRW A;  4BOZ B;  4EUT A;  4XZ4 A;  1J19 A;  2HE7 A;  3OLM D;  3D32 A;  2MBO A;  4DWF A;  1OEY A;  1WJ4 A;  1NBF C;  2MBB B;  4I6N B;  1JRU A;  1OGW A;  3A1Q B;  2N1V A;  2EMT A;  3BIN A;  3IG3 A;  5G2N A;  1WMH A;  3V60 A;  4K7S A;  2C7H A;  3OJ4 B;  1ISN A;  2DX5 B;  4K7W A;  2QHO A;  3H1U A;  3TIX A;  2M1M A;  1LFD A;  2L0T A;  3N3K B;  3R7R A;  3EC8 A;  4WJQ A;  4FUL A;  4GB9 A;  3HM3 A;  1TBE A;  3ML8 A;  3MJW A;  1WGY A;  5C1Z A;  4FLH A;  1FXT B;  1NI2 A;  2KK8 A;  4ANU A;  3IBE A;  3UF8 A;  4HPM B;  4NPN A;  2ZCC A;  2PEA A;  2V3S A;  3S2A A;  2JVC A;  1WM2 A;  2RSU A;  1IP9 A;  4GDL B;  4EKU A;  3H7S A;  5E6N A;  3NS8 A;  3W1S C;  2WYQ A;  4GGQ A;  2MWS B;  1V2Y A;  3GZN I;  3QAQ A;  2GOW A;  1UEL A;  2LVP A;  2IZV B;  4DHJ B;  2MX2 A;  4IW0 A;  4K7U A;  3QCA A;  4WJP A;  3ZLZ A;  2BGF A;  1R4N I;  4HJK A;  2V4L A;  4MGY E;  4EZL A;  4JIO U;  2BWF A;  2ZVN A;  3IVF A;  2LZ6 A;  3A4R A;  3APC A;  2FIF A;  3RT3 B;  4GDL A;  5J17 A;  4LCD E;  2XBB C;  4X57 B;  2ZNV C;  1L2N A;  2LGY A;  2OOB B;  3DVN V;  4ZYN A;  4DDI D;  4XX5 A;  4BKT A;  1WE7 A;  3CMM B;  2OJR A;  3JSV A;  2JZ3 B;  2J0K A;  5GMV A;  3GOE A;  2C60 A;  2CKH B;  3M3J A;  3QA8 A;  4RM9 A;  2KFK B;  2J7Q B;  2BYV E;  4M8M A;  5CHF A;  4JGH B;  1V9J A;  4EZK A;  3AUL A;  3L0W B;  1WX8 A;  4WWN A;  2GBR A;  1SE9 A;  5JH5 C;  2NBV B;  1Q5W B;  1Z2M A;  3B1L X;  2UWQ A;  5L83 A;  1LQB A;  4HXD A;  4MSQ B;  3VVW B;  1V5O A;  1Z5S B;  3OJ3 A;  2KD0 A;  1YX6 B;  2WX0 A;  2BYE A;  4MEL A;  2K39 A;  2KTF A;  1RFA A;  2KHW B;  2NS5 A;  2ZPY A;  5CHV C;  2KJR A;  4GOC A;  3A9K B;  5C23 A;  4HVB A;  2WX1 A;  2GBN A;  1E7U A;  1ZW7 A;  4OVU A;  4ZRJ A;  2KN5 A;  4GIV A;  4TUU A;  1WXV A;  4MDK E;  2I1J A;  2G4S A;  2XK5 B;  1ZKH A;  3DBH I;  3EHV A;  1E7V A;  1SIF A;  5IA7 A;  4ANW A;  4WWO A;  4W9J A;  4F1S A;  3MHS D;  2Y5B B;  3QQ8 B;  1WGD A;  4IM3 A;  4ZDV A;  1VCB A;  2KC1 A;  4II2 B;  3ZRC A;  4G11 A;  2L0F A;  1Q0W B;  1WY8 A;  1WX9 A;  2MCN B;  4F8C B;  1PQS A;  3ZO5 B;  2REX A;  2KFJ A;  2MSE D;  4AJY B;  3W1Y A;  3DBL I;  2LWP A;  2NPT B;  3R3M A;  3WIM A;  2BYF A;  2O6V A;  4F7Z A;  3Q3J A;  3KH0 A;  2KLG A;  4B6W A;  2JT4 B;  2LXA A;  1V80 A;  2M4N A;  3EEC A;  4EZJ A;  1SGH A;  2DEN B;  2KWC A;  1UGM A;  2GBJ A;  3DBS A;  4HWI B;  3KYC D;  4FJV B;  4HCP B;  4FA6 A;  2CU1 A;  2FCQ A;  3CST A;  1WMH B;  5E6O A;  3DQV A;  3L17 A;  4NQK E;  4AP4 C;  2KJ6 A;  4W9K A;  1CMX B;  5JHB A;  3UIP B;  1A5R A;  2MA9 B;  4P7I A;  3U8Z A;  3ZTC A;  3KW5 B;  3PLU A;  4ANX A;  3RUL A;  4TQ1 A;  2G45 B;  3DDC B;  1VD2 A;  3PRM B;  2N9E B;  4KDL B;  3ZKJ C;  2HTH A;  1GUA B;  2N7E A;  1WIA A;  3M95 A;  1EO6 A;  3ONS A;  2B3A A;  3R66 C;  4WAA A;  4IWQ A;  3VUW A;  1P98 A;  3L08 A;  4FHK A;  5DPW A;  4MGK E;  2KZR A;  1P9D U;  2N1W A;  3U7D A;  2D2Q A;  2MP2 A;  3O65 B;  3V61 A;  4AOF A;  3VFK A;  2CR5 A;  2ZVO A;  2HJ8 A;  2IO3 B;  2DYO A;  1QZE A;  5CTR C;  2MBQ A;  2MLB A;  4IWP A;  2IO2 B;  2ZPN A;  2LRU A;  5D6J B;  1E8X A;  4GU2 A;  2DAF A;  2DHZ A;  5DPR A;  4EOY A;  4DDG D;  4E71 A;  2BWE S;  1YIW A;  3VXW A;  3UIO B;  4LDT B;  5KHO A;  3DCG A;  3C0R B;  4ICV A;  3H7P A;  4GSW A;  2ZJD A;  2C9W B;  3WAO A;  3RZF A;  3AXC A;  1WXS A;  2ZEQ A;  4EEW A;  4EFO A;  3NZS A;  2IO0 B;  2KDF B;  2M0X A;  4PS3 A;  4KVG B;  2BPS A;  3JSV B;  2KMA A;  2UYZ B;  2LVQ A;  3KYD D;  3NHE B;  4KV2 A;  2L00 B;  5FR6 A;  1WX7 A;  4RMA A;  4IUM B;  2O6V D;  4TQ0 A;  2IYD B;  4G50 A;  3K9O B;  2I1K A;  3LDZ E;  4MJS A;  3TL5 A;  2KXJ A;  5LXH A;  3VDZ A;  3OAW A;  2JF5 A;  2L7R A;  3HK0 A;  4GMV A;  4BKS A;  4KIK B;  2LD9 A;  1E8Z A;  3ZVV A;  2M8S A;  3CF6 E;  3KUD B;  4FAD A;  4NAW A;  4W9L A;  2HD5 B;  1GG3 A;  2ZZP B;  2KLC A;  1WGR A;  2M17 A;  3B08 A;  3LJ3 A;  1XQQ A;  1XD3 B;  3V62 A;  4CYE A;  3NZU A;  1J0G A;  4KDI C;  3PRE A;  2FUH B;  1Y8R C;  3M63 B;  4JQW C;  3KVF B;  2N9X A;  5CHW A;  2LAS A;  4FJZ A;  5AZH A;  2C5L C;  5AEK B;  4KIK A;  5DPT A;  1ZGU B;  2PJH A;  3SHQ A;  3I3T B;  1T0Y A;  2BF8 B;  3ENE A;  3A4S C;  2K1F A;  3QAR A;  1WGH A;  2D10 A;  2DZK A;  4GXB A;  3M62 B;  2MQJ A;  4MH0 E;  3ALB A;  4DHZ B;  3VHT C;  5D7G A;  2KKC A;  1S3S G;  4J6I A;  4KSK C;  2WWZ A;  3QIJ A;  5AZG A;  3WA0 A;  1I35 A;  1HE8 A;  4W9G A; 
#chains in the Genus database with same CATH topology
 2MJE A;  2KQS A;  5KHQ A;  3ZJV A;  2KWV B;  4TV3 A;  1WJU A;  3A9J A;  2UU7 A;  3DBR I;  4IM2 A;  1UUP A;  2O6V B;  4JPS A;  2KDB A;  3Q6B A;  2C7M B;  1GJZ A;  2YEP F;  1EF1 A;  1V86 A;  1D5Z C;  2NBW B;  2KOX A;  5AZF A;  1EUV B;  2K5P A;  3PGE A;  4D2K A;  1XCT L;  1MI0 A;  2O2V A;  2BKF A;  1UH6 A;  3PV1 A;  4DWF A;  1ET9 A;  3VQI A;  3BWU D;  3DHI C;  2KDI A;  1ZDV A;  3PRZ A;  4OVV A;  1KLU D;  2GBK A;  1XCQ L;  1RAX A;  3AEF B;  4W9C A;  2IJ0 A;  2DYM A;  3FC4 A;  1WR1 A;  3GB1 A;  1JWS D;  3J9C A;  2KX0 A;  3PTF C;  2FNJ B;  3N32 A;  2K6Q A;  1P3Q U;  5G55 A;  4FBJ B;  3H7P B;  1IBX A;  4H2A A;  3APD A;  3CSF A;  2KVZ A;  3C19 A;  2PIA A;  1TGZ B;  1E7P B;  1QLB B;  1L5P A;  1E90 A;  4A3O A;  2G1E A;  2JYE A;  1I4G A;  3PT2 B;  1N60 A;  3A33 B;  1WXQ A;  2VZK B;  2NVU I;  2NBU A;  2WP9 B;  4HPL B;  1XT9 B;  2ASQ A;  2WU5 B;  4JLC A;  4RGT A;  3ZRF A;  4MAC A;  5BO4 B;  4XC2 A;  1I4Q A;  4GLS C;  2YLM A;  4K3C A;  1N61 A;  3AE4 B;  3WAP A;  4G3X B;  2CHX A;  2GLS A;  1GC7 A;  4C4V B;  3U52 E;  1WE6 A;  2CJN A;  2JY6 A;  4RGO S;  5D2M B;  5E6J A;  3AE9 B;  2PLP A;  3L13 A;  4LJP B;  1WZ3 A;  3H8H A;  4NJ6 A;  4WWM A;  1TS2 A;  1QT9 A;  1TT5 B;  1MVK A;  3ZW3 A;  1UBI A;  3UGB B;  1VR9 A;  3Q3O C;  4WH4 A;  2L32 A;  3PHW B;  3X23 A;  2N4F A;  2PW9 A;  2BQQ A;  3BYT B;  1A70 A;  3QX1 A;  5H92 C;  2G3Q B;  4A6Q A;  1MFW A;  2Z0E B;  2L05 A;  3ZNZ B;  3Q3F A;  5EE1 A;  1L4Z B;  1C9F A;  3EGR A;  4KZ0 A;  2JRH A;  4DBG A;  3VH4 B;  1EU3 A;  3A9K A;  4W9D A;  3W2D A;  1YQ4 B;  2CHW A;  1T0S C;  5LLI A;  1YQB A;  1I42 A;  2PE6 B;  2KN4 A;  3WAL A;  3ETR A;  4GDK B;  2KX3 A;  2AQ3 B;  3ZNI D;  1HZ6 A;  1P7E A;  5D94 A;  2Z0D B;  3Q2A C;  1EF5 A;  3AE1 B;  3SFE B;  2FE8 A;  1V8C A;  3K9P B;  4DXG A;  1YMH E;  4KKI A;  3RMK C;  4BBN C;  4ZHO A;  4AUQ C;  1D3Z A;  4IC7 B;  3SDL C;  1ZP0 B;  2KTR B;  2B76 B;  3QHT A;  1G6J A;  1AWD A;  4EUT A;  4XZ4 A;  2HE7 A;  2ZW0 A;  2KDM A;  4ZYS A;  2PKO A;  1WJ4 A;  4I6N B;  2EMT A;  3P4Q B;  5G2N A;  1KFY B;  1CZP A;  2QHO A;  1LFD A;  2KYW A;  3KWV A;  4BZA A;  4FUL A;  4GB9 A;  3UF8 A;  4HPM B;  4NPN A;  2JVC A;  1VDV A;  4GDL B;  5HG2 A;  3DWG C;  1JQ4 A;  1V2Y A;  3GZN I;  1ENF A;  5IN7 A;  1UEL A;  3ZLZ A;  3QCA A;  2BGF A;  2JX5 A;  2ZVN A;  2V3P A;  2LZ6 A;  4GDL A;  5J17 A;  2XBB C;  2WU2 B;  5EE3 A;  3DVN V;  4ZYN A;  4DDI D;  1R4N B;  3CMM B;  3N1Z C;  1C4A A;  5AUK A;  5GMV A;  2W54 A;  2KFK B;  4RNA A;  2J7Q B;  2BYV E;  5D3I B;  5MPO A;  1FRR A;  4OZA A;  1V9J A;  3AUL A;  3L0W B;  1WX8 A;  2JZP A;  4A90 A;  1Q5W B;  3B1L X;  2WLB A;  1EU4 A;  1LQB A;  4RF0 A;  4HXD A;  1V5O A;  1Z5S B;  1VLB A;  5CHV C;  2PMV A;  2KJR A;  2ACZ B;  5C23 A;  2V3N A;  1V97 A;  1E7U A;  3AE7 B;  2AQ1 B;  3AEG B;  1ZKH A;  3W5U B;  4ACF A;  4W9J A;  4REZ A;  3QQ8 B;  4ZDV A;  1FXI A;  2QSD A;  2BYT A;  3LYY A;  2V4I B;  4IDI A;  3ZRC A;  1NEN B;  3MJ5 A;  1EWC A;  1WY8 A;  2OJW A;  3FAH A;  1K53 A;  2REX A;  2BYF A;  1GAQ B;  4JWS C;  2BW2 A;  3U7Z A;  1DOY A;  1FM0 D;  1FFV A;  2WGS A;  3TEZ A;  1NI3 A;  2LXA A;  2QC8 A;  3Q3N C;  1WYG A;  4HWI B;  2JWU A;  5T8I A;  4FA6 A;  2CU1 A;  2FCQ A;  1N62 A;  5E6O A;  2KJ6 A;  2MA9 B;  3ZTC A;  4PK1 A;  2G45 B;  3PRM B;  4KDL B;  4LK0 M;  2HTH A;  2N7E A;  1N5X A;  3R66 C;  5DPW A;  3L08 A;  3O65 B;  1HTQ A;  3VR9 B;  2CR5 A;  3VR8 B;  2HJ8 A;  2IO3 B;  3B2F A;  1QZE A;  2WXL A;  5CTR C;  2MBQ A;  1Y56 A;  2IO2 B;  4L1B A;  2AQ2 B;  4E71 A;  3VXW A;  2N0S B;  3BK1 A;  5KHO A;  2WXP A;  3DCG A;  3MC8 A;  4ICV A;  2ZJD A;  3RZF A;  2IPK D;  1WXS A;  3AXC A;  3B2G A;  2ZEQ A;  4EFO A;  3GE8 C;  2IO0 B;  2M0X A;  3Q8E A;  5C3J B;  2BPS A;  1L6U A;  3JSV B;  3KYD D;  2LVQ A;  2KAJ A;  4HRO A;  2W82 A;  3DHH C;  4P16 A;  3K9O B;  4MJS A;  3C8Y A;  1ZXI A;  2Y3A A;  1K50 A;  3OAW A;  2JF5 A;  1UNS A;  3HK0 A;  2RDB C;  4KGT A;  2M8S A;  3KUD B;  4NAW A;  4W9L A;  1T0R C;  2KLC A;  1VZ7 A;  3TEX A;  2M17 A;  1D5M C;  3MC0 B;  4JQW C;  2ONQ A;  2C5L C;  4NZL B;  5DPT A;  2Y5C A;  1YJI A;  1T0Y A;  3ENE A;  1FIQ A;  1F2R C;  2DZK A;  4DHZ B;  5D7G A;  4KSK C;  5C2T B;  3WA0 A;  4W9G A;  5TR5 A;  4G0N B;  1M94 A;  3NY5 A;  4OZB A;  3PZ7 A;  4ICU A;  3VAW A;  4NJ7 A;  2L76 A;  3GS2 A;  4HRS A;  2NCN A;  4HPP A;  3NS1 A;  3OG5 A;  3ZYY X;  4ARC A;  3H6N A;  1BT0 A;  3P2B A;  2RD0 A;  3VH3 B;  1P0R A;  3ZDM C;  2M0A A;  1ZE3 D;  3DVG Y;  3PS6 A;  3NOB A;  4KZC A;  3RNB C;  2GB1 A;  2CHZ A;  4GN1 A;  2MW5 A;  1WRD B;  3FIL A;  3L10 B;  4HDO A;  1D4B A;  3R7Q A;  1LO5 D;  2DZJ A;  3DOW A;  5IAA C;  1YNT E;  1JWB D;  2MP2 B;  3RN9 C;  1TKY A;  2LVO A;  1E8Y A;  2KDE B;  2LGD A;  2I38 A;  1TKE A;  2IGH A;  1RLF A;  2D11 A;  1GB4 A;  4WUR A;  1MPE A;  3AB5 A;  3SU8 X;  4N9F 4;  5JZE B;  2BVC A;  3WCQ A;  2WXK A;  1HZ5 A;  3AI5 A;  1UGJ A;  3VTW A;  4WJN A;  2VRR B;  4M8N A;  1U4A A;  2JWZ A;  4S0R A;  4A55 A;  1JAL A;  1V1P A;  2D3B A;  1SJE D;  3VUX A;  2ZCB A;  1FEH A;  3NRZ A;  2XEW A;  2N7D A;  2BT6 A;  3PPA A;  3JW0 X;  4KGR A;  3B9J A;  2RDG A;  3A1Q A;  1LM8 B;  1QOA A;  4LLG M;  1RYJ A;  5IP4 D;  4FJY A;  4LJO B;  2Z59 B;  5EE9 A;  2G4D B;  1WM3 A;  1TYG B;  2GMI C;  3L54 A;  2E6X A;  4J3O D;  2RPQ A;  3PRP B;  5GXG B;  2EKE C;  3VTU A;  3P4R B;  1TS4 A;  4TSS A;  3MP9 A;  1I7H A;  1WR6 E;  1GB1 A;  2G9H D;  2QDF A;  2PE9 A;  2JU6 X;  3PHX B;  1CK1 A;  3ZIM A;  1QQR A;  2A5U A;  3A9J B;  2EMS A;  1N63 A;  2MJD A;  4C80 A;  4BFR A;  2KWU B;  3UQB A;  4W9E A;  3JYU A;  4XYC A;  1H4R A;  4M00 A;  1FCC C;  1R4M B;  2LEK A;  2J0M A;  2KQ7 A;  2WXJ A;  5L95 C;  1HQR D;  3NVY A;  2K22 A;  3ECI A;  3DVN U;  3ZUN A;  4L2Y A;  2BTE A;  1UF0 A;  3T9L A;  1L0X B;  2O2V B;  3SFD B;  4YWG G;  1HA5 A;  4LNN A;  1L7Y A;  3IFW B;  2LJI A;  1BUI C;  4CO7 A;  2KAN A;  2SEB D;  1PUT A;  4L23 A;  1WJ6 A;  1SSN A;  4YTN B;  1XLN A;  3TBL D;  4DQO C;  4AWJ A;  2CS4 A;  2K8B A;  4II3 B;  3IT4 B;  1WFY A;  3AM9 A;  2L8J A;  1WXA A;  4KKJ A;  2XK5 A;  3JVZ X;  2HJ1 A;  4ANV A;  4M0W B;  2LXC A;  3OWE B;  1PFD A;  1FFU A;  1V49 A;  2OHF A;  4PYU A;  1IBX B;  3BII D;  3IXS A;  1AAR A;  4E74 A;  2RR9 A;  4DHJ D;  3HM6 X;  4M0W A;  2RPV A;  2NPT A;  1OQQ A;  4B0M A;  2FCM A;  3QJZ A;  4FN2 A;  4BBN F;  3KUZ A;  1H8C A;  1WI0 A;  4A20 A;  3P63 A;  1QKZ A;  3U30 A;  4KSL C;  2LRW A;  1OEY A;  1NBF C;  1JRU A;  3IG3 A;  1I4H A;  1WMH A;  4YT0 B;  3AE6 B;  2MEK A;  3OJ4 B;  1KLG D;  5H8Y E;  3H1U A;  2M1M A;  1AW7 A;  1KH0 A;  3R7R A;  3EC8 A;  3BVM A;  1BML C;  4WJQ A;  2PVO D;  3HM3 A;  2QIE B;  4FLH A;  1FXT B;  1TIF A;  4RCO A;  2V9H A;  4HEA 1;  4EKU A;  3H7S A;  3KQ4 A;  5E6N A;  4ZHP A;  5BYS A;  2WYQ A;  2MWS B;  3QAQ A;  2K9X A;  2IZV B;  1QOB A;  4IW0 A;  4K7U A;  1R4N I;  2V4L A;  4EZL A;  2BWF A;  3A4R A;  3RNA C;  2FIF A;  1FRD A;  2KT7 A;  2OOB B;  1M4V A;  2TSS A;  2OJR A;  2M56 B;  1XF5 L;  3M3J A;  4RM9 A;  2JQR B;  5FKA C;  4M8M A;  5CHF A;  1PGA A;  4EZK A;  3TEY A;  4M02 A;  5JH5 C;  1Z2M A;  4WAF A;  2UWQ A;  1LGR A;  3VVW B;  4YTP B;  2KD0 A;  2BYE A;  4EE2 A;  2K39 A;  2KTF A;  4YSZ B;  3A9K B;  1C4P A;  4HVB A;  1E10 A;  2GBN A;  3Q14 C;  4XDD A;  3PO0 A;  4ZRJ A;  2KN5 A;  4JX1 C;  3BYY B;  4TUU A;  1ZDX A;  2H88 B;  2I1J A;  2G4S A;  2DBY A;  1JRP A;  2WXH A;  1V1O A;  2W55 A;  1SBB B;  2GI9 A;  2Y5B B;  5LNK 1;  1WGD A;  1D6E C;  1STE A;  1PGB A;  1DYQ A;  3ZO5 B;  1UWM A;  3W1Y A;  3R3M A;  3Q3J A;  1SE4 A;  1DOI A;  2KLG A;  4B6W A;  2JT4 B;  1D5X C;  1MHX A;  1V80 A;  1WSP A;  2M4N A;  3EEC A;  4EZJ A;  3DBL B;  4TMA B;  2GBJ A;  1JW9 D;  4P1C C;  1JWA D;  2R61 A;  3L17 A;  4NQK E;  4LNF A;  1WWT A;  3UIP B;  1A5R A;  1FD6 A;  1L0Y B;  3KW5 B;  4TQ1 A;  3KLS X;  1VD2 A;  3ZQ4 A;  4BKT A;  3ONS A;  1EO6 A;  3VUW A;  1NYR A;  4FHK A;  4MGK E;  3U7D A;  1RM6 C;  2XNA C;  4AOF A;  1GPX A;  2WXM A;  2MLB A;  4IWP A;  4FXC A;  2LRU A;  2DAF A;  4DDG D;  1IUE A;  4LDT B;  3C0R B;  4XWW A;  2C9W B;  3TUO A;  3ZGZ A;  4MH8 A;  2KDF B;  4AS1 A;  1XLP A;  4PS3 A;  4P6V F;  1JRO A;  2L00 B;  1NEK B;  2O6V D;  3NVW A;  4RH6 A;  3NG0 A;  3N1Y C;  3IT6 B;  5LXH A;  1ZOY B;  1PGX A;  3ZVV A;  2Q5W D;  3CF6 E;  2PVG C;  2HTM E;  3BVZ A;  2ZZP B;  1JCK B;  3LJ3 A;  1XD3 B;  4KDI C;  1T5X D;  1WRI A;  2FUH B;  4OHJ A;  2LAS A;  2ON8 A;  1C76 A;  3MC9 A;  4FJZ A;  5AZH A;  5AEK B;  2NTS A;  1ZPS A;  1SE2 A;  1TZO A;  4MH0 E;  2LGI A;  4J6I A;  5AZG A;  4FAD A;  3E9S A;  4WQM A;  1F52 A;  1K8R B;  2FCN A;  1RRB A;  2MRP A;  1YX5 B;  1XXG A;  2WQY B;  2D3G A;  4USA A;  3RZW C;  5G5G A;  3W1S A;  2MBE A;  3ZXR A;  1B1Z A;  1SIJ A;  4K81 A;  1KRH A;  1KM7 A;  2Z8L A;  2EEL A;  1C1Y B;  4ZRQ A;  2MHJ A;  4B0E A;  1UBQ A;  2JXX A;  2XN9 C;  4ZRK A;  4DK5 A;  4NAM A;  2NTT A;  1IYF A;  3IHP C;  3B0A A;  4PYZ A;  2J4X A;  4HLE A;  2C7N B;  2OED A;  4BKS D;  2V0G A;  2VZK D;  2W9N A;  3DVG X;  2L3Z A;  2I2Y A;  3BZD B;  2IY1 B;  4FHJ A;  1NDD A;  4DXF A;  2AWT A;  2FID A;  1DGJ A;  3KUC B;  3Q8F A;  2KWD A;  2X38 A;  4OVZ A;  3V3X A;  4PT5 A;  1V5T A;  2KO3 A;  4MM3 A;  5DCN A;  2WXR A;  1V81 A;  2K8H A;  3TSS A;  1F0Z A;  3T3O A;  1K52 A;  1GNU A;  1C3T A;  1T3Q A;  3I57 A;  2IGD A;  1L6V A;  2A4Z A;  1OTR B;  2INC C;  3N30 A;  4M01 A;  1OQY A;  2V1Y A;  4XDC A;  4HK2 A;  3NZ3 A;  1J7B A;  2W3S A;  4AQ7 A;  3FKY A;  2WDT B;  2L1A A;  2YVC A;  4MJS B;  2AL6 A;  4WWP A;  2FAZ A;  4UDU C;  5BMI A;  3HIZ A;  5E6P A;  4N6E B;  4N59 A;  4NAW B;  4NJC A;  4W9F A;  3PVL A;  3AEC B;  4KGS A;  1ROE A;  4W9H A;  1E8W A;  4I6L B;  2IDY A;  4WJO A;  2WDR B;  1YN4 A;  3GE3 C;  1BXT A;  1P7F A;  2RMM A;  2FCS A;  4MSM B;  4IWO A;  2GBM A;  1WXM A;  2N9L A;  2WNM A;  1R4M I;  4DXA B;  2K0P A;  3X0W A;  3EUB 2;  3VUY A;  4ASW C;  1CJE A;  1CQV A;  2AEH A;  4YXD B;  2QEJ C;  5DPS A;  2CJO A;  3RD2 A;  1YJ1 A;  1YN5 A;  2DLB A;  4PS7 A;  1C78 A;  1LXD A;  4MGI E;  2KC2 A;  3ML9 A;  1VRA B;  5HI1 A;  3L16 A;  4CQN A;  4BVU C;  2K6D B;  2J0J A;  3UIN B;  2MBH A;  1HEZ E;  3RUI B;  2DZI A;  3FIL B;  3RNE C;  2M19 A;  4HJG E;  1TZ1 A;  3MHZ A;  3QK0 A;  3W5V B;  4HCN B;  2LUE A;  2DYB A;  4RM8 A;  2K3U A;  2D07 B;  3P42 A;  1PDX A;  4YSY B;  2WDQ B;  2J42 A;  2K8C A;  3N1X C;  1FO4 A;  3DWM A;  1V6E A;  2AYO B;  2K25 A;  1WGG A;  4BOS C;  3AE2 B;  1AN8 A;  4YL8 A;  1IPG A;  4LDT D;  2KJH B;  5JHA A;  1SB3 C;  3AEA B;  3NVV A;  3UI3 A;  2R2O A;  4HDQ A;  3H9D A;  4RGM A;  4TKN A;  1Q10 A;  2LJ5 A;  1V1P B;  2IO1 B;  1UZX B;  1IGD A;  3AED B;  4HKZ E;  2KQ4 X;  4K1R B;  4US8 A;  2DAJ A;  4BOZ B;  1J19 A;  3D32 A;  2MBO A;  2CU3 A;  3ZXV A;  2MBB B;  3A1Q B;  3Q69 A;  2N1V A;  1GOZ A;  3R8B A;  1T0Q C;  4P1B C;  2EKI A;  2C7H A;  2SAK A;  4K7W A;  2L0T A;  3TEW A;  3MJW A;  5C1Z A;  3SEB A;  2KK8 A;  4ANU A;  1EWY C;  2ZCC A;  2V3S A;  3S2A A;  1WM2 A;  1IP9 A;  3NS8 A;  2QCZ A;  3W1S C;  4GGQ A;  2INN E;  4HKQ A;  2WS3 B;  2LVP A;  1JWM D;  4WJP A;  4K3B A;  4MGY E;  4HJK A;  4JIO U;  1MHH E;  3IVF A;  3APC A;  1DOX A;  3RT3 B;  4LCD E;  1ET6 A;  2ZNV C;  1L2N A;  1RFK A;  2LGY A;  2J0K A;  3GOE A;  2C60 A;  3QA8 A;  1QIL A;  2N7J A;  3GP7 A;  3BK2 A;  2NBV B;  5L83 A;  3Q8C A;  1YX6 B;  4MEL A;  2NS5 A;  2ZPY A;  3SR6 A;  4GOC A;  2J52 A;  1N5W A;  1ZW7 A;  2BB6 A;  4GIV A;  4Q2J A;  1SEB D;  4MDK E;  2XK5 B;  3EA6 A;  4WIP A;  1SIF A;  5IA7 A;  3P4P B;  4ANW A;  3MHS D;  1F2R I;  2KC1 A;  3DBH B;  2MCN B;  1PQS A;  4C56 C;  2WXF A;  4AJY B;  2MSE D;  3DBL I;  5EE0 A;  2LWP A;  2NPT B;  2BS2 B;  3EFC A;  1SJH D;  2D5G A;  3BVG A;  2O6V A;  4N58 A;  2L52 A;  2DWQ A;  2KWC A;  5IOI A;  2JSV X;  3KWL A;  3O13 A;  3DBS A;  4XGA B;  1XEE A;  3KYC D;  1ZXH A;  1L4D B;  1WMH B;  3DQV A;  4W9K A;  5JHB A;  3I63 C;  5HFY A;  4P7I A;  4ANX A;  3RUL A;  1VJK A;  3DDC B;  3ZKJ C;  2N9E B;  4JWU C;  2N9K A;  1GUA B;  1WIA A;  3M95 A;  4WAA A;  2B3A A;  2J53 A;  4IWQ A;  3U4E G;  1P98 A;  2IGG A;  2KZR A;  1P9D U;  2N1W A;  2D2Q A;  2ZVO A;  3AV8 A;  2LHD A;  3CWI A;  2DYO A;  5D6J B;  5DPR A;  1E8X A;  4GU2 A;  3CIR B;  2BWE S;  3UIO B;  1VZ6 A;  1TY0 A;  2FBW B;  2VH2 A;  3H7P A;  3URY A;  1YQ3 B;  3NZS A;  5BYQ A;  5I4D A;  3P4S B;  1TJE A;  2UYZ B;  5FR6 A;  1QOF A;  1WX7 A;  4RMA A;  4IUM B;  4A8X C;  4TQ0 A;  2IYD B;  4G50 A;  3LDZ E;  2I1K A;  4ITK A;  3TL5 A;  3VDZ A;  5FK9 C;  4BKS A;  3Q3M C;  4KIK B;  2LD9 A;  2LHE A;  1E8Z A;  1C79 A;  3HRD D;  2HD5 B;  3I9V 1;  1WGR A;  3LB8 C;  3B08 A;  3V62 A;  1XQQ A;  1IGC A;  1I4X A;  2QJL A;  1Y8R C;  5CHW A;  4KIK A;  3SHQ A;  3I3T B;  2BF8 B;  4O1N A;  2FUG 1;  1WGH A;  1FMA D;  4RF1 A;  4GXB A;  3M62 B;  3ALB A;  1QOG A;  2KKC A;  4C4V A;  1S3S G;  3QIJ A;  5IKC M;  4B95 A;  4BKG A;  1KLV A;  4WQO B;  4R3D A;  2JUO A;  2WXN A;  1FCL A;  2WXO A;  3WAM A;  2BS3 B;  3IAS 1;  4E3C A;  2H89 B;  3R2T A;  3EFU A;  2MH7 A;  3NJT A;  3U2S C;  4LNO A;  3DBR B;  4MGZ E;  3UQA A;  2WHI A;  1YJJ A;  2IND C;  4I6P A;  4IKG A;  4XWT A;  3RFZ B;  5IO9 A;  1J7C A;  2BKR B;  3PSE B;  1WJN A;  3DHG C;  2KVR A;  4ZRI A;  1Q1O A;  3ZTD A;  4A9A A;  2LI5 A;  4PS8 A;  5HHD G;  4B9K A;  1OFF A;  2LGX A;  1J7A A;  2N9P C;  1YN3 A;  5BMG A;  3HUI A;  4GDK A;  4NQL B;  3AU5 A;  3QC8 B;  1QF6 A;  3RNC C;  1E5W A;  2D3C A;  2JRI B;  3ZNH B;  1EM7 A;  2KMM A;  2WXI A;  2W3R A;  3AU4 A;  1OEY J;  1TS3 A;  4NY0 A;  2KTR A;  2RGF A;  1WYW B;  3I5J C;  4A3P A;  2DZM A;  1UWX A;  1PYW D;  1KTK A;  2ZW1 A;  1WZ0 A;  2L83 A;  1MG8 A;  3PZD A;  5CX3 A;  3AE5 B;  4CHK A;  2LUM A;  4DHZ E;  4IOI E;  5AUI A;  3ZJT A;  3RCZ A;  1E0Z A;  3DPD A;  3V6E B;  1XO3 A;  1WF9 A;  4IM0 A;  3SD5 A;  2KNB A;  5JXV A;  1R7S A;  3RI7 C;  1HXY D;  1L0V B;  2KMC A;  4JE3 B;  1MJD A;  2D3A A;  1TTN A;  1P1A A;  2QIL A;  5LXI B;  3APF A;  3TMP B;  1XLO A;  3PLV A;  3IAM 1;  1ACC A;  1WH3 A;  2JPH A;  4ZOH C;  2ICI A;  3TJP A;  5J18 A;  4MEM A;  4NNJ B;  1KOT A;  1J8C A;  2R2Q A;  2NR2 A;  1YD8 U;  2KFK A;  1N6Z A;  1X1M A;  3WAN A;  4LNI A;  1GC6 A;  2ZNV B;  1S1Q B;  2PPH A;  1FNV A;  3LXF A;  2IY0 B;  2JZZ A;  5G5H A;  4JL9 A;  4RGN A;  4AJW A;  1FNU A;  5J2R A;  1TKG A;  2E3T A;  1TY2 A;  3BY4 B;  3V6C B;  5EDS A;  3W9C B;  4W9I A;  3NVZ A;  2WXQ A;  2IBI B;  3MTN B;  1JWU D;  3AH7 A;  3Q8B A;  3TCA A;  3ZJU A;  4MM3 B;  3ZDT A;  1E6E B;  2HDE A;  3QWZ B;  3T8M A;  1UD7 A;  3ZNG C;  1KF6 B;  5HKH A;  4IG7 B;  1ESF A;  1F9J A;  2AL3 A;  4S17 A;  4URK A;  1KJT A;  5D3D A;  3HHM A;  1B9R A;  3RYT A;  2BS4 B;  3VTV A;  4US9 A;  3OLM D;  1OGW A;  2GRI A;  3BIN A;  2JXT A;  3V60 A;  3V05 A;  4K7S A;  1ISN A;  2DX5 B;  3TIX A;  3P1M A;  2JYT A;  3N3K B;  3N9Y C;  3AEE B;  1TBE A;  2WDV B;  5BYR A;  3ML8 A;  1WGY A;  4ARI A;  2Y5P A;  1NI2 A;  4ZRP A;  3IBE A;  2PEA A;  2RSU A;  1F1H A;  1SXT A;  3Q8A A;  3RNF C;  3R2I A;  2GOW A;  4DHJ B;  3T3N A;  2MX2 A;  1NVI D;  4YSX B;  3GZN B;  4X57 B;  1JML A;  4XX5 A;  1WE7 A;  3N20 C;  3JSV A;  2JZ3 B;  1I4P A;  2CKH B;  2BB5 A;  2X8X X;  4JGH B;  4OZC A;  4OW0 A;  4WWN A;  2GBR A;  1SE9 A;  3MFG A;  1SE3 A;  4MSQ B;  3AN1 A;  3OJ3 A;  2WX0 A;  1T6B X;  1RFA A;  2KHW B;  4KX6 B;  1HTO A;  2WX1 A;  1AYF A;  1ZUD 2;  4OVU A;  1WXV A;  4C00 A;  4QAY A;  1E9M A;  4LTU A;  3DBH I;  3EHV A;  1E7V A;  4F1S A;  4WWO A;  3RNG C;  4LNK A;  4IM3 A;  4C7Y A;  3AEB B;  1VCB A;  4II2 B;  3AE3 B;  1OQR A;  4G11 A;  1C4C A;  2L0F A;  4XE0 A;  1Q0W B;  2QMT A;  1WX9 A;  4F8C B;  2KFJ A;  3WIM A;  4F7Z A;  1F77 A;  3KH0 A;  2INP E;  1SGH A;  2DEN B;  1UGM A;  2YEP B;  4FJV B;  3L4P A;  2KAC A;  4HCP B;  5TSS A;  3CST A;  4AP4 C;  3HVD A;  1CMX B;  3U8Z A;  3PLU A;  3ABV B;  3RPF C;  3NUH B;  2VH1 A;  2LMC A;  1C77 A;  3V61 A;  2MP2 A;  3VFK A;  1YOV B;  2ZPN A;  5FR3 A;  1TS5 A;  2DHZ A;  4EOY A;  2NMQ A;  1YIW A;  3E56 A;  5BMH A;  1MG4 A;  4GSW A;  1K51 A;  3WAO A;  4YTM B;  2AX5 A;  4EEW A;  2LGS A;  4KVG B;  2KMA A;  3NHE B;  4MT5 A;  4KV2 A;  1VZ8 A;  3HVZ A;  2RDH A;  1FXA A;  1FNW A;  2KXJ A;  1RWS A;  2LFI A;  2L7R A;  4GMV A;  3VRA B;  2MJ3 A;  1NYQ A;  1GG3 A;  1SF0 A;  3PZ8 A;  4CYE A;  3AE8 B;  3NZU A;  2DNF A;  4BAX A;  1J0G A;  3PRE A;  3M63 B;  2WXG A;  3KVF B;  2N9X A;  1I4R A;  3AMZ A;  1ZGU B;  4RFB A;  2PJH A;  2BBC A;  3A4S C;  2K1F A;  3QAR A;  4C7Z A;  1FPY A;  2D10 A;  2MQJ A;  1WGK A;  3VHT C;  2PTL A;  2WWZ A;  1I35 A;  3VRB B;  1HE8 A;  1XLQ A; 
#chains in the Genus database with same CATH homology
 4B95 A;  2KQS A;  4BKG A;  5KHQ A;  5TR5 A;  1KLV A;  1K8R B;  4G0N B;  1M94 A;  1RRB A;  2FCN A;  2MRP A;  3NY5 A;  1YX5 B;  4WQO B;  2KWV B;  4TV3 A;  1WJU A;  2JUO A;  3A9J A;  4IM2 A;  3DBR I;  4ICU A;  3VAW A;  4NJ7 A;  3WAM A;  2L76 A;  2NCN A;  2D3G A;  2O6V B;  4E3C A;  2KDB A;  3RZW C;  3EFU A;  2C7M B;  3W1S A;  2MBE A;  1GJZ A;  3H6N A;  1BT0 A;  3P2B A;  1EF1 A;  2RD0 A;  1V86 A;  4K81 A;  1KM7 A;  3VH3 B;  2NBW B;  4MGZ E;  1P0R A;  2KOX A;  1C1Y B;  3ZDM C;  5AZF A;  3UQA A;  4I6P A;  3DVG Y;  1EUV B;  1UBQ A;  2JXX A;  3PS6 A;  3PGE A;  4ZRK A;  2BKR B;  3NOB A;  4DK5 A;  2O2V A;  4KZC A;  1IYF A;  2BKF A;  1UH6 A;  3PV1 A;  2CHZ A;  3IHP C;  4GN1 A;  2MW5 A;  1WRD B;  3B0A A;  3PSE B;  4PYZ A;  3VQI A;  3L10 B;  4HDO A;  1WJN A;  2C7N B;  4HLE A;  2KVR A;  4BKS D;  4ZRI A;  1Q1O A;  3ZTD A;  2W9N A;  3DVG X;  2KDI A;  2L3Z A;  3R7Q A;  2LI5 A;  3PRZ A;  4PS8 A;  4OVV A;  2DZJ A;  2IY1 B;  4B9K A;  2GBK A;  3DOW A;  4FHJ A;  5IAA C;  1RAX A;  1NDD A;  4W9C A;  2AWT A;  2DYM A;  2FID A;  2LGX A;  1WR1 A;  2MP2 B;  3KUC B;  2LVO A;  1E8Y A;  2KDE B;  2LGD A;  2N9P C;  1RLF A;  2D11 A;  4GDK A;  1V5T A;  4NQL B;  2KO3 A;  2KX0 A;  3AU5 A;  3PTF C;  3QC8 B;  2FNJ B;  3N32 A;  4MM3 A;  5DCN A;  2K6Q A;  1P3Q U;  1V81 A;  2K8H A;  5G55 A;  4N9F 4;  3SU8 X;  5JZE B;  4FBJ B;  3H7P B;  1GNU A;  1E5W A;  1C3T A;  3APD A;  3CSF A;  2JRI B;  3ZNH B;  3AI5 A;  2A4Z A;  1OTR B;  1TGZ B;  3N30 A;  3VTW A;  3AU4 A;  4WJN A;  2VRR B;  1OQY A;  4M8N A;  1OEY J;  1U4A A;  2V1Y A;  2JWZ A;  4HK2 A;  1E90 A;  4A3O A;  2WDT B;  2YVC A;  3VUX A;  4NY0 A;  3PT2 B;  4MJS B;  2ZCB A;  2KTR A;  2RGF A;  1WYW B;  4A3P A;  2DZM A;  2XEW A;  2AL6 A;  2N7D A;  3A33 B;  3PPA A;  4WWP A;  2FAZ A;  3JW0 X;  1WZ0 A;  3HIZ A;  5E6P A;  2NVU I;  2NBU A;  4HPL B;  1XT9 B;  1LM8 B;  3A1Q A;  1MG8 A;  2ASQ A;  3PZD A;  4NAW B;  5CX3 A;  4W9F A;  4JLC A;  3PVL A;  4FJY A;  3ZRF A;  4LJO B;  5BO4 B;  2Z59 B;  4XC2 A;  2G4D B;  4CHK A;  1WM3 A;  4DHZ E;  4W9H A;  1E8W A;  4I6L B;  4WJO A;  2GMI C;  3L54 A;  2YLM A;  2RPQ A;  3RCZ A;  3PRP B;  3DPD A;  3V6E B;  2EKE C;  1WF9 A;  3VTU A;  4IM0 A;  3WAP A;  2FCS A;  4G3X B;  3SD5 A;  2KNB A;  4MSM B;  4IWO A;  2CHX A;  1WR6 E;  1GC7 A;  2GBM A;  1WXM A;  1WE6 A;  2JY6 A;  5D2M B;  2PE9 A;  3PHX B;  2KMC A;  1R4M I;  4DXA B;  3ZIM A;  3X0W A;  2A5U A;  1TTN A;  3L13 A;  4LJP B;  1WZ3 A;  3A9J B;  1P1A A;  2EMS A;  4NJ6 A;  3VUY A;  4ASW C;  5LXI B;  2AEH A;  3APF A;  2KWU B;  4BFR A;  3UQB A;  4W9E A;  3JYU A;  5DPS A;  3TMP B;  3RD2 A;  1H4R A;  3PLV A;  3ZW3 A;  1UBI A;  1WH3 A;  1YJ1 A;  2JPH A;  2J0M A;  2KQ7 A;  5L95 C;  3UGB B;  3TJP A;  5J18 A;  4PS7 A;  1LXD A;  3ECI A;  4MEM A;  4NNJ B;  3DVN U;  3PHW B;  1KOT A;  3ZUN A;  4MGI E;  2KC2 A;  1J8C A;  2R2Q A;  3ML9 A;  2NR2 A;  3T9L A;  1YD8 U;  3X23 A;  2KFK A;  3L16 A;  2N4F A;  4BVU C;  1X1M A;  2O2V B;  2K6D B;  2J0J A;  3UIN B;  1GC6 A;  2MBH A;  1S1Q B;  2ZNV B;  3WAN A;  3QX1 A;  3RUI B;  2PPH A;  2G3Q B;  2DZI A;  1L7Y A;  3IFW B;  2IY0 B;  2JZZ A;  2Z0E B;  4JL9 A;  4CO7 A;  2KAN A;  2L05 A;  4AJW A;  1TZ1 A;  3ZNZ B;  5J2R A;  3Q3F A;  3QK0 A;  4HCN B;  3BY4 B;  1WJ6 A;  3V6C B;  5EDS A;  2LUE A;  2DYB A;  2JRH A;  4KZ0 A;  4W9I A;  4RM8 A;  3VH4 B;  4DBG A;  2D07 B;  3A9K A;  4W9D A;  3TBL D;  4AWJ A;  2CHW A;  2IBI B;  3MTN B;  2CS4 A;  2K8B A;  4II3 B;  2K8C A;  5LLI A;  1YQB A;  1WFY A;  1I42 A;  2PE6 B;  2L8J A;  1V6E A;  3TCA A;  3WAL A;  2AYO B;  1WXA A;  1WGG A;  2K25 A;  2KX3 A;  4GDK B;  3ZNI D;  4BOS C;  2XK5 A;  4YL8 A;  3JVZ X;  3ZDT A;  5D94 A;  1IPG A;  4LDT D;  2KJH B;  4M0W B;  4ANV A;  2LXC A;  2Z0D B;  3QWZ B;  3T8M A;  1EF5 A;  5JHA A;  1V49 A;  1UD7 A;  4PYU A;  3ZNG C;  3K9P B;  1AAR A;  2R2O A;  4E74 A;  5HKH A;  2RR9 A;  4HDQ A;  3H9D A;  4IG7 B;  4DHJ D;  4TKN A;  4BBN C;  1F9J A;  3HM6 X;  2AL3 A;  2LJ5 A;  4AUQ C;  4URK A;  1KJT A;  2NPT A;  2IO1 B;  1UZX B;  1D3Z A;  4IC7 B;  2FCM A;  3SDL C;  3QJZ A;  4FN2 A;  3HHM A;  2KTR B;  4BBN F;  3KUZ A;  1H8C A;  1WI0 A;  3QHT A;  4K1R B;  4A20 A;  3RYT A;  2DAJ A;  1G6J A;  3VTV A;  3U30 A;  4KSL C;  2LRW A;  4BOZ B;  4EUT A;  4XZ4 A;  1J19 A;  2HE7 A;  3OLM D;  3D32 A;  2MBO A;  4DWF A;  1OEY A;  1WJ4 A;  1NBF C;  2MBB B;  4I6N B;  1JRU A;  1OGW A;  3A1Q B;  2N1V A;  2EMT A;  3BIN A;  3IG3 A;  5G2N A;  1WMH A;  3V60 A;  4K7S A;  2C7H A;  3OJ4 B;  1ISN A;  2DX5 B;  4K7W A;  2QHO A;  3H1U A;  3TIX A;  2M1M A;  1LFD A;  2L0T A;  3N3K B;  3R7R A;  3EC8 A;  4WJQ A;  4FUL A;  4GB9 A;  3HM3 A;  1TBE A;  3ML8 A;  3MJW A;  1WGY A;  5C1Z A;  4FLH A;  1FXT B;  1NI2 A;  2KK8 A;  4ANU A;  3IBE A;  3UF8 A;  4HPM B;  4NPN A;  2ZCC A;  2PEA A;  2V3S A;  3S2A A;  2JVC A;  1WM2 A;  2RSU A;  1IP9 A;  4GDL B;  4EKU A;  3H7S A;  5E6N A;  3NS8 A;  3W1S C;  2WYQ A;  4GGQ A;  2MWS B;  1V2Y A;  3GZN I;  3QAQ A;  2GOW A;  1UEL A;  2LVP A;  2IZV B;  4DHJ B;  2MX2 A;  4IW0 A;  4K7U A;  3QCA A;  4WJP A;  3ZLZ A;  2BGF A;  1R4N I;  4HJK A;  2V4L A;  4MGY E;  4EZL A;  4JIO U;  2BWF A;  2ZVN A;  3IVF A;  2LZ6 A;  3A4R A;  3APC A;  2FIF A;  3RT3 B;  4GDL A;  5J17 A;  4LCD E;  2XBB C;  4X57 B;  2ZNV C;  1L2N A;  2LGY A;  2OOB B;  3DVN V;  4ZYN A;  4DDI D;  4XX5 A;  4BKT A;  1WE7 A;  3CMM B;  2OJR A;  3JSV A;  2JZ3 B;  2J0K A;  5GMV A;  3GOE A;  2C60 A;  2CKH B;  3M3J A;  3QA8 A;  4RM9 A;  2KFK B;  2J7Q B;  2BYV E;  4M8M A;  5CHF A;  4JGH B;  1V9J A;  4EZK A;  3AUL A;  3L0W B;  1WX8 A;  4WWN A;  2GBR A;  1SE9 A;  5JH5 C;  2NBV B;  1Q5W B;  1Z2M A;  3B1L X;  2UWQ A;  5L83 A;  1LQB A;  4HXD A;  4MSQ B;  3VVW B;  1V5O A;  1Z5S B;  3OJ3 A;  2KD0 A;  1YX6 B;  2WX0 A;  2BYE A;  4MEL A;  2K39 A;  2KTF A;  1RFA A;  2KHW B;  2NS5 A;  2ZPY A;  5CHV C;  2KJR A;  4GOC A;  3A9K B;  5C23 A;  4HVB A;  2WX1 A;  2GBN A;  1E7U A;  1ZW7 A;  4OVU A;  4ZRJ A;  2KN5 A;  4GIV A;  4TUU A;  1WXV A;  4MDK E;  2I1J A;  2G4S A;  2XK5 B;  1ZKH A;  3DBH I;  3EHV A;  1E7V A;  1SIF A;  5IA7 A;  4ANW A;  4WWO A;  4W9J A;  4F1S A;  3MHS D;  2Y5B B;  3QQ8 B;  1WGD A;  4IM3 A;  4ZDV A;  1VCB A;  2KC1 A;  4II2 B;  3ZRC A;  4G11 A;  2L0F A;  1Q0W B;  1WY8 A;  1WX9 A;  2MCN B;  4F8C B;  1PQS A;  3ZO5 B;  2REX A;  2KFJ A;  2MSE D;  4AJY B;  3W1Y A;  3DBL I;  2LWP A;  2NPT B;  3R3M A;  3WIM A;  2BYF A;  2O6V A;  4F7Z A;  3Q3J A;  3KH0 A;  2KLG A;  4B6W A;  2JT4 B;  2LXA A;  1V80 A;  2M4N A;  3EEC A;  4EZJ A;  1SGH A;  2DEN B;  2KWC A;  1UGM A;  2GBJ A;  3DBS A;  4HWI B;  3KYC D;  4FJV B;  4HCP B;  4FA6 A;  2CU1 A;  2FCQ A;  3CST A;  1WMH B;  5E6O A;  3DQV A;  3L17 A;  4NQK E;  4AP4 C;  2KJ6 A;  4W9K A;  1CMX B;  5JHB A;  3UIP B;  1A5R A;  2MA9 B;  4P7I A;  3U8Z A;  3ZTC A;  3KW5 B;  3PLU A;  4ANX A;  3RUL A;  4TQ1 A;  2G45 B;  3DDC B;  1VD2 A;  3PRM B;  2N9E B;  4KDL B;  3ZKJ C;  2HTH A;  1GUA B;  2N7E A;  1WIA A;  3M95 A;  1EO6 A;  3ONS A;  2B3A A;  3R66 C;  4WAA A;  4IWQ A;  3VUW A;  1P98 A;  3L08 A;  4FHK A;  5DPW A;  4MGK E;  2KZR A;  1P9D U;  2N1W A;  3U7D A;  2D2Q A;  2MP2 A;  3O65 B;  3V61 A;  4AOF A;  3VFK A;  2CR5 A;  2ZVO A;  2HJ8 A;  2IO3 B;  2DYO A;  1QZE A;  5CTR C;  2MBQ A;  2MLB A;  4IWP A;  2IO2 B;  2ZPN A;  2LRU A;  5D6J B;  1E8X A;  4GU2 A;  2DAF A;  2DHZ A;  5DPR A;  4EOY A;  4DDG D;  4E71 A;  2BWE S;  1YIW A;  3VXW A;  3UIO B;  4LDT B;  5KHO A;  3DCG A;  3C0R B;  4ICV A;  3H7P A;  4GSW A;  2ZJD A;  2C9W B;  3WAO A;  3RZF A;  3AXC A;  1WXS A;  2ZEQ A;  4EEW A;  4EFO A;  3NZS A;  2IO0 B;  2KDF B;  2M0X A;  4PS3 A;  4KVG B;  2BPS A;  3JSV B;  2KMA A;  2UYZ B;  2LVQ A;  3KYD D;  3NHE B;  4KV2 A;  2L00 B;  5FR6 A;  1WX7 A;  4RMA A;  4IUM B;  2O6V D;  4TQ0 A;  2IYD B;  4G50 A;  3K9O B;  2I1K A;  3LDZ E;  4MJS A;  3TL5 A;  2KXJ A;  5LXH A;  3VDZ A;  3OAW A;  2JF5 A;  2L7R A;  3HK0 A;  4GMV A;  4BKS A;  4KIK B;  2LD9 A;  1E8Z A;  3ZVV A;  2M8S A;  3CF6 E;  3KUD B;  4FAD A;  4NAW A;  4W9L A;  2HD5 B;  1GG3 A;  2ZZP B;  2KLC A;  1WGR A;  2M17 A;  3B08 A;  3LJ3 A;  1XQQ A;  1XD3 B;  3V62 A;  4CYE A;  3NZU A;  1J0G A;  4KDI C;  3PRE A;  2FUH B;  1Y8R C;  3M63 B;  4JQW C;  3KVF B;  2N9X A;  5CHW A;  2LAS A;  4FJZ A;  5AZH A;  2C5L C;  5AEK B;  4KIK A;  5DPT A;  1ZGU B;  2PJH A;  3SHQ A;  3I3T B;  1T0Y A;  2BF8 B;  3ENE A;  3A4S C;  2K1F A;  3QAR A;  1WGH A;  2D10 A;  2DZK A;  4GXB A;  3M62 B;  2MQJ A;  4MH0 E;  3ALB A;  4DHZ B;  3VHT C;  5D7G A;  2KKC A;  1S3S G;  4J6I A;  4KSK C;  2WWZ A;  3QIJ A;  5AZG A;  3WA0 A;  1I35 A;  1HE8 A;  4W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...