3KUDB

Complex of ras-gdp with rafrbd(a85k)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
76
structure length
76
Chain Sequence
b'NTIRVFLPNKQRTVVNVRNGMSLHDCLMKKLKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title What makes Ras an efficient molecular switch: a computational, biophysical, and structural study of Ras-GDP interactions with mutants of Raf.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gtp binding protein/transferase
total genus 12
structure length 76
sequence length 76
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02196 RBD Raf-like Ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kudB00
4NQKE 1Z2MA 1YJ1A 2M1MA 1RFAA 3L08A 5FR6A 5HKHA 3KUZA 3PPAA 2NVUI 3QARA 3UIOB 2LXCA 5LLIA 4HWIB 1WJ4A 5L83A 1V80A 2PJHA 2KTRA 2HD5B 3QIJA 3DQVA 2JVCA 4I6LB 3H7SA 1J8CA 1TBEA 4E74A 4KSLC 1WGYA 3TCAA 4TQ1A 5CTRC 1E7UA 1OGWA 3OAWA 5D7GA 4WJPA 2K6DB 4AJYB 2R2OA 2JZ3B 2L00B 3DBLI 2ZNVB 1RAXA 3DCGA 2A5UA 2N7EA 3ECIA 4A20A 4HK2A 3A4RA 3TBLD 2PPHA 3O65B 2KTRB 2CHWA 1CMXB 2V4LA 2D10A 1KLVA 1XD3B 4IWPA 4BBNF 4NNJB 3EC8A 4PYUA 3DVNU 4NJ7A 1F9JA 1VCBA 2O6VD 3ZDMC 4JIOU 4ANWA 4KDLB 2GBNA 3ML9A 1E8WA 1WR1A 3K9PB 4ANXA 1V81A 4WJNA 4MELA 3QC8B 4MJSA 4X57B 4ZDVA 3MJWA 1E8XA 2KXJA 4LJPB 1WY8A 1NBFC 2AL3A 2MWSB 4ICUA 3VUXA 1PQSA 4NPNA 2D2QA 2ZPNA 3MHSD 4W9DA 3X23A 3VQIA 2J7QB 4B9KA 2GOWA 5AZHA 2M17A 3VUYA 1YQBA 4DBGA 3QK0A 4FULA 1Q1OA 1R4NI 1M94A 1EO6A 2NCNA 4MEMA 4MJSB 1I42A 2R2QA 2N1WA 5AZFA 2GMIC 4PS8A 2ZEQA 4AUQC 2XK5A 1EUVB 5C1ZA 3NOBA 4TQ0A 1YX6B 3KUDB 2K6QA 5LXIB 1P9DU 5D2MB 1R4MI 3ZNGC 4CHKA 4W9JA 4TUUA 1H8CA 1AARA 4MDKE 3SU8X 3BINA 2M4NA 2KNBA 1OQYA 3B08A 5JHBA 2YVCA 2AYOB 4WQOB 3W1SC 4EOYA 5J17A 2EMTA 2XK5B 3H1UA 4EZJA 2Z0EB 4ASWC 1WR6E 1U4AA 3U7DA 4KDIC 3RZWC 2BYVE 1P1AA 1V6EA 2KJHB 2LASA 2YLMA 2B3AA 4JL9A 2WYQA 2LD9A 3B1LX 1WF9A 1WE7A 2I1JA 2N9PC 3DVGY 5E6OA 3DPDA 4ZRKA 5GMVA 3OJ4B 1S1QB 2KQSA 4DWFA 4FHKA 2NR2A 2OOBB 1WZ0A 2BWFA 3PRZA 1E5WA 2BGFA 2MBOA 2NBWB 1A5RA 4K7UA 2LVOA 4G0NB 2GBKA 3AU5A 2DYMA 3S2AA 4RMAA 4AWJA 2LVQA 4OVUA 2CR5A 4RM8A 1P98A 3N30A 3JYUA 3GZNI 3LJ3A 1WXVA 2K25A 4HPMB 3APFA 2DZJA 3QX1A 3JSVA 2IBIB 1OTRB 1UH6A 4WWPA 2KZRA 4YL8A 3DVNV 3PRMB 4BOSC 2C60A 3VXWA 2D3GA 2QHOA 1TTNA 2ZVNA 4EFOA 4K1RB 5DPSA 1G6JA 2GBJA 2FIDA 1UBIA 2MBBB 3PVLA 2N7DA 3JSVB 4RM9A 4B95A 1WJ6A 5CHWA 2DYBA 3ZNZB 1T0YA 1UZXB 2FUHB 2K8HA 4HDOA 3WANA 2NBUA 4GXBA 4F7ZA 4AP4C 3QJZA 3UQAA 2V3SA 3H9DA 3LDZE 3RT3B 1UD7A 1L7YA 4ZRJA 2MBHA 3PTFC 3BY4B 1VD2A 1LFDA 4II3B 4GU2A 3V61A 1C1YB 2FAZA 2FCSA 2PEAA 4M8MA 1SGHA 4NQLB 2MW5A 4NJ6A 4M0WB 4JLCA 1WXAA 2OJRA 3L0WB 4LJOB 2NBVB 2LGXA 3IFWB 1J19A 1V2YA 3QCAA 3L13A 4B6WA 1WGHA 2O2VA 1V49A 5EDSA 2CS4A 1OEYJ 2Z59B 1V86A 4W9KA 3R7QA 4EZKA 2FCQA 3HHMA 2MBQA 2LRWA 2BF8B 2KX0A 3DBHI 2DZIA 3CSTA 2MBEA 2LI5A 5JZEB 4GMVA 4BKSA 4W9GA 2ZJDA 2JRIB 4K81A 1WJUA 3A9KA 3WALA 5KHOA 2N9EB 2JWZA 2O2VB 1QZEA 4WJQA 1XT9B 5E6PA 2UYZB 3JW0X 3M63B 5BO4B 4MSQB 1LQBA 1GNUA 1EF5A 1UGMA 1GUAB 4J6IA 2KDIA 1ZKHA 2KD0A 2J0MA 2K8CA 1S3SG 3A9KB 2G4DB 4DK5A 4F1SA 3PGEA 4TKNA 4URKA 2KDBA 2K39A 2KC2A 4W9EA 4I6PA 2LXAA 1WGGA 4CO7A 4K7SA 5CHVC 3SDLC 4MGYE 3JVZX 4IG7B 3KYDD 4I6NB 2IY0B 5DPRA 2WX1A 3T8MA 3ZLZA 5AZGA 2BKFA 1IP9A 1UELA 1V9JA 3EHVA 4A3PA 3PHXB 4WWNA 2JPHA 4W9CA 2G4SA 1E7VA 2C5LC 3ZNID 4W9HA 2LGYA 4DHZB 2KWUB 4KIKA 3ONSA 3NZSA 4GB9A 2KLCA 2KFKA 5E6NA 1IPGA 3PS6A 2DENB 4MGIE 2ZNVC 3CSFA 3DDCB 2MSED 3NZUA 4IW0A 2CHXA 3M62B 3WAOA 2IYDB 2CU1A 2IO1B 2DZKA 2BPSA 4G3XB 1JRUA 1WMHA 2DX5B 2MP2A 1UBQA 2O6VA 4BFRA 3AU4A 3OLMD 3PLVA 4ZYNA 4KIKB 1WXSA 2ZZPB 2IY1B 2KFKB 2AL6A 3IHPC 2IO2B 2KMAA 4N9F4 3V62A 5D6JB 2FCNA 4GDLA 1IYFA 4HXDA 4KVGB 1FXTB 3RCZA 4LDTB 2G45B 3VAWA 1K8RB 1WMHB 2MP2B 2CKHB 3PREA 1WM3A 1MG8A 2DZMA 2MLBA 4BOZB 5C23A 4GN1A 2KDFB 4EUTA 1HE8A 2KQ7A 2LGDA 2L76A 4GOCA 3UIPB 1GG3A 3B0AA 2L3ZA 4XZ4A 4HJKA 4ICVA 1YX5B 4WAAA 2ZCCA 1SE9A 2MRPA 3PT2B 3ML8A 2KJ6A 3VTVA 4W9FA 4GDLB 1GC7A 3KYCD 3ZRFA 3L17A 2C9WB 3AULA 4FLHA 4BKTA 3UINB 1V5OA 2CHZA 3HM6X 3KW5B 4DXAB 3AXCA 2KFJA 4PYZA 2J0JA 3PRPB 2C7MB 1OEYA 2HE7A 2RGFA 3DBSA 3APCA 3VDZA 3VUWA 3ZUNA 2KANA 3A9JA 4MM3A 3HM3A 2MQJA 2UWQA 4BKSD 5J2RA 2LJ5A 2BWES 4DHJB 4JGHB 2XEWA 4K7WA 5TR5A 3K9OB 1YIWA 3P2BA 4WWOA 3M3JA 5G55A 4AJWA 4HVBA 1WGRA 1WM2A 4FHJA 4M8NA 3W1YA 1Q5WB 2AEHA 3U30A 3ZDTA 3VTUA 4JQWC 4E71A 5JH5C 3A9JB 1BT0A 1TGZB 3PLUA 3R7RA 2LWPA 3W1SA 3V6EB 3ENEA 3RULA 1GC6A 3KVFB 3UQBA 3NS8A 1TZ1A 2LUEA 2WX0A 5CHFA 2KN5A 3SD5A 1E90A 1P0RA 1NI2A 1RRBA 4KSKC 3RZFA 3RD2A 2KDEB 4II2B 2WWZA 2N1VA 4DHZE 2Z0DB 1NDDA 2I1KA 2JRHA 2KX3A 2MX2A 2LRUA 1ZW7A 2DHZA 3AI5A 2WDTB 3IG3A 4HPLB 2GBRA 2W9NA 3A4SC 3ZNHB 2FIFA 2HJ8A 2KOXA 3QA8A 3TJPA 2D11A 5DPTA 2KWVB 3X0WA 1LXDA 3R66C 3T9LA 3D32A 2RR9A 3HIZA 4EZLA 5IAAC 2L7RA 1WI0A 2LZ6A 2M8SA 3R3MA 4FJZA 2KMCA 4XX5A 3OJ3A 4LDTD 5D94A 4TV3A 4ANUA 3MTNB 3VHTC 2RD0A 4FN2A 3V6CB 1X1MA 5IA7A 4HDQA 5L95C 3PZDA 2L0TA 1E8ZA 2JZZA 2L05A 4G11A 4KV2A 4HLEA 4MSMB 5DPWA 2L0FA 2G3QB 1Q0WB 5KHQA 5J18A 2N9XA 3WAPA 3N32A 3PHWB 3M95A 3VFKA 2NPTA 2V1YA 1WE6A 2GBMA 3NHEB 3N3KB 2AWTA 2KK8A 3DBRI 1I35A 1WX7A 2MA9B 3Q3JA 3APDA 3L10B 2FCMA 4DDGD 4ZRIA 4IWOA 2JT4B 1WX8A 3KH0A 5G2NA 3U8ZA 2PE6B 3ZO5B 4G50A 1KM7A 3VVWB 2JF5A 4DHJD 4E3CA 4KZCA 2KC1A 1WJNA 1WRDB 4BKGA 1E8YA 2JY6A 3H6NA 4W9IA 2BYFA 2NPTB 3SHQA 3A33B 2DAJA 4IM3A 1XQQA 2N4FA 2IO3B 1L2NA 2PE9A 3DOWA 1RLFA 2KLGA 3V60A 2DAFA 3UF8A 2IO0B 3ZVVA 3WIMA 4GIVA 3ZKJC 3IBEA 3TIXA 2JUOA 4DDID 2REXA 4NY0A 2J0KA 4MH0E 2KWCA 3ZTDA 2JXXA 1WXMA 2XBBC 4AOFA 3DVGX 4GSWA 4IWQA 2KHWB 4GGQA 3CF6E 5LXHA 4IM2A 4EEWA 2VRRB 2HTHA 2KVRA 3EECA 4PS3A 2O6VB 3TL5A 1KJTA 4GDKA 2A4ZA 2ZVOA 3QQ8B 1SIFA 4NAWA 1H4RA 2C7HA 4MGZE 4FBJB 3WAMA 1Z5SB 3EFUA 3QHTA 3QWZB 1Y8RC 3QAQA 2EKEC 4FJYA 4F8CB 1ZGUB 4PS7A 4WJOA 4HCNB 5AEKB 3TMPB 3VH3B 2ASQA 3PSEB 2KKCA 3L54A 2C7NB 4LCDE 2K1FA 1J0GA 1WIAA 2EMSA 3ZW3A 4IUMB 4FJVB 1WZ3A 4GDKB 1P3QU 3Q3FA 4EKUA 3VH4B 3I3TB 3NY5A 1C3TA 3H7PA 1WGDA 4NAWB 4W9LA 2FNJB 1YD8U 2MCNB 4OVVA 1KOTA 3ZRCA 3A1QA 3PV1A 3L16A 2BKRB 2L8JA 4A3OA 1LM8B 1GJZA 3RUIB 1ISNA 4MGKE 2M0XA 4FADA 2ZCBA 2NS5A 2RPQA 4HCPB 4ANVA 5JHAA 3ZTCA 1WH3A 2KTFA 2DYOA 4IM0A 2BYEA 4P7IA 3GOEA 2KO3A 2Y5BB 5DCNA 3KUCB 2K8BA 3RYTA 4FA6A 3H7PB 1V5TA 2RSUA 4BVUC 1WYWB 2IZVB 3HK0A 3ZIMA 3A1QB 3C0RB 4XC2A 3WA0A 4KZ0A 5CX3A 3IVFA 3VTWA 2KJRA 1WX9A 3CMMB 4CYEA 1WFYA 1D3ZA 1EF1A 2D07B 2LVPA 3ALBA 4BBNC 4IC7B 2ZPYA 3UGBB
chains in the Genus database with same CATH superfamily
3L08A 1F77A 5MPOA 2WQYB 4L1BA 3KUZA 3QARA 2NVUI 2LXCA 2AX5A 4ARIA 2PJHA 2KTRA 2Y5CA 4RGOS 4KSLC 3TCAA 1E7UA 2FBWB 3IT4B 4QAYA 2A5UA 2N7EA 4A20A 2PPHA 1CMXB 2D10A 4BBNF 4NJ7A 1F9JA 1VCBA 2O6VD 4JIOU 1WR1A 1QQRA 2E6XA 2NMQA 4WJNA 3V3XA 3QC8B 4ZDVA 3VUXA 4ICUA 2J52A 4BAXA 2ZPNA 3B2FA 3VQIA 1N5XA 2J7QB 4B9KA 4DBGA 4FULA 2WXLA 4MJSB 1I42A 5AZFA 2L52A 2XK5A 4TQ0A 1R4MI 4RH6A 4W9JA 1AARA 3SU8X 4N58A 2KNBA 1OQYA 3ZJTA 1FMAD 5JHBA 3W1SC 2JZPA 1WR6E 2SAKA 3O13A 3BWUD 2BYVE 3L4PA 1FNVA 2KJHB 2LASA 5GMVA 3DPDA 4P6VF 3OJ4B 1HTOA 1KF6B 2UU7A 2KWDA 2NR2A 4FHKA 2LMCA 4H2AA 3PRZA 1SE2A 5BYRA 4RF0A 2IJ0A 4RGTA 4AWJA 4B0EA 4JWSC 4OVUA 2FUG1 3JYUA 1C9FA 1RM6C 2KQ4X 1UH6A 3H8HA 1WWTA 3DHHC 3DVNV 3VXWA 1TTNA 1D5MC 2ZW1A 5DPSA 2MBBB 2N7DA 3JSVB 1XCTL 4RM9A 4B95A 1BMLC 5CHWA 2DYBA 3ZNZB 3IT6B 1UZXB 3NUHB 4HROA 4MACA 2NBUA 2WXKA 3UQAA 5IP4D 3H9DA 1RFKA 1SSNA 4ZHOA 2K22A 2OEDA 3BY4B 1C1YB 4M8MA 3R2IA 4NJ6A 4JLCA 1WXAA 3KLSX 2QJLA 1K50A 2LGXA 2KVZA 1YJIA 3L13A 4BZAA 4JWUC 4K3CA 3R7QA 2FCQA 2BF8B 2KX0A 3DBHI 2DZIA 2MBEA 3Q8CA 2ZJDA 2JRIB 3NVWA 3ETRA 3WALA 2O2VB 3NJTA 4ZYSA 5AUKA 5HI1A 5BO4B 2PW9A 1GNUA 1JWMD 2K8CA 4URKA 4F1SA 2K39A 3NVVA 2KC2A 1XXGA 4AQ7A 1WGGA 4K7SA 1KRHA 3TEXA 3AEAB 3RNFC 1E6EB 3BK2A 5DPRA 2CJOA 3ZLZA 1IP9A 1K52A 4A3PA 2DWQA 4OZCA 2G4SA 2C5LC 3ZNID 4DHZB 3AH7A 1VZ8A 4KIKA 2PVGC 3AMZA 3ONSA 3NZSA 2ZNVC 2MSED 1TYGB 3WAOA 3M62B 1PYWD 4P1BC 1WMHA 2ON8A 4BFRA 3PLVA 3NZ3A 2QEJC 2KFKB 5HFYA 2IO2B 2KMAA 2MJEA 3V62A 4ZOHC 1XO3A 1IBXB 1IYFA 4HXDA 4RGNA 2G45B 3PREA 2MP2B 2CKHB 1WM3A 1MG8A 5C23A 2BW2A 2N9LA 3PZ8A 1OQRA 3AEDB 4ICVA 2ZCCA 2KN4A 1GC7A 4OVZA 3AULA 2WGSA 3HM6X 3KW5B 1I4GA 2D5GA 2C7MB 3RNEC 2RGFA 1XLOA 3HM3A 4NJCA 4BKSD 3DHIC 4JGHB 3K9OB 1YIWA 1WM2A 2KT7A 1V1PB 1Q5WB 3Q3MC 3ZDTA 4E71A 4JQWC 3A9JB 4MM3B 1N63A 3PLUA 2QILA 5BMGA 3I57A 3UQBA 3AEGB 5H8YE 3T3NA 1KLUD 4HRSA 3BIID 1C76A 2N1VA 2I1KA 2JRHA 2LRUA 3MC0B 2DHZA 2WDTB 5EE9A 3IG3A 3BVGA 3A4SC 2W9NA 2FIFA 2HJ8A 3QA8A 3TJPA 2D11A 1LXDA 3D32A 4KGSA 1CK1A 4US8A 4XX5A 1T0RC 4LDTD 4ANUA 3J9CA 2ONQA 3VHTC 2N0SB 4FN2A 1QKZA 5IA7A 4HDQA 2JZZA 4KV2A 2L0FA 3R2TA 2BBCA 2QIEB 2AQ2B 2VZKB 2BS2B 1SEBD 3RNAC 1WE6A 3NHEB 3Q3JA 2MA9B 1HZ5A 4ZRIA 1ZXIA 4A90A 2JF5A 1V8CA 1NVID 4RFBA 3MC8A 1E8YA 2JY6A 3SHQA 4RGMA 3A33B 3ZXVA 4IM3A 2M19A 2W54A 5BYSA 2WXPA 2KLGA 3Q69A 1C78A 2IO0B 3UF8A 3WIMA 3NS1A 3ZKJC 1I4HA 2HTME 3IBEA 4D2KA 2J0KA 2V9HA 2XBBC 3DVGX 3RI7C 3C8YA 3EECA 2WP9B 4GDKA 2A4ZA 3HVDA 1SIFA 3E56A 1DGJA 2OJWA 1TT5B 4F8CB 4WJOA 3TMPB 3LXFA 1CZPA 4LCDE 1WIAA 2WXGA 1JQ4A 4M02A 3I3TB 4USAA 1YD8U 3ZRCA 3A1QA 1V1OA 1JROA 2BKRB 2L8JA 1GOZA 1ZXHA 4ANVA 1L5PA 1HA5A 2DYOA 4IM0A 2Y5BB 4C4VA 5DCNA 3GE3C 3KWVA 2RSUA 1WYWB 2IZVB 3Q8EA 2OHFA 3C0RB 1DOIA 4YSYB 1DYQA 4KZ0A 4DQOC 1WX9A 4XYCA 1TY2A 3ALBA 2WU2B 4HLEA 4NQKE 1YJ1A 5HKHA 2H89B 3PPAA 3UIOB 1AYFA 4WAFA 4HWIB 3ZJVA 5L83A 2GLSA 2JVCA 3H7SA 2L32A 4HJGE 2VH2A 2GI9A 4E74A 1WGYA 4XWTA 3Q8FA 2R2OA 3VRBB 1DOXA 3ECIA 2BVCA 1KLVA 4NNJB 1VR9A 1XEEA 4KDLB 3ML9A 3K9PB 1QILA 4ANXA 3ZJUA 2KXJA 3P42A 2AL3A 2MWSB 1D6EC 4NPNA 1OFFA 2BB5A 3MHSD 4ZHPA 3Q2AC 2D3CA 1FFUA 2M17A 3VUYA 1MHXA 1EO6A 1F2RI 2GMIC 1I4XA 1QT9A 2ZEQA 3RMKC 4DXGA 1EUVB 5C1ZA 1YX6B 5LXIB 4CHKA 1ZDVA 2YEPB 2MHJA 1H8CA 2K5PA 3AE9B 1M4VA 3AE1B 5D3DA 2AYOB 4CQNA 4EOYA 2WXNA 3H1UA 4EZJA 2Z0EB 2QDFA 4ASWC 3U7DA 1V6EA 2B3AA 2KYWA 4M00A 1WF9A 1YN4A 1S1QB 2KQSA 4DWFA 1IUEA 2WU5B 3UI3A 3AE6B 3ABVB 3AE4B 1EWYC 4K7UA 3BVMA 4G0NB 4UDUC 2LVQA 1PGBA 2CR5A 3LJ3A 3U2SC 4HPMB 2WNMA 1J7CA 3QX1A 2MJ3A 2IBIB 1JWSD 1ENFA 1ZP0B 2KZRA 4YL8A 3FILA 2QHOA 1FXIA 4EFOA 1V1PA 3ZGZA 4S17A 2WHIA 1WJ6A 2DNFA 2PTLA 1T0YA 1B1ZA 3WANA 4GXBA 4AP4C 1SXTA 1FM0D 3LDZE 4ITKA 3IXSA 3SFDB 4L2YA 2PEAA 1NYQA 1SGHA 1VDVA 2MW5A 4M0WB 4WIPA 3VR9B 5EDSA 2CS4A 1OEYJ 1V86A 2LRWA 4N6EB 4OW0A 3B9JA 3CSTA 2LI5A 4GMVA 3HVZA 4BKSA 4W9GA 4ARCA 5KHOA 4WJQA 1XT9B 1WGKA 2UYZB 3M63B 3R8BA 4MSQB 1UGMA 2KDIA 1I7HA 3DWMA 4JE3B 2KD0A 3A9KB 4ZRPA 1L6UA 4I6PA 2LXAA 1FNWA 3SDLC 3Q14C 3LB8C 1ZE3D 4MGYE 2WXHA 1VZ6A 1FCLA 3DBRB 1NEKB 1TY0A 3T8MA 5AZGA 2BKFA 4LTUA 3AE5B 3URYA 1YQ3B 4W9HA 2KWUB 3OG5A 4PT5A 1F52A 2WDQB 2DENB 4MGIE 2IYDB 1JRUA 1UBQA 3RN9C 1WXSA 1C4CA 1C79A 2AL6A 3AE3B 4C80A 3BYTB 1IGDA 2W55A 2X8XX 3NG0A 4KVGB 4BOZB 2DZMA 2KDFB 5BMIA 2KQ7A 2LGDA 3UIPB 1GG3A 3B0AA 2L3ZA 4HJKA 1YX5B 2LGIA 4WAAA 2MRPA 2JYEA 3ML8A 4C56C 4W9FA 4GDLB 1F0ZA 2KFJA 4PYZA 2HE7A 1ZOYB 4HKZE 2MQJA 5J2RA 2L1AA 4N59A 2LJ5A 4DHJB 2RDGA 2WDVB 1AWDA 2XEWA 4K7WA 5TR5A 4WWOA 5G55A 4AJWA 1WGRA 2AEHA 3V6EB 2BT6A 1GC6A 3MC9A 4L23A 3NS8A 1TZ1A 5CHFA 5EE3A 1E90A 1NI2A 4KGTA 2BTEA 1RWSA 2KDEB 2WWZA 3CWIA 3TEWA 4DHZE 1YN3A 1NDDA 1TZOA 2MX2A 2KX3A 3AI5A 3EUB2 1NENB 2GBRA 3ZNHB 3P4QB 1SJED 2LFIA 1JMLA 2KWVB 3AEFB 3BZDB 1N6ZA 2RR9A 3HIZA 2LZ6A 2M8SA 1HXYD 4A55A 2MH7A 3OJ3A 2K3UA 3MTNB 3V6CB 3PZDA 2L0TA 1E8ZA 1IGCA 4G11A 4P16A 3DHGC 1ET9A 2MEKA 1T0QC 3WAPA 3N32A 3PHWB 3M95A 2NPTA 2V1YA 5BMHA 1YQ4B 3N3KB 2KK8A 5FR3A 1R4MB 3AE2B 2FCMA 4DDGD 4IWOA 1SE4A 3E9SA 1N61A 5G2NA 3GB1A 1KM7A 1E7PB 3N9YC 1WJNA 4BKGA 4W9IA 1FIQA 1SE3A 1VJKA 2PE9A 2DAFA 3ZVVA 3FKYA 4DDID 3U7ZA 4MH0E 2WXOA 4AOFA 2JXXA 1T3QA 2JU6X 4XGAB 4GGQA 2LHDA 4XE0A 2FE8A 2INPE 2KVRA 1PFDA 3TL5A 2WXMA 3QQ8B 2LEKA 3AN1A 1ET6A 1H4RA 2C7HA 2HJ1A 4M01A 4MGZE 3WAMA 1D5ZC 1Z5SB 3EFUA 3U4EG 1E0ZA 1ZGUB 4MT5A 2ASQA 3L54A 2K1FA 3ZW3A 4FJVB 4EKUA 1PGXA 3H7PA 4NAWB 4W9LA 1BXTA 4YWGG 4A3OA 2M0XA 2RPQA 3W2DA 1WH3A 4KGRA 1T6BX 2BYEA 4P7IA 1SB3C 2KO3A 3P63A 3KUCB 3ZIMA 3IVFA 3VTWA 2KJRA 2LVPA 1VZ7A 1FD6A 4IC7B 1TKEA 3PZ7A 3UGBB 1Z2MA 2M1MA 1MHHE 5FR6A 4OZAA 5HG2A 5LLIA 1CJEA 1WJ4A 1WYGA 2YEPF 4I6LB 2G1EA 1JCKB 1T0SC 5D7GA 2K6DB 4AJYB 2I2YA 1JWAD 3DBLI 2ZNVB 3NRZA 1RAXA 3DCGA 4LK0M 3DBHB 3AE8B 5H92C 3TBLD 2KTRB 2RDBC 2CHWA 2V4LA 3TEZA 1I4RA 3EC8A 4C7ZA 3W5UB 2KAJA 2GBNA 1E8WA 1V81A 4X57B 4MELA 4MJSA 2JX5A 4KKJA 1P7FA 1TS2A 3W5VB 1PQSA 2D2QA 1E10A 4W9DA 2GOWA 5AZHA 1VRAB 1NYRA 1R4NI 1M94A 4MEMA 2N1WA 4PS8A 4AUQC 3RNGC 3KUDB 1P9DU 5D2MB 2EKIA 4K3BA 4LLGM 3BINA 1TIFA 3IAM1 5J17A 2XK5B 1UGJA 2RMMA 1U4AA 4KDIC 1UNSA 2IPKD 1TS5A 3I5JC 2LD9A 3B1LX 2KDMA 1WE7A 5E6OA 5TSSA 3RNBC 3ZYYX 4B0MA 3TUOA 2OOBB 1FEHA 2BWFA 1E5WA 2CU3A 2BGFA 1KH0A 1MVKA 3SEBA 2NBWB 3C19A 2LVOA 2NTTA 2GBKA 3AU5A 2DYMA 4RMAA 2XN9C 1P98A 3U52E 2DBYA 2IDYA 3APFA 3JSVA 1UF0A 5D3IB 2B76B 2C60A 3Q6BA 2ZVNA 4K1RB 1R7SA 2FIDA 1UBIA 1VLBA 4HKQA 1TKYA 4R3DA 2GRIA 3I63C 1PDXA 3RFZB 2J4XA 2FUHB 2K8HA 4JPSA 4HDOA 1XLNA 1SF0A 3QJZA 1JALA 2V3SA 1FCCC 2BB6A 4TSSA 1UD7A 1EU4A 1L7YA 1N60A 3N1ZC 1LFDA 3AEEB 3V61A 2FAZA 2FCSA 4NQLB 3L0WB 4LJOB 2NBVB 5GXGB 3IFWB 1L4ZB 1V2YA 4OHJA 2IGDA 1WGHA 2O2VA 1GB1A 3HHMA 1KFYB 2J42A 1WJUA 2WXRA 3HUIA 1MPEA 2N9EB 1QZEA 3AB5A 2M0AA 1LQBA 1N62A 4J6IA 5G5HA 3P1MA 3SR6A 2J0MA 4DK5A 3PGEA 5I4DA 4DXFA 1MJDA 4CO7A 1P7EA 1YJJA 4IG7B 3KYDD 4I6NB 2IY0B 2WX1A 3B2GA 1C4PA 1UELA 1RYJA 3PHXB 5IKCM 2IGHA 4W9CA 2WXFA 3SFEB 1FRDA 3V05A 2LGYA 1AW7A 2BS3B 2J53A 4GB9A 4J3OD 2KLCA 2KFKA 2V0GA 1IPGA 4YXDB 3NZUA 1IBXA 4IW0A 1FO4A 1YN5A 2CU1A 3OWEB 2IO1B 2DZKA 2BPSA 4ACFA 2MP2A 3AU4A 3I9V1 3OLMD 4KIKB 4N9F4 2IY1B 1FFVA 4S0RA 3FC4A 2FCNA 1PUTA 1WMHB 4RNAA 2MLBA 4GN1A 4EUTA 1HE8A 4GOCA 3P4SB 3PT2B 1SE9A 2X38A 3MHZA 3KYCD 3L17A 2C9WB 4BKTA 1STEA 1V5OA 2CHZA 3MFGA 1OEYA 5IOIA 3ZUNA 1N5WA 2KANA 3A9JA 4MM3A 1JW9D 5AUIA 3M3JA 3TEYA 4HVBA 4WH4A 2V3NA 5JH5C 1F1HA 3VTUA 2RPVA 1C77A 1BT0A 2LWPA 4OZBA 3ENEA 3AEBB 3KVFB 2NTSA 2LUEA 4TMAB 3SD5A 1P0RA 4KSKC 1HQRD 2Z0DB 4LNFA 1HTQA 3ZQ4A 5FKAC 1ZW7A 3GE8C 4AS1A 4HPLB 3WCQA 2JSVX 2BS4B 5DPTA 3X0WA 3R66C 1QOBA 4EZLA 3VR8B 2L7RA 3R3MA 4FJZA 1QLBB 5D94A 4TV3A 4P1CC 3AV8A 4PK1A 5L95C 3P4RB 3CIRB 4MSMB 5DPWA 5KHQA 2D3BA 5J18A 2N9XA 2W3RA 2TSSA 2AWTA 1I35A 1WX7A 2LHEA 3APDA 4WURA 1WRIA 2JT4B 3KH0A 2PE6B 3ZO5B 4DHJD 4E3CA 3H6NA 1LO5D 1L4DB 1XQQA 2N4FA 2IO3B 3DOWA 1RLFA 3V60A 4C00A 3IAS1 3GS2A 5EE1A 2REXA 4NY0A 2KWCA 4IWQA 4IM2A 4EEWA 2VRRB 4PS3A 2O6VB 1K53A 3GP7A 4FBJB 3N1XC 1I4QA 4YTPB 3QHTA 3QAQA 4PS7A 2KMMA 4HCNB 1A70A 1JWUD 4XDCA 2QCZA 1J0GA 2EMSA 5G5GA 4IUMB 2QC8A 1Q10A 4FXCA 4GDKB 3Q3FA 4Q2JA 3VH4B 3NY5A 2MCNB 4WQMA 3L16A 2LJIA 1LM8B 2INDC 3RUIB 1ISNA 4MGKE 3MP9A 4FADA 4YSZB 2NS5A 4HCPB 3ZTCA 1ZDXA 3GOEA 3RYTA 2K8BA 4BVUC 1J7BA 1EWCA 2LUMA 3A1QB 3WA0A 3CMMB 2SEBD 3EGRA 4BBNC 2V4IB 1QOAA 1RFAA 4C4VB 1I4PA 4YTNB 1V80A 3QIJA 2HD5B 3DQVA 1J8CA 1TBEA 1FPYA 4KX6B 4TQ1A 5CTRC 1OGWA 3OAWA 4WJPA 2JZ3B 2L00B 1LGRA 2Y5PA 4HK2A 3A4RA 3O65B 2RDHA 1D5XC 1XD3B 4IWPA 4PYUA 3DVNU 3ZDMC 4ANWA 1SBBB 1QOGA 1ROEA 3MJWA 1E8XA 4LJPB 1WY8A 1NBFC 1QF6A 2G9HD 3X23A 2CJNA 1YQBA 3QK0A 1Q1OA 2NCNA 1FXAA 2R2QA 3NVYA 4REZA 1JRPA 2WXQA 3NOBA 5IO9A 1V97A 2K6QA 2Y3AA 1SJHD 4MH8A 4A8XC 3ZNGC 5LNK1 1MI0A 4TUUA 4MDKE 3T3OA 2M4NA 2I38A 3B08A 2YVCA 4WQOB 2EMTA 2JQRB 2K0PA 3RZWC 1BUIC 1KLGD 1P1AA 2YLMA 4JL9A 2WYQA 2I1JA 2N9PC 3DVGY 4ZRKA 1GB4A 2PVOD 1WZ0A 2MBOA 1A5RA 2H88B 3S2AA 4RM8A 1UWMA 3Q3OC 3N30A 1SIJA 4IOIE 3GZNI 1WXVA 2K25A 5FK9C 2DZJA 2PMVA 2DLBA 1OTRB 1GPXA 4WWPA 2L83A 5E6JA 3PRMB 3VRAB 4BOSC 1KTKA 2D3GA 2GB1A 1ACCA 4YT0B 2IGGA 1G6JA 2GBJA 3N1YC 1TKGA 2N7JA 3PVLA 2VZKD 1HZ6A 4YSXB 4M0WA 1FRRA 2HDEA 3FILB 4F7ZA 2INCC 2QMTA 2LGSA 3RT3B 1QOFA 4ZRJA 2MBHA 3PTFC 5C2TB 1VD2A 4II3B 4GU2A 1Y56A 3N20C 2INNE 2OJRA 3RNCC 1J19A 3P4PB 3QCAA 4B6WA 4RCOA 1V49A 2Z59B 4W9KA 3Q3NC 4EZKA 1YNTE 2MBQA 1JWBD 2VH1A 3HRDD 2JWUA 5JZEB 2JYTA 1WXQA 1UWXA 4K81A 3A9KA 1AN8A 2XNAC 3BK1A 4LNIA 2JWZA 1D4BA 5E6PA 4HPPA 3JW0X 5BYQA 3Q8BA 1CQVA 4HEA1 3DWGC 1EF5A 5IN7A 1GUAB 4XDDA 2V3PA 3MJ5A 1ZKHA 1S3SG 2G4DB 4TKNA 2KDBA 4RF1A 4W9EA 1YMHE 3RPFC 5CHVC 2AQ3B 2W82A 2ZW0A 4LNNA 5JXVA 1ZPSA 3JVZX 1EM7A 1V9JA 3EHVA 2WLBA 4WWNA 2JPHA 4YTMB 1E7VA 3W9CB 3AM9A 4LNKA 5E6NA 3PS6A 3CSFA 3DDCB 3KQ4A 2CHXA 3Q8AA 4G3XB 2BQQA 2DX5B 2O6VA 2WDRB 4ZYNA 2ZZPB 3IHPC 3AE7B 2W3SA 1HEZE 4IKGA 1L0XB 5D6JB 1E9MA 4GDLA 2QSDA 3LYYA 2ICIA 1MG4A 1FXTB 3RCZA 4LDTB 3VAWA 1K8RB 1J7AA 2WXJA 3TSSA 2L76A 1XLQA 4ZRQA 1EU3A 4XZ4A 2KJ6A 3VTVA 3GZNB 3BYYB 2WXIA 3ZRFA 4FLHA 5HHDG 3UINB 2Z8LA 3AXCA 2AQ1B 2J0JA 3PRPB 1ESFA 1B9RA 3DBSA 3VUWA 3APCA 3VDZA 2UWQA 4A6QA 2BWES 4NZLB 2JXTA 3P2BA 4LNOA 4KKIA 4FHJA 4M8NA 4GLSC 3W1YA 4WWMA 3U30A 2ACZB 2E3TA 5C3JB 1TGZB 2EELA 3R7RA 3W1SA 1TS4A 3RULA 1T5XD 1FNUA 2WX0A 2KN5A 1RRBA 3RZFA 3RD2A 4II2B 3DBLB 1NI3A 2Q5WD 2PLPA 3PO0A 2KOXA 3NVZA 4EE2A 1GAQB 3T9LA 5IAAC 1WI0A 1TS3A 2KMCA 2PKOA 2RD0A 1X1MA 4IDIA 3FAHA 2K9XA 1K51A 2L05A 2G3QB 4NAMA 4XWWA 1Q0WB 1R4NB 2KACA 5T8IA 2R61A 3VFKA 2GBMA 3DBRI 3L10B 1PGAA 1WX8A 3U8ZA 4G50A 3VVWB 1UUPA 4KZCA 1XF5L 2KC1A 1WRDB 1XLPA 2BYFA 2NPTB 2PIAA 2DAJA 1L2NA 1L0YB 4GIVA 3TIXA 1XCQL 2JUOA 2D3AA 3ZTDA 1WXMA 4GSWA 2KHWB 3CF6E 5LXHA 2HTHA 1KJTA 3EFCA 2ZVOA 1TJEA 4NAWA 3QWZB 4US9A 1Y8RC 4FJYA 2EKEC 1L6VA 5AEKB 3VH3B 3PSEB 2KKCA 2WS3B 2C7NB 5EE0A 1WZ3A 1P3QU 1MFWA 3AECB 4C7YA 4O1NA 1C3TA 1ZUD2 1WGDA 2FNJB 3ZXRA 4OVVA 4JX1C 1KOTA 3PV1A 1F2RC 1GJZA 2BYTA 2ZCBA 3BVZA 5JHAA 2KTFA 2M56B 1YOVB 1L0VB 4FA6A 3KWLA 3H7PB 1OQQA 1V5TA 3HK0A 1C4AA 4XC2A 2N9KA 5CX3A 4A9AA 2MJDA 4CYEA 1WFYA 3EA6A 1WSPA 1D3ZA 1EF1A 2D07B 1DOYA 4DXAB 2ZPYA
chains in the Genus database with same CATH topology
4NQKE 1Z2MA 1YJ1A 2M1MA 1RFAA 3L08A 5FR6A 5HKHA 3KUZA 3PPAA 2NVUI 3QARA 3UIOB 2LXCA 5LLIA 4HWIB 1WJ4A 5L83A 1V80A 2PJHA 2KTRA 2HD5B 3QIJA 3DQVA 2JVCA 4I6LB 3H7SA 1J8CA 1TBEA 4E74A 4KSLC 1WGYA 3TCAA 4TQ1A 5CTRC 1E7UA 1OGWA 3OAWA 5D7GA 4WJPA 2K6DB 4AJYB 2R2OA 2JZ3B 2L00B 3DBLI 2ZNVB 1RAXA 3DCGA 2A5UA 2N7EA 3ECIA 4A20A 4HK2A 3A4RA 3TBLD 2PPHA 3O65B 2KTRB 2CHWA 1CMXB 2V4LA 2D10A 1KLVA 1XD3B 4IWPA 4BBNF 4NNJB 3EC8A 4PYUA 3DVNU 4NJ7A 1F9JA 1VCBA 2O6VD 3ZDMC 4JIOU 4ANWA 4KDLB 2GBNA 3ML9A 1E8WA 1WR1A 3K9PB 4ANXA 1V81A 4WJNA 4MELA 3QC8B 4MJSA 4X57B 4ZDVA 3MJWA 1E8XA 2KXJA 4LJPB 1WY8A 1NBFC 2AL3A 2MWSB 4ICUA 3VUXA 1PQSA 4NPNA 2D2QA 2ZPNA 3MHSD 4W9DA 3X23A 3VQIA 2J7QB 4B9KA 2GOWA 5AZHA 2M17A 3VUYA 1YQBA 4DBGA 3QK0A 4FULA 1Q1OA 1R4NI 1M94A 1EO6A 2NCNA 4MEMA 4MJSB 1I42A 2R2QA 2N1WA 5AZFA 2GMIC 4PS8A 2ZEQA 4AUQC 2XK5A 1EUVB 5C1ZA 3NOBA 4TQ0A 1YX6B 3KUDB 2K6QA 5LXIB 1P9DU 5D2MB 1R4MI 3ZNGC 4CHKA 4W9JA 4TUUA 1H8CA 1AARA 4MDKE 3SU8X 3BINA 2M4NA 2KNBA 1OQYA 3B08A 5JHBA 2YVCA 2AYOB 4WQOB 3W1SC 4EOYA 5J17A 2EMTA 2XK5B 3H1UA 4EZJA 2Z0EB 4ASWC 1WR6E 1U4AA 3U7DA 4KDIC 3RZWC 2BYVE 1P1AA 1V6EA 2KJHB 2LASA 2YLMA 2B3AA 4JL9A 2WYQA 2LD9A 3B1LX 1WF9A 1WE7A 2I1JA 2N9PC 3DVGY 5E6OA 3DPDA 4ZRKA 5GMVA 3OJ4B 1S1QB 2KQSA 4DWFA 4FHKA 2NR2A 2OOBB 1WZ0A 2BWFA 3PRZA 1E5WA 2BGFA 2MBOA 2NBWB 1A5RA 4K7UA 2LVOA 4G0NB 2GBKA 3AU5A 2DYMA 3S2AA 4RMAA 4AWJA 2LVQA 4OVUA 2CR5A 4RM8A 1P98A 3N30A 3JYUA 3GZNI 3LJ3A 1WXVA 2K25A 4HPMB 3APFA 2DZJA 3QX1A 3JSVA 2IBIB 1OTRB 1UH6A 4WWPA 2KZRA 4YL8A 3DVNV 3PRMB 4BOSC 2C60A 3VXWA 2D3GA 2QHOA 1TTNA 2ZVNA 4EFOA 4K1RB 5DPSA 1G6JA 2GBJA 2FIDA 1UBIA 2MBBB 3PVLA 2N7DA 3JSVB 4RM9A 4B95A 1WJ6A 5CHWA 2DYBA 3ZNZB 1T0YA 1UZXB 2FUHB 2K8HA 4HDOA 3WANA 2NBUA 4GXBA 4F7ZA 4AP4C 3QJZA 3UQAA 2V3SA 3H9DA 3LDZE 3RT3B 1UD7A 1L7YA 4ZRJA 2MBHA 3PTFC 3BY4B 1VD2A 1LFDA 4II3B 4GU2A 3V61A 1C1YB 2FAZA 2FCSA 2PEAA 4M8MA 1SGHA 4NQLB 2MW5A 4NJ6A 4M0WB 4JLCA 1WXAA 2OJRA 3L0WB 4LJOB 2NBVB 2LGXA 3IFWB 1J19A 1V2YA 3QCAA 3L13A 4B6WA 1WGHA 2O2VA 1V49A 5EDSA 2CS4A 1OEYJ 2Z59B 1V86A 4W9KA 3R7QA 4EZKA 2FCQA 3HHMA 2MBQA 2LRWA 2BF8B 2KX0A 3DBHI 2DZIA 3CSTA 2MBEA 2LI5A 5JZEB 4GMVA 4BKSA 4W9GA 2ZJDA 2JRIB 4K81A 1WJUA 3A9KA 3WALA 5KHOA 2N9EB 2JWZA 2O2VB 1QZEA 4WJQA 1XT9B 5E6PA 2UYZB 3JW0X 3M63B 5BO4B 4MSQB 1LQBA 1GNUA 1EF5A 1UGMA 1GUAB 4J6IA 2KDIA 1ZKHA 2KD0A 2J0MA 2K8CA 1S3SG 3A9KB 2G4DB 4DK5A 4F1SA 3PGEA 4TKNA 4URKA 2KDBA 2K39A 2KC2A 4W9EA 4I6PA 2LXAA 1WGGA 4CO7A 4K7SA 5CHVC 3SDLC 4MGYE 3JVZX 4IG7B 3KYDD 4I6NB 2IY0B 5DPRA 2WX1A 3T8MA 3ZLZA 5AZGA 2BKFA 1IP9A 1UELA 1V9JA 3EHVA 4A3PA 3PHXB 4WWNA 2JPHA 4W9CA 2G4SA 1E7VA 2C5LC 3ZNID 4W9HA 2LGYA 4DHZB 2KWUB 4KIKA 3ONSA 3NZSA 4GB9A 2KLCA 2KFKA 5E6NA 1IPGA 3PS6A 2DENB 4MGIE 2ZNVC 3CSFA 3DDCB 2MSED 3NZUA 4IW0A 2CHXA 3M62B 3WAOA 2IYDB 2CU1A 2IO1B 2DZKA 2BPSA 4G3XB 1JRUA 1WMHA 2DX5B 2MP2A 1UBQA 2O6VA 4BFRA 3AU4A 3OLMD 3PLVA 4ZYNA 4KIKB 1WXSA 2ZZPB 2IY1B 2KFKB 2AL6A 3IHPC 2IO2B 2KMAA 4N9F4 3V62A 5D6JB 2FCNA 4GDLA 1IYFA 4HXDA 4KVGB 1FXTB 3RCZA 4LDTB 2G45B 3VAWA 1K8RB 1WMHB 2MP2B 2CKHB 3PREA 1WM3A 1MG8A 2DZMA 2MLBA 4BOZB 5C23A 4GN1A 2KDFB 4EUTA 1HE8A 2KQ7A 2LGDA 2L76A 4GOCA 3UIPB 1GG3A 3B0AA 2L3ZA 4XZ4A 4HJKA 4ICVA 1YX5B 4WAAA 2ZCCA 1SE9A 2MRPA 3PT2B 3ML8A 2KJ6A 3VTVA 4W9FA 4GDLB 1GC7A 3KYCD 3ZRFA 3L17A 2C9WB 3AULA 4FLHA 4BKTA 3UINB 1V5OA 2CHZA 3HM6X 3KW5B 4DXAB 3AXCA 2KFJA 4PYZA 2J0JA 3PRPB 2C7MB 1OEYA 2HE7A 2RGFA 3DBSA 3APCA 3VDZA 3VUWA 3ZUNA 2KANA 3A9JA 4MM3A 3HM3A 2MQJA 2UWQA 4BKSD 5J2RA 2LJ5A 2BWES 4DHJB 4JGHB 2XEWA 4K7WA 5TR5A 3K9OB 1YIWA 3P2BA 4WWOA 3M3JA 5G55A 4AJWA 4HVBA 1WGRA 1WM2A 4FHJA 4M8NA 3W1YA 1Q5WB 2AEHA 3U30A 3ZDTA 3VTUA 4JQWC 4E71A 5JH5C 3A9JB 1BT0A 1TGZB 3PLUA 3R7RA 2LWPA 3W1SA 3V6EB 3ENEA 3RULA 1GC6A 3KVFB 3UQBA 3NS8A 1TZ1A 2LUEA 2WX0A 5CHFA 2KN5A 3SD5A 1E90A 1P0RA 1NI2A 1RRBA 4KSKC 3RZFA 3RD2A 2KDEB 4II2B 2WWZA 2N1VA 4DHZE 2Z0DB 1NDDA 2I1KA 2JRHA 2KX3A 2MX2A 2LRUA 1ZW7A 2DHZA 3AI5A 2WDTB 3IG3A 4HPLB 2GBRA 2W9NA 3A4SC 3ZNHB 2FIFA 2HJ8A 2KOXA 3QA8A 3TJPA 2D11A 5DPTA 2KWVB 3X0WA 1LXDA 3R66C 3T9LA 3D32A 2RR9A 3HIZA 4EZLA 5IAAC 2L7RA 1WI0A 2LZ6A 2M8SA 3R3MA 4FJZA 2KMCA 4XX5A 3OJ3A 4LDTD 5D94A 4TV3A 4ANUA 3MTNB 3VHTC 2RD0A 4FN2A 3V6CB 1X1MA 5IA7A 4HDQA 5L95C 3PZDA 2L0TA 1E8ZA 2JZZA 2L05A 4G11A 4KV2A 4HLEA 4MSMB 5DPWA 2L0FA 2G3QB 1Q0WB 5KHQA 5J18A 2N9XA 3WAPA 3N32A 3PHWB 3M95A 3VFKA 2NPTA 2V1YA 1WE6A 2GBMA 3NHEB 3N3KB 2AWTA 2KK8A 3DBRI 1I35A 1WX7A 2MA9B 3Q3JA 3APDA 3L10B 2FCMA 4DDGD 4ZRIA 4IWOA 2JT4B 1WX8A 3KH0A 5G2NA 3U8ZA 2PE6B 3ZO5B 4G50A 1KM7A 3VVWB 2JF5A 4DHJD 4E3CA 4KZCA 2KC1A 1WJNA 1WRDB 4BKGA 1E8YA 2JY6A 3H6NA 4W9IA 2BYFA 2NPTB 3SHQA 3A33B 2DAJA 4IM3A 1XQQA 2N4FA 2IO3B 1L2NA 2PE9A 3DOWA 1RLFA 2KLGA 3V60A 2DAFA 3UF8A 2IO0B 3ZVVA 3WIMA 4GIVA 3ZKJC 3IBEA 3TIXA 2JUOA 4DDID 2REXA 4NY0A 2J0KA 4MH0E 2KWCA 3ZTDA 2JXXA 1WXMA 2XBBC 4AOFA 3DVGX 4GSWA 4IWQA 2KHWB 4GGQA 3CF6E 5LXHA 4IM2A 4EEWA 2VRRB 2HTHA 2KVRA 3EECA 4PS3A 2O6VB 3TL5A 1KJTA 4GDKA 2A4ZA 2ZVOA 3QQ8B 1SIFA 4NAWA 1H4RA 2C7HA 4MGZE 4FBJB 3WAMA 1Z5SB 3EFUA 3QHTA 3QWZB 1Y8RC 3QAQA 2EKEC 4FJYA 4F8CB 1ZGUB 4PS7A 4WJOA 4HCNB 5AEKB 3TMPB 3VH3B 2ASQA 3PSEB 2KKCA 3L54A 2C7NB 4LCDE 2K1FA 1J0GA 1WIAA 2EMSA 3ZW3A 4IUMB 4FJVB 1WZ3A 4GDKB 1P3QU 3Q3FA 4EKUA 3VH4B 3I3TB 3NY5A 1C3TA 3H7PA 1WGDA 4NAWB 4W9LA 2FNJB 1YD8U 2MCNB 4OVVA 1KOTA 3ZRCA 3A1QA 3PV1A 3L16A 2BKRB 2L8JA 4A3OA 1LM8B 1GJZA 3RUIB 1ISNA 4MGKE 2M0XA 4FADA 2ZCBA 2NS5A 2RPQA 4HCPB 4ANVA 5JHAA 3ZTCA 1WH3A 2KTFA 2DYOA 4IM0A 2BYEA 4P7IA 3GOEA 2KO3A 2Y5BB 5DCNA 3KUCB 2K8BA 3RYTA 4FA6A 3H7PB 1V5TA 2RSUA 4BVUC 1WYWB 2IZVB 3HK0A 3ZIMA 3A1QB 3C0RB 4XC2A 3WA0A 4KZ0A 5CX3A 3IVFA 3VTWA 2KJRA 1WX9A 3CMMB 4CYEA 1WFYA 1D3ZA 1EF1A 2D07B 2LVPA 3ALBA 4BBNC 4IC7B 2ZPYA 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQK E;  1Z2M A;  1YJ1 A;  2M1M A;  1RFA A;  3L08 A;  5FR6 A;  5HKH A;  3KUZ A;  3PPA A;  2NVU I;  3QAR A;  3UIO B;  2LXC A;  5LLI A;  4HWI B;  1WJ4 A;  5L83 A;  1V80 A;  2PJH A;  2KTR A;  2HD5 B;  3QIJ A;  3DQV A;  2JVC A;  4I6L B;  3H7S A;  1J8C A;  1TBE A;  4E74 A;  4KSL C;  1WGY A;  3TCA A;  4TQ1 A;  5CTR C;  1E7U A;  1OGW A;  3OAW A;  5D7G A;  4WJP A;  2K6D B;  4AJY B;  2R2O A;  2JZ3 B;  2L00 B;  3DBL I;  2ZNV B;  1RAX A;  3DCG A;  2A5U A;  2N7E A;  3ECI A;  4A20 A;  4HK2 A;  3A4R A;  3TBL D;  2PPH A;  3O65 B;  2KTR B;  2CHW A;  1CMX B;  2V4L A;  2D10 A;  1KLV A;  1XD3 B;  4IWP A;  4BBN F;  4NNJ B;  3EC8 A;  4PYU A;  3DVN U;  4NJ7 A;  1F9J A;  1VCB A;  2O6V D;  3ZDM C;  4JIO U;  4ANW A;  4KDL B;  2GBN A;  3ML9 A;  1E8W A;  1WR1 A;  3K9P B;  4ANX A;  1V81 A;  4WJN A;  4MEL A;  3QC8 B;  4MJS A;  4X57 B;  4ZDV A;  3MJW A;  1E8X A;  2KXJ A;  4LJP B;  1WY8 A;  1NBF C;  2AL3 A;  2MWS B;  4ICU A;  3VUX A;  1PQS A;  4NPN A;  2D2Q A;  2ZPN A;  3MHS D;  4W9D A;  3X23 A;  3VQI A;  2J7Q B;  4B9K A;  2GOW A;  5AZH A;  2M17 A;  3VUY A;  1YQB A;  4DBG A;  3QK0 A;  4FUL A;  1Q1O A;  1R4N I;  1M94 A;  1EO6 A;  2NCN A;  4MEM A;  4MJS B;  1I42 A;  2R2Q A;  2N1W A;  5AZF A;  2GMI C;  4PS8 A;  2ZEQ A;  4AUQ C;  2XK5 A;  1EUV B;  5C1Z A;  3NOB A;  4TQ0 A;  1YX6 B;  3KUD B;  2K6Q A;  5LXI B;  1P9D U;  5D2M B;  1R4M I;  3ZNG C;  4CHK A;  4W9J A;  4TUU A;  1H8C A;  1AAR A;  4MDK E;  3SU8 X;  3BIN A;  2M4N A;  2KNB A;  1OQY A;  3B08 A;  5JHB A;  2YVC A;  2AYO B;  4WQO B;  3W1S C;  4EOY A;  5J17 A;  2EMT A;  2XK5 B;  3H1U A;  4EZJ A;  2Z0E B;  4ASW C;  1WR6 E;  1U4A A;  3U7D A;  4KDI C;  3RZW C;  2BYV E;  1P1A A;  1V6E A;  2KJH B;  2LAS A;  2YLM A;  2B3A A;  4JL9 A;  2WYQ A;  2LD9 A;  3B1L X;  1WF9 A;  1WE7 A;  2I1J A;  2N9P C;  3DVG Y;  5E6O A;  3DPD A;  4ZRK A;  5GMV A;  3OJ4 B;  1S1Q B;  2KQS A;  4DWF A;  4FHK A;  2NR2 A;  2OOB B;  1WZ0 A;  2BWF A;  3PRZ A;  1E5W A;  2BGF A;  2MBO A;  2NBW B;  1A5R A;  4K7U A;  2LVO A;  4G0N B;  2GBK A;  3AU5 A;  2DYM A;  3S2A A;  4RMA A;  4AWJ A;  2LVQ A;  4OVU A;  2CR5 A;  4RM8 A;  1P98 A;  3N30 A;  3JYU A;  3GZN I;  3LJ3 A;  1WXV A;  2K25 A;  4HPM B;  3APF A;  2DZJ A;  3QX1 A;  3JSV A;  2IBI B;  1OTR B;  1UH6 A;  4WWP A;  2KZR A;  4YL8 A;  3DVN V;  3PRM B;  4BOS C;  2C60 A;  3VXW A;  2D3G A;  2QHO A;  1TTN A;  2ZVN A;  4EFO A;  4K1R B;  5DPS A;  1G6J A;  2GBJ A;  2FID A;  1UBI A;  2MBB B;  3PVL A;  2N7D A;  3JSV B;  4RM9 A;  4B95 A;  1WJ6 A;  5CHW A;  2DYB A;  3ZNZ B;  1T0Y A;  1UZX B;  2FUH B;  2K8H A;  4HDO A;  3WAN A;  2NBU A;  4GXB A;  4F7Z A;  4AP4 C;  3QJZ A;  3UQA A;  2V3S A;  3H9D A;  3LDZ E;  3RT3 B;  1UD7 A;  1L7Y A;  4ZRJ A;  2MBH A;  3PTF C;  3BY4 B;  1VD2 A;  1LFD A;  4II3 B;  4GU2 A;  3V61 A;  1C1Y B;  2FAZ A;  2FCS A;  2PEA A;  4M8M A;  1SGH A;  4NQL B;  2MW5 A;  4NJ6 A;  4M0W B;  4JLC A;  1WXA A;  2OJR A;  3L0W B;  4LJO B;  2NBV B;  2LGX A;  3IFW B;  1J19 A;  1V2Y A;  3QCA A;  3L13 A;  4B6W A;  1WGH A;  2O2V A;  1V49 A;  5EDS A;  2CS4 A;  1OEY J;  2Z59 B;  1V86 A;  4W9K A;  3R7Q A;  4EZK A;  2FCQ A;  3HHM A;  2MBQ A;  2LRW A;  2BF8 B;  2KX0 A;  3DBH I;  2DZI A;  3CST A;  2MBE A;  2LI5 A;  5JZE B;  4GMV A;  4BKS A;  4W9G A;  2ZJD A;  2JRI B;  4K81 A;  1WJU A;  3A9K A;  3WAL A;  5KHO A;  2N9E B;  2JWZ A;  2O2V B;  1QZE A;  4WJQ A;  1XT9 B;  5E6P A;  2UYZ B;  3JW0 X;  3M63 B;  5BO4 B;  4MSQ B;  1LQB A;  1GNU A;  1EF5 A;  1UGM A;  1GUA B;  4J6I A;  2KDI A;  1ZKH A;  2KD0 A;  2J0M A;  2K8C A;  1S3S G;  3A9K B;  2G4D B;  4DK5 A;  4F1S A;  3PGE A;  4TKN A;  4URK A;  2KDB A;  2K39 A;  2KC2 A;  4W9E A;  4I6P A;  2LXA A;  1WGG A;  4CO7 A;  4K7S A;  5CHV C;  3SDL C;  4MGY E;  3JVZ X;  4IG7 B;  3KYD D;  4I6N B;  2IY0 B;  5DPR A;  2WX1 A;  3T8M A;  3ZLZ A;  5AZG A;  2BKF A;  1IP9 A;  1UEL A;  1V9J A;  3EHV A;  4A3P A;  3PHX B;  4WWN A;  2JPH A;  4W9C A;  2G4S A;  1E7V A;  2C5L C;  3ZNI D;  4W9H A;  2LGY A;  4DHZ B;  2KWU B;  4KIK A;  3ONS A;  3NZS A;  4GB9 A;  2KLC A;  2KFK A;  5E6N A;  1IPG A;  3PS6 A;  2DEN B;  4MGI E;  2ZNV C;  3CSF A;  3DDC B;  2MSE D;  3NZU A;  4IW0 A;  2CHX A;  3M62 B;  3WAO A;  2IYD B;  2CU1 A;  2IO1 B;  2DZK A;  2BPS A;  4G3X B;  1JRU A;  1WMH A;  2DX5 B;  2MP2 A;  1UBQ A;  2O6V A;  4BFR A;  3AU4 A;  3OLM D;  3PLV A;  4ZYN A;  4KIK B;  1WXS A;  2ZZP B;  2IY1 B;  2KFK B;  2AL6 A;  3IHP C;  2IO2 B;  2KMA A;  4N9F 4;  3V62 A;  5D6J B;  2FCN A;  4GDL A;  1IYF A;  4HXD A;  4KVG B;  1FXT B;  3RCZ A;  4LDT B;  2G45 B;  3VAW A;  1K8R B;  1WMH B;  2MP2 B;  2CKH B;  3PRE A;  1WM3 A;  1MG8 A;  2DZM A;  2MLB A;  4BOZ B;  5C23 A;  4GN1 A;  2KDF B;  4EUT A;  1HE8 A;  2KQ7 A;  2LGD A;  2L76 A;  4GOC A;  3UIP B;  1GG3 A;  3B0A A;  2L3Z A;  4XZ4 A;  4HJK A;  4ICV A;  1YX5 B;  4WAA A;  2ZCC A;  1SE9 A;  2MRP A;  3PT2 B;  3ML8 A;  2KJ6 A;  3VTV A;  4W9F A;  4GDL B;  1GC7 A;  3KYC D;  3ZRF A;  3L17 A;  2C9W B;  3AUL A;  4FLH A;  4BKT A;  3UIN B;  1V5O A;  2CHZ A;  3HM6 X;  3KW5 B;  4DXA B;  3AXC A;  2KFJ A;  4PYZ A;  2J0J A;  3PRP B;  2C7M B;  1OEY A;  2HE7 A;  2RGF A;  3DBS A;  3APC A;  3VDZ A;  3VUW A;  3ZUN A;  2KAN A;  3A9J A;  4MM3 A;  3HM3 A;  2MQJ A;  2UWQ A;  4BKS D;  5J2R A;  2LJ5 A;  2BWE S;  4DHJ B;  4JGH B;  2XEW A;  4K7W A;  5TR5 A;  3K9O B;  1YIW A;  3P2B A;  4WWO A;  3M3J A;  5G55 A;  4AJW A;  4HVB A;  1WGR A;  1WM2 A;  4FHJ A;  4M8N A;  3W1Y A;  1Q5W B;  2AEH A;  3U30 A;  3ZDT A;  3VTU A;  4JQW C;  4E71 A;  5JH5 C;  3A9J B;  1BT0 A;  1TGZ B;  3PLU A;  3R7R A;  2LWP A;  3W1S A;  3V6E B;  3ENE A;  3RUL A;  1GC6 A;  3KVF B;  3UQB A;  3NS8 A;  1TZ1 A;  2LUE A;  2WX0 A;  5CHF A;  2KN5 A;  3SD5 A;  1E90 A;  1P0R A;  1NI2 A;  1RRB A;  4KSK C;  3RZF A;  3RD2 A;  2KDE B;  4II2 B;  2WWZ A;  2N1V A;  4DHZ E;  2Z0D B;  1NDD A;  2I1K A;  2JRH A;  2KX3 A;  2MX2 A;  2LRU A;  1ZW7 A;  2DHZ A;  3AI5 A;  2WDT B;  3IG3 A;  4HPL B;  2GBR A;  2W9N A;  3A4S C;  3ZNH B;  2FIF A;  2HJ8 A;  2KOX A;  3QA8 A;  3TJP A;  2D11 A;  5DPT A;  2KWV B;  3X0W A;  1LXD A;  3R66 C;  3T9L A;  3D32 A;  2RR9 A;  3HIZ A;  4EZL A;  5IAA C;  2L7R A;  1WI0 A;  2LZ6 A;  2M8S A;  3R3M A;  4FJZ A;  2KMC A;  4XX5 A;  3OJ3 A;  4LDT D;  5D94 A;  4TV3 A;  4ANU A;  3MTN B;  3VHT C;  2RD0 A;  4FN2 A;  3V6C B;  1X1M A;  5IA7 A;  4HDQ A;  5L95 C;  3PZD A;  2L0T A;  1E8Z A;  2JZZ A;  2L05 A;  4G11 A;  4KV2 A;  4HLE A;  4MSM B;  5DPW A;  2L0F A;  2G3Q B;  1Q0W B;  5KHQ A;  5J18 A;  2N9X A;  3WAP A;  3N32 A;  3PHW B;  3M95 A;  3VFK A;  2NPT A;  2V1Y A;  1WE6 A;  2GBM A;  3NHE B;  3N3K B;  2AWT A;  2KK8 A;  3DBR I;  1I35 A;  1WX7 A;  2MA9 B;  3Q3J A;  3APD A;  3L10 B;  2FCM A;  4DDG D;  4ZRI A;  4IWO A;  2JT4 B;  1WX8 A;  3KH0 A;  5G2N A;  3U8Z A;  2PE6 B;  3ZO5 B;  4G50 A;  1KM7 A;  3VVW B;  2JF5 A;  4DHJ D;  4E3C A;  4KZC A;  2KC1 A;  1WJN A;  1WRD B;  4BKG A;  1E8Y A;  2JY6 A;  3H6N A;  4W9I A;  2BYF A;  2NPT B;  3SHQ A;  3A33 B;  2DAJ A;  4IM3 A;  1XQQ A;  2N4F A;  2IO3 B;  1L2N A;  2PE9 A;  3DOW A;  1RLF A;  2KLG A;  3V60 A;  2DAF A;  3UF8 A;  2IO0 B;  3ZVV A;  3WIM A;  4GIV A;  3ZKJ C;  3IBE A;  3TIX A;  2JUO A;  4DDI D;  2REX A;  4NY0 A;  2J0K A;  4MH0 E;  2KWC A;  3ZTD A;  2JXX A;  1WXM A;  2XBB C;  4AOF A;  3DVG X;  4GSW A;  4IWQ A;  2KHW B;  4GGQ A;  3CF6 E;  5LXH A;  4IM2 A;  4EEW A;  2VRR B;  2HTH A;  2KVR A;  3EEC A;  4PS3 A;  2O6V B;  3TL5 A;  1KJT A;  4GDK A;  2A4Z A;  2ZVO A;  3QQ8 B;  1SIF A;  4NAW A;  1H4R A;  2C7H A;  4MGZ E;  4FBJ B;  3WAM A;  1Z5S B;  3EFU A;  3QHT A;  3QWZ B;  1Y8R C;  3QAQ A;  2EKE C;  4FJY A;  4F8C B;  1ZGU B;  4PS7 A;  4WJO A;  4HCN B;  5AEK B;  3TMP B;  3VH3 B;  2ASQ A;  3PSE B;  2KKC A;  3L54 A;  2C7N B;  4LCD E;  2K1F A;  1J0G A;  1WIA A;  2EMS A;  3ZW3 A;  4IUM B;  4FJV B;  1WZ3 A;  4GDK B;  1P3Q U;  3Q3F A;  4EKU A;  3VH4 B;  3I3T B;  3NY5 A;  1C3T A;  3H7P A;  1WGD A;  4NAW B;  4W9L A;  2FNJ B;  1YD8 U;  2MCN B;  4OVV A;  1KOT A;  3ZRC A;  3A1Q A;  3PV1 A;  3L16 A;  2BKR B;  2L8J A;  4A3O A;  1LM8 B;  1GJZ A;  3RUI B;  1ISN A;  4MGK E;  2M0X A;  4FAD A;  2ZCB A;  2NS5 A;  2RPQ A;  4HCP B;  4ANV A;  5JHA A;  3ZTC A;  1WH3 A;  2KTF A;  2DYO A;  4IM0 A;  2BYE A;  4P7I A;  3GOE A;  2KO3 A;  2Y5B B;  5DCN A;  3KUC B;  2K8B A;  3RYT A;  4FA6 A;  3H7P B;  1V5T A;  2RSU A;  4BVU C;  1WYW B;  2IZV B;  3HK0 A;  3ZIM A;  3A1Q B;  3C0R B;  4XC2 A;  3WA0 A;  4KZ0 A;  5CX3 A;  3IVF A;  3VTW A;  2KJR A;  1WX9 A;  3CMM B;  4CYE A;  1WFY A;  1D3Z A;  1EF1 A;  2D07 B;  2LVP A;  3ALB A;  4BBN C;  4IC7 B;  2ZPY A;  3UGB B; 
#chains in the Genus database with same CATH topology
 3L08 A;  1F77 A;  5MPO A;  2WQY B;  4L1B A;  3KUZ A;  3QAR A;  2NVU I;  2LXC A;  2AX5 A;  4ARI A;  2PJH A;  2KTR A;  2Y5C A;  4RGO S;  4KSL C;  3TCA A;  1E7U A;  2FBW B;  3IT4 B;  4QAY A;  2A5U A;  2N7E A;  4A20 A;  2PPH A;  1CMX B;  2D10 A;  4BBN F;  4NJ7 A;  1F9J A;  1VCB A;  2O6V D;  4JIO U;  1WR1 A;  1QQR A;  2E6X A;  2NMQ A;  4WJN A;  3V3X A;  3QC8 B;  4ZDV A;  3VUX A;  4ICU A;  2J52 A;  4BAX A;  2ZPN A;  3B2F A;  3VQI A;  1N5X A;  2J7Q B;  4B9K A;  4DBG A;  4FUL A;  2WXL A;  4MJS B;  1I42 A;  5AZF A;  2L52 A;  2XK5 A;  4TQ0 A;  1R4M I;  4RH6 A;  4W9J A;  1AAR A;  3SU8 X;  4N58 A;  2KNB A;  1OQY A;  3ZJT A;  1FMA D;  5JHB A;  3W1S C;  2JZP A;  1WR6 E;  2SAK A;  3O13 A;  3BWU D;  2BYV E;  3L4P A;  1FNV A;  2KJH B;  2LAS A;  5GMV A;  3DPD A;  4P6V F;  3OJ4 B;  1HTO A;  1KF6 B;  2UU7 A;  2KWD A;  2NR2 A;  4FHK A;  2LMC A;  4H2A A;  3PRZ A;  1SE2 A;  5BYR A;  4RF0 A;  2IJ0 A;  4RGT A;  4AWJ A;  4B0E A;  4JWS C;  4OVU A;  2FUG 1;  3JYU A;  1C9F A;  1RM6 C;  2KQ4 X;  1UH6 A;  3H8H A;  1WWT A;  3DHH C;  3DVN V;  3VXW A;  1TTN A;  1D5M C;  2ZW1 A;  5DPS A;  2MBB B;  2N7D A;  3JSV B;  1XCT L;  4RM9 A;  4B95 A;  1BML C;  5CHW A;  2DYB A;  3ZNZ B;  3IT6 B;  1UZX B;  3NUH B;  4HRO A;  4MAC A;  2NBU A;  2WXK A;  3UQA A;  5IP4 D;  3H9D A;  1RFK A;  1SSN A;  4ZHO A;  2K22 A;  2OED A;  3BY4 B;  1C1Y B;  4M8M A;  3R2I A;  4NJ6 A;  4JLC A;  1WXA A;  3KLS X;  2QJL A;  1K50 A;  2LGX A;  2KVZ A;  1YJI A;  3L13 A;  4BZA A;  4JWU C;  4K3C A;  3R7Q A;  2FCQ A;  2BF8 B;  2KX0 A;  3DBH I;  2DZI A;  2MBE A;  3Q8C A;  2ZJD A;  2JRI B;  3NVW A;  3ETR A;  3WAL A;  2O2V B;  3NJT A;  4ZYS A;  5AUK A;  5HI1 A;  5BO4 B;  2PW9 A;  1GNU A;  1JWM D;  2K8C A;  4URK A;  4F1S A;  2K39 A;  3NVV A;  2KC2 A;  1XXG A;  4AQ7 A;  1WGG A;  4K7S A;  1KRH A;  3TEX A;  3AEA B;  3RNF C;  1E6E B;  3BK2 A;  5DPR A;  2CJO A;  3ZLZ A;  1IP9 A;  1K52 A;  4A3P A;  2DWQ A;  4OZC A;  2G4S A;  2C5L C;  3ZNI D;  4DHZ B;  3AH7 A;  1VZ8 A;  4KIK A;  2PVG C;  3AMZ A;  3ONS A;  3NZS A;  2ZNV C;  2MSE D;  1TYG B;  3WAO A;  3M62 B;  1PYW D;  4P1B C;  1WMH A;  2ON8 A;  4BFR A;  3PLV A;  3NZ3 A;  2QEJ C;  2KFK B;  5HFY A;  2IO2 B;  2KMA A;  2MJE A;  3V62 A;  4ZOH C;  1XO3 A;  1IBX B;  1IYF A;  4HXD A;  4RGN A;  2G45 B;  3PRE A;  2MP2 B;  2CKH B;  1WM3 A;  1MG8 A;  5C23 A;  2BW2 A;  2N9L A;  3PZ8 A;  1OQR A;  3AED B;  4ICV A;  2ZCC A;  2KN4 A;  1GC7 A;  4OVZ A;  3AUL A;  2WGS A;  3HM6 X;  3KW5 B;  1I4G A;  2D5G A;  2C7M B;  3RNE C;  2RGF A;  1XLO A;  3HM3 A;  4NJC A;  4BKS D;  3DHI C;  4JGH B;  3K9O B;  1YIW A;  1WM2 A;  2KT7 A;  1V1P B;  1Q5W B;  3Q3M C;  3ZDT A;  4E71 A;  4JQW C;  3A9J B;  4MM3 B;  1N63 A;  3PLU A;  2QIL A;  5BMG A;  3I57 A;  3UQB A;  3AEG B;  5H8Y E;  3T3N A;  1KLU D;  4HRS A;  3BII D;  1C76 A;  2N1V A;  2I1K A;  2JRH A;  2LRU A;  3MC0 B;  2DHZ A;  2WDT B;  5EE9 A;  3IG3 A;  3BVG A;  3A4S C;  2W9N A;  2FIF A;  2HJ8 A;  3QA8 A;  3TJP A;  2D11 A;  1LXD A;  3D32 A;  4KGS A;  1CK1 A;  4US8 A;  4XX5 A;  1T0R C;  4LDT D;  4ANU A;  3J9C A;  2ONQ A;  3VHT C;  2N0S B;  4FN2 A;  1QKZ A;  5IA7 A;  4HDQ A;  2JZZ A;  4KV2 A;  2L0F A;  3R2T A;  2BBC A;  2QIE B;  2AQ2 B;  2VZK B;  2BS2 B;  1SEB D;  3RNA C;  1WE6 A;  3NHE B;  3Q3J A;  2MA9 B;  1HZ5 A;  4ZRI A;  1ZXI A;  4A90 A;  2JF5 A;  1V8C A;  1NVI D;  4RFB A;  3MC8 A;  1E8Y A;  2JY6 A;  3SHQ A;  4RGM A;  3A33 B;  3ZXV A;  4IM3 A;  2M19 A;  2W54 A;  5BYS A;  2WXP A;  2KLG A;  3Q69 A;  1C78 A;  2IO0 B;  3UF8 A;  3WIM A;  3NS1 A;  3ZKJ C;  1I4H A;  2HTM E;  3IBE A;  4D2K A;  2J0K A;  2V9H A;  2XBB C;  3DVG X;  3RI7 C;  3C8Y A;  3EEC A;  2WP9 B;  4GDK A;  2A4Z A;  3HVD A;  1SIF A;  3E56 A;  1DGJ A;  2OJW A;  1TT5 B;  4F8C B;  4WJO A;  3TMP B;  3LXF A;  1CZP A;  4LCD E;  1WIA A;  2WXG A;  1JQ4 A;  4M02 A;  3I3T B;  4USA A;  1YD8 U;  3ZRC A;  3A1Q A;  1V1O A;  1JRO A;  2BKR B;  2L8J A;  1GOZ A;  1ZXH A;  4ANV A;  1L5P A;  1HA5 A;  2DYO A;  4IM0 A;  2Y5B B;  4C4V A;  5DCN A;  3GE3 C;  3KWV A;  2RSU A;  1WYW B;  2IZV B;  3Q8E A;  2OHF A;  3C0R B;  1DOI A;  4YSY B;  1DYQ A;  4KZ0 A;  4DQO C;  1WX9 A;  4XYC A;  1TY2 A;  3ALB A;  2WU2 B;  4HLE A;  4NQK E;  1YJ1 A;  5HKH A;  2H89 B;  3PPA A;  3UIO B;  1AYF A;  4WAF A;  4HWI B;  3ZJV A;  5L83 A;  2GLS A;  2JVC A;  3H7S A;  2L32 A;  4HJG E;  2VH2 A;  2GI9 A;  4E74 A;  1WGY A;  4XWT A;  3Q8F A;  2R2O A;  3VRB B;  1DOX A;  3ECI A;  2BVC A;  1KLV A;  4NNJ B;  1VR9 A;  1XEE A;  4KDL B;  3ML9 A;  3K9P B;  1QIL A;  4ANX A;  3ZJU A;  2KXJ A;  3P42 A;  2AL3 A;  2MWS B;  1D6E C;  4NPN A;  1OFF A;  2BB5 A;  3MHS D;  4ZHP A;  3Q2A C;  2D3C A;  1FFU A;  2M17 A;  3VUY A;  1MHX A;  1EO6 A;  1F2R I;  2GMI C;  1I4X A;  1QT9 A;  2ZEQ A;  3RMK C;  4DXG A;  1EUV B;  5C1Z A;  1YX6 B;  5LXI B;  4CHK A;  1ZDV A;  2YEP B;  2MHJ A;  1H8C A;  2K5P A;  3AE9 B;  1M4V A;  3AE1 B;  5D3D A;  2AYO B;  4CQN A;  4EOY A;  2WXN A;  3H1U A;  4EZJ A;  2Z0E B;  2QDF A;  4ASW C;  3U7D A;  1V6E A;  2B3A A;  2KYW A;  4M00 A;  1WF9 A;  1YN4 A;  1S1Q B;  2KQS A;  4DWF A;  1IUE A;  2WU5 B;  3UI3 A;  3AE6 B;  3ABV B;  3AE4 B;  1EWY C;  4K7U A;  3BVM A;  4G0N B;  4UDU C;  2LVQ A;  1PGB A;  2CR5 A;  3LJ3 A;  3U2S C;  4HPM B;  2WNM A;  1J7C A;  3QX1 A;  2MJ3 A;  2IBI B;  1JWS D;  1ENF A;  1ZP0 B;  2KZR A;  4YL8 A;  3FIL A;  2QHO A;  1FXI A;  4EFO A;  1V1P A;  3ZGZ A;  4S17 A;  2WHI A;  1WJ6 A;  2DNF A;  2PTL A;  1T0Y A;  1B1Z A;  3WAN A;  4GXB A;  4AP4 C;  1SXT A;  1FM0 D;  3LDZ E;  4ITK A;  3IXS A;  3SFD B;  4L2Y A;  2PEA A;  1NYQ A;  1SGH A;  1VDV A;  2MW5 A;  4M0W B;  4WIP A;  3VR9 B;  5EDS A;  2CS4 A;  1OEY J;  1V86 A;  2LRW A;  4N6E B;  4OW0 A;  3B9J A;  3CST A;  2LI5 A;  4GMV A;  3HVZ A;  4BKS A;  4W9G A;  4ARC A;  5KHO A;  4WJQ A;  1XT9 B;  1WGK A;  2UYZ B;  3M63 B;  3R8B A;  4MSQ B;  1UGM A;  2KDI A;  1I7H A;  3DWM A;  4JE3 B;  2KD0 A;  3A9K B;  4ZRP A;  1L6U A;  4I6P A;  2LXA A;  1FNW A;  3SDL C;  3Q14 C;  3LB8 C;  1ZE3 D;  4MGY E;  2WXH A;  1VZ6 A;  1FCL A;  3DBR B;  1NEK B;  1TY0 A;  3T8M A;  5AZG A;  2BKF A;  4LTU A;  3AE5 B;  3URY A;  1YQ3 B;  4W9H A;  2KWU B;  3OG5 A;  4PT5 A;  1F52 A;  2WDQ B;  2DEN B;  4MGI E;  2IYD B;  1JRU A;  1UBQ A;  3RN9 C;  1WXS A;  1C4C A;  1C79 A;  2AL6 A;  3AE3 B;  4C80 A;  3BYT B;  1IGD A;  2W55 A;  2X8X X;  3NG0 A;  4KVG B;  4BOZ B;  2DZM A;  2KDF B;  5BMI A;  2KQ7 A;  2LGD A;  3UIP B;  1GG3 A;  3B0A A;  2L3Z A;  4HJK A;  1YX5 B;  2LGI A;  4WAA A;  2MRP A;  2JYE A;  3ML8 A;  4C56 C;  4W9F A;  4GDL B;  1F0Z A;  2KFJ A;  4PYZ A;  2HE7 A;  1ZOY B;  4HKZ E;  2MQJ A;  5J2R A;  2L1A A;  4N59 A;  2LJ5 A;  4DHJ B;  2RDG A;  2WDV B;  1AWD A;  2XEW A;  4K7W A;  5TR5 A;  4WWO A;  5G55 A;  4AJW A;  1WGR A;  2AEH A;  3V6E B;  2BT6 A;  1GC6 A;  3MC9 A;  4L23 A;  3NS8 A;  1TZ1 A;  5CHF A;  5EE3 A;  1E90 A;  1NI2 A;  4KGT A;  2BTE A;  1RWS A;  2KDE B;  2WWZ A;  3CWI A;  3TEW A;  4DHZ E;  1YN3 A;  1NDD A;  1TZO A;  2MX2 A;  2KX3 A;  3AI5 A;  3EUB 2;  1NEN B;  2GBR A;  3ZNH B;  3P4Q B;  1SJE D;  2LFI A;  1JML A;  2KWV B;  3AEF B;  3BZD B;  1N6Z A;  2RR9 A;  3HIZ A;  2LZ6 A;  2M8S A;  1HXY D;  4A55 A;  2MH7 A;  3OJ3 A;  2K3U A;  3MTN B;  3V6C B;  3PZD A;  2L0T A;  1E8Z A;  1IGC A;  4G11 A;  4P16 A;  3DHG C;  1ET9 A;  2MEK A;  1T0Q C;  3WAP A;  3N32 A;  3PHW B;  3M95 A;  2NPT A;  2V1Y A;  5BMH A;  1YQ4 B;  3N3K B;  2KK8 A;  5FR3 A;  1R4M B;  3AE2 B;  2FCM A;  4DDG D;  4IWO A;  1SE4 A;  3E9S A;  1N61 A;  5G2N A;  3GB1 A;  1KM7 A;  1E7P B;  3N9Y C;  1WJN A;  4BKG A;  4W9I A;  1FIQ A;  1SE3 A;  1VJK A;  2PE9 A;  2DAF A;  3ZVV A;  3FKY A;  4DDI D;  3U7Z A;  4MH0 E;  2WXO A;  4AOF A;  2JXX A;  1T3Q A;  2JU6 X;  4XGA B;  4GGQ A;  2LHD A;  4XE0 A;  2FE8 A;  2INP E;  2KVR A;  1PFD A;  3TL5 A;  2WXM A;  3QQ8 B;  2LEK A;  3AN1 A;  1ET6 A;  1H4R A;  2C7H A;  2HJ1 A;  4M01 A;  4MGZ E;  3WAM A;  1D5Z C;  1Z5S B;  3EFU A;  3U4E G;  1E0Z A;  1ZGU B;  4MT5 A;  2ASQ A;  3L54 A;  2K1F A;  3ZW3 A;  4FJV B;  4EKU A;  1PGX A;  3H7P A;  4NAW B;  4W9L A;  1BXT A;  4YWG G;  4A3O A;  2M0X A;  2RPQ A;  3W2D A;  1WH3 A;  4KGR A;  1T6B X;  2BYE A;  4P7I A;  1SB3 C;  2KO3 A;  3P63 A;  3KUC B;  3ZIM A;  3IVF A;  3VTW A;  2KJR A;  2LVP A;  1VZ7 A;  1FD6 A;  4IC7 B;  1TKE A;  3PZ7 A;  3UGB B;  1Z2M A;  2M1M A;  1MHH E;  5FR6 A;  4OZA A;  5HG2 A;  5LLI A;  1CJE A;  1WJ4 A;  1WYG A;  2YEP F;  4I6L B;  2G1E A;  1JCK B;  1T0S C;  5D7G A;  2K6D B;  4AJY B;  2I2Y A;  1JWA D;  3DBL I;  2ZNV B;  3NRZ A;  1RAX A;  3DCG A;  4LK0 M;  3DBH B;  3AE8 B;  5H92 C;  3TBL D;  2KTR B;  2RDB C;  2CHW A;  2V4L A;  3TEZ A;  1I4R A;  3EC8 A;  4C7Z A;  3W5U B;  2KAJ A;  2GBN A;  1E8W A;  1V81 A;  4X57 B;  4MEL A;  4MJS A;  2JX5 A;  4KKJ A;  1P7F A;  1TS2 A;  3W5V B;  1PQS A;  2D2Q A;  1E10 A;  4W9D A;  2GOW A;  5AZH A;  1VRA B;  1NYR A;  1R4N I;  1M94 A;  4MEM A;  2N1W A;  4PS8 A;  4AUQ C;  3RNG C;  3KUD B;  1P9D U;  5D2M B;  2EKI A;  4K3B A;  4LLG M;  3BIN A;  1TIF A;  3IAM 1;  5J17 A;  2XK5 B;  1UGJ A;  2RMM A;  1U4A A;  4KDI C;  1UNS A;  2IPK D;  1TS5 A;  3I5J C;  2LD9 A;  3B1L X;  2KDM A;  1WE7 A;  5E6O A;  5TSS A;  3RNB C;  3ZYY X;  4B0M A;  3TUO A;  2OOB B;  1FEH A;  2BWF A;  1E5W A;  2CU3 A;  2BGF A;  1KH0 A;  1MVK A;  3SEB A;  2NBW B;  3C19 A;  2LVO A;  2NTT A;  2GBK A;  3AU5 A;  2DYM A;  4RMA A;  2XN9 C;  1P98 A;  3U52 E;  2DBY A;  2IDY A;  3APF A;  3JSV A;  1UF0 A;  5D3I B;  2B76 B;  2C60 A;  3Q6B A;  2ZVN A;  4K1R B;  1R7S A;  2FID A;  1UBI A;  1VLB A;  4HKQ A;  1TKY A;  4R3D A;  2GRI A;  3I63 C;  1PDX A;  3RFZ B;  2J4X A;  2FUH B;  2K8H A;  4JPS A;  4HDO A;  1XLN A;  1SF0 A;  3QJZ A;  1JAL A;  2V3S A;  1FCC C;  2BB6 A;  4TSS A;  1UD7 A;  1EU4 A;  1L7Y A;  1N60 A;  3N1Z C;  1LFD A;  3AEE B;  3V61 A;  2FAZ A;  2FCS A;  4NQL B;  3L0W B;  4LJO B;  2NBV B;  5GXG B;  3IFW B;  1L4Z B;  1V2Y A;  4OHJ A;  2IGD A;  1WGH A;  2O2V A;  1GB1 A;  3HHM A;  1KFY B;  2J42 A;  1WJU A;  2WXR A;  3HUI A;  1MPE A;  2N9E B;  1QZE A;  3AB5 A;  2M0A A;  1LQB A;  1N62 A;  4J6I A;  5G5H A;  3P1M A;  3SR6 A;  2J0M A;  4DK5 A;  3PGE A;  5I4D A;  4DXF A;  1MJD A;  4CO7 A;  1P7E A;  1YJJ A;  4IG7 B;  3KYD D;  4I6N B;  2IY0 B;  2WX1 A;  3B2G A;  1C4P A;  1UEL A;  1RYJ A;  3PHX B;  5IKC M;  2IGH A;  4W9C A;  2WXF A;  3SFE B;  1FRD A;  3V05 A;  2LGY A;  1AW7 A;  2BS3 B;  2J53 A;  4GB9 A;  4J3O D;  2KLC A;  2KFK A;  2V0G A;  1IPG A;  4YXD B;  3NZU A;  1IBX A;  4IW0 A;  1FO4 A;  1YN5 A;  2CU1 A;  3OWE B;  2IO1 B;  2DZK A;  2BPS A;  4ACF A;  2MP2 A;  3AU4 A;  3I9V 1;  3OLM D;  4KIK B;  4N9F 4;  2IY1 B;  1FFV A;  4S0R A;  3FC4 A;  2FCN A;  1PUT A;  1WMH B;  4RNA A;  2MLB A;  4GN1 A;  4EUT A;  1HE8 A;  4GOC A;  3P4S B;  3PT2 B;  1SE9 A;  2X38 A;  3MHZ A;  3KYC D;  3L17 A;  2C9W B;  4BKT A;  1STE A;  1V5O A;  2CHZ A;  3MFG A;  1OEY A;  5IOI A;  3ZUN A;  1N5W A;  2KAN A;  3A9J A;  4MM3 A;  1JW9 D;  5AUI A;  3M3J A;  3TEY A;  4HVB A;  4WH4 A;  2V3N A;  5JH5 C;  1F1H A;  3VTU A;  2RPV A;  1C77 A;  1BT0 A;  2LWP A;  4OZB A;  3ENE A;  3AEB B;  3KVF B;  2NTS A;  2LUE A;  4TMA B;  3SD5 A;  1P0R A;  4KSK C;  1HQR D;  2Z0D B;  4LNF A;  1HTQ A;  3ZQ4 A;  5FKA C;  1ZW7 A;  3GE8 C;  4AS1 A;  4HPL B;  3WCQ A;  2JSV X;  2BS4 B;  5DPT A;  3X0W A;  3R66 C;  1QOB A;  4EZL A;  3VR8 B;  2L7R A;  3R3M A;  4FJZ A;  1QLB B;  5D94 A;  4TV3 A;  4P1C C;  3AV8 A;  4PK1 A;  5L95 C;  3P4R B;  3CIR B;  4MSM B;  5DPW A;  5KHQ A;  2D3B A;  5J18 A;  2N9X A;  2W3R A;  2TSS A;  2AWT A;  1I35 A;  1WX7 A;  2LHE A;  3APD A;  4WUR A;  1WRI A;  2JT4 B;  3KH0 A;  2PE6 B;  3ZO5 B;  4DHJ D;  4E3C A;  3H6N A;  1LO5 D;  1L4D B;  1XQQ A;  2N4F A;  2IO3 B;  3DOW A;  1RLF A;  3V60 A;  4C00 A;  3IAS 1;  3GS2 A;  5EE1 A;  2REX A;  4NY0 A;  2KWC A;  4IWQ A;  4IM2 A;  4EEW A;  2VRR B;  4PS3 A;  2O6V B;  1K53 A;  3GP7 A;  4FBJ B;  3N1X C;  1I4Q A;  4YTP B;  3QHT A;  3QAQ A;  4PS7 A;  2KMM A;  4HCN B;  1A70 A;  1JWU D;  4XDC A;  2QCZ A;  1J0G A;  2EMS A;  5G5G A;  4IUM B;  2QC8 A;  1Q10 A;  4FXC A;  4GDK B;  3Q3F A;  4Q2J A;  3VH4 B;  3NY5 A;  2MCN B;  4WQM A;  3L16 A;  2LJI A;  1LM8 B;  2IND C;  3RUI B;  1ISN A;  4MGK E;  3MP9 A;  4FAD A;  4YSZ B;  2NS5 A;  4HCP B;  3ZTC A;  1ZDX A;  3GOE A;  3RYT A;  2K8B A;  4BVU C;  1J7B A;  1EWC A;  2LUM A;  3A1Q B;  3WA0 A;  3CMM B;  2SEB D;  3EGR A;  4BBN C;  2V4I B;  1QOA A;  1RFA A;  4C4V B;  1I4P A;  4YTN B;  1V80 A;  3QIJ A;  2HD5 B;  3DQV A;  1J8C A;  1TBE A;  1FPY A;  4KX6 B;  4TQ1 A;  5CTR C;  1OGW A;  3OAW A;  4WJP A;  2JZ3 B;  2L00 B;  1LGR A;  2Y5P A;  4HK2 A;  3A4R A;  3O65 B;  2RDH A;  1D5X C;  1XD3 B;  4IWP A;  4PYU A;  3DVN U;  3ZDM C;  4ANW A;  1SBB B;  1QOG A;  1ROE A;  3MJW A;  1E8X A;  4LJP B;  1WY8 A;  1NBF C;  1QF6 A;  2G9H D;  3X23 A;  2CJN A;  1YQB A;  3QK0 A;  1Q1O A;  2NCN A;  1FXA A;  2R2Q A;  3NVY A;  4REZ A;  1JRP A;  2WXQ A;  3NOB A;  5IO9 A;  1V97 A;  2K6Q A;  2Y3A A;  1SJH D;  4MH8 A;  4A8X C;  3ZNG C;  5LNK 1;  1MI0 A;  4TUU A;  4MDK E;  3T3O A;  2M4N A;  2I38 A;  3B08 A;  2YVC A;  4WQO B;  2EMT A;  2JQR B;  2K0P A;  3RZW C;  1BUI C;  1KLG D;  1P1A A;  2YLM A;  4JL9 A;  2WYQ A;  2I1J A;  2N9P C;  3DVG Y;  4ZRK A;  1GB4 A;  2PVO D;  1WZ0 A;  2MBO A;  1A5R A;  2H88 B;  3S2A A;  4RM8 A;  1UWM A;  3Q3O C;  3N30 A;  1SIJ A;  4IOI E;  3GZN I;  1WXV A;  2K25 A;  5FK9 C;  2DZJ A;  2PMV A;  2DLB A;  1OTR B;  1GPX A;  4WWP A;  2L83 A;  5E6J A;  3PRM B;  3VRA B;  4BOS C;  1KTK A;  2D3G A;  2GB1 A;  1ACC A;  4YT0 B;  2IGG A;  1G6J A;  2GBJ A;  3N1Y C;  1TKG A;  2N7J A;  3PVL A;  2VZK D;  1HZ6 A;  4YSX B;  4M0W A;  1FRR A;  2HDE A;  3FIL B;  4F7Z A;  2INC C;  2QMT A;  2LGS A;  3RT3 B;  1QOF A;  4ZRJ A;  2MBH A;  3PTF C;  5C2T B;  1VD2 A;  4II3 B;  4GU2 A;  1Y56 A;  3N20 C;  2INN E;  2OJR A;  3RNC C;  1J19 A;  3P4P B;  3QCA A;  4B6W A;  4RCO A;  1V49 A;  2Z59 B;  4W9K A;  3Q3N C;  4EZK A;  1YNT E;  2MBQ A;  1JWB D;  2VH1 A;  3HRD D;  2JWU A;  5JZE B;  2JYT A;  1WXQ A;  1UWX A;  4K81 A;  3A9K A;  1AN8 A;  2XNA C;  3BK1 A;  4LNI A;  2JWZ A;  1D4B A;  5E6P A;  4HPP A;  3JW0 X;  5BYQ A;  3Q8B A;  1CQV A;  4HEA 1;  3DWG C;  1EF5 A;  5IN7 A;  1GUA B;  4XDD A;  2V3P A;  3MJ5 A;  1ZKH A;  1S3S G;  2G4D B;  4TKN A;  2KDB A;  4RF1 A;  4W9E A;  1YMH E;  3RPF C;  5CHV C;  2AQ3 B;  2W82 A;  2ZW0 A;  4LNN A;  5JXV A;  1ZPS A;  3JVZ X;  1EM7 A;  1V9J A;  3EHV A;  2WLB A;  4WWN A;  2JPH A;  4YTM B;  1E7V A;  3W9C B;  3AM9 A;  4LNK A;  5E6N A;  3PS6 A;  3CSF A;  3DDC B;  3KQ4 A;  2CHX A;  3Q8A A;  4G3X B;  2BQQ A;  2DX5 B;  2O6V A;  2WDR B;  4ZYN A;  2ZZP B;  3IHP C;  3AE7 B;  2W3S A;  1HEZ E;  4IKG A;  1L0X B;  5D6J B;  1E9M A;  4GDL A;  2QSD A;  3LYY A;  2ICI A;  1MG4 A;  1FXT B;  3RCZ A;  4LDT B;  3VAW A;  1K8R B;  1J7A A;  2WXJ A;  3TSS A;  2L76 A;  1XLQ A;  4ZRQ A;  1EU3 A;  4XZ4 A;  2KJ6 A;  3VTV A;  3GZN B;  3BYY B;  2WXI A;  3ZRF A;  4FLH A;  5HHD G;  3UIN B;  2Z8L A;  3AXC A;  2AQ1 B;  2J0J A;  3PRP B;  1ESF A;  1B9R A;  3DBS A;  3VUW A;  3APC A;  3VDZ A;  2UWQ A;  4A6Q A;  2BWE S;  4NZL B;  2JXT A;  3P2B A;  4LNO A;  4KKI A;  4FHJ A;  4M8N A;  4GLS C;  3W1Y A;  4WWM A;  3U30 A;  2ACZ B;  2E3T A;  5C3J B;  1TGZ B;  2EEL A;  3R7R A;  3W1S A;  1TS4 A;  3RUL A;  1T5X D;  1FNU A;  2WX0 A;  2KN5 A;  1RRB A;  3RZF A;  3RD2 A;  4II2 B;  3DBL B;  1NI3 A;  2Q5W D;  2PLP A;  3PO0 A;  2KOX A;  3NVZ A;  4EE2 A;  1GAQ B;  3T9L A;  5IAA C;  1WI0 A;  1TS3 A;  2KMC A;  2PKO A;  2RD0 A;  1X1M A;  4IDI A;  3FAH A;  2K9X A;  1K51 A;  2L05 A;  2G3Q B;  4NAM A;  4XWW A;  1Q0W B;  1R4N B;  2KAC A;  5T8I A;  2R61 A;  3VFK A;  2GBM A;  3DBR I;  3L10 B;  1PGA A;  1WX8 A;  3U8Z A;  4G50 A;  3VVW B;  1UUP A;  4KZC A;  1XF5 L;  2KC1 A;  1WRD B;  1XLP A;  2BYF A;  2NPT B;  2PIA A;  2DAJ A;  1L2N A;  1L0Y B;  4GIV A;  3TIX A;  1XCQ L;  2JUO A;  2D3A A;  3ZTD A;  1WXM A;  4GSW A;  2KHW B;  3CF6 E;  5LXH A;  2HTH A;  1KJT A;  3EFC A;  2ZVO A;  1TJE A;  4NAW A;  3QWZ B;  4US9 A;  1Y8R C;  4FJY A;  2EKE C;  1L6V A;  5AEK B;  3VH3 B;  3PSE B;  2KKC A;  2WS3 B;  2C7N B;  5EE0 A;  1WZ3 A;  1P3Q U;  1MFW A;  3AEC B;  4C7Y A;  4O1N A;  1C3T A;  1ZUD 2;  1WGD A;  2FNJ B;  3ZXR A;  4OVV A;  4JX1 C;  1KOT A;  3PV1 A;  1F2R C;  1GJZ A;  2BYT A;  2ZCB A;  3BVZ A;  5JHA A;  2KTF A;  2M56 B;  1YOV B;  1L0V B;  4FA6 A;  3KWL A;  3H7P B;  1OQQ A;  1V5T A;  3HK0 A;  1C4A A;  4XC2 A;  2N9K A;  5CX3 A;  4A9A A;  2MJD A;  4CYE A;  1WFY A;  3EA6 A;  1WSP A;  1D3Z A;  1EF1 A;  2D07 B;  1DOY A;  4DXA B;  2ZPY A; 
#chains in the Genus database with same CATH homology
 4NQK E;  1Z2M A;  1YJ1 A;  2M1M A;  1RFA A;  3L08 A;  5FR6 A;  5HKH A;  3KUZ A;  3PPA A;  2NVU I;  3QAR A;  3UIO B;  2LXC A;  5LLI A;  4HWI B;  1WJ4 A;  5L83 A;  1V80 A;  2PJH A;  2KTR A;  2HD5 B;  3QIJ A;  3DQV A;  2JVC A;  4I6L B;  3H7S A;  1J8C A;  1TBE A;  4E74 A;  4KSL C;  1WGY A;  3TCA A;  4TQ1 A;  5CTR C;  1E7U A;  1OGW A;  3OAW A;  5D7G A;  4WJP A;  2K6D B;  4AJY B;  2R2O A;  2JZ3 B;  2L00 B;  3DBL I;  2ZNV B;  1RAX A;  3DCG A;  2A5U A;  2N7E A;  3ECI A;  4A20 A;  4HK2 A;  3A4R A;  3TBL D;  2PPH A;  3O65 B;  2KTR B;  2CHW A;  1CMX B;  2V4L A;  2D10 A;  1KLV A;  1XD3 B;  4IWP A;  4BBN F;  4NNJ B;  3EC8 A;  4PYU A;  3DVN U;  4NJ7 A;  1F9J A;  1VCB A;  2O6V D;  3ZDM C;  4JIO U;  4ANW A;  4KDL B;  2GBN A;  3ML9 A;  1E8W A;  1WR1 A;  3K9P B;  4ANX A;  1V81 A;  4WJN A;  4MEL A;  3QC8 B;  4MJS A;  4X57 B;  4ZDV A;  3MJW A;  1E8X A;  2KXJ A;  4LJP B;  1WY8 A;  1NBF C;  2AL3 A;  2MWS B;  4ICU A;  3VUX A;  1PQS A;  4NPN A;  2D2Q A;  2ZPN A;  3MHS D;  4W9D A;  3X23 A;  3VQI A;  2J7Q B;  4B9K A;  2GOW A;  5AZH A;  2M17 A;  3VUY A;  1YQB A;  4DBG A;  3QK0 A;  4FUL A;  1Q1O A;  1R4N I;  1M94 A;  1EO6 A;  2NCN A;  4MEM A;  4MJS B;  1I42 A;  2R2Q A;  2N1W A;  5AZF A;  2GMI C;  4PS8 A;  2ZEQ A;  4AUQ C;  2XK5 A;  1EUV B;  5C1Z A;  3NOB A;  4TQ0 A;  1YX6 B;  3KUD B;  2K6Q A;  5LXI B;  1P9D U;  5D2M B;  1R4M I;  3ZNG C;  4CHK A;  4W9J A;  4TUU A;  1H8C A;  1AAR A;  4MDK E;  3SU8 X;  3BIN A;  2M4N A;  2KNB A;  1OQY A;  3B08 A;  5JHB A;  2YVC A;  2AYO B;  4WQO B;  3W1S C;  4EOY A;  5J17 A;  2EMT A;  2XK5 B;  3H1U A;  4EZJ A;  2Z0E B;  4ASW C;  1WR6 E;  1U4A A;  3U7D A;  4KDI C;  3RZW C;  2BYV E;  1P1A A;  1V6E A;  2KJH B;  2LAS A;  2YLM A;  2B3A A;  4JL9 A;  2WYQ A;  2LD9 A;  3B1L X;  1WF9 A;  1WE7 A;  2I1J A;  2N9P C;  3DVG Y;  5E6O A;  3DPD A;  4ZRK A;  5GMV A;  3OJ4 B;  1S1Q B;  2KQS A;  4DWF A;  4FHK A;  2NR2 A;  2OOB B;  1WZ0 A;  2BWF A;  3PRZ A;  1E5W A;  2BGF A;  2MBO A;  2NBW B;  1A5R A;  4K7U A;  2LVO A;  4G0N B;  2GBK A;  3AU5 A;  2DYM A;  3S2A A;  4RMA A;  4AWJ A;  2LVQ A;  4OVU A;  2CR5 A;  4RM8 A;  1P98 A;  3N30 A;  3JYU A;  3GZN I;  3LJ3 A;  1WXV A;  2K25 A;  4HPM B;  3APF A;  2DZJ A;  3QX1 A;  3JSV A;  2IBI B;  1OTR B;  1UH6 A;  4WWP A;  2KZR A;  4YL8 A;  3DVN V;  3PRM B;  4BOS C;  2C60 A;  3VXW A;  2D3G A;  2QHO A;  1TTN A;  2ZVN A;  4EFO A;  4K1R B;  5DPS A;  1G6J A;  2GBJ A;  2FID A;  1UBI A;  2MBB B;  3PVL A;  2N7D A;  3JSV B;  4RM9 A;  4B95 A;  1WJ6 A;  5CHW A;  2DYB A;  3ZNZ B;  1T0Y A;  1UZX B;  2FUH B;  2K8H A;  4HDO A;  3WAN A;  2NBU A;  4GXB A;  4F7Z A;  4AP4 C;  3QJZ A;  3UQA A;  2V3S A;  3H9D A;  3LDZ E;  3RT3 B;  1UD7 A;  1L7Y A;  4ZRJ A;  2MBH A;  3PTF C;  3BY4 B;  1VD2 A;  1LFD A;  4II3 B;  4GU2 A;  3V61 A;  1C1Y B;  2FAZ A;  2FCS A;  2PEA A;  4M8M A;  1SGH A;  4NQL B;  2MW5 A;  4NJ6 A;  4M0W B;  4JLC A;  1WXA A;  2OJR A;  3L0W B;  4LJO B;  2NBV B;  2LGX A;  3IFW B;  1J19 A;  1V2Y A;  3QCA A;  3L13 A;  4B6W A;  1WGH A;  2O2V A;  1V49 A;  5EDS A;  2CS4 A;  1OEY J;  2Z59 B;  1V86 A;  4W9K A;  3R7Q A;  4EZK A;  2FCQ A;  3HHM A;  2MBQ A;  2LRW A;  2BF8 B;  2KX0 A;  3DBH I;  2DZI A;  3CST A;  2MBE A;  2LI5 A;  5JZE B;  4GMV A;  4BKS A;  4W9G A;  2ZJD A;  2JRI B;  4K81 A;  1WJU A;  3A9K A;  3WAL A;  5KHO A;  2N9E B;  2JWZ A;  2O2V B;  1QZE A;  4WJQ A;  1XT9 B;  5E6P A;  2UYZ B;  3JW0 X;  3M63 B;  5BO4 B;  4MSQ B;  1LQB A;  1GNU A;  1EF5 A;  1UGM A;  1GUA B;  4J6I A;  2KDI A;  1ZKH A;  2KD0 A;  2J0M A;  2K8C A;  1S3S G;  3A9K B;  2G4D B;  4DK5 A;  4F1S A;  3PGE A;  4TKN A;  4URK A;  2KDB A;  2K39 A;  2KC2 A;  4W9E A;  4I6P A;  2LXA A;  1WGG A;  4CO7 A;  4K7S A;  5CHV C;  3SDL C;  4MGY E;  3JVZ X;  4IG7 B;  3KYD D;  4I6N B;  2IY0 B;  5DPR A;  2WX1 A;  3T8M A;  3ZLZ A;  5AZG A;  2BKF A;  1IP9 A;  1UEL A;  1V9J A;  3EHV A;  4A3P A;  3PHX B;  4WWN A;  2JPH A;  4W9C A;  2G4S A;  1E7V A;  2C5L C;  3ZNI D;  4W9H A;  2LGY A;  4DHZ B;  2KWU B;  4KIK A;  3ONS A;  3NZS A;  4GB9 A;  2KLC A;  2KFK A;  5E6N A;  1IPG A;  3PS6 A;  2DEN B;  4MGI E;  2ZNV C;  3CSF A;  3DDC B;  2MSE D;  3NZU A;  4IW0 A;  2CHX A;  3M62 B;  3WAO A;  2IYD B;  2CU1 A;  2IO1 B;  2DZK A;  2BPS A;  4G3X B;  1JRU A;  1WMH A;  2DX5 B;  2MP2 A;  1UBQ A;  2O6V A;  4BFR A;  3AU4 A;  3OLM D;  3PLV A;  4ZYN A;  4KIK B;  1WXS A;  2ZZP B;  2IY1 B;  2KFK B;  2AL6 A;  3IHP C;  2IO2 B;  2KMA A;  4N9F 4;  3V62 A;  5D6J B;  2FCN A;  4GDL A;  1IYF A;  4HXD A;  4KVG B;  1FXT B;  3RCZ A;  4LDT B;  2G45 B;  3VAW A;  1K8R B;  1WMH B;  2MP2 B;  2CKH B;  3PRE A;  1WM3 A;  1MG8 A;  2DZM A;  2MLB A;  4BOZ B;  5C23 A;  4GN1 A;  2KDF B;  4EUT A;  1HE8 A;  2KQ7 A;  2LGD A;  2L76 A;  4GOC A;  3UIP B;  1GG3 A;  3B0A A;  2L3Z A;  4XZ4 A;  4HJK A;  4ICV A;  1YX5 B;  4WAA A;  2ZCC A;  1SE9 A;  2MRP A;  3PT2 B;  3ML8 A;  2KJ6 A;  3VTV A;  4W9F A;  4GDL B;  1GC7 A;  3KYC D;  3ZRF A;  3L17 A;  2C9W B;  3AUL A;  4FLH A;  4BKT A;  3UIN B;  1V5O A;  2CHZ A;  3HM6 X;  3KW5 B;  4DXA B;  3AXC A;  2KFJ A;  4PYZ A;  2J0J A;  3PRP B;  2C7M B;  1OEY A;  2HE7 A;  2RGF A;  3DBS A;  3APC A;  3VDZ A;  3VUW A;  3ZUN A;  2KAN A;  3A9J A;  4MM3 A;  3HM3 A;  2MQJ A;  2UWQ A;  4BKS D;  5J2R A;  2LJ5 A;  2BWE S;  4DHJ B;  4JGH B;  2XEW A;  4K7W A;  5TR5 A;  3K9O B;  1YIW A;  3P2B A;  4WWO A;  3M3J A;  5G55 A;  4AJW A;  4HVB A;  1WGR A;  1WM2 A;  4FHJ A;  4M8N A;  3W1Y A;  1Q5W B;  2AEH A;  3U30 A;  3ZDT A;  3VTU A;  4JQW C;  4E71 A;  5JH5 C;  3A9J B;  1BT0 A;  1TGZ B;  3PLU A;  3R7R A;  2LWP A;  3W1S A;  3V6E B;  3ENE A;  3RUL A;  1GC6 A;  3KVF B;  3UQB A;  3NS8 A;  1TZ1 A;  2LUE A;  2WX0 A;  5CHF A;  2KN5 A;  3SD5 A;  1E90 A;  1P0R A;  1NI2 A;  1RRB A;  4KSK C;  3RZF A;  3RD2 A;  2KDE B;  4II2 B;  2WWZ A;  2N1V A;  4DHZ E;  2Z0D B;  1NDD A;  2I1K A;  2JRH A;  2KX3 A;  2MX2 A;  2LRU A;  1ZW7 A;  2DHZ A;  3AI5 A;  2WDT B;  3IG3 A;  4HPL B;  2GBR A;  2W9N A;  3A4S C;  3ZNH B;  2FIF A;  2HJ8 A;  2KOX A;  3QA8 A;  3TJP A;  2D11 A;  5DPT A;  2KWV B;  3X0W A;  1LXD A;  3R66 C;  3T9L A;  3D32 A;  2RR9 A;  3HIZ A;  4EZL A;  5IAA C;  2L7R A;  1WI0 A;  2LZ6 A;  2M8S A;  3R3M A;  4FJZ A;  2KMC A;  4XX5 A;  3OJ3 A;  4LDT D;  5D94 A;  4TV3 A;  4ANU A;  3MTN B;  3VHT C;  2RD0 A;  4FN2 A;  3V6C B;  1X1M A;  5IA7 A;  4HDQ A;  5L95 C;  3PZD A;  2L0T A;  1E8Z A;  2JZZ A;  2L05 A;  4G11 A;  4KV2 A;  4HLE A;  4MSM B;  5DPW A;  2L0F A;  2G3Q B;  1Q0W B;  5KHQ A;  5J18 A;  2N9X A;  3WAP A;  3N32 A;  3PHW B;  3M95 A;  3VFK A;  2NPT A;  2V1Y A;  1WE6 A;  2GBM A;  3NHE B;  3N3K B;  2AWT A;  2KK8 A;  3DBR I;  1I35 A;  1WX7 A;  2MA9 B;  3Q3J A;  3APD A;  3L10 B;  2FCM A;  4DDG D;  4ZRI A;  4IWO A;  2JT4 B;  1WX8 A;  3KH0 A;  5G2N A;  3U8Z A;  2PE6 B;  3ZO5 B;  4G50 A;  1KM7 A;  3VVW B;  2JF5 A;  4DHJ D;  4E3C A;  4KZC A;  2KC1 A;  1WJN A;  1WRD B;  4BKG A;  1E8Y A;  2JY6 A;  3H6N A;  4W9I A;  2BYF A;  2NPT B;  3SHQ A;  3A33 B;  2DAJ A;  4IM3 A;  1XQQ A;  2N4F A;  2IO3 B;  1L2N A;  2PE9 A;  3DOW A;  1RLF A;  2KLG A;  3V60 A;  2DAF A;  3UF8 A;  2IO0 B;  3ZVV A;  3WIM A;  4GIV A;  3ZKJ C;  3IBE A;  3TIX A;  2JUO A;  4DDI D;  2REX A;  4NY0 A;  2J0K A;  4MH0 E;  2KWC A;  3ZTD A;  2JXX A;  1WXM A;  2XBB C;  4AOF A;  3DVG X;  4GSW A;  4IWQ A;  2KHW B;  4GGQ A;  3CF6 E;  5LXH A;  4IM2 A;  4EEW A;  2VRR B;  2HTH A;  2KVR A;  3EEC A;  4PS3 A;  2O6V B;  3TL5 A;  1KJT A;  4GDK A;  2A4Z A;  2ZVO A;  3QQ8 B;  1SIF A;  4NAW A;  1H4R A;  2C7H A;  4MGZ E;  4FBJ B;  3WAM A;  1Z5S B;  3EFU A;  3QHT A;  3QWZ B;  1Y8R C;  3QAQ A;  2EKE C;  4FJY A;  4F8C B;  1ZGU B;  4PS7 A;  4WJO A;  4HCN B;  5AEK B;  3TMP B;  3VH3 B;  2ASQ A;  3PSE B;  2KKC A;  3L54 A;  2C7N B;  4LCD E;  2K1F A;  1J0G A;  1WIA A;  2EMS A;  3ZW3 A;  4IUM B;  4FJV B;  1WZ3 A;  4GDK B;  1P3Q U;  3Q3F A;  4EKU A;  3VH4 B;  3I3T B;  3NY5 A;  1C3T A;  3H7P A;  1WGD A;  4NAW B;  4W9L A;  2FNJ B;  1YD8 U;  2MCN B;  4OVV A;  1KOT A;  3ZRC A;  3A1Q A;  3PV1 A;  3L16 A;  2BKR B;  2L8J A;  4A3O A;  1LM8 B;  1GJZ A;  3RUI B;  1ISN A;  4MGK E;  2M0X A;  4FAD A;  2ZCB A;  2NS5 A;  2RPQ A;  4HCP B;  4ANV A;  5JHA A;  3ZTC A;  1WH3 A;  2KTF A;  2DYO A;  4IM0 A;  2BYE A;  4P7I A;  3GOE A;  2KO3 A;  2Y5B B;  5DCN A;  3KUC B;  2K8B A;  3RYT A;  4FA6 A;  3H7P B;  1V5T A;  2RSU A;  4BVU C;  1WYW B;  2IZV B;  3HK0 A;  3ZIM A;  3A1Q B;  3C0R B;  4XC2 A;  3WA0 A;  4KZ0 A;  5CX3 A;  3IVF A;  3VTW A;  2KJR A;  1WX9 A;  3CMM B;  4CYE A;  1WFY A;  1D3Z A;  1EF1 A;  2D07 B;  2LVP A;  3ALB A;  4BBN C;  4IC7 B;  2ZPY A;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...