3KUGA

Crystal structure of e. coli hppk(h115a)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPAYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
molecule tags Transferase
source organism Escherichia coli
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kugA00
4CRJA 1RTZA 5ETPA 4PZVA 3ILJA 4CYUA 4CYUB 5ETLA 3HSJA 3MCOA 1EQMA 4M5GA 4CWBA 4M5LA 1KBRA 3HSGA 3ILOA 2CG8A 3HSZA 4M5JA 5ETQA 1EQ0A 1RB0A 1TMMA 1Q0NA 4M5NA 1HKAA 1HQ2A 1RU2A 5ETMA 3UDVA 5ETNA 1RAOA 3HSDA 1EX8A 2BMBA 4M5IA 5ETRA 4F7VA 3HCXA 1DY3A 3HT0A 3MCMA 3KUEA 1CBKA 1G4CA 3ILIA 3KUHA 3MCNA 4M5MA 3UD5A 5ETSA 3UDEA 3IP0A 5ETKA 5ETVA 3KUGA 4AD6A 3HD1A 5ETOA 4M5HA 1RU1A 2F63A 1F9HA 5ETTA 3HD2A 1TMJA 3ILLA 4M5KA 2F65A 3QBCA 2QX0A 1IM6A
chains in the Genus database with same CATH superfamily
3GFXA 5KFOA 4R8UB 2MZJA 3DHWC 5DO2A 1H7XA 4H4OB 2C42A 2MHEA 3I5CA 1SBRA 2R8JA 3GZ7A 2X1FA 1ITPA 1IR2A 1DQ8A 1H98A 2EKYA 2ZHOA 3OFFA 1UWBA 2CPJA 4FVCA 3QPIA 3GV5B 2XZWA 2LKZA 1S1UA 3DGPA 2BOPA 4ES1A 4RUAA 1EZZB 1RA6A 2EG2A 2C22A 1YJNS 1TTHB 4DR6J 4WFXA 1F6TA 3G8SA 2HVDA 3P49B 2B9XA 1TV6B 3QLHA 3HFVA 1DTTA 2CDQA 5C42B 4DL6A 3UCGA 1VQOS 2DR8A 1N52B 1IKXA 4LJMA 3EGVA 5FLXY 4ZIWA 1KLNA 1CS4B 3PM9A 1JLBA 4DQIA 4RW8A 4BWMA 3HD2A 1VBZA 2VODA 2BR0A 1WG1A 2IM3A 2M7SA 1XTZA 2OHDA 5DRKA 2CRLA 2DNLA 5ETPA 5BYRA 1F5BA 3TAPA 4YEAA 1OS5A 4FNHA 1TAUA 3IXQA 3FNNA 1SIWB 2DCUB 1TL1B 2EVZA 3DU6A 5CCLA 3PZPA 3W2WA 1WF0A 5IZHA 5LMUJ 4JI8J 4I2QA 4Z7CA 2VPYB 4ED5A 2VB6A 5D3GB 2VPWB 3FEXB 4ANCA 1B64A 5DDOC 4EWTA 3P8BB 4GO5X 2PO4A 1S9GA 4MK7A 4CH1A 2KU7A 7FD1A 1GX5A 2D74B 2QRRA 3IS9A 3KUHA 1R6YA 3FUYA 3M6VA 3VGVA 4IFVA 2CQDA 2KKHA 3MMBB 1GFWB 3OL7A 2HFSA 2HRTA 4QWCA 3ITHB 2L48A 3UCZP 3HVWA 1NK5A 4EO6A 3CULA 3CJ3A 5CABA 4XDDA 1RHJB 1W25A 5ADZA 5EDWA 1X8DA 4LRDA 3UD3P 2FZKB 2UUBJ 1Y9OA 1VC6A 3AOCA 4KR0B 2E5LF 3JSBA 2WAQD 3W65A 2JLEA 3F56A 1V3SA 4NLYA 1Q4RA 3FSYA 3GIKA 1FEEA 3QT6A 1FF2A 4L74A 4PQAA 4LF8J 1S1VB 2JL9A 4I2PB 5D0HA 5D78A 3T6JA 1XNQF 3GTYX 2ZHBA 3NWGA 1IBCB 2K7JA 4UOHA 3LP0A 4P6QA 3SSQA 2X1AA 1X5TA 2D69A 4XK8C 5KFAA 3D2WA 2NSCA 1D0EA 4WBFA 1IR1A 3EGWB 2W25A 3NS5A 3RR7A 3EZUA 3HHLA 3TARA 1KHWA 3NGDA 3OQ2A 3JQKA 4LFBJ 1EP4B 3QO9A 3CJ5A 5DDQC 3FZ2A 3NGTA 3OV7A 1RT5A 4LSLA 4OYPA 4RW7A 1RAFB 4M5LA 2J7UA 2HIQA 5E3QA 3DLHA 1QM9A 1YJVA 5D0GA 2WVCA 3D3BJ 3OXGA 4QWEA 1B0VA 4ED2A 5KT6A 5DG7A 1X4EA 4ZVOB 3SSSA 4CIOA 1X4FA 2QG9B 3LP2A 4ES2A 4FF4A 2HHHF 1NB2A 5BXIA 1Q8IA 1VQKS 2R7OA 4USVA 4RX6A 1NCLA 2MMYA 4QR2A 3IRXB 2C1EB 2CNNB 3W5YA 2QO3A 1LWFB 4UW2A 1HYSA 3RR8A 4UY8T 2FQQB 3A3NB 3EICA 3KLIA 2FD2A 2L9WA 3K7RA 1RJJA 2A2DA 1HNWJ 3WBZA 1M5KC 3OBIA 4L73A 4NL5A 2DYAA 1X31C 4ZPAA 2V4RA 1WOOA 4OV6A 2E5JA 4ZPWR 2ZH6A 2DGOA 2V2KA 2POKA 5KFUA 4P2FA 1QDUB 5IM0B 2UUTA 1NSQA 5LSRA 3T5JA 4GC7A 3BR8A 4FKYA 4LF7F 4KHPF 1SVDA 2JJ4D 1GNKA 2XMKA 1UWAA 1MROB 2W01A 3BZQA 2U1AA 4FBTA 3TJAA 1F3VA 2DGSA 4J9RA 4PUOA 1Q5VA 1R8CA 3C8YA 3OR1B 4DR2F 4Z2XA 3VGUA 5C42A 3EPGA 4OYZA 2ZKUA 1FWLA 3HT3A 1APSA 1BQXA 1T94A 4G6VB 1XEZA 5C5JA 3MDFA 1L5UA 2MSTA 3FFIB 3M1VA 3N9UC 3NS6A 4USHA 5DDPC 2R9LA 2FTRA 3W64A 2VICA 5J2NA 3R5DA 1P8GA 3QRRA 2W1BA 4JI2J 4R0JA 2XLJA 3HHLB 1NSPA 1IKWB 1SCJB 2L3MA 1XERA 2WW8A 1JLFA 3DDNA 2GVDA 4KGVB 1WHWA 4LREA 1EB0A 2FYXA 4KAIA 1S9EB 1U8WA 4CLLA 3OVSA 2QL5B 4RKUC 2Z58B 4ES3A 3MR2A 3LP0B 1VRUB 2XEXA 2W2PP 3TJ9A 4GO7X 4LFBF 5LT5A 4WFYA 1SQFA 2PEHA 1S48A 4HVZA 2E1AA 3H5XA 4C8ZA 1NM2A 2LXIA 4PPDA 3E2EA 3W5XA 3DMJA 5U47A 3E01A 1HQ2A 1TKDA 2NREA 3DYAA 3H7HB 3I87A 1O8BA 4LR9A 2QLFB 2V8GA 2O1PA 2HS4A 4MKBA 2UUAJ 4RZRA 2QIFA 2OP5A 3M7VA 2DNHA 1QAJA 2QTWA 2VPZB 1P27B 2J6TA 1XNRJ 4M5DA 2LQ9A 5KFXA 4KJIA 2D7SA 2GO8A 4JB8B 1UEVA 2HGMA 3DLLQ 2OAUA 5JXSA 5C25B 1VLYA 1PAUB 3GYNA 3O3LA 3PYFA 4J9PA 1WI8A 1WHVA 2XHCA 5B0AA 2R7WA 2KJWA 1IKYA 4AL6A 4ECSA 4JI7J 3MMJA 2VQEJ 2JRSA 1EP4A 5HBMB 2XSJA 1U26A 1S1UB 1VYAA 5SUHA 4DL0C 2AYGA 2VA3A 1LFWA 4DN0A 4CYUB 1S0OA 3AA9A 5B0CA 1NPPA 4DR3F 4LF9F 2HHSA 2A2CA 1U24A 3IWNC 4CH0S 3ENAA 2NXCA 1CPZA 4R8UA 3KK2A 2FLPA 2PFFB 3JS9A 1IKVA 2VQFF 3QJPA 4WIQA 2XY7A 1WACA 3KMQA 2FJDB 1CULB 3GLJA 3OFHA 2BQRA 1PYSB 1KTVA 4XAKA 5KG0A 1J5OB 3FCHA 4GVBA 4FDFA 3R97A 3R9LA 3TAQA 3THVA 1ZS6A 4USMA 4FS2A 3KK1A 4HH0A 3VV2B 4K2JA 3VAMA 3RBEA 2XG8A 2VG7A 4JI6F 1LXNA 1EETA 4YOEA 5EX0A 3GJTB 1S6QA 5D15A 2WZ1A 3P6YC 2ZH1A 2Z56B 5EWFA 4LF9J 3NY0A 1QLNA 1IKXB 2XLKA 3NNAA 5G0RB 1FJGF 2KVIA 1TV6A 3U02A 1URNA 2D3UA 3NS7B 2OD6A 3QNWB 4EEYA 1I6JA 3AA8A 4C7QA 4P74A 2ZNZA 1X4BA 2DR6A 3M2RB 1XIQA 3SBMA 4C0BA 1SH0A 5LJ3Y 4DSEA 2MB0B 4Y6IA 4RJVA 4IR1A 2V8DA 3C3LA 1AUSL 4OI3A 1UEUA 4USWA 3KLVA 1VHFA 5E2QA 4UOCA 4NLDA 4DFMA 1C0TA 3PW5A 3DN9A 2X1BA 3AXMA 5I3UB 2HEKA 1ZOTA 4CLWA 3MEKA 4ICLA 3VGTA 1NSAA 2R4FA 1RT2B 3K5MA 3C6TA 1TELA 1KNZA 2D3O1 1NK4A 2ASLA 1K9MT 4JI0J 4KHMA 4DF4A 1S6QB 3MEGB 3SV3A 3HSJA 4I64A 1ZH5A 2XS2A 4ELTA 3GIIA 1RAAB 4ZP8A 4CQ1A 4OX6A 2V4QA 3FSIA 2MKHA 2XY6A 3CW2C 3MM7B 1L3SA 2AMCB 2WVFA 3BS9A 1FRJA 4A48A 5IWAJ 3DMJB 3V2UC 2JC0A 4YR0A 1REGX 1WHYA 2V6AA 3MOZA 3OTEA 3BO3A 3LOUA 3OPKA 4AQYF 2XCAA 3MCMA 1FD2A 5HMWA 1XK8A 1BE4A 1T9UA 4P2SA 1JNZB 1MN7A 2FHOB 5HO4A 2QEXS 2QFJA 1RYSA 1VDHA 3DLKA 1NJIT 3KLIB 1AFJA 5KFIA 3QWUA 4ZA1A 3QQCD 2CUYA 4PXEA 3T5KA 4P73A 4FXDA 2NCKL 1CJVB 3R6GB 3CCZA 2NSBA 3A8IA 2B8QA 4DSIA 4NOHA 1HNIA 2UV8G 1HWIA 3ILJA 1N33J 2VG5A 2JFKA 2EBEA 2GQQA 1CQNA 1C1CA 2BEFA 4GVLA 4JYAJ 3Q22A 1H2UX 1ZZNA 2UXBF 2XMWA 2AHOB 1FRXA 2VFUA 5F3ZA 1KQFB 1YJ9S 4NZ0A 3LF0A 4DSKA 4DL4A 2SXLA 7AT1B 2LDYA 3RUBL 3W8GA 2Z4PA 4DDFA 3TUZC 2H65B 4ECWA 2WB1D 3ILIA 3AD7C 2JLGA 4P72A 3G96A 5KFVA 2BXJA 2GHPA 3LO3A 5KFTA 2DNKA 1A0OB 3ULHA 1R3NA 3GJRB 4USIA 1RP5A 3DOLA 3S01A 3HK2A 2Q79A 2RH3A 4MKAA 2N3OA 3K0JA 2AKWB 3M8PB 4JOUA 3RRHA 1IBLF 2HHUA 2GVDB 4BC7A 3MM5B 1CSJA 2DH9A 3NOCA 4KPCA 1OWXA 2OPQA 4YB6A 2VIHA 3IWXA 4ZITA 4DSFA 2XMMA 1S99A 2D9OA 3OLBA 1TFYA 3M4XA 2CFXA 3MEEA 4GKJF 1HD0A 4Y34A 3KTQA 1GMWA 2C2DA 4ZOSA 1LW2B 3ISNC 3OXFA 3OXLA 5DZ7A 1N33F 1TKZB 4TN2A 1FE4A 3QAUA 2BKPA 4U96A 1RWVB 3A4TA 1MROA 2RKIA 3IP0A 4PCQA 3UDCA 1IUJA 2YH1A 3D0GE 1RWKB 3I55S 2AT1B 2XLIA 1JLCB 1S1TA 2AJ4A 2OPPB 1SUQA 2E1RA 3KNGA 2X3GA 5GMKa 1TK0A 3K17A 4LRFA 3C14A 4GKKJ 3FK4A 4NA3A 3DDKA 5L9XA 3OD2A 2WVEA 4WYLA 7FDRA 1D9FA 2QLXA 1TAQA 3NEKA 1WKJA 5HMXA 1R7IA 2Z2YB 3MM6B 2UXDF 1JLFB 4X62F 2YPZA 3UCUP 1KQSR 2ALYB 4NLOA 4TYAA 2B4UA 3OJUA 1RTDB 4ECXA 3DOMA 1ZM4A 1RK8A 4C8OA 1ZPWX 2BDPA 2H3EB 1FI4A 2GMLA 5KFWA 3TQ1A 2G2OA 2F8HA 2R7UA 5HJYA 1FVQA 3DOKB 3RB0A 2WSCC 3JB9k 2OFHX 2H4YB 1RAGB 3KG1A 2IVMA 2QC3A 5J2QB 1SH3A 2IM1A 1NO8A 1R0BG 2RHQB 3AB2B 4TNOA 2PD1A 3H5UA 3QO9B 4UF4A 4CRJA 2A10A 1D9AA 2B4OA 3PY8A 5LMNJ 2OPQB 3EXYA 1B99A 1Q16B 3ET6A 5F8MA 4DQQA 1CQMA 3ILOA 5KFJA 1FNXH 4I68A 1HNVB 3IGNA 1NK9A 4WJBA 2ZD1A 4ZVEA 1NNDA 4EMDA 5IV4A 4B3RF 1UZHA 3MPUB 5GMDA 5KG1A 2UXCJ 4F4KA 4GKKF 1SH2A 2AX1A 1OYEA 2OSRA 3FRZA 1UVKA 1VC0A 1X4DA 2BW2A 1XMBA 2ZWPA 4DV5J 2QE5A 1GTEA 4ETXA 1PBAA 2HLTA 2GQCA 3D54A 3SCJE 1FKOA 3QYYA 4KFBB 3G6YA 3PTWA 5I42A 2XS5A 3PO5A 2HFNA 2HS3A 4X4UA 2A0FB 1HBNA 4Y2IA 1JLBB 1KC8T 4IO1A 4KRWA 4RBTA 1ROFA 3K2YA 3TI0A 1HA1A 3M8ZA 2A6MA 1M5VC 3FBCA 4FYXB 1RHMB 3CNQP 3FMWA 3EDQB 3CD7A 1YX2A 2VBYA 4QIVA 2WRMA 2AZ3A 3KKFA 3ZC4A 1NXIA 2PE8A 1NJZA 4OX9J 1HBOA 4KO0B 3TVKA 2QLWA 5HQMA 2O01C 4OJ3A 1R0CB 1S79A 2DNRA 4K4WA 3J7YI 3KDOA 4S0MA 5DLFA 4J9LA 2XYGB 2KFZA 2GMHA 1TR0A 2MLYA 5A2QY 2RDJA 1SC3B 5J2PB 3VAJA 2VQEF 1S72S 3BB5A 1WC6A 5LSLA 4WP8A 3SDEA 2J9CA 1T9WA 2VPXB 4PG6A 2FJXA 1P6TA 1S4FA 2PC6A 4MT1A 3EX7B 1TL3A 5CYQB 1G7CB 4CLSA 2DXEA 3QATA 2VDIA 3C16A 4CP5A 3LQVA 4CTAB 5F0WA 4DV5F 5D0RA 5G4DA 1QVGR 2MKJA 4UUWA 3IBFB 1VQMS 1AUDA 1BUXA 4KH0B 4OYIA 2LA6A 5K20B 4HYKA 1N36J 3KK3B 2HLUA 2EPIA 3FCVA 3GG0A 2EKNA 4F26A 1XR6A 1X4HA 3MMCB 4IH6A 2X7IA 3HVRA 3BJYA 2C2RA 1X4CA 4MFBB 1NUEA 2UUBF 3PX6A 2B56A 3JSRA 4QYRA 1T03A 2KFNA 1RT7A 2Q1LA 4URSA 1LWXA 2LYVA 4KV8B 2DPJA 1HNIB 3MD3A 5LMNF 2FLNA 2N7YA 5LJ5Y 2W7OA 1QY7A 1TZ0A 4HACB 4DV4J 4ZVFA 2EFVA 4MK9A 4NLTA 4ZN1A 1Y5IB 3IS9B 1HNZF 1UJ5A 2RU3A 4IRKA 1UPMB 2ZBQA 3QMQA 3I0RA 1RT6A 4OHWA 4BWJA 1F5AA 1C1CB 3D3CJ 3D4JA 1S9GB 3M2UB 3L7UA 2YNGB 3PW0A 2H1YA 2JLFA 4Y2KA 1IBMJ 4PEOA 5DETA 2OEJA 5KFCA 1JJHA 2MJUA 3BM7A 1DQAA 3IG1A 3JQJA 3M6WA 4KC5A 1IBKF 4JI3J 1BQMA 3PRVA 1UVIA 1FXLA 1FEHA 2YH0A 1TK8A 2RU9A 2DHAA 3MMCA 3CJKA 4F67A 1CVJA 2V4JA 3R7BB 2YNFA 2HBYB 2BUNA 4RNHA 5H9FJ 2GJIA 4IG0B 2BJEA 3UQSA 3KLHA 3M6UA 1RLCL 5HROB 4FPRA 5HK4A 4DX5A 3SQGA 1YIJS 3H8YA 2ZKTA 3LPYA 4F7VA 2IJRA 1PJ5A 1KRPA 4QYZK 5KOWA 5GAEU 4CLFA 2DH8A 4QIGA 2HHWA 2CQ0A 4DUTA 1NZ8A 1HWKA 2BACA 2KB2A 5CYQA 1TL3B 2MZTA 4OI2A 1I3OB 2CNOB 2ADCA 5E33A 1B4SA 3EE3A 3CCQS 4QQBA 1HNWF 5A8WB 2HZVA 1AW0A 3R7SB 3D9BA 2QX0A 3TYTA 5KAKA 4CTAA 3JSMB 1N5QA 2CWXA 1N5YA 5DQHA 3OTDA 1F9FA 1F5CA 1RTJA 2E5GA 1IJFB 4UTGA 4O0IA 4DR1F 3IAM9 3ZZYA 2ZBRA 3BREA 1MN9A 3CCES 2RE1A 4RW4B 4J9SA 2WONB 3Q8UA 1NDPA 3TJ8A 3KJVB 3M8RA 8AT1B 4C9DA 2ZUGA 2NZCA 1EX8A 1ZAWA 1KLMB 4Y28C 3GIJA 2BJ9A 2B8PA 5I3PA 3LWMA 1T9TA 2NYHA 3G6XA 3U1LA 1KHVA 1RUSA 4P75A 5ETVA 5MAOA 3ZZRA 2W9BB 4V19J 2R7XA 4OX8A 4ZK7M 2ZHAA 1WSRA 3LANA 5H9FK 1TL7A 4J9NA 1N0UA 4OZ1A 1U0HA 1VBKA 3UO0A 3CCJS 1CG2A 1E6YA 1ZBTA 2CAJA 3GJSB 3H2VE 3MPWA 2FHJD 4FZVA 1YQHA 1WKLA 5T7LA 1K1SA 4P10A 4CWBA 1ELOA 4N56A 4C8YA 1CC7A 3P96A 1SXLA 2XULA 3A1YG 3M9NB 1PYTA 2BRKA 3IO1A 3M30A 4X64J 4CO3A 3CXCR 5DM7Q 4ED4A 4DV0F 1X4AA 2CPXA 2JNJA 3K59A 2G0IA 2KI2A 4RW9A 1FKPB 2MKCA 2RF2A 2IJFA 4FN5A 3BQ0A 4A8KA 2BZ2A 5C24A 3MEDA 2AGPA 4K4SA 4N8OA 5KFBA 1WEZA 1R89A 2LFVA 5HBMA 5HVFA 1RCXB 2WOMB 2GJFA 4NLQA 1IKYB 2B9YA 2VC1A 2ADBA 4PG5A 1YSJA 1H72C 1NSKL 4FS1A 3DLJA 2PMZD 3CUNA 5KG5A 3MPYA 2CG8A 3KG4A 2Q66A 4NZ6A 5E3AA 3TX0A 1SPBP 1HBNB 2YQ1A 3OR2A 3AQPA 3AOAA 2YNFB 4LFCJ 1AFIA 4K0KF 2M70A 2KM8C 2KXFA 4OZNA 3Q8YA 2LU1A 2U2FA 3EGNA 3EM1A 1M1KT 4V19X 2B9EA 2MJNA 2VD3A 2A6OA 5CXTA 1MU2B 1OPZA 2ZH8A 5HLFA 2V8VA 3PW4A 1FRLA 2CZ4A 4RO0A 4LRCA 4FP9A 3NGRA 5J2NB 3TRGA 2XC9A 3K5PA 5ETOA 4NXNF 2V94A 1UVLA 1FRKA 2VBZA 2NLWA 2ACMA 4XPEA 2FJEB 4ALZA 4E2FB 1Q8BA 1YLXA 1QTNB 1RTZA 4KB7A 1S49A 3QZ7A 4DV7J 4OZJA 2CNKB 5D4PA 1AROP 2C2ZB 3DRPA 4F0HA 1S0NA 5GADI 2BABA 2KG1A 2B4PA 1ZTWA 3D7SB 1BQNB 1BY9A 5AJ3J 2FVRA 3Q24A 3H2LA 4LFAF 2BBEA 1RA7A 4PXCA 4V1Ak 1EKRA 2XHWA 2Z8QA 3THTA 3OSNA 3GP9A 4NYPA 5KFNA 2CPIA 2QYGA 4LBIA 5GAGI 1Q81T 4KQZA 1T9VA 2V2QA 5AE3A 3DRXA 4TVAB 5I4MA 4IQXA 4UY85 1WNEA 1KVJA 2E1PA 2KRRA 3SQOP 4X66F 4F3MA 2XCPA 3F41A 2I38A 2H5JB 1B0PA 1VC5A 1I94J 2Y8WA 4JI4J 4ZCMA 2F65A 1Q7LB 5FDLA 1FX2A 2IYIA 2PMHA 1BWEA 3KNAA 2PT0A 3L7PA 4DX7A 3M8WA 4J37A 4C3MA 5J2PA 4DUZJ 4ZJLA 2H4WB 1BC6A 3PG9A 1TP7A 2HNZA 2XY5A 2QA2A 3ITHA 4DR3J 5ETNA 4CDIA 4XDCA 1TKTB 4BDPA 2VV5A 5B0EA 3UNGC 4WXOA 2B5JA 2YY3A 3R5AA 3RGIA 2OJ3A 3J7ZT 4R5PB 1RWPB 1HI8A 3BF4A 2W9AA 3CCLS 2RS2A 3D28A 3JYTB 4DV3F 3HVTA 2MLZA 3LW5C 4B3MJ 1RWWB 4RW4A 3C15A 5K5MA 1BGXT 1ICEB 1TMJA 4HT7A 1N4LA 2KTQA 2C3MA 3M8SA 2COLA 4RBUA 1YHQS 2ZOFA 2RMLA 3IAS9 1T7PA 1VS3A 4MH8A 2K06A 5F9LA 1UKUA 3R2DJ 4NCGA 1VMBA 2KT2A 1RE1B 2JC1A 3M32B 3Q8SB 3S7RA 2B6AA 3DLGA 1MSWD 5A8WA 3H5YA 1Y7PA 2MEWA 1Q0NA 3K8WA 3PRDA 5BYQA 1SJQA 1PJ7A 4NZ7A 2F8EX 1HWUA 2LXUA 2IRXA 2M5YA 4I6YA 4UZBA 2FC8A 2RAQA 3MUMP 5EGYA 3I96A 1DTTB 2J8AA 2JVOA 2J0SD 4IOAQ 4KHPJ 2MQNA 1W2IA 1QE1B 2O3DA 4O3OA 4AXIA 5A6PA 5AXNA 5I3UA 1FA0A 4IG0A 3NRBA 2GAHC 4A8MP 3DGPB 3CJKB 3G6ES 2HW3A 3OTOF 1CJKA 4M63A 2PN6A 4NLXA 2ZJRQ 2GW8A 1WC3A 3G86A 1HLWA 4TU8A 4M94A 2VONA 3GV7B 3C6UB 3LP1B 1RAJA 3DRSB 2ZVSA 4UT4A 2LCWA 4B3OA 2O5DA 4DR2J 4DQSA 1OJ4A 3MZIA 1RHKB 2CZ9A 4WYWA 1KBRA 1PC5A 3BGRB 3W2WB 1CJVA 1RGVA 2NZ4A 2M0GB 1U1RA 4X4QA 4R0EA 3R1HA 1RAOA 4NLRA 2V0NA 4O3QA 4DN9A 1L3KA 3JTOA 1XMQF 4Q8FA 4J9QA 2KYXA 1C1BA 3HT0A 5KFFA 1VQ9S 5F8NA 2R2RA 4EBDA 4NX9A 3NGUA 1N5SA 3FKBA 2M2BA 3NG8A 2VUGA 5K8MA 1XMOJ 1NJYA 4WCEQ 1LKZA 3DC2A 1MMDA 3DRYA 4DU7A 3UR0A 1RISA 1Y3KA 2X1GA 4BLGA 2UXBJ 2VG6B 1C4CA 1RBAA 3WX8A 1P1TA 1ZAXA 4URQU 4NEZA 3MFIA 4F4WA 1BMQB 1LWCA 4DR7J 2WOMA 1SJFA 1XN9A 4H4MB 4PG8A 1ZM9A 1Y10A 4OFZA 2R7QA 3RJMB 1CS4A 1L3VA 3QGHA 2B6AB 2HVZA 3MEDB 3QAEA 4I1TA 1DZ5A 2WB4A 2UUWA 2HBZB 2I0XA 3C16B 1T05B 2BANA 2CPEA 2ZDOA 1LW2A 5B0FA 2HWTA 1MWZA 1GXUA 3I6PA 4KY3A 1W26A 3M8QA 4TKTA 3C19A 2HRUA 3J81U 2RUGA 4WP9A 4FVMA 3CEDA 4YQWA 2MGZB 4Z7YA 2DXFA 2RHSB 3KUGA 4ZIVA 3T3FA 1M5HA 1LQ9A 2MQPA 4IOBA 1GK8A 1SL0A 2UVWA 2J5AA 5IC6B 5GAGU 2AD9A 1R31A 5HL7Q 1YBAA 1JLEA 1OMSA 1LEOA 2EFGA 1S4EA 2CPHA 3GMGA 4W98A 3ZFVA 4AXJA 5BR8F 3O1LA 1HQUB 2PI4A 4C8KA 5GADU 2AQ4A 1JMTA 2E9ZA 4ZVHA 5GAHU 2DVIA 4M5DB 4NLSA 2DO0A 2DNGA 1FJEB 1X60A 2LXFA 2MYFA 1RWNB 3VAFA 1S1WA 2HSEB 4URGA 2YX7A 2CQ3A 4E8UA 2DTJA 3D6HB 2J9EA 3ELHA 5DG9A 1WG4A 4NA1A 2HZAA 1K47A 4O44A 2XS7A 4WFAQ 1IJEB 1S76D 2YXLA 3QJLA 2BVZA 3KK2B 1KD1T 4ZJOA 2F63A 3D6TB 4RW6A 4IH5A 4DWIA 4TQRA 1RT3B 1SL1A 1HL6A 1V9OA 3DDIA 3KWMA 4EO8A 3OFEA 4TU9A 2E7VA 2M88A 2OMLA 3GU0A 4KYZA 1KN6A 1V3RA 2XMUA 2OELA 2WBRA 1J5EJ 4W4MA 2EI5A 1NEEA 4LVNP 1N5TA 2AJ0A 5C25A 4I67A 2GA7A 2ZBCA 2HKEA 3X3UA 2BJ7A 3KJQB 3P3DA 2H51B 5F0UA 4KKOA 3T1YF 4DQPA 3BBCA 2E1CA 1Q8LA 4ZHRB 3AFGA 3MD1A 5HSPA 4UUXA 3PW7A 2Q3PA 3HD1A 2IVFB 3R5BA 4FF3A 3E01B 4LF4F 1V6HA 2OSQA 3EGZA 1WC0A 5HMYA 3IRXA 1HYSB 4G1QA 1SL2A 2JEJA 2GIQA 4TU7A 3RAQA 3LP2B 2K1RA 5THWA 1D09B 2CPFA 4DX6A 4Z37A 3BQ2A 4E0DA 3QRQA 4DV1F 3D1OA 1R0AB 2QN6B 4HDHA 1X0FA 1KOOA 1M5PC 4WFBQ 3CD6S 4MK8A 2ZITA 2EG1A 3E51A 2JEIA 1Q79A 3SYZA 1CJKB 4OI0A 3CF5Q 5J1NA 1UEKA 1ACMB 1B3TA 1VFJA 2AZ1A 2GVZA 2KRBA 1WOSA 2C2MB 4M5IA 4KV8A 1DY3A 3GFZA 3CPWR 1JXEA 5AE2A 4Q43A 4QW9A 4K0KJ 2ZE2B 3O44A 2ZH4A 1YRXA 5C24B 3L4BC 3TQEA 1HBMB 2QZ8A 4NCBA 4Q0BA 1UW4A 2HQCA 4ENOA 3MR6A 2IMWP 3HZGA 3SMZA 3OUYA 1SC1B 1AXQA 1EIYB 4ZCLA 2OUGA 3TNVA 5IM0A 4LIWA 3GIMA 3CCVS 4TLQA 1J5OA 1FFSB 3MAAA 1Q5YA 4ELUA 5F8LA 2W2OP 4PYAA 5HANA 3OL9A 5KFPA 3TZYA 2DNMA 2Y1JA 4KSEB 2KG0A 4LBPA 3AJ1A 1FHTA 1XJWB 4C8MA 3CD0A 3MECA 5KFHA 2OFGX 4OJGA 3NMAA 1ZAVA 3PEJA 1X5PA 3MR3A 4ILRA 2FHJA 4JI4F 1S1VA 1FXDA 4NRUA 3UD4P 3CDWA 3HHDA 4X66J 4FF2A 4DR7F 2KYZA 3BEGB 4X4SA 1LXJA 2P8IA 4DUYJ 1X5OA 1VK8A 1BXNA 1WF2A 2C2OB 5MLCV 2CJ9A 3CSKA 2VKZG 4OLOA 4XO0A 1OSDA 1FJGJ 3AXKA 2DB1A 4AL7A 1U1KA 2VA2A 2HNZB 3DGVA 3J81Y 1FWPA 1UAWA 8ATCB 2JWNA 5B7WA 1OPIA 2MZSA 1VK3A 3CCUS 4EUVA 4AFFA 2YX4A 3K8VA 1QVFR 1DURA 5ETLA 4M1KA 1H2TZ 3CJSA 2AJ1A 4JBCA 4ZVSB 5KFRA 1RT4A 1RTJB 1CJTB 1DFDA 1C0UA 2V9KA 4H4KA 5A76A 3NLCA 4G65A 4ZCIA 2DNNA 2XNRA 4DU8A 3R5JB 1ZA2B 3W9IA 2HYIB 4UQGA 3GQCA 2MPUA 3CC4S 1T11A 3DI6B 4F3OA 4USTA 3T9NA 4K4XA 2V68A 5CH7B 4RUCA 4B9VA 3UN5A 4J91A 3PV8A 1GQEA 2PMWA 1HR0J 1S59A 2HNYB 4WK1A 2W9BA 2HURA 2BKOA 3BO2A 3OVBA 5KT5A 2HHTA 4KGKA 3PEHA 4XIUA 5JVHQ 3QFWA 1Q8KA 4WZQA 2CQHA 3AH6A 2UXDJ 1YJWS 1FJ7A 4EBCA 5DZ6A 4P52A 1RT1A 1FT8A 4ZS6A 2RRNA 5IV3A 1JB0C 1T3NA 2HK3A 1M1GA 3FEZA 4F04B 3CCSS 5KT3A 1FK9A 4F4YA 3ISZA 3MAHA 4C6AA 4OX7A 1JXLA 2RQKA 1RT2A 2ATCB 3ETOA 2YWGA 2PA3A 4OJ1A 2DIUA 3TP2A 2J7WA 3OFGA 4HTIA 3P45B 1AB8A 3G87A 2BA9A 1NKEA 4Y2MA 2VC0A 2DHXA 2XYHB 3CMQA 4O3SA 2BYCA 1MMLA 1RWUA 4X4PA 3HJFA 4Q5VA 2IHR1 3H0PA 2EC0A 1H73A 2KDOA 2NPIA 3SCIE 3PR4A 4JI1F 2JDJA 5LXRA 2OPRA 1WC1A 2V2ZA 2ZBIA 3H40A 2E29A 1WEYA 1U0HB 3J7YU 1Q86T 4J90A 2ZJQQ 4GKJJ 4GRSA 1KFDA 2KO1A 4HR2A 3RBZA 4ZJQA 2BQ3A 1S0MA 2DD8S 1QSLA 3I5AA 4WWSA 5CD4A 1SQGA 2YWKA 4BHQA 4M95A 2NR0A 4X4VA 2GS8A 4R25A 2JSXA 5CZXA 4ATNA 2DEIA 3CO0P 3FMBA 3RTVA 3PYGA 1H74A 1X0PA 1U47A 1KLMA 2JVRA 2F4VF 3HZEA 1RT3A 4NCGB 3ZZUA 3QIPA 4P9SA 2P9EA 3KHLA 1CULA 4RPFA 5KG7A 4UZCA 1GT8A 1JX4A 3TUPA 1H7WA 1YZ6A 4J9KA 2K8GA 1D1UA 1YRTA 4CO4A 2WBMA 2IMOA 4DCOB 3C15B 4USUA 1JIHA 2Y9HA 4NE9C 2O67A 4ED3A 1F60B 1HPZB 4L3KA 1I1GA 3SEOA 1FTCA 5HQLA 2YNIA 3R5CA 5D0EA 3TO8A 1VBYA 3H20A 2Y1RI 2UUCF 2Y1IA 3CWJA 1TUWA 4H4OA 3RZAA 4CYUA 5LSOA 2HAIA 4B3TJ 3H98A 3T41A 2RIJA 4DR4J 2Z2ZA 3AOBA 2KN4A 4YB7A 2XI2A 5F41A 3OL8A 1RB0A 1RKIA 2BJDA 4ZLLA 1T95A 2V69A 2BKNA 3MMAA 3P4UB 4CCHA 1J27A 2QGFB 2CJAA 3IM9A 1JLEB 4A4JA 4QWAA 2EFOA 1GXLA 2DR5A 1JJCB 3K58A 2HBQB 5HROA 2KZZA 5HP1A 1RLDA 1PGZA 2DRAA 1AZSA 4O0NA 5HVGA 4DV2F 4NLVA 2DGXA 3C6TB 2HGLA 4ZLNA 2IBOA 1JXVA 3GR0A 3KXDA 5AXKA 2FDNA 4DHVA 4C0HA 3ZZZA 3A3PB 3R1LA 2NUUG 4PZVA 1TL5A 4L76A 2UVRA 2UVUA 3AT1B 4CM2A 1GMUA 1HQEB 1RAHB 1ZZFA 3M2UA 4HLBA 1FK9B 4TLRA 1HPZA 1QAIA 2AWZA 3T1HF 4ERDA 1HHQA 3BYPA 1YRUA 3M2RA 1LFPA 2G0JA 2MZRA 2UZAA 1ZM3A 4DS5A 6AT1B 2UUCJ 5H1SV 3DRPB 3EVOA 1N36F 3QIPB 2XB2D 4B08A 3W66A 3VTIA 1P1LA 2DHHA 1REVA 3KLHB 3VALA 1U45A 1IM4A 3IWLA 1EETB 4QZVB 4WE1A 4MIBA 4I6AA 5KFKA 3IC1A 5KFLA 3TVZA 3T5LA 3JSYA 3I31A 3HX9A 3DRRB 3UVJA 2VJUA 1VQLS 2OTLS 4DFJA 1WOPA 1XWLA 2DGWA 5KFZA 1M5SA 1QSSA 1XNRF 1U1PA 3AY0A 1T02A 2B3TB 1WJ9A 4O4GA 1RTHA 2HQFA 3QIDA 3KMSA 1TVRA 4FKXA 1G6BA 3EYZA 3QZ8A 3AD8C 1NKCA 3LH2S 4I0WA 4OYBA 4B3SJ 3CO9A 5F8HA 2Q43A 4ZCKA 3GPAA 4OZLA 3NP5A 2MKSA 1VLOA 2OPPA 3RRKA 2LDIA 2J76E 3SSRA 1YZ7A 2XMAA 3T1HJ 4QIFA 4KGMA 3I0SA 3KHRA 3ICLA 1CJTA 2F4FA 4K2XA 2G1HA 2GNKA 3PYEA 4O23A 5J2MB 3FFIA 3M1VB 4RUBA 4F3QA 1N32J 2ZZTA 4YB1P 2O66A 2OI2A 2XWYA 3WIUA 4LF7J 3TR5A 5A2QU 2VQFJ 4LRBA 3CJ0A 1HIYA 2CDRB 4LFAJ 1S77D 2W8LA 4U7UK 3J80Y 1U2RA 4USJC 3CJQA 2LEBA 4IRDA 2ROGA 1NDCA 2NXJA 4XTTA 4MKYA 1NDLA 3OW2R 1LW0B 2QYCA 2VF3A 3DLGB 2VFTA 2HQ3A 5E0OA 2HNYA 2YX1A 2Z0GA 2V8HA 4ED7A 4LF6J 2JEGA 1HI1A 1NZAA 4HH1A 3NBPB 4DLEA 4ED6A 1N54B 3FGVA 5T7LB 3K89A 3DHXA 2EBGA 5K14B 1IQZA 4QPTA 2CVEA 4DF8A 3OT9A 3BR9A 1RTIB 3M6XA 1KTQA 1CJUA 3DFEA 4GMKA 1WWHA 3MGJA 2YKAA 4C98A 3HVTB 4TXSA 2G9OA 3IFEA 1N34F 2RT3A 4N8NA 3NAIA 2FY1A 1KQKA 1WC4A 3PR5B 2A1BA 5D6GA 2LU2A 3G4SS 4OZ2A 1T8EA 2ASYA 4JV5J 4U9RA 3IRWP 5D4OA 2I6WA 1U4BA 3I9ZA 3SZ2A 3HSGA 1TL4A 4DQRA 3GSIA 2R8KA 4JI1J 3D66A 3DOKA 2VZ9A 4LSNA 5E5NA 2AEFA 4W92B 2DK2A 1MLAA 1MW7A 1N32F 4KT0C 3BPSP 2F1FA 4K7QA 4CNZA 1FKAF 2MQLA 4F25A 4ECYA 5BR8J 3VAKA 4LF8F 5CZVA 2HQIA 1XNQJ 2LQJA 4K4YA 1YWXA 2WVDA 4MYUA 3MHYA 1AYEA 1FDDA 1RTIA 1SKUB 1F9EB 1PC4A 1DHMA 2NXEA 4I7FA 2OD4A 2HAFA 3MM9B 2PSZA 4F4AA 1DLOB 4PQUB 3FBBA 3HHNB 1DTQA 1U6FA 1YJUA 4DV4F 2ZBPA 1SUQB 5L1IA 2RQCA 1NK6A 1KVIA 3ET6B 2H5EA 1SJRA 2YKPA 2Z2LA 4B9LA 2YNHB 4K4TA 2JEFA 2YWHA 1WTFA 2AEMA 2C3PA 4DV6F 1U6BA 2FVCA 3Q2TC 1E6VA 4I4BA 2ACYA 4A8OA 4KKOB 3OTCA 3FC9A 4F0MA 4RLEA 3RB3A 2BMBA 1TKZA 2FVPA 2E7XA 2E5LJ 2P6TA 1VR6A 3BSCA 2MTLA 4YDXA 4LQ3A 2R7VA 4FBUA 5EWEA 3CC2S 2FUG9 1TU0B 2IC3A 3W63A 3KG0A 3ILLA 4OZ3A 2FGOA 3QBCA 4HHHA 2VH7A 2IRYA 3NGSA 4NYOA 3SFGA 2ROPA 4FPIA 3OSPA 4ZPTR 1LWEB 1S6UA 3SFUA 4TQSA 2QA1A 2PIIA 4PXDA 5H9EK 4UOFA 4DPTA 1RTHB 4I7FB 3DLEA 2BE2A 1M1HA 2EFPA 1FNMA 3US5A 3E8OA 2CQ1A 3EPIA 1JKHA 2PI5A 4XPCA 2GQ2A 5IXUA 3KHGA 3V81A 1VQ6S 1Z2ZA 4JYAF 3BGFA 3RG6A 1TK5A 1GX6A 2XO7A 4BS2A 2ZH7A 1OIAA 4DG1A 3V4IA 1WEXA 2HHQA 2NS1B 2W4PA 1CLFA 3DCAA 4RW7B 2AP6A 3TUIC 4LF2A 2A18A 1NKBA 2DNZA 1QD1A 3Q8PB 1NH8A 2MKIA 2DHGA 2HRYA 3ENVA 1PCAA 1J2VA 4N5SA 3MPVA 5L1KA 2KXNB 1XQIA 1F0XA 2X3DA 4N77A 2B51A 1T3OA 3IM8A 1KWMA 4AT1B 3DM2A 4HT5A 1KVKA 3LPEA 3Q89A 5DGBA 1WI6A 3CCTA 1NAQA 1YKWA 4EZ9A 2H48B 3SV4A 1RACB 4YDDB 3A12A 3EDRB 5K14A 5GAEI 2VASA 3O5TB 2I2YA 2W2MP 1EAYC 1H2VZ 3ENQA 5DG8A 4DUZF 4IH7A 4KTQA 3W62A 2MHNA 4WPAA 1VQSA 1LK7A 2BM1A 4P2XA 4ZVGA 2HNDB 1P9YA 1T0TV 2HGNA 3S1TA 1RWXB 2E7WA 2MLXA 3P5TL 2R2UA 2V4JB 2ZH2A 2L41A 3B8HA 4BC9A 3T5HA 3H4BA 5KTQA 2GIRA 3DYAB 4DOZA 2QLBB 1HQUA 3GCWP 4DBQA 1NK7A 1LV5A 1N0VC 5IOLA 4QW8A 5K8NA 1DRZA 1JLQA 4NI2B 1KDNA 1Y5LB 2XMVA 3BGRA 4DEZA 2HFUA 2D41A 1FVSA 1RZMA 2EWHA 5SZTA 1NHKL 2DIVA 4U6PA 3DRSA 3W2VA 1SV5A 2BE7D 2QLJB 2YTCA 4LT6A 2HWIA 1N56A 3NKYA 1IKWA 3NGKA 4NXMJ 3KLGA 5CYMA 4ED0A 2HZCA 2C3OA 4HACA 9ATCB 5GAHI 1FO1A 4NMXA 1I51B 1S97A 4ZDNA 3IGVA 3VF0B 3Q0AA 2EEYA 4IUFA 4MIWA 4FF1A 2RDDA 1VQ4S 3EVMA 3D1QA 2BJ1A 3D0IE 4ID8A 3KHHA 3R2CJ 4M5NA 2W9CB 2I5JA 4PUOB 4L72B 4NMLA 3A8JA 2VKRA 3IBWA 1RT1B 1DAXA 5K8PA 1VQ8S 4LF4J 3BKUA 4OIXA 1N48A 1V5VA 3WC0A 3KK1B 3TANA 4DPUA 2RRAA 2HHXA 2VG6A 1YBUA 1G3OA 3C66A 3OL6A 2CVIA 3LGHA 4NRTA 4LVOP 1W7WA 4WXWA 1NJWA 1DTQB 1XR5A 3H59A 3AODA 5IT9Y 3AQOA 3GSDA 2ZH5A 2UV8A 3PRBA 4ID5B 2ZEJA 5EHHA 3I56S 3I9V9 2HBRB 2HFOA 4C8NA 4OYWA 4ZVTB 1SIZA 3M9OB 2G0CA 4HI1A 4USKA 2HHPA 3M32A 1RT6B 3I0RB 1O0PA 3VVUA 4WIIA 1FFWB 1YDLA 3MUVP 1U0SA 3W2VB 5A6WA 4NLPA 4Y2AA 2C3UA 3H42A 1BD6A 2FPHX 3ZZ0A 2ILZA 2J0XA 2FHKA 5T41A 4DL3A 1HNXJ 3CMES 1K73T 1K0VA 2NQPA 3Q8QB 2KXHA 1VQ7S 2DPIA 2NPFA 2P6SA 2DJWA 5HN0A 3VAHA 3MR5A 4LF5F 1A6LA 1AZSB 4OLPA 3QFHA 1TMMA 2VOPA 3FJ2A 3PO4A 2HFZA 1U6ZA 2XSFA 3UDVA 4Y00A 3B6BA 3RAMA 3TEGA 2W24A 1AT1B 1QSYA 1U1QA 4U8VA 2E1MC 2YKNB 5L1JA 1SC4B 1UL3A 2YWWA 2LMIA 5B09A 4QU6A 2J0WA 1HHSA 1VIOA 2CQPA 2W7AA 4GVBB 3UD5A 2AJQA 3UPFA 4IG3A 3CJRA 5IQQA 4WU3A 3GONA 5HI7A 4OHXA 4HHJA 3CD5A 3DI6A 2IAJB 3MCSA 1RXOB 4CH7A 2ZH3A 2QV6A 2LA4A 2WK4A 3J7Z5 4MJKA 3VVTA 1HNVA 2XNQA 3EXCX 2AX0A 2MY7A 2Z30B 3I32A 3PW2A 1RHRB 4WKRA 3G6VA 4F8RA 4DCJB 3R8YA 4Y0FA 5L8RC 1VRTB 1YK9A 3L3CA 1UA1A 1GEHA 1EHWA 4MIAA 4N7TA 3EWGA 5E3CA 4YS2A 5B0BA 6FD1A 3QGPA 3OHAA 2CZVC 4O3RA 3GILA 3WDOA 2BJ3A 3KOAA 4IDKA 1T9YA 1JLGA 3V6JA 4DL2A 3VAIA 3O2IA 3BH6B 3G8TA 2OMOA 3OR1A 4LBHA 2CYYA 3J81j 1CEZA 3T1AA 3RAXA 2WCXA 2I1RA 3TWZA 2CA9A 2G13A 3JAMU 3M2VB 4RWWA 4FYVB 2AYBA 5J2MA 2ZZMA 3HFZB 3FEYB 2OTJS 2YNHA 5JJBA 4ETZA 4DV7F 4A8QA 4B02A 3NWRA 3S6EA 3HHKA 5A8KA 2GO9A 1IXKA 4HHUA 4O3NA 4EYIB 2DR9A 4OYAA 2IBKA 3NCQA 1H0HB 1X7VA 4MYTA 2BV3A 4NEYA 3A13A 4C2MA 4DFKA 1D8YA 2YVSA 3JTPA 1N34J 2HIYA 1YJ7A 4HEA9 2B43A 2V8PA 3I5BA 5IC4B 4ITSA 2Y0BB 3B4DA 3RBXA 1HWJA 2GX8A 3KJFB 3MR7A 1JLCA 1S1TB 2R2TA 4J9MA 1PO6A 4DSLA 5CYJA 4DCPB 4ECVA 1M0SA 3NAHA 5C7PA 4O3PA 1RADB 2DNQA 2Y3YA 4CLPA 3HO1A 2PEBA 5IT0A 1CBKA 2ABYA 2G2ZA 2F4VJ 1FWKA 4OI6A 2IY5B 3Q83A 3B82A 3QGGA 4DFPA 1QAXA 4OYMA 4WU2A 1JLGB 1UPPA 3N79A 2AJ2A 3F73A 2E5HA 4EK2A 3MF5A 3GFHA 1E6VB 4ICLB 3N28A 3UFCX 1F1BB 4YMEA 4A8WA 5F3TA 4ILMA 4DI6A 4DPXA 3NMRA 4ZPCA 3BGUA 4KGZB 2E9TA 1Z1ZA 1PJ6A 4X65J 5J1EB 3HHLC 3PHTA 1LOUA 3PDNA 1SKWA 3V6DB 1S7IA 2DGQA 2JHEA 1RSCA 2EFNA 3CCWA 4KHRA 3U1NA 2LP4A 4F2RA 4P7VA 5D3GA 4RW6B 5FLXU 4LF1A 2VFRA 2DKOB 1FESA 3BDEA 3NOGA 1IBLJ 2GCFA 4K4VA 4LIRA 1UVMA 4G1QB 1UFLA 1VQYA 4X64F 4PPZA 5F8IA 3KUEA 1IBKJ 4JI3F 4B3SF 1S9FA 3G82A 4KGXB 1V5IB 1VOMA 1R43A 4DPYA 3G71S 4B9SA 2N7CA 5HP1B 4CO5A 1YGYA 2MQMA 4WE1B 5F8JA 3FDSA 1S10A 2VG7B 2FGCA 5ETTA 3A3OB 3RB6A 1REVB 5IT9U 2F7VA 4NLWA 2GJ2A 3ZTOA 1RYRA 4ELVA 5A8KB 1M90T 3F0NA 2OPSA 3RRGA 3FRYA 2C28A 2KZMA 2APOA 1K1QA 3QLHB 3Q86A 2OIHA 2XGPA 4DR5J 4LSLB 1QJHA 2NXUA 1MWYA 2DT9A 2UUAF 1XR7A 3MEEB 4OZ0A 3G8QA 2G4BA 1Y5NB 2CQIA 4B9MA 3CVKA 3Q8VA 5KFQA 1VQPS 1HKAA 1D3WA 1K44A 4NPOA 2M3DA 2J7KA 1YG0A 2MSSA 2M4MA 4OI1A 3ZTRA 4ECRA 4Q2MA 1GMWD 3KJVA 1HQEA 3HKWA 3HCXA 2HVEA 4C8LA 1HMVA 1OSCA 1XC9A 3L7OA 4RUHA 5JMNA 1S5ZA 2CNLB 2QL9B 2RD5C 3FBEA 3KDNA 4ID5A 4MKVA 4ZLPA 5LXYA 2DNPA 4X65F 4F4ZA 3VQSA 2GV1A 4OMFG 1JJ4A 2VL1A 2ZM6F 3HM9A 4DLGA 2WVBA 3PKYA 2YPYA 3T1YJ 5AT1B 3WQPA 1ZTTA 1QUPA 5DJBA 4IFYB 4JUZA 1GMVA 3TX8A 2N4CA 3UVJB 5A0YB 3QSIA 1FDAA 3HKZD 4ED8A 4U7UD 4K50A 1EJ7L 4DV2J 3D6MB 3LAMA 1WD6A 1FRIA 1HFEL 2OEKA 1XMOF 2D9PA 5EWGA 2IA0A 1BLUA 3BSOA 4JI6J 1TUVA 2ZWOA 2IRUA 2CJBA 3N4WA 5ETRA 4ANEA 2V63A 1RQ0A 3IG1B 4RWXA 5KT4A 1K8AT 1YITS 2R7TA 3A8KA 2NYIA 3I0SB 4WTYA 1C1BB 4FYYB 5F8GA 4B9UA 1VBXA 5E7OB 3WC2A 5M2PA 4N76A 3J7A1 4OYOA 3M9MB 1S0VA 3RW7A 3PIOQ 5C2CA 3HP6A 3TAMB 3R5GA 2KL8A 4ECUA 1NK8A 2LVWA 1VQ5S 3ZTPA 2CQGA 2IM2A 4LRAA 4QR1A 4RNMA 3RU0A 4DL5A 3V6KA 5GVQA 3JAMY 4YN3B 4NXNJ 4B3OB 5HLFB 4YY3F 4DSJA 3LP1A 4Y65A 1SJ1A 1UCNA 2F9JA 1Q53A 2ZDPA 1PKUA 1F2HA 3L09A 5G0RA 4E98A 3DLBA 1OY9A 3K57A 4X4NA 1WTBA 2CJKA 1A9NB 1OY6A 4DZ6A 4ECTA 4B9NA 4KPYA 3N6LA 3IBCB 2BOAA 1WHXA 3LAKA 3M8YA 2HPUA 3BH7B 3OR2B 4KBIA 2V9WA 5KT7A 1HD1A 2HS0A 2QMWA 2AYEA 1HBUB 1HW9A 2IYGA 2GHWA 2I5JB 3CJTA 3PXGa 9RUBA 4QR0A 2R8HA 2ZH9A 2HHVA 3QGIA 4RU2A 4WZMA 4N47A 3ZXWA 6FDRA 3C46A 2KVQE 1SKSA 3VGSA 1C0TB 2CPYA 3MM9A 4CNYA 4D3HA 2DNOA 3SXLA 3TA2A 1UJ4A 2XWXA 2CPDA 2FY8A 4ZKAA 3GIRA 4IFYA 3UN3A 1NLKL 1KEKA 3HPOA 1FERA 2QMXA 3PNIA 3FVYA 4Y3CA 1U49A 3NNCA 3QRPA 1HNZJ 1RI7A 4RW9B 2DY1A 2IDLA 3POTB 3W1YC 3NXZA 2DH7A 2P9GA 1VI7A 1Y00A 5ETQA 4YR2A 4ZP9A 1Q78A 4JI5J 2OGUA 4I69A 4DV3J 3SCKE 2ZUAA 4YHHJ 1IR0A 2VHGA 2WTFA 2IIHA 3HSDA 1SV5B 2E44A 5KG3A 3KJNB 2WSEC 2ZC4A 3EJMA 4LUBA 4HKQA 3E3XA 5RUBA 4A8SA 2GZOA 4IYQA 2XO6A 4MMOA 2QSWA 4U8YA 3OHBA 1PSDA 5KG4A 1IWAA 3HFKA 2HNDA 3LGNA 3O6QA 2K7KA 4WFZA 2GGPA 1N6QA 2V50A 1F9HA 1FX4A 2B7BB 4MFBA 4DR1J 2LEPA 5HVHA 1QUVA 4NWBA 1O6XA 5DM6Q 2F3JA 1IKVB 2W7PA 2HK2A 3KK3A 2M8DB 5JVGQ 2OKQA 3T9ZA 1LWEA 4C48A 1R27B 3BQ1A 4LF6F 2CWKA 3HSZA 1U1LA 4F2SA 2LLZA 4HDGA 3ONQA 3V6DA 4ILLA 1FJCA 2CQ4A 2GHVC 2IPOB 1N8RT 1F3FA 2WONA 3THPA 4CLTA 5DQIA 2ZOMA 1Y4ZB 2JOQA 2V34A 3EZ5A 2W4DA 3M8QB 5M2RA 1N5YB 2PDAA 3JQMA 2ERRA 3UNYA 2XYPB 1WDDA 1XMQJ 3TZXA 5AJ3F 1HI0P 5J1EA 2YKMB 4FNIA 1X4GA 3D0HE 1G2EA 4ZPVR 2ROEA 1U2FA 2DCLA 4RNOA 5L39A 4NLGA 1U7LA 4U95A 3FQLA 4J7CA 2YKQA 3UDLA 3HVAA 1EARA 1LNQA 2J0QD 1URRA 4DR6F 1D9DA 2LQ8A 1M5OC 5D4NA 4JV0A 3MM6A 5CHCB 1KONA 2GMJA 3ZZTA 1D8ZA 2BE2B 3V6HA 1R0AA 3DLEB 3CDAA 5KFMA 2DR7A 1MNEA 2QMUB 4CLYA 1TVRB 3BN7A 1RABB 3R3TA 3GR1A 5T14A 4IO9Q 1NU4A 1SKRA 5FDLB 1H6KX 3ADAC 4LQ9A 4TY8B 3V81B 1KKHA 4MTPA 5BJRA 3PJ9A 3T6BA 4EGLA 4GC6A 1G4CA 2RDIA 2W2QP 4JI5F 4W90B 5KFEA 2CIMA 1C0UB 1NK0A 3KYLA 1R8HA 1WUUA 1VRUA 1IN0A 2RKIB 2ZOGA 4H54A 3UW1A 2UU9J 1H3DA 1Z2LA 2E9RX 4UQTA 3EUNA 2DO4A 2L9DA 4P71A 2YNGA 4DMZA 4Q0BB 1X9SA 3Q23A 4KIAA 4D3GA 2RSQA 1QTMA 2OEMA 1S6OA 2V5HG 1PBUA 2AV5A 3BN4A 3DXSX 1B7YB 3GYXB 4OV1A 3PFOA 3TA0A 4WF9Q 2VFVA 5CA5A 2PFDA 4OHYA 4YFUA 1RCOB 1OY8A 4QYZJ 5M2UA 2AEJA 2EK6A 3GJQB 8RUCA 3QT5A 1QE1A 1OYDA 2AYMA 3N6NA 1YJRA 2YQ3A 2F5GA 4CO1A 2ZC3A 3CIZA 3CDEA 2AU0A 4A8FA 1FCAA 4OZ5A 4QPXA 1SB6A 3HLUA 4QWBA 3KLEA 1B70B 4J9UE 5HMZA 4YB5A 5LM7E 4CI0B 4DV0J 5FJ4A 2ILYA 1V3ZA 3UDEA 4YY3J 3IN5A 3TEHB 1H38A 1S57A 2CQ2A 2K3KA 4M5HA 4BBYA 1SQEA 1WG5A 2BM0A 3N01A 4RBVA 1VRQC 3TUJC 4TY8A 2J6UA 4KE5A 2RB7A 3BBFA 2A3JA 2ATLA 2UU9F 5KG6A 1JK9B 2XMTA 3PFEA 2UVVA 3D6FB 3CCMS 3QSYB 1L3TA 4OQJA 3C14B 3HXMA 1FFGB 2HMIA 3ZNJ1 5E41A 2XGQA 3MURP 1WC5A 4NA2A 3SIPB 2MXYA 3JYTA 3K5OA 3HMJG 3CCRS 5JUMA 1O51A 2HQDA 4IRCA 2J6SA 2R2SA 2CPZA 2DEJA 2GVZB 2V2VA 3HHLD 1HWLA 2YKOA 3P5BP 1U1OA 3H4DA 2FJWA 4AUKA 3S8SA 2UXCF 1DQ9A 3FQKA 1PAEX 4OYXA 5ETKA 4C11B 2MGZA 2FLLA 3CC7S 4B3RJ 1S1XB 1KP6A 5LL6d 4DPWA 5EN1A 5AXMA 3U7JA 3W61A 5K9FA 5IT4A 2ASDA 1IQTA 1VJQA 2XM3A 2KHDA 3N0VA 2NXNA 5C2GA 3GE9A 3D67A 3PJXA 4I2PA 3VR1A 3MAAB 3NCRA 2Y8YA 4ZVUB 3DLKB 4G3IA 2D3ZA 1CJUB 3CJ8A 1Z4UA 1FXRA 3PJWA 1Q1KA 2FC9A 3K5NA 3IR5B 5J1PA 2VFSA 2DNYA 5B0DA 4DX8H 4IOCQ 3MM8A 4EI2A 3OVAA 4IKAA 3KLEB 4QCLA 2I8EA 3GG1A 1TKXA 5DLGA 5CD4H 4RU9A 3MCNA 3AAWB 1ZM2A 2PA8D 4I56A 4DR5F 3D5MA 4DS4A 4OL8A 3I4HX 1UFWA 3LA0A 3ZTSA 2R8IA 5J2QA 1U1MA 2FLOA 2QSFA 2HG4A 1S12A 2CG4A 2YBVA 3W9HA 2W9CA 3AJ2A 3B4MA 2JX2A 4NLUA 2DISA 4JI2F 5BYSA 1NHUA 3UR3C 1K0TA 4DJBA 2OH2A 3W3SA 2HWHA 3MCOA 3U27A 1C2PA 2CJYB 3MI7X 3UWTA 5A8RB 2BE9B 3Q8RB 1UW9A 2FZGB 3ENWA 4O4GB 4RNNA 2ASJA 4AQYJ 1TL1A 3MOJB 2KH9A 1QAYA 4J5OA 2Z2MA 4ZP7A 2QA4G 3TAMA 3M30B 3J80U 1T05A 1KFSA 1WELA 1RBLA 1X5SA 3N5BA 4F0KA 2F8MA 4C97A 4F50A 1GAOA 1UA0A 2R3VA 3AJDA 4K4UA 2N82B 2VJVA 1NB7A 3MTJA 4Q7AA 3PX4A 4M5MA 3CT9A 1N5VA 2MY8A 1C4AA 3V5RA 3R27A 4QWDA 3CDBA 3VQTA 4JI0F 1G1XA 1N88A 5HAOA 4NCAA 4JV5F 2DGTA 2FZCB 3U1MA 3K5LA 4ER8A 4C4WA 3MM7A 3RYLA 3J7AN 4FXVA 5CCMA 4LF5J 1TFWA 2EC2A 4CM0A 3QJJA 5B0GA 4I6WA 1J5EF 3BGLA 2WW4A 1S6PA 2EW9A 4PAAA 2DRBA 2XI3A 4K59A 1WDTA 2YKMA 4WKYA 3VZIA 1FNOA 3NCPA 1HNXF 1RWOB 1SJ4P 1T9XA 1VIXA 1F2GA 3DM2B 4LR8A 1FDNA 2GC8A 2DGUA 4YUDA 3FCWA 3G2XA 3QWPA 3CDUA 1LK5A 2L08A 3IR6B 1CC8A 4RL1A 2XSJB 1KS2A 1RHQB 2F9DA 2RQ4A 3TOQA 1PIEA 2LECA 2Y0SD 2MKYA 1VRTA 3H5SA 3JTNA 2FVQA 4B3TF 1HMVB 2KM8B 3NL0A 2JZ5A 4FYDA 3F44A 2MDAA 2BX6A 1OQ6A 3MM5A 1IWGA 4HTJA 1U25A 3HF5A 3UI3A 4C11A 4DPOA 2BW7A 2BRLA 1W2BR 1Y3JA 1UZDA 4YR3A 5L46A 5DGAA 1S1WB 2C2NA 5FIIA 3PVXA 3BPDA 5FD1A 1KQGB 4Q2LA 2H54B 4P2MA 4ZLJA 2DRDA 1TKTA 1LWCB 2XBPA 5KOXA 1FD8A 3OLAA 1RT7B 2VBWA 2D3OR 1AA1B 3VWSA 3ZZPA 2AGOA 3CJ4A 1L3UA 3VAGA 1EQMA 3HULA 1X9MA 3BKFA 4MAKA 5KFSA 2IVYA 1RAIB 3UE2A 1HHTP 4L3NA 4EFAC 3W9JA 2MKKA 4K5SA 5ETMA 4JP8A 3B54A 1NRKA 3TA1A 4J9OA 1KOHA 4AE5A 3IMQJ 2M52A 3G82B 1VISA 1U2CA 2OO4A 3AHPA 2R7SA 2HFVA 4RR5A 5ETSA 1UMJA 3BKTA 1Q7YT 1BQMB 3BSAA 2GFFA 1RAEB 2ZD1B 3ZTQA 4X4TA 1JLAA 1ZPVA 3ISND 2Y1LB 4PR6A 4CT8A 4LR7A 4L6V3 4C3KA 1FTRA 1S9EA 3D1HA 4PWUA 3C6UA 2YNIB 2XQCA 3IR7B 4KH1B 4PG4A 3NNHA 2ZE2A 1SI9A 3JSMA 1Q82T 2LEAA 1RWMB 3ZZOA 1HR0F 3BDPA 2M9KA 1S6PB 5IS2A 2HVHA 4PWDB 2FB0A 2XZDB 4M5GA 4M5JA 4F4XA 5KT2A 3WX4A 3MFHA 1UP1A 2C2EA 1BWVA 3IA0A 1IBMF 2RVJA 4QIWD 4B9TA 1PYOB 2B7CB 4QJVA 5DS7A 4ZPBA 4ED1A 1TKXB 5B08A 1ZA1B 2H5IB 3CE8A 3SQGB 1HBUA 5GMEA 2HMIB 3MAQA 1B0TA 1DLOA 1NBEB 5DDRC 1KSPA 2CJQA 2K1RB 3CIMA 2DHSA 4EZ6A 4F02A 1GH8A 2P9CA 3H90A 2CQCA 2R8GA 1FRMA 2F40A 1RHUB 2CADA 3W60A 2LQBA 1JKHB 3BO4A 1U09A 2MZQA 4PYDA 1WF1A 2G1DA 3GCXP 4JV1A 1YBTA 2EXUA 2VU5A 2KT5A 3PKMA 2OLWA 3CMAS 4IR9A 2FHMA 4ZHRA 5A8RA 3W5ZA 4JI7F 3SDEB 2AIRB 4TY9A 4UOGA 5CYMB 3QT8A 2QA4S 3OJSA 1WORA 4LSNB 3VZHA 2EFQA 4LSZB 3VHQA 1WKKA 5E3PA 3GV8B 4ECZA 2AGQA 2JH3A 1RU2A 2E66A 5L9NA 1ZETA 4FYWB 3OTOJ 5IQ6A 2ALZA 3I4PA 4NYZA 2IM0A 2IA6A 2DY9A 3DU5A 2VBXA 4C0OC 2Q6BA 3GWCA 5AE1A 2I9SA 2RRBA 1S7HA 2RF2B 3RW6A 4ZN3A 2H9ZA 2K3IA 3MM8B 4QBUA 4IDKB 1FRHA 1JLAB 1R8AA 2MQQA 4N41A 2KT3A 3MECB 4EYHB 3AD9C 3L95X 1JJ2R 5KFYA 4DUYF 2RILA 1EKSA 2Q6CA 4OX9F 5HQ8A 2R7RA 1RTDA 1R6VA 3OTBA 4O44B 3BYRA 5DQGA 2KJVA 1VHIA 1U48A 1X9WA 4PWWA 1RBOB 3CGIA 3UN2A 3V4MA 4A46A 1TQLA 1SJ3P 4OHVA 1RT4B 1YTYA 3X1LB 3L9ZA 1LW0A 2J8SA 2FJBB 5D77A 3SI8A 4NXMF 1VCTA 4U67Q 3OUYB 3D68A 1B7FA 1E6YB 2IAJA 3PCOB 3WZ0A 4AL5A 1S1XA 5ITHA 3PIPQ 3NBPA 4ZVPB 2LQ5A 4DR4F 2ZJPQ 1ULRA 1NJXA 4R5PA 4PQUA 2GAGC 3FZBA 3TZZA 2B9WA 3CB4A 4AYBD 1RKJA 2W4CA 5E3RA 4X2BA 3W8PA 2KHCA 3BGOP 2HQGA 1NPRA 2ZFHA 3M2VA 4C3LA 1UFKA 4DV1J 2CXEA 2YWFA 2IJNA 1UJ6A 3Q2SC 4DXLA 3H2UB 4DV6J 2AJFE 2G2YA 1NMEB 1VJWA 1YVFA 3VCDA 3C2PA 4TYBA 2CKWA 2OPSB 1FKPA 3DXBA 1HARA 2J9DE 3MWBA 5HATA 2HHHJ 4QU7A 2VG5B 4X62J 1Q95G 4FXWA 3MMBA 3LTOA 3KFWX 1OQ3A 2QL7B 2P5VA 4I2QB 4CO2A 4IFVB 2WHOA 2AF6A 3POTA 4KFBA 4ZP6A 3MPDA 4B17A 1R8BA 3BSNA 2BANB 2GIFA 3R6LB 2XTJP 4OI4A 1PG5B 2IDEA 4CT9A 4Q8EA 5KG2A 2J9DA 3W7BA 1I94F 3GFYA 4ZVQB 1NDKA 1UVJA 4NASA 3ETMA 1KR4A 4IQMA 3O8WA 1YJTA 1MWQA 5IWAF 3FSXA 4PABA 4L75A 3MXHP 2RQMA 3N5FA 4ANDA 4X84A 2FJVA 4M8LA 1Y0HA 5K8OA 2EK1A 2IC3B 3DRRA 4M5KA 1BQNA 2WSFC 4QOTA 3WHIA 2DGVA 3M8PA 2C2KB 1A7GE 2P2CB 4PKDB 4A47A 1UTAA 2YQ0A 2X51A 4YP3A 4CO0A 3MEGA 1HBMA 3I82A 2DXDA 3H25A 4PG7A 4K4ZA 1EQ0A 4PXBA 3TZWA 1WSVA 1MG7A 4A8YA 3PACA 5IFMA 4K5RA 3SCLE 4DZDA 4ECQA 1ZYQA 4ZPDA 2L9NA 2RJZA 1VQNS 2QFIA 2QT7A 2VOOA 4F36A 2QJ3A 3DOMB 1MMNA 4K8RA 5LMUF 3RB4A 5F9NA 1O5JA 3DKDA 3KLGB 1HW8A 2MQ8A 1MU2A 3GYGA 4ZVRB 4EBEA 3CJ2A 4EU0A 3ZNUA 1UWBB 2AW0A 3GB0A 4G1IA 1U1NA 3M05A 4AD6A 2D1CA 4JV2A 4P7TA 4OJHA 1R8PA 1RU1A 1Y11A 2NUHA 2C3YA 2N3LA 2V67A 2ZNYA 1DBDA 3FBFA 3LALA 1JLQB 3LUYA 4NI2A 4ZMMA 2HVIA 2W8KA 2CJXB 5KFDA 2UP1A 1DARA 4LFCF 4U7CA 3JXOA 2VDHA 5CAAA 2R42A 4IG3B 4OHZA 3MUTP 1JQGA 1LWFA 3A8EA 4DL7A 2BQUA 1I5OB 1FDBA 1SC6A 2GGPB 3PHEA 5D4LA 3EVWA 4CZCA 1N6QB 3HJVA 2RNEA 4RW8B 3WIVA 2MZ1A 2XZTB 2Z57B 1DJ0A 1RDRA 2RS8A 1IVZA 4J9VA 5A0YA 5I3QA 2FIUA 2JFDA 1NHVA 2K2PA 4WK3A 4WFNQ 2BJ8A 3LWLA 1U02A 4CLUA 5HJXA 3B78A 3QT7A 1NPKA 1RT5B 1XBWA 2DBBA 3EMTA 1JWWA 3BBBA 1NH7A 3KLFB 3HDSA 4RNFA 2W2NP 1TUGB 1JNRB 1GXTA 3AB4B 3LGMA 4QIEA 3ZO7A 5CQGA 3KLFA 4PWDA 2ZVIA 5EUHA 4WP3A 1U8SA 2KFYA 3HHEA 1IM6A 2XMJA 3CTRA 2ZZNA 2FJAB 4YHHF 5L1LA 3G9CA 4LMZA 2DITA 4H4KC 2B0GA 3TW0A 2B5JB 3MTKA 1FE0A 2CQBA 4H4MA 3DOLB 3N6MA 5AXLA 4Q45A 4A8XA 1HBOB 4KO0A 3BV8A 2ZM6J 3PX0A 1TL7B 1T03B 1UVNA 3R7NB 3TVYA 5H9EJ 1GTHA 4X4RA 3EZOA 5EX3A 1BHNA 3RBDA 2YKNA 1OO0B 3DNCA 3HI9A 1YI2S 2MQOA 4HL9A 1VGYA 2OPRB 4Q44A 4BCAA 5LOQA 1P9QC 4DG1B 3V4IB 4B3MF 4CLZA 2RUSA 2FVSA 4G1PA 2IFXA 1FKOB 4CLKA 3T19A 5I42B 1PILA 4X4OA 2PGCA 3PYDA 2N4DA 3MMAB 5KFGA 1UETA 2E5IA 4JI8F 4O4RA 4Y2CA 4WTOB 4HI2A 5D8HB 2B4VA 2M8HA 4PRFA 5L38A 2YWEA
chains in the Genus database with same CATH topology
4CRJA 1RTZA 5ETPA 4PZVA 3ILJA 4CYUA 4CYUB 5ETLA 3HSJA 3MCOA 1EQMA 4M5GA 4CWBA 4M5LA 1KBRA 3HSGA 3ILOA 2CG8A 3HSZA 4M5JA 5ETQA 1EQ0A 1RB0A 1TMMA 1Q0NA 4M5NA 1HKAA 1HQ2A 1RU2A 5ETMA 3UDVA 5ETNA 1RAOA 3HSDA 1EX8A 2BMBA 4M5IA 5ETRA 4F7VA 3HCXA 1DY3A 3HT0A 3MCMA 3KUEA 1CBKA 1G4CA 3ILIA 3KUHA 3MCNA 4M5MA 3UD5A 5ETSA 3UDEA 3IP0A 5ETKA 5ETVA 3KUGA 4AD6A 3HD1A 5ETOA 4M5HA 1RU1A 2F63A 1F9HA 5ETTA 3HD2A 1TMJA 3ILLA 4M5KA 2F65A 3QBCA 2QX0A 1IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRJ A;  1RTZ A;  5ETP A;  4PZV A;  3ILJ A;  4CYU A;  4CYU B;  5ETL A;  3HSJ A;  3MCO A;  1EQM A;  4M5G A;  4CWB A;  4M5L A;  1KBR A;  3HSG A;  3ILO A;  2CG8 A;  3HSZ A;  4M5J A;  5ETQ A;  1EQ0 A;  1RB0 A;  1TMM A;  1Q0N A;  4M5N A;  1HKA A;  1HQ2 A;  1RU2 A;  5ETM A;  3UDV A;  5ETN A;  1RAO A;  3HSD A;  1EX8 A;  2BMB A;  4M5I A;  5ETR A;  4F7V A;  3HCX A;  1DY3 A;  3HT0 A;  3MCM A;  3KUE A;  1CBK A;  1G4C A;  3ILI A;  3KUH A;  3MCN A;  4M5M A;  3UD5 A;  5ETS A;  3UDE A;  3IP0 A;  5ETK A;  5ETV A;  3KUG A;  4AD6 A;  3HD1 A;  5ETO A;  4M5H A;  1RU1 A;  2F63 A;  1F9H A;  5ETT A;  3HD2 A;  1TMJ A;  3ILL A;  4M5K A;  2F65 A;  3QBC A;  2QX0 A;  1IM6 A; 
#chains in the Genus database with same CATH topology
 3GFX A;  5KFO A;  4R8U B;  2MZJ A;  3DHW C;  5DO2 A;  1H7X A;  4H4O B;  2C42 A;  2MHE A;  3I5C A;  1SBR A;  2R8J A;  3GZ7 A;  2X1F A;  1ITP A;  1IR2 A;  1DQ8 A;  1H98 A;  2EKY A;  2ZHO A;  3OFF A;  1UWB A;  2CPJ A;  4FVC A;  3QPI A;  3GV5 B;  2XZW A;  2LKZ A;  1S1U A;  3DGP A;  2BOP A;  4ES1 A;  4RUA A;  1EZZ B;  1RA6 A;  2EG2 A;  2C22 A;  1YJN S;  1TTH B;  4DR6 J;  4WFX A;  1F6T A;  3G8S A;  2HVD A;  3P49 B;  2B9X A;  1TV6 B;  3QLH A;  3HFV A;  1DTT A;  2CDQ A;  5C42 B;  4DL6 A;  3UCG A;  1VQO S;  2DR8 A;  1N52 B;  1IKX A;  4LJM A;  3EGV A;  5FLX Y;  4ZIW A;  1KLN A;  1CS4 B;  3PM9 A;  1JLB A;  4DQI A;  4RW8 A;  4BWM A;  3HD2 A;  1VBZ A;  2VOD A;  2BR0 A;  1WG1 A;  2IM3 A;  2M7S A;  1XTZ A;  2OHD A;  5DRK A;  2CRL A;  2DNL A;  5ETP A;  5BYR A;  1F5B A;  3TAP A;  4YEA A;  1OS5 A;  4FNH A;  1TAU A;  3IXQ A;  3FNN A;  1SIW B;  2DCU B;  1TL1 B;  2EVZ A;  3DU6 A;  5CCL A;  3PZP A;  3W2W A;  1WF0 A;  5IZH A;  5LMU J;  4JI8 J;  4I2Q A;  4Z7C A;  2VPY B;  4ED5 A;  2VB6 A;  5D3G B;  2VPW B;  3FEX B;  4ANC A;  1B64 A;  5DDO C;  4EWT A;  3P8B B;  4GO5 X;  2PO4 A;  1S9G A;  4MK7 A;  4CH1 A;  2KU7 A;  7FD1 A;  1GX5 A;  2D74 B;  2QRR A;  3IS9 A;  3KUH A;  1R6Y A;  3FUY A;  3M6V A;  3VGV A;  4IFV A;  2CQD A;  2KKH A;  3MMB B;  1GFW B;  3OL7 A;  2HFS A;  2HRT A;  4QWC A;  3ITH B;  2L48 A;  3UCZ P;  3HVW A;  1NK5 A;  4EO6 A;  3CUL A;  3CJ3 A;  5CAB A;  4XDD A;  1RHJ B;  1W25 A;  5ADZ A;  5EDW A;  1X8D A;  4LRD A;  3UD3 P;  2FZK B;  2UUB J;  1Y9O A;  1VC6 A;  3AOC A;  4KR0 B;  2E5L F;  3JSB A;  2WAQ D;  3W65 A;  2JLE A;  3F56 A;  1V3S A;  4NLY A;  1Q4R A;  3FSY A;  3GIK A;  1FEE A;  3QT6 A;  1FF2 A;  4L74 A;  4PQA A;  4LF8 J;  1S1V B;  2JL9 A;  4I2P B;  5D0H A;  5D78 A;  3T6J A;  1XNQ F;  3GTY X;  2ZHB A;  3NWG A;  1IBC B;  2K7J A;  4UOH A;  3LP0 A;  4P6Q A;  3SSQ A;  2X1A A;  1X5T A;  2D69 A;  4XK8 C;  5KFA A;  3D2W A;  2NSC A;  1D0E A;  4WBF A;  1IR1 A;  3EGW B;  2W25 A;  3NS5 A;  3RR7 A;  3EZU A;  3HHL A;  3TAR A;  1KHW A;  3NGD A;  3OQ2 A;  3JQK A;  4LFB J;  1EP4 B;  3QO9 A;  3CJ5 A;  5DDQ C;  3FZ2 A;  3NGT A;  3OV7 A;  1RT5 A;  4LSL A;  4OYP A;  4RW7 A;  1RAF B;  4M5L A;  2J7U A;  2HIQ A;  5E3Q A;  3DLH A;  1QM9 A;  1YJV A;  5D0G A;  2WVC A;  3D3B J;  3OXG A;  4QWE A;  1B0V A;  4ED2 A;  5KT6 A;  5DG7 A;  1X4E A;  4ZVO B;  3SSS A;  4CIO A;  1X4F A;  2QG9 B;  3LP2 A;  4ES2 A;  4FF4 A;  2HHH F;  1NB2 A;  5BXI A;  1Q8I A;  1VQK S;  2R7O A;  4USV A;  4RX6 A;  1NCL A;  2MMY A;  4QR2 A;  3IRX B;  2C1E B;  2CNN B;  3W5Y A;  2QO3 A;  1LWF B;  4UW2 A;  1HYS A;  3RR8 A;  4UY8 T;  2FQQ B;  3A3N B;  3EIC A;  3KLI A;  2FD2 A;  2L9W A;  3K7R A;  1RJJ A;  2A2D A;  1HNW J;  3WBZ A;  1M5K C;  3OBI A;  4L73 A;  4NL5 A;  2DYA A;  1X31 C;  4ZPA A;  2V4R A;  1WOO A;  4OV6 A;  2E5J A;  4ZPW R;  2ZH6 A;  2DGO A;  2V2K A;  2POK A;  5KFU A;  4P2F A;  1QDU B;  5IM0 B;  2UUT A;  1NSQ A;  5LSR A;  3T5J A;  4GC7 A;  3BR8 A;  4FKY A;  4LF7 F;  4KHP F;  1SVD A;  2JJ4 D;  1GNK A;  2XMK A;  1UWA A;  1MRO B;  2W01 A;  3BZQ A;  2U1A A;  4FBT A;  3TJA A;  1F3V A;  2DGS A;  4J9R A;  4PUO A;  1Q5V A;  1R8C A;  3C8Y A;  3OR1 B;  4DR2 F;  4Z2X A;  3VGU A;  5C42 A;  3EPG A;  4OYZ A;  2ZKU A;  1FWL A;  3HT3 A;  1APS A;  1BQX A;  1T94 A;  4G6V B;  1XEZ A;  5C5J A;  3MDF A;  1L5U A;  2MST A;  3FFI B;  3M1V A;  3N9U C;  3NS6 A;  4USH A;  5DDP C;  2R9L A;  2FTR A;  3W64 A;  2VIC A;  5J2N A;  3R5D A;  1P8G A;  3QRR A;  2W1B A;  4JI2 J;  4R0J A;  2XLJ A;  3HHL B;  1NSP A;  1IKW B;  1SCJ B;  2L3M A;  1XER A;  2WW8 A;  1JLF A;  3DDN A;  2GVD A;  4KGV B;  1WHW A;  4LRE A;  1EB0 A;  2FYX A;  4KAI A;  1S9E B;  1U8W A;  4CLL A;  3OVS A;  2QL5 B;  4RKU C;  2Z58 B;  4ES3 A;  3MR2 A;  3LP0 B;  1VRU B;  2XEX A;  2W2P P;  3TJ9 A;  4GO7 X;  4LFB F;  5LT5 A;  4WFY A;  1SQF A;  2PEH A;  1S48 A;  4HVZ A;  2E1A A;  3H5X A;  4C8Z A;  1NM2 A;  2LXI A;  4PPD A;  3E2E A;  3W5X A;  3DMJ A;  5U47 A;  3E01 A;  1HQ2 A;  1TKD A;  2NRE A;  3DYA A;  3H7H B;  3I87 A;  1O8B A;  4LR9 A;  2QLF B;  2V8G A;  2O1P A;  2HS4 A;  4MKB A;  2UUA J;  4RZR A;  2QIF A;  2OP5 A;  3M7V A;  2DNH A;  1QAJ A;  2QTW A;  2VPZ B;  1P27 B;  2J6T A;  1XNR J;  4M5D A;  2LQ9 A;  5KFX A;  4KJI A;  2D7S A;  2GO8 A;  4JB8 B;  1UEV A;  2HGM A;  3DLL Q;  2OAU A;  5JXS A;  5C25 B;  1VLY A;  1PAU B;  3GYN A;  3O3L A;  3PYF A;  4J9P A;  1WI8 A;  1WHV A;  2XHC A;  5B0A A;  2R7W A;  2KJW A;  1IKY A;  4AL6 A;  4ECS A;  4JI7 J;  3MMJ A;  2VQE J;  2JRS A;  1EP4 A;  5HBM B;  2XSJ A;  1U26 A;  1S1U B;  1VYA A;  5SUH A;  4DL0 C;  2AYG A;  2VA3 A;  1LFW A;  4DN0 A;  4CYU B;  1S0O A;  3AA9 A;  5B0C A;  1NPP A;  4DR3 F;  4LF9 F;  2HHS A;  2A2C A;  1U24 A;  3IWN C;  4CH0 S;  3ENA A;  2NXC A;  1CPZ A;  4R8U A;  3KK2 A;  2FLP A;  2PFF B;  3JS9 A;  1IKV A;  2VQF F;  3QJP A;  4WIQ A;  2XY7 A;  1WAC A;  3KMQ A;  2FJD B;  1CUL B;  3GLJ A;  3OFH A;  2BQR A;  1PYS B;  1KTV A;  4XAK A;  5KG0 A;  1J5O B;  3FCH A;  4GVB A;  4FDF A;  3R97 A;  3R9L A;  3TAQ A;  3THV A;  1ZS6 A;  4USM A;  4FS2 A;  3KK1 A;  4HH0 A;  3VV2 B;  4K2J A;  3VAM A;  3RBE A;  2XG8 A;  2VG7 A;  4JI6 F;  1LXN A;  1EET A;  4YOE A;  5EX0 A;  3GJT B;  1S6Q A;  5D15 A;  2WZ1 A;  3P6Y C;  2ZH1 A;  2Z56 B;  5EWF A;  4LF9 J;  3NY0 A;  1QLN A;  1IKX B;  2XLK A;  3NNA A;  5G0R B;  1FJG F;  2KVI A;  1TV6 A;  3U02 A;  1URN A;  2D3U A;  3NS7 B;  2OD6 A;  3QNW B;  4EEY A;  1I6J A;  3AA8 A;  4C7Q A;  4P74 A;  2ZNZ A;  1X4B A;  2DR6 A;  3M2R B;  1XIQ A;  3SBM A;  4C0B A;  1SH0 A;  5LJ3 Y;  4DSE A;  2MB0 B;  4Y6I A;  4RJV A;  4IR1 A;  2V8D A;  3C3L A;  1AUS L;  4OI3 A;  1UEU A;  4USW A;  3KLV A;  1VHF A;  5E2Q A;  4UOC A;  4NLD A;  4DFM A;  1C0T A;  3PW5 A;  3DN9 A;  2X1B A;  3AXM A;  5I3U B;  2HEK A;  1ZOT A;  4CLW A;  3MEK A;  4ICL A;  3VGT A;  1NSA A;  2R4F A;  1RT2 B;  3K5M A;  3C6T A;  1TEL A;  1KNZ A;  2D3O 1;  1NK4 A;  2ASL A;  1K9M T;  4JI0 J;  4KHM A;  4DF4 A;  1S6Q B;  3MEG B;  3SV3 A;  3HSJ A;  4I64 A;  1ZH5 A;  2XS2 A;  4ELT A;  3GII A;  1RAA B;  4ZP8 A;  4CQ1 A;  4OX6 A;  2V4Q A;  3FSI A;  2MKH A;  2XY6 A;  3CW2 C;  3MM7 B;  1L3S A;  2AMC B;  2WVF A;  3BS9 A;  1FRJ A;  4A48 A;  5IWA J;  3DMJ B;  3V2U C;  2JC0 A;  4YR0 A;  1REG X;  1WHY A;  2V6A A;  3MOZ A;  3OTE A;  3BO3 A;  3LOU A;  3OPK A;  4AQY F;  2XCA A;  3MCM A;  1FD2 A;  5HMW A;  1XK8 A;  1BE4 A;  1T9U A;  4P2S A;  1JNZ B;  1MN7 A;  2FHO B;  5HO4 A;  2QEX S;  2QFJ A;  1RYS A;  1VDH A;  3DLK A;  1NJI T;  3KLI B;  1AFJ A;  5KFI A;  3QWU A;  4ZA1 A;  3QQC D;  2CUY A;  4PXE A;  3T5K A;  4P73 A;  4FXD A;  2NCK L;  1CJV B;  3R6G B;  3CCZ A;  2NSB A;  3A8I A;  2B8Q A;  4DSI A;  4NOH A;  1HNI A;  2UV8 G;  1HWI A;  3ILJ A;  1N33 J;  2VG5 A;  2JFK A;  2EBE A;  2GQQ A;  1CQN A;  1C1C A;  2BEF A;  4GVL A;  4JYA J;  3Q22 A;  1H2U X;  1ZZN A;  2UXB F;  2XMW A;  2AHO B;  1FRX A;  2VFU A;  5F3Z A;  1KQF B;  1YJ9 S;  4NZ0 A;  3LF0 A;  4DSK A;  4DL4 A;  2SXL A;  7AT1 B;  2LDY A;  3RUB L;  3W8G A;  2Z4P A;  4DDF A;  3TUZ C;  2H65 B;  4ECW A;  2WB1 D;  3ILI A;  3AD7 C;  2JLG A;  4P72 A;  3G96 A;  5KFV A;  2BXJ A;  2GHP A;  3LO3 A;  5KFT A;  2DNK A;  1A0O B;  3ULH A;  1R3N A;  3GJR B;  4USI A;  1RP5 A;  3DOL A;  3S01 A;  3HK2 A;  2Q79 A;  2RH3 A;  4MKA A;  2N3O A;  3K0J A;  2AKW B;  3M8P B;  4JOU A;  3RRH A;  1IBL F;  2HHU A;  2GVD B;  4BC7 A;  3MM5 B;  1CSJ A;  2DH9 A;  3NOC A;  4KPC A;  1OWX A;  2OPQ A;  4YB6 A;  2VIH A;  3IWX A;  4ZIT A;  4DSF A;  2XMM A;  1S99 A;  2D9O A;  3OLB A;  1TFY A;  3M4X A;  2CFX A;  3MEE A;  4GKJ F;  1HD0 A;  4Y34 A;  3KTQ A;  1GMW A;  2C2D A;  4ZOS A;  1LW2 B;  3ISN C;  3OXF A;  3OXL A;  5DZ7 A;  1N33 F;  1TKZ B;  4TN2 A;  1FE4 A;  3QAU A;  2BKP A;  4U96 A;  1RWV B;  3A4T A;  1MRO A;  2RKI A;  3IP0 A;  4PCQ A;  3UDC A;  1IUJ A;  2YH1 A;  3D0G E;  1RWK B;  3I55 S;  2AT1 B;  2XLI A;  1JLC B;  1S1T A;  2AJ4 A;  2OPP B;  1SUQ A;  2E1R A;  3KNG A;  2X3G A;  5GMK a;  1TK0 A;  3K17 A;  4LRF A;  3C14 A;  4GKK J;  3FK4 A;  4NA3 A;  3DDK A;  5L9X A;  3OD2 A;  2WVE A;  4WYL A;  7FDR A;  1D9F A;  2QLX A;  1TAQ A;  3NEK A;  1WKJ A;  5HMX A;  1R7I A;  2Z2Y B;  3MM6 B;  2UXD F;  1JLF B;  4X62 F;  2YPZ A;  3UCU P;  1KQS R;  2ALY B;  4NLO A;  4TYA A;  2B4U A;  3OJU A;  1RTD B;  4ECX A;  3DOM A;  1ZM4 A;  1RK8 A;  4C8O A;  1ZPW X;  2BDP A;  2H3E B;  1FI4 A;  2GML A;  5KFW A;  3TQ1 A;  2G2O A;  2F8H A;  2R7U A;  5HJY A;  1FVQ A;  3DOK B;  3RB0 A;  2WSC C;  3JB9 k;  2OFH X;  2H4Y B;  1RAG B;  3KG1 A;  2IVM A;  2QC3 A;  5J2Q B;  1SH3 A;  2IM1 A;  1NO8 A;  1R0B G;  2RHQ B;  3AB2 B;  4TNO A;  2PD1 A;  3H5U A;  3QO9 B;  4UF4 A;  4CRJ A;  2A10 A;  1D9A A;  2B4O A;  3PY8 A;  5LMN J;  2OPQ B;  3EXY A;  1B99 A;  1Q16 B;  3ET6 A;  5F8M A;  4DQQ A;  1CQM A;  3ILO A;  5KFJ A;  1FNX H;  4I68 A;  1HNV B;  3IGN A;  1NK9 A;  4WJB A;  2ZD1 A;  4ZVE A;  1NND A;  4EMD A;  5IV4 A;  4B3R F;  1UZH A;  3MPU B;  5GMD A;  5KG1 A;  2UXC J;  4F4K A;  4GKK F;  1SH2 A;  2AX1 A;  1OYE A;  2OSR A;  3FRZ A;  1UVK A;  1VC0 A;  1X4D A;  2BW2 A;  1XMB A;  2ZWP A;  4DV5 J;  2QE5 A;  1GTE A;  4ETX A;  1PBA A;  2HLT A;  2GQC A;  3D54 A;  3SCJ E;  1FKO A;  3QYY A;  4KFB B;  3G6Y A;  3PTW A;  5I42 A;  2XS5 A;  3PO5 A;  2HFN A;  2HS3 A;  4X4U A;  2A0F B;  1HBN A;  4Y2I A;  1JLB B;  1KC8 T;  4IO1 A;  4KRW A;  4RBT A;  1ROF A;  3K2Y A;  3TI0 A;  1HA1 A;  3M8Z A;  2A6M A;  1M5V C;  3FBC A;  4FYX B;  1RHM B;  3CNQ P;  3FMW A;  3EDQ B;  3CD7 A;  1YX2 A;  2VBY A;  4QIV A;  2WRM A;  2AZ3 A;  3KKF A;  3ZC4 A;  1NXI A;  2PE8 A;  1NJZ A;  4OX9 J;  1HBO A;  4KO0 B;  3TVK A;  2QLW A;  5HQM A;  2O01 C;  4OJ3 A;  1R0C B;  1S79 A;  2DNR A;  4K4W A;  3J7Y I;  3KDO A;  4S0M A;  5DLF A;  4J9L A;  2XYG B;  2KFZ A;  2GMH A;  1TR0 A;  2MLY A;  5A2Q Y;  2RDJ A;  1SC3 B;  5J2P B;  3VAJ A;  2VQE F;  1S72 S;  3BB5 A;  1WC6 A;  5LSL A;  4WP8 A;  3SDE A;  2J9C A;  1T9W A;  2VPX B;  4PG6 A;  2FJX A;  1P6T A;  1S4F A;  2PC6 A;  4MT1 A;  3EX7 B;  1TL3 A;  5CYQ B;  1G7C B;  4CLS A;  2DXE A;  3QAT A;  2VDI A;  3C16 A;  4CP5 A;  3LQV A;  4CTA B;  5F0W A;  4DV5 F;  5D0R A;  5G4D A;  1QVG R;  2MKJ A;  4UUW A;  3IBF B;  1VQM S;  1AUD A;  1BUX A;  4KH0 B;  4OYI A;  2LA6 A;  5K20 B;  4HYK A;  1N36 J;  3KK3 B;  2HLU A;  2EPI A;  3FCV A;  3GG0 A;  2EKN A;  4F26 A;  1XR6 A;  1X4H A;  3MMC B;  4IH6 A;  2X7I A;  3HVR A;  3BJY A;  2C2R A;  1X4C A;  4MFB B;  1NUE A;  2UUB F;  3PX6 A;  2B56 A;  3JSR A;  4QYR A;  1T03 A;  2KFN A;  1RT7 A;  2Q1L A;  4URS A;  1LWX A;  2LYV A;  4KV8 B;  2DPJ A;  1HNI B;  3MD3 A;  5LMN F;  2FLN A;  2N7Y A;  5LJ5 Y;  2W7O A;  1QY7 A;  1TZ0 A;  4HAC B;  4DV4 J;  4ZVF A;  2EFV A;  4MK9 A;  4NLT A;  4ZN1 A;  1Y5I B;  3IS9 B;  1HNZ F;  1UJ5 A;  2RU3 A;  4IRK A;  1UPM B;  2ZBQ A;  3QMQ A;  3I0R A;  1RT6 A;  4OHW A;  4BWJ A;  1F5A A;  1C1C B;  3D3C J;  3D4J A;  1S9G B;  3M2U B;  3L7U A;  2YNG B;  3PW0 A;  2H1Y A;  2JLF A;  4Y2K A;  1IBM J;  4PEO A;  5DET A;  2OEJ A;  5KFC A;  1JJH A;  2MJU A;  3BM7 A;  1DQA A;  3IG1 A;  3JQJ A;  3M6W A;  4KC5 A;  1IBK F;  4JI3 J;  1BQM A;  3PRV A;  1UVI A;  1FXL A;  1FEH A;  2YH0 A;  1TK8 A;  2RU9 A;  2DHA A;  3MMC A;  3CJK A;  4F67 A;  1CVJ A;  2V4J A;  3R7B B;  2YNF A;  2HBY B;  2BUN A;  4RNH A;  5H9F J;  2GJI A;  4IG0 B;  2BJE A;  3UQS A;  3KLH A;  3M6U A;  1RLC L;  5HRO B;  4FPR A;  5HK4 A;  4DX5 A;  3SQG A;  1YIJ S;  3H8Y A;  2ZKT A;  3LPY A;  4F7V A;  2IJR A;  1PJ5 A;  1KRP A;  4QYZ K;  5KOW A;  5GAE U;  4CLF A;  2DH8 A;  4QIG A;  2HHW A;  2CQ0 A;  4DUT A;  1NZ8 A;  1HWK A;  2BAC A;  2KB2 A;  5CYQ A;  1TL3 B;  2MZT A;  4OI2 A;  1I3O B;  2CNO B;  2ADC A;  5E33 A;  1B4S A;  3EE3 A;  3CCQ S;  4QQB A;  1HNW F;  5A8W B;  2HZV A;  1AW0 A;  3R7S B;  3D9B A;  2QX0 A;  3TYT A;  5KAK A;  4CTA A;  3JSM B;  1N5Q A;  2CWX A;  1N5Y A;  5DQH A;  3OTD A;  1F9F A;  1F5C A;  1RTJ A;  2E5G A;  1IJF B;  4UTG A;  4O0I A;  4DR1 F;  3IAM 9;  3ZZY A;  2ZBR A;  3BRE A;  1MN9 A;  3CCE S;  2RE1 A;  4RW4 B;  4J9S A;  2WON B;  3Q8U A;  1NDP A;  3TJ8 A;  3KJV B;  3M8R A;  8AT1 B;  4C9D A;  2ZUG A;  2NZC A;  1EX8 A;  1ZAW A;  1KLM B;  4Y28 C;  3GIJ A;  2BJ9 A;  2B8P A;  5I3P A;  3LWM A;  1T9T A;  2NYH A;  3G6X A;  3U1L A;  1KHV A;  1RUS A;  4P75 A;  5ETV A;  5MAO A;  3ZZR A;  2W9B B;  4V19 J;  2R7X A;  4OX8 A;  4ZK7 M;  2ZHA A;  1WSR A;  3LAN A;  5H9F K;  1TL7 A;  4J9N A;  1N0U A;  4OZ1 A;  1U0H A;  1VBK A;  3UO0 A;  3CCJ S;  1CG2 A;  1E6Y A;  1ZBT A;  2CAJ A;  3GJS B;  3H2V E;  3MPW A;  2FHJ D;  4FZV A;  1YQH A;  1WKL A;  5T7L A;  1K1S A;  4P10 A;  4CWB A;  1ELO A;  4N56 A;  4C8Y A;  1CC7 A;  3P96 A;  1SXL A;  2XUL A;  3A1Y G;  3M9N B;  1PYT A;  2BRK A;  3IO1 A;  3M30 A;  4X64 J;  4CO3 A;  3CXC R;  5DM7 Q;  4ED4 A;  4DV0 F;  1X4A A;  2CPX A;  2JNJ A;  3K59 A;  2G0I A;  2KI2 A;  4RW9 A;  1FKP B;  2MKC A;  2RF2 A;  2IJF A;  4FN5 A;  3BQ0 A;  4A8K A;  2BZ2 A;  5C24 A;  3MED A;  2AGP A;  4K4S A;  4N8O A;  5KFB A;  1WEZ A;  1R89 A;  2LFV A;  5HBM A;  5HVF A;  1RCX B;  2WOM B;  2GJF A;  4NLQ A;  1IKY B;  2B9Y A;  2VC1 A;  2ADB A;  4PG5 A;  1YSJ A;  1H72 C;  1NSK L;  4FS1 A;  3DLJ A;  2PMZ D;  3CUN A;  5KG5 A;  3MPY A;  2CG8 A;  3KG4 A;  2Q66 A;  4NZ6 A;  5E3A A;  3TX0 A;  1SPB P;  1HBN B;  2YQ1 A;  3OR2 A;  3AQP A;  3AOA A;  2YNF B;  4LFC J;  1AFI A;  4K0K F;  2M70 A;  2KM8 C;  2KXF A;  4OZN A;  3Q8Y A;  2LU1 A;  2U2F A;  3EGN A;  3EM1 A;  1M1K T;  4V19 X;  2B9E A;  2MJN A;  2VD3 A;  2A6O A;  5CXT A;  1MU2 B;  1OPZ A;  2ZH8 A;  5HLF A;  2V8V A;  3PW4 A;  1FRL A;  2CZ4 A;  4RO0 A;  4LRC A;  4FP9 A;  3NGR A;  5J2N B;  3TRG A;  2XC9 A;  3K5P A;  5ETO A;  4NXN F;  2V94 A;  1UVL A;  1FRK A;  2VBZ A;  2NLW A;  2ACM A;  4XPE A;  2FJE B;  4ALZ A;  4E2F B;  1Q8B A;  1YLX A;  1QTN B;  1RTZ A;  4KB7 A;  1S49 A;  3QZ7 A;  4DV7 J;  4OZJ A;  2CNK B;  5D4P A;  1ARO P;  2C2Z B;  3DRP A;  4F0H A;  1S0N A;  5GAD I;  2BAB A;  2KG1 A;  2B4P A;  1ZTW A;  3D7S B;  1BQN B;  1BY9 A;  5AJ3 J;  2FVR A;  3Q24 A;  3H2L A;  4LFA F;  2BBE A;  1RA7 A;  4PXC A;  4V1A k;  1EKR A;  2XHW A;  2Z8Q A;  3THT A;  3OSN A;  3GP9 A;  4NYP A;  5KFN A;  2CPI A;  2QYG A;  4LBI A;  5GAG I;  1Q81 T;  4KQZ A;  1T9V A;  2V2Q A;  5AE3 A;  3DRX A;  4TVA B;  5I4M A;  4IQX A;  4UY8 5;  1WNE A;  1KVJ A;  2E1P A;  2KRR A;  3SQO P;  4X66 F;  4F3M A;  2XCP A;  3F41 A;  2I38 A;  2H5J B;  1B0P A;  1VC5 A;  1I94 J;  2Y8W A;  4JI4 J;  4ZCM A;  2F65 A;  1Q7L B;  5FDL A;  1FX2 A;  2IYI A;  2PMH A;  1BWE A;  3KNA A;  2PT0 A;  3L7P A;  4DX7 A;  3M8W A;  4J37 A;  4C3M A;  5J2P A;  4DUZ J;  4ZJL A;  2H4W B;  1BC6 A;  3PG9 A;  1TP7 A;  2HNZ A;  2XY5 A;  2QA2 A;  3ITH A;  4DR3 J;  5ETN A;  4CDI A;  4XDC A;  1TKT B;  4BDP A;  2VV5 A;  5B0E A;  3UNG C;  4WXO A;  2B5J A;  2YY3 A;  3R5A A;  3RGI A;  2OJ3 A;  3J7Z T;  4R5P B;  1RWP B;  1HI8 A;  3BF4 A;  2W9A A;  3CCL S;  2RS2 A;  3D28 A;  3JYT B;  4DV3 F;  3HVT A;  2MLZ A;  3LW5 C;  4B3M J;  1RWW B;  4RW4 A;  3C15 A;  5K5M A;  1BGX T;  1ICE B;  1TMJ A;  4HT7 A;  1N4L A;  2KTQ A;  2C3M A;  3M8S A;  2COL A;  4RBU A;  1YHQ S;  2ZOF A;  2RML A;  3IAS 9;  1T7P A;  1VS3 A;  4MH8 A;  2K06 A;  5F9L A;  1UKU A;  3R2D J;  4NCG A;  1VMB A;  2KT2 A;  1RE1 B;  2JC1 A;  3M32 B;  3Q8S B;  3S7R A;  2B6A A;  3DLG A;  1MSW D;  5A8W A;  3H5Y A;  1Y7P A;  2MEW A;  1Q0N A;  3K8W A;  3PRD A;  5BYQ A;  1SJQ A;  1PJ7 A;  4NZ7 A;  2F8E X;  1HWU A;  2LXU A;  2IRX A;  2M5Y A;  4I6Y A;  4UZB A;  2FC8 A;  2RAQ A;  3MUM P;  5EGY A;  3I96 A;  1DTT B;  2J8A A;  2JVO A;  2J0S D;  4IOA Q;  4KHP J;  2MQN A;  1W2I A;  1QE1 B;  2O3D A;  4O3O A;  4AXI A;  5A6P A;  5AXN A;  5I3U A;  1FA0 A;  4IG0 A;  3NRB A;  2GAH C;  4A8M P;  3DGP B;  3CJK B;  3G6E S;  2HW3 A;  3OTO F;  1CJK A;  4M63 A;  2PN6 A;  4NLX A;  2ZJR Q;  2GW8 A;  1WC3 A;  3G86 A;  1HLW A;  4TU8 A;  4M94 A;  2VON A;  3GV7 B;  3C6U B;  3LP1 B;  1RAJ A;  3DRS B;  2ZVS A;  4UT4 A;  2LCW A;  4B3O A;  2O5D A;  4DR2 J;  4DQS A;  1OJ4 A;  3MZI A;  1RHK B;  2CZ9 A;  4WYW A;  1KBR A;  1PC5 A;  3BGR B;  3W2W B;  1CJV A;  1RGV A;  2NZ4 A;  2M0G B;  1U1R A;  4X4Q A;  4R0E A;  3R1H A;  1RAO A;  4NLR A;  2V0N A;  4O3Q A;  4DN9 A;  1L3K A;  3JTO A;  1XMQ F;  4Q8F A;  4J9Q A;  2KYX A;  1C1B A;  3HT0 A;  5KFF A;  1VQ9 S;  5F8N A;  2R2R A;  4EBD A;  4NX9 A;  3NGU A;  1N5S A;  3FKB A;  2M2B A;  3NG8 A;  2VUG A;  5K8M A;  1XMO J;  1NJY A;  4WCE Q;  1LKZ A;  3DC2 A;  1MMD A;  3DRY A;  4DU7 A;  3UR0 A;  1RIS A;  1Y3K A;  2X1G A;  4BLG A;  2UXB J;  2VG6 B;  1C4C A;  1RBA A;  3WX8 A;  1P1T A;  1ZAX A;  4URQ U;  4NEZ A;  3MFI A;  4F4W A;  1BMQ B;  1LWC A;  4DR7 J;  2WOM A;  1SJF A;  1XN9 A;  4H4M B;  4PG8 A;  1ZM9 A;  1Y10 A;  4OFZ A;  2R7Q A;  3RJM B;  1CS4 A;  1L3V A;  3QGH A;  2B6A B;  2HVZ A;  3MED B;  3QAE A;  4I1T A;  1DZ5 A;  2WB4 A;  2UUW A;  2HBZ B;  2I0X A;  3C16 B;  1T05 B;  2BAN A;  2CPE A;  2ZDO A;  1LW2 A;  5B0F A;  2HWT A;  1MWZ A;  1GXU A;  3I6P A;  4KY3 A;  1W26 A;  3M8Q A;  4TKT A;  3C19 A;  2HRU A;  3J81 U;  2RUG A;  4WP9 A;  4FVM A;  3CED A;  4YQW A;  2MGZ B;  4Z7Y A;  2DXF A;  2RHS B;  3KUG A;  4ZIV A;  3T3F A;  1M5H A;  1LQ9 A;  2MQP A;  4IOB A;  1GK8 A;  1SL0 A;  2UVW A;  2J5A A;  5IC6 B;  5GAG U;  2AD9 A;  1R31 A;  5HL7 Q;  1YBA A;  1JLE A;  1OMS A;  1LEO A;  2EFG A;  1S4E A;  2CPH A;  3GMG A;  4W98 A;  3ZFV A;  4AXJ A;  5BR8 F;  3O1L A;  1HQU B;  2PI4 A;  4C8K A;  5GAD U;  2AQ4 A;  1JMT A;  2E9Z A;  4ZVH A;  5GAH U;  2DVI A;  4M5D B;  4NLS A;  2DO0 A;  2DNG A;  1FJE B;  1X60 A;  2LXF A;  2MYF A;  1RWN B;  3VAF A;  1S1W A;  2HSE B;  4URG A;  2YX7 A;  2CQ3 A;  4E8U A;  2DTJ A;  3D6H B;  2J9E A;  3ELH A;  5DG9 A;  1WG4 A;  4NA1 A;  2HZA A;  1K47 A;  4O44 A;  2XS7 A;  4WFA Q;  1IJE B;  1S76 D;  2YXL A;  3QJL A;  2BVZ A;  3KK2 B;  1KD1 T;  4ZJO A;  2F63 A;  3D6T B;  4RW6 A;  4IH5 A;  4DWI A;  4TQR A;  1RT3 B;  1SL1 A;  1HL6 A;  1V9O A;  3DDI A;  3KWM A;  4EO8 A;  3OFE A;  4TU9 A;  2E7V A;  2M88 A;  2OML A;  3GU0 A;  4KYZ A;  1KN6 A;  1V3R A;  2XMU A;  2OEL A;  2WBR A;  1J5E J;  4W4M A;  2EI5 A;  1NEE A;  4LVN P;  1N5T A;  2AJ0 A;  5C25 A;  4I67 A;  2GA7 A;  2ZBC A;  2HKE A;  3X3U A;  2BJ7 A;  3KJQ B;  3P3D A;  2H51 B;  5F0U A;  4KKO A;  3T1Y F;  4DQP A;  3BBC A;  2E1C A;  1Q8L A;  4ZHR B;  3AFG A;  3MD1 A;  5HSP A;  4UUX A;  3PW7 A;  2Q3P A;  3HD1 A;  2IVF B;  3R5B A;  4FF3 A;  3E01 B;  4LF4 F;  1V6H A;  2OSQ A;  3EGZ A;  1WC0 A;  5HMY A;  3IRX A;  1HYS B;  4G1Q A;  1SL2 A;  2JEJ A;  2GIQ A;  4TU7 A;  3RAQ A;  3LP2 B;  2K1R A;  5THW A;  1D09 B;  2CPF A;  4DX6 A;  4Z37 A;  3BQ2 A;  4E0D A;  3QRQ A;  4DV1 F;  3D1O A;  1R0A B;  2QN6 B;  4HDH A;  1X0F A;  1KOO A;  1M5P C;  4WFB Q;  3CD6 S;  4MK8 A;  2ZIT A;  2EG1 A;  3E51 A;  2JEI A;  1Q79 A;  3SYZ A;  1CJK B;  4OI0 A;  3CF5 Q;  5J1N A;  1UEK A;  1ACM B;  1B3T A;  1VFJ A;  2AZ1 A;  2GVZ A;  2KRB A;  1WOS A;  2C2M B;  4M5I A;  4KV8 A;  1DY3 A;  3GFZ A;  3CPW R;  1JXE A;  5AE2 A;  4Q43 A;  4QW9 A;  4K0K J;  2ZE2 B;  3O44 A;  2ZH4 A;  1YRX A;  5C24 B;  3L4B C;  3TQE A;  1HBM B;  2QZ8 A;  4NCB A;  4Q0B A;  1UW4 A;  2HQC A;  4ENO A;  3MR6 A;  2IMW P;  3HZG A;  3SMZ A;  3OUY A;  1SC1 B;  1AXQ A;  1EIY B;  4ZCL A;  2OUG A;  3TNV A;  5IM0 A;  4LIW A;  3GIM A;  3CCV S;  4TLQ A;  1J5O A;  1FFS B;  3MAA A;  1Q5Y A;  4ELU A;  5F8L A;  2W2O P;  4PYA A;  5HAN A;  3OL9 A;  5KFP A;  3TZY A;  2DNM A;  2Y1J A;  4KSE B;  2KG0 A;  4LBP A;  3AJ1 A;  1FHT A;  1XJW B;  4C8M A;  3CD0 A;  3MEC A;  5KFH A;  2OFG X;  4OJG A;  3NMA A;  1ZAV A;  3PEJ A;  1X5P A;  3MR3 A;  4ILR A;  2FHJ A;  4JI4 F;  1S1V A;  1FXD A;  4NRU A;  3UD4 P;  3CDW A;  3HHD A;  4X66 J;  4FF2 A;  4DR7 F;  2KYZ A;  3BEG B;  4X4S A;  1LXJ A;  2P8I A;  4DUY J;  1X5O A;  1VK8 A;  1BXN A;  1WF2 A;  2C2O B;  5MLC V;  2CJ9 A;  3CSK A;  2VKZ G;  4OLO A;  4XO0 A;  1OSD A;  1FJG J;  3AXK A;  2DB1 A;  4AL7 A;  1U1K A;  2VA2 A;  2HNZ B;  3DGV A;  3J81 Y;  1FWP A;  1UAW A;  8ATC B;  2JWN A;  5B7W A;  1OPI A;  2MZS A;  1VK3 A;  3CCU S;  4EUV A;  4AFF A;  2YX4 A;  3K8V A;  1QVF R;  1DUR A;  5ETL A;  4M1K A;  1H2T Z;  3CJS A;  2AJ1 A;  4JBC A;  4ZVS B;  5KFR A;  1RT4 A;  1RTJ B;  1CJT B;  1DFD A;  1C0U A;  2V9K A;  4H4K A;  5A76 A;  3NLC A;  4G65 A;  4ZCI A;  2DNN A;  2XNR A;  4DU8 A;  3R5J B;  1ZA2 B;  3W9I A;  2HYI B;  4UQG A;  3GQC A;  2MPU A;  3CC4 S;  1T11 A;  3DI6 B;  4F3O A;  4UST A;  3T9N A;  4K4X A;  2V68 A;  5CH7 B;  4RUC A;  4B9V A;  3UN5 A;  4J91 A;  3PV8 A;  1GQE A;  2PMW A;  1HR0 J;  1S59 A;  2HNY B;  4WK1 A;  2W9B A;  2HUR A;  2BKO A;  3BO2 A;  3OVB A;  5KT5 A;  2HHT A;  4KGK A;  3PEH A;  4XIU A;  5JVH Q;  3QFW A;  1Q8K A;  4WZQ A;  2CQH A;  3AH6 A;  2UXD J;  1YJW S;  1FJ7 A;  4EBC A;  5DZ6 A;  4P52 A;  1RT1 A;  1FT8 A;  4ZS6 A;  2RRN A;  5IV3 A;  1JB0 C;  1T3N A;  2HK3 A;  1M1G A;  3FEZ A;  4F04 B;  3CCS S;  5KT3 A;  1FK9 A;  4F4Y A;  3ISZ A;  3MAH A;  4C6A A;  4OX7 A;  1JXL A;  2RQK A;  1RT2 A;  2ATC B;  3ETO A;  2YWG A;  2PA3 A;  4OJ1 A;  2DIU A;  3TP2 A;  2J7W A;  3OFG A;  4HTI A;  3P45 B;  1AB8 A;  3G87 A;  2BA9 A;  1NKE A;  4Y2M A;  2VC0 A;  2DHX A;  2XYH B;  3CMQ A;  4O3S A;  2BYC A;  1MML A;  1RWU A;  4X4P A;  3HJF A;  4Q5V A;  2IHR 1;  3H0P A;  2EC0 A;  1H73 A;  2KDO A;  2NPI A;  3SCI E;  3PR4 A;  4JI1 F;  2JDJ A;  5LXR A;  2OPR A;  1WC1 A;  2V2Z A;  2ZBI A;  3H40 A;  2E29 A;  1WEY A;  1U0H B;  3J7Y U;  1Q86 T;  4J90 A;  2ZJQ Q;  4GKJ J;  4GRS A;  1KFD A;  2KO1 A;  4HR2 A;  3RBZ A;  4ZJQ A;  2BQ3 A;  1S0M A;  2DD8 S;  1QSL A;  3I5A A;  4WWS A;  5CD4 A;  1SQG A;  2YWK A;  4BHQ A;  4M95 A;  2NR0 A;  4X4V A;  2GS8 A;  4R25 A;  2JSX A;  5CZX A;  4ATN A;  2DEI A;  3CO0 P;  3FMB A;  3RTV A;  3PYG A;  1H74 A;  1X0P A;  1U47 A;  1KLM A;  2JVR A;  2F4V F;  3HZE A;  1RT3 A;  4NCG B;  3ZZU A;  3QIP A;  4P9S A;  2P9E A;  3KHL A;  1CUL A;  4RPF A;  5KG7 A;  4UZC A;  1GT8 A;  1JX4 A;  3TUP A;  1H7W A;  1YZ6 A;  4J9K A;  2K8G A;  1D1U A;  1YRT A;  4CO4 A;  2WBM A;  2IMO A;  4DCO B;  3C15 B;  4USU A;  1JIH A;  2Y9H A;  4NE9 C;  2O67 A;  4ED3 A;  1F60 B;  1HPZ B;  4L3K A;  1I1G A;  3SEO A;  1FTC A;  5HQL A;  2YNI A;  3R5C A;  5D0E A;  3TO8 A;  1VBY A;  3H20 A;  2Y1R I;  2UUC F;  2Y1I A;  3CWJ A;  1TUW A;  4H4O A;  3RZA A;  4CYU A;  5LSO A;  2HAI A;  4B3T J;  3H98 A;  3T41 A;  2RIJ A;  4DR4 J;  2Z2Z A;  3AOB A;  2KN4 A;  4YB7 A;  2XI2 A;  5F41 A;  3OL8 A;  1RB0 A;  1RKI A;  2BJD A;  4ZLL A;  1T95 A;  2V69 A;  2BKN A;  3MMA A;  3P4U B;  4CCH A;  1J27 A;  2QGF B;  2CJA A;  3IM9 A;  1JLE B;  4A4J A;  4QWA A;  2EFO A;  1GXL A;  2DR5 A;  1JJC B;  3K58 A;  2HBQ B;  5HRO A;  2KZZ A;  5HP1 A;  1RLD A;  1PGZ A;  2DRA A;  1AZS A;  4O0N A;  5HVG A;  4DV2 F;  4NLV A;  2DGX A;  3C6T B;  2HGL A;  4ZLN A;  2IBO A;  1JXV A;  3GR0 A;  3KXD A;  5AXK A;  2FDN A;  4DHV A;  4C0H A;  3ZZZ A;  3A3P B;  3R1L A;  2NUU G;  4PZV A;  1TL5 A;  4L76 A;  2UVR A;  2UVU A;  3AT1 B;  4CM2 A;  1GMU A;  1HQE B;  1RAH B;  1ZZF A;  3M2U A;  4HLB A;  1FK9 B;  4TLR A;  1HPZ A;  1QAI A;  2AWZ A;  3T1H F;  4ERD A;  1HHQ A;  3BYP A;  1YRU A;  3M2R A;  1LFP A;  2G0J A;  2MZR A;  2UZA A;  1ZM3 A;  4DS5 A;  6AT1 B;  2UUC J;  5H1S V;  3DRP B;  3EVO A;  1N36 F;  3QIP B;  2XB2 D;  4B08 A;  3W66 A;  3VTI A;  1P1L A;  2DHH A;  1REV A;  3KLH B;  3VAL A;  1U45 A;  1IM4 A;  3IWL A;  1EET B;  4QZV B;  4WE1 A;  4MIB A;  4I6A A;  5KFK A;  3IC1 A;  5KFL A;  3TVZ A;  3T5L A;  3JSY A;  3I31 A;  3HX9 A;  3DRR B;  3UVJ A;  2VJU A;  1VQL S;  2OTL S;  4DFJ A;  1WOP A;  1XWL A;  2DGW A;  5KFZ A;  1M5S A;  1QSS A;  1XNR F;  1U1P A;  3AY0 A;  1T02 A;  2B3T B;  1WJ9 A;  4O4G A;  1RTH A;  2HQF A;  3QID A;  3KMS A;  1TVR A;  4FKX A;  1G6B A;  3EYZ A;  3QZ8 A;  3AD8 C;  1NKC A;  3LH2 S;  4I0W A;  4OYB A;  4B3S J;  3CO9 A;  5F8H A;  2Q43 A;  4ZCK A;  3GPA A;  4OZL A;  3NP5 A;  2MKS A;  1VLO A;  2OPP A;  3RRK A;  2LDI A;  2J76 E;  3SSR A;  1YZ7 A;  2XMA A;  3T1H J;  4QIF A;  4KGM A;  3I0S A;  3KHR A;  3ICL A;  1CJT A;  2F4F A;  4K2X A;  2G1H A;  2GNK A;  3PYE A;  4O23 A;  5J2M B;  3FFI A;  3M1V B;  4RUB A;  4F3Q A;  1N32 J;  2ZZT A;  4YB1 P;  2O66 A;  2OI2 A;  2XWY A;  3WIU A;  4LF7 J;  3TR5 A;  5A2Q U;  2VQF J;  4LRB A;  3CJ0 A;  1HIY A;  2CDR B;  4LFA J;  1S77 D;  2W8L A;  4U7U K;  3J80 Y;  1U2R A;  4USJ C;  3CJQ A;  2LEB A;  4IRD A;  2ROG A;  1NDC A;  2NXJ A;  4XTT A;  4MKY A;  1NDL A;  3OW2 R;  1LW0 B;  2QYC A;  2VF3 A;  3DLG B;  2VFT A;  2HQ3 A;  5E0O A;  2HNY A;  2YX1 A;  2Z0G A;  2V8H A;  4ED7 A;  4LF6 J;  2JEG A;  1HI1 A;  1NZA A;  4HH1 A;  3NBP B;  4DLE A;  4ED6 A;  1N54 B;  3FGV A;  5T7L B;  3K89 A;  3DHX A;  2EBG A;  5K14 B;  1IQZ A;  4QPT A;  2CVE A;  4DF8 A;  3OT9 A;  3BR9 A;  1RTI B;  3M6X A;  1KTQ A;  1CJU A;  3DFE A;  4GMK A;  1WWH A;  3MGJ A;  2YKA A;  4C98 A;  3HVT B;  4TXS A;  2G9O A;  3IFE A;  1N34 F;  2RT3 A;  4N8N A;  3NAI A;  2FY1 A;  1KQK A;  1WC4 A;  3PR5 B;  2A1B A;  5D6G A;  2LU2 A;  3G4S S;  4OZ2 A;  1T8E A;  2ASY A;  4JV5 J;  4U9R A;  3IRW P;  5D4O A;  2I6W A;  1U4B A;  3I9Z A;  3SZ2 A;  3HSG A;  1TL4 A;  4DQR A;  3GSI A;  2R8K A;  4JI1 J;  3D66 A;  3DOK A;  2VZ9 A;  4LSN A;  5E5N A;  2AEF A;  4W92 B;  2DK2 A;  1MLA A;  1MW7 A;  1N32 F;  4KT0 C;  3BPS P;  2F1F A;  4K7Q A;  4CNZ A;  1FKA F;  2MQL A;  4F25 A;  4ECY A;  5BR8 J;  3VAK A;  4LF8 F;  5CZV A;  2HQI A;  1XNQ J;  2LQJ A;  4K4Y A;  1YWX A;  2WVD A;  4MYU A;  3MHY A;  1AYE A;  1FDD A;  1RTI A;  1SKU B;  1F9E B;  1PC4 A;  1DHM A;  2NXE A;  4I7F A;  2OD4 A;  2HAF A;  3MM9 B;  2PSZ A;  4F4A A;  1DLO B;  4PQU B;  3FBB A;  3HHN B;  1DTQ A;  1U6F A;  1YJU A;  4DV4 F;  2ZBP A;  1SUQ B;  5L1I A;  2RQC A;  1NK6 A;  1KVI A;  3ET6 B;  2H5E A;  1SJR A;  2YKP A;  2Z2L A;  4B9L A;  2YNH B;  4K4T A;  2JEF A;  2YWH A;  1WTF A;  2AEM A;  2C3P A;  4DV6 F;  1U6B A;  2FVC A;  3Q2T C;  1E6V A;  4I4B A;  2ACY A;  4A8O A;  4KKO B;  3OTC A;  3FC9 A;  4F0M A;  4RLE A;  3RB3 A;  2BMB A;  1TKZ A;  2FVP A;  2E7X A;  2E5L J;  2P6T A;  1VR6 A;  3BSC A;  2MTL A;  4YDX A;  4LQ3 A;  2R7V A;  4FBU A;  5EWE A;  3CC2 S;  2FUG 9;  1TU0 B;  2IC3 A;  3W63 A;  3KG0 A;  3ILL A;  4OZ3 A;  2FGO A;  3QBC A;  4HHH A;  2VH7 A;  2IRY A;  3NGS A;  4NYO A;  3SFG A;  2ROP A;  4FPI A;  3OSP A;  4ZPT R;  1LWE B;  1S6U A;  3SFU A;  4TQS A;  2QA1 A;  2PII A;  4PXD A;  5H9E K;  4UOF A;  4DPT A;  1RTH B;  4I7F B;  3DLE A;  2BE2 A;  1M1H A;  2EFP A;  1FNM A;  3US5 A;  3E8O A;  2CQ1 A;  3EPI A;  1JKH A;  2PI5 A;  4XPC A;  2GQ2 A;  5IXU A;  3KHG A;  3V81 A;  1VQ6 S;  1Z2Z A;  4JYA F;  3BGF A;  3RG6 A;  1TK5 A;  1GX6 A;  2XO7 A;  4BS2 A;  2ZH7 A;  1OIA A;  4DG1 A;  3V4I A;  1WEX A;  2HHQ A;  2NS1 B;  2W4P A;  1CLF A;  3DCA A;  4RW7 B;  2AP6 A;  3TUI C;  4LF2 A;  2A18 A;  1NKB A;  2DNZ A;  1QD1 A;  3Q8P B;  1NH8 A;  2MKI A;  2DHG A;  2HRY A;  3ENV A;  1PCA A;  1J2V A;  4N5S A;  3MPV A;  5L1K A;  2KXN B;  1XQI A;  1F0X A;  2X3D A;  4N77 A;  2B51 A;  1T3O A;  3IM8 A;  1KWM A;  4AT1 B;  3DM2 A;  4HT5 A;  1KVK A;  3LPE A;  3Q89 A;  5DGB A;  1WI6 A;  3CCT A;  1NAQ A;  1YKW A;  4EZ9 A;  2H48 B;  3SV4 A;  1RAC B;  4YDD B;  3A12 A;  3EDR B;  5K14 A;  5GAE I;  2VAS A;  3O5T B;  2I2Y A;  2W2M P;  1EAY C;  1H2V Z;  3ENQ A;  5DG8 A;  4DUZ F;  4IH7 A;  4KTQ A;  3W62 A;  2MHN A;  4WPA A;  1VQS A;  1LK7 A;  2BM1 A;  4P2X A;  4ZVG A;  2HND B;  1P9Y A;  1T0T V;  2HGN A;  3S1T A;  1RWX B;  2E7W A;  2MLX A;  3P5T L;  2R2U A;  2V4J B;  2ZH2 A;  2L41 A;  3B8H A;  4BC9 A;  3T5H A;  3H4B A;  5KTQ A;  2GIR A;  3DYA B;  4DOZ A;  2QLB B;  1HQU A;  3GCW P;  4DBQ A;  1NK7 A;  1LV5 A;  1N0V C;  5IOL A;  4QW8 A;  5K8N A;  1DRZ A;  1JLQ A;  4NI2 B;  1KDN A;  1Y5L B;  2XMV A;  3BGR A;  4DEZ A;  2HFU A;  2D41 A;  1FVS A;  1RZM A;  2EWH A;  5SZT A;  1NHK L;  2DIV A;  4U6P A;  3DRS A;  3W2V A;  1SV5 A;  2BE7 D;  2QLJ B;  2YTC A;  4LT6 A;  2HWI A;  1N56 A;  3NKY A;  1IKW A;  3NGK A;  4NXM J;  3KLG A;  5CYM A;  4ED0 A;  2HZC A;  2C3O A;  4HAC A;  9ATC B;  5GAH I;  1FO1 A;  4NMX A;  1I51 B;  1S97 A;  4ZDN A;  3IGV A;  3VF0 B;  3Q0A A;  2EEY A;  4IUF A;  4MIW A;  4FF1 A;  2RDD A;  1VQ4 S;  3EVM A;  3D1Q A;  2BJ1 A;  3D0I E;  4ID8 A;  3KHH A;  3R2C J;  4M5N A;  2W9C B;  2I5J A;  4PUO B;  4L72 B;  4NML A;  3A8J A;  2VKR A;  3IBW A;  1RT1 B;  1DAX A;  5K8P A;  1VQ8 S;  4LF4 J;  3BKU A;  4OIX A;  1N48 A;  1V5V A;  3WC0 A;  3KK1 B;  3TAN A;  4DPU A;  2RRA A;  2HHX A;  2VG6 A;  1YBU A;  1G3O A;  3C66 A;  3OL6 A;  2CVI A;  3LGH A;  4NRT A;  4LVO P;  1W7W A;  4WXW A;  1NJW A;  1DTQ B;  1XR5 A;  3H59 A;  3AOD A;  5IT9 Y;  3AQO A;  3GSD A;  2ZH5 A;  2UV8 A;  3PRB A;  4ID5 B;  2ZEJ A;  5EHH A;  3I56 S;  3I9V 9;  2HBR B;  2HFO A;  4C8N A;  4OYW A;  4ZVT B;  1SIZ A;  3M9O B;  2G0C A;  4HI1 A;  4USK A;  2HHP A;  3M32 A;  1RT6 B;  3I0R B;  1O0P A;  3VVU A;  4WII A;  1FFW B;  1YDL A;  3MUV P;  1U0S A;  3W2V B;  5A6W A;  4NLP A;  4Y2A A;  2C3U A;  3H42 A;  1BD6 A;  2FPH X;  3ZZ0 A;  2ILZ A;  2J0X A;  2FHK A;  5T41 A;  4DL3 A;  1HNX J;  3CME S;  1K73 T;  1K0V A;  2NQP A;  3Q8Q B;  2KXH A;  1VQ7 S;  2DPI A;  2NPF A;  2P6S A;  2DJW A;  5HN0 A;  3VAH A;  3MR5 A;  4LF5 F;  1A6L A;  1AZS B;  4OLP A;  3QFH A;  1TMM A;  2VOP A;  3FJ2 A;  3PO4 A;  2HFZ A;  1U6Z A;  2XSF A;  3UDV A;  4Y00 A;  3B6B A;  3RAM A;  3TEG A;  2W24 A;  1AT1 B;  1QSY A;  1U1Q A;  4U8V A;  2E1M C;  2YKN B;  5L1J A;  1SC4 B;  1UL3 A;  2YWW A;  2LMI A;  5B09 A;  4QU6 A;  2J0W A;  1HHS A;  1VIO A;  2CQP A;  2W7A A;  4GVB B;  3UD5 A;  2AJQ A;  3UPF A;  4IG3 A;  3CJR A;  5IQQ A;  4WU3 A;  3GON A;  5HI7 A;  4OHX A;  4HHJ A;  3CD5 A;  3DI6 A;  2IAJ B;  3MCS A;  1RXO B;  4CH7 A;  2ZH3 A;  2QV6 A;  2LA4 A;  2WK4 A;  3J7Z 5;  4MJK A;  3VVT A;  1HNV A;  2XNQ A;  3EXC X;  2AX0 A;  2MY7 A;  2Z30 B;  3I32 A;  3PW2 A;  1RHR B;  4WKR A;  3G6V A;  4F8R A;  4DCJ B;  3R8Y A;  4Y0F A;  5L8R C;  1VRT B;  1YK9 A;  3L3C A;  1UA1 A;  1GEH A;  1EHW A;  4MIA A;  4N7T A;  3EWG A;  5E3C A;  4YS2 A;  5B0B A;  6FD1 A;  3QGP A;  3OHA A;  2CZV C;  4O3R A;  3GIL A;  3WDO A;  2BJ3 A;  3KOA A;  4IDK A;  1T9Y A;  1JLG A;  3V6J A;  4DL2 A;  3VAI A;  3O2I A;  3BH6 B;  3G8T A;  2OMO A;  3OR1 A;  4LBH A;  2CYY A;  3J81 j;  1CEZ A;  3T1A A;  3RAX A;  2WCX A;  2I1R A;  3TWZ A;  2CA9 A;  2G13 A;  3JAM U;  3M2V B;  4RWW A;  4FYV B;  2AYB A;  5J2M A;  2ZZM A;  3HFZ B;  3FEY B;  2OTJ S;  2YNH A;  5JJB A;  4ETZ A;  4DV7 F;  4A8Q A;  4B02 A;  3NWR A;  3S6E A;  3HHK A;  5A8K A;  2GO9 A;  1IXK A;  4HHU A;  4O3N A;  4EYI B;  2DR9 A;  4OYA A;  2IBK A;  3NCQ A;  1H0H B;  1X7V A;  4MYT A;  2BV3 A;  4NEY A;  3A13 A;  4C2M A;  4DFK A;  1D8Y A;  2YVS A;  3JTP A;  1N34 J;  2HIY A;  1YJ7 A;  4HEA 9;  2B43 A;  2V8P A;  3I5B A;  5IC4 B;  4ITS A;  2Y0B B;  3B4D A;  3RBX A;  1HWJ A;  2GX8 A;  3KJF B;  3MR7 A;  1JLC A;  1S1T B;  2R2T A;  4J9M A;  1PO6 A;  4DSL A;  5CYJ A;  4DCP B;  4ECV A;  1M0S A;  3NAH A;  5C7P A;  4O3P A;  1RAD B;  2DNQ A;  2Y3Y A;  4CLP A;  3HO1 A;  2PEB A;  5IT0 A;  1CBK A;  2ABY A;  2G2Z A;  2F4V J;  1FWK A;  4OI6 A;  2IY5 B;  3Q83 A;  3B82 A;  3QGG A;  4DFP A;  1QAX A;  4OYM A;  4WU2 A;  1JLG B;  1UPP A;  3N79 A;  2AJ2 A;  3F73 A;  2E5H A;  4EK2 A;  3MF5 A;  3GFH A;  1E6V B;  4ICL B;  3N28 A;  3UFC X;  1F1B B;  4YME A;  4A8W A;  5F3T A;  4ILM A;  4DI6 A;  4DPX A;  3NMR A;  4ZPC A;  3BGU A;  4KGZ B;  2E9T A;  1Z1Z A;  1PJ6 A;  4X65 J;  5J1E B;  3HHL C;  3PHT A;  1LOU A;  3PDN A;  1SKW A;  3V6D B;  1S7I A;  2DGQ A;  2JHE A;  1RSC A;  2EFN A;  3CCW A;  4KHR A;  3U1N A;  2LP4 A;  4F2R A;  4P7V A;  5D3G A;  4RW6 B;  5FLX U;  4LF1 A;  2VFR A;  2DKO B;  1FES A;  3BDE A;  3NOG A;  1IBL J;  2GCF A;  4K4V A;  4LIR A;  1UVM A;  4G1Q B;  1UFL A;  1VQY A;  4X64 F;  4PPZ A;  5F8I A;  3KUE A;  1IBK J;  4JI3 F;  4B3S F;  1S9F A;  3G82 A;  4KGX B;  1V5I B;  1VOM A;  1R43 A;  4DPY A;  3G71 S;  4B9S A;  2N7C A;  5HP1 B;  4CO5 A;  1YGY A;  2MQM A;  4WE1 B;  5F8J A;  3FDS A;  1S10 A;  2VG7 B;  2FGC A;  5ETT A;  3A3O B;  3RB6 A;  1REV B;  5IT9 U;  2F7V A;  4NLW A;  2GJ2 A;  3ZTO A;  1RYR A;  4ELV A;  5A8K B;  1M90 T;  3F0N A;  2OPS A;  3RRG A;  3FRY A;  2C28 A;  2KZM A;  2APO A;  1K1Q A;  3QLH B;  3Q86 A;  2OIH A;  2XGP A;  4DR5 J;  4LSL B;  1QJH A;  2NXU A;  1MWY A;  2DT9 A;  2UUA F;  1XR7 A;  3MEE B;  4OZ0 A;  3G8Q A;  2G4B A;  1Y5N B;  2CQI A;  4B9M A;  3CVK A;  3Q8V A;  5KFQ A;  1VQP S;  1HKA A;  1D3W A;  1K44 A;  4NPO A;  2M3D A;  2J7K A;  1YG0 A;  2MSS A;  2M4M A;  4OI1 A;  3ZTR A;  4ECR A;  4Q2M A;  1GMW D;  3KJV A;  1HQE A;  3HKW A;  3HCX A;  2HVE A;  4C8L A;  1HMV A;  1OSC A;  1XC9 A;  3L7O A;  4RUH A;  5JMN A;  1S5Z A;  2CNL B;  2QL9 B;  2RD5 C;  3FBE A;  3KDN A;  4ID5 A;  4MKV A;  4ZLP A;  5LXY A;  2DNP A;  4X65 F;  4F4Z A;  3VQS A;  2GV1 A;  4OMF G;  1JJ4 A;  2VL1 A;  2ZM6 F;  3HM9 A;  4DLG A;  2WVB A;  3PKY A;  2YPY A;  3T1Y J;  5AT1 B;  3WQP A;  1ZTT A;  1QUP A;  5DJB A;  4IFY B;  4JUZ A;  1GMV A;  3TX8 A;  2N4C A;  3UVJ B;  5A0Y B;  3QSI A;  1FDA A;  3HKZ D;  4ED8 A;  4U7U D;  4K50 A;  1EJ7 L;  4DV2 J;  3D6M B;  3LAM A;  1WD6 A;  1FRI A;  1HFE L;  2OEK A;  1XMO F;  2D9P A;  5EWG A;  2IA0 A;  1BLU A;  3BSO A;  4JI6 J;  1TUV A;  2ZWO A;  2IRU A;  2CJB A;  3N4W A;  5ETR A;  4ANE A;  2V63 A;  1RQ0 A;  3IG1 B;  4RWX A;  5KT4 A;  1K8A T;  1YIT S;  2R7T A;  3A8K A;  2NYI A;  3I0S B;  4WTY A;  1C1B B;  4FYY B;  5F8G A;  4B9U A;  1VBX A;  5E7O B;  3WC2 A;  5M2P A;  4N76 A;  3J7A 1;  4OYO A;  3M9M B;  1S0V A;  3RW7 A;  3PIO Q;  5C2C A;  3HP6 A;  3TAM B;  3R5G A;  2KL8 A;  4ECU A;  1NK8 A;  2LVW A;  1VQ5 S;  3ZTP A;  2CQG A;  2IM2 A;  4LRA A;  4QR1 A;  4RNM A;  3RU0 A;  4DL5 A;  3V6K A;  5GVQ A;  3JAM Y;  4YN3 B;  4NXN J;  4B3O B;  5HLF B;  4YY3 F;  4DSJ A;  3LP1 A;  4Y65 A;  1SJ1 A;  1UCN A;  2F9J A;  1Q53 A;  2ZDP A;  1PKU A;  1F2H A;  3L09 A;  5G0R A;  4E98 A;  3DLB A;  1OY9 A;  3K57 A;  4X4N A;  1WTB A;  2CJK A;  1A9N B;  1OY6 A;  4DZ6 A;  4ECT A;  4B9N A;  4KPY A;  3N6L A;  3IBC B;  2BOA A;  1WHX A;  3LAK A;  3M8Y A;  2HPU A;  3BH7 B;  3OR2 B;  4KBI A;  2V9W A;  5KT7 A;  1HD1 A;  2HS0 A;  2QMW A;  2AYE A;  1HBU B;  1HW9 A;  2IYG A;  2GHW A;  2I5J B;  3CJT A;  3PXG a;  9RUB A;  4QR0 A;  2R8H A;  2ZH9 A;  2HHV A;  3QGI A;  4RU2 A;  4WZM A;  4N47 A;  3ZXW A;  6FDR A;  3C46 A;  2KVQ E;  1SKS A;  3VGS A;  1C0T B;  2CPY A;  3MM9 A;  4CNY A;  4D3H A;  2DNO A;  3SXL A;  3TA2 A;  1UJ4 A;  2XWX A;  2CPD A;  2FY8 A;  4ZKA A;  3GIR A;  4IFY A;  3UN3 A;  1NLK L;  1KEK A;  3HPO A;  1FER A;  2QMX A;  3PNI A;  3FVY A;  4Y3C A;  1U49 A;  3NNC A;  3QRP A;  1HNZ J;  1RI7 A;  4RW9 B;  2DY1 A;  2IDL A;  3POT B;  3W1Y C;  3NXZ A;  2DH7 A;  2P9G A;  1VI7 A;  1Y00 A;  5ETQ A;  4YR2 A;  4ZP9 A;  1Q78 A;  4JI5 J;  2OGU A;  4I69 A;  4DV3 J;  3SCK E;  2ZUA A;  4YHH J;  1IR0 A;  2VHG A;  2WTF A;  2IIH A;  3HSD A;  1SV5 B;  2E44 A;  5KG3 A;  3KJN B;  2WSE C;  2ZC4 A;  3EJM A;  4LUB A;  4HKQ A;  3E3X A;  5RUB A;  4A8S A;  2GZO A;  4IYQ A;  2XO6 A;  4MMO A;  2QSW A;  4U8Y A;  3OHB A;  1PSD A;  5KG4 A;  1IWA A;  3HFK A;  2HND A;  3LGN A;  3O6Q A;  2K7K A;  4WFZ A;  2GGP A;  1N6Q A;  2V50 A;  1F9H A;  1FX4 A;  2B7B B;  4MFB A;  4DR1 J;  2LEP A;  5HVH A;  1QUV A;  4NWB A;  1O6X A;  5DM6 Q;  2F3J A;  1IKV B;  2W7P A;  2HK2 A;  3KK3 A;  2M8D B;  5JVG Q;  2OKQ A;  3T9Z A;  1LWE A;  4C48 A;  1R27 B;  3BQ1 A;  4LF6 F;  2CWK A;  3HSZ A;  1U1L A;  4F2S A;  2LLZ A;  4HDG A;  3ONQ A;  3V6D A;  4ILL A;  1FJC A;  2CQ4 A;  2GHV C;  2IPO B;  1N8R T;  1F3F A;  2WON A;  3THP A;  4CLT A;  5DQI A;  2ZOM A;  1Y4Z B;  2JOQ A;  2V34 A;  3EZ5 A;  2W4D A;  3M8Q B;  5M2R A;  1N5Y B;  2PDA A;  3JQM A;  2ERR A;  3UNY A;  2XYP B;  1WDD A;  1XMQ J;  3TZX A;  5AJ3 F;  1HI0 P;  5J1E A;  2YKM B;  4FNI A;  1X4G A;  3D0H E;  1G2E A;  4ZPV R;  2ROE A;  1U2F A;  2DCL A;  4RNO A;  5L39 A;  4NLG A;  1U7L A;  4U95 A;  3FQL A;  4J7C A;  2YKQ A;  3UDL A;  3HVA A;  1EAR A;  1LNQ A;  2J0Q D;  1URR A;  4DR6 F;  1D9D A;  2LQ8 A;  1M5O C;  5D4N A;  4JV0 A;  3MM6 A;  5CHC B;  1KON A;  2GMJ A;  3ZZT A;  1D8Z A;  2BE2 B;  3V6H A;  1R0A A;  3DLE B;  3CDA A;  5KFM A;  2DR7 A;  1MNE A;  2QMU B;  4CLY A;  1TVR B;  3BN7 A;  1RAB B;  3R3T A;  3GR1 A;  5T14 A;  4IO9 Q;  1NU4 A;  1SKR A;  5FDL B;  1H6K X;  3ADA C;  4LQ9 A;  4TY8 B;  3V81 B;  1KKH A;  4MTP A;  5BJR A;  3PJ9 A;  3T6B A;  4EGL A;  4GC6 A;  1G4C A;  2RDI A;  2W2Q P;  4JI5 F;  4W90 B;  5KFE A;  2CIM A;  1C0U B;  1NK0 A;  3KYL A;  1R8H A;  1WUU A;  1VRU A;  1IN0 A;  2RKI B;  2ZOG A;  4H54 A;  3UW1 A;  2UU9 J;  1H3D A;  1Z2L A;  2E9R X;  4UQT A;  3EUN A;  2DO4 A;  2L9D A;  4P71 A;  2YNG A;  4DMZ A;  4Q0B B;  1X9S A;  3Q23 A;  4KIA A;  4D3G A;  2RSQ A;  1QTM A;  2OEM A;  1S6O A;  2V5H G;  1PBU A;  2AV5 A;  3BN4 A;  3DXS X;  1B7Y B;  3GYX B;  4OV1 A;  3PFO A;  3TA0 A;  4WF9 Q;  2VFV A;  5CA5 A;  2PFD A;  4OHY A;  4YFU A;  1RCO B;  1OY8 A;  4QYZ J;  5M2U A;  2AEJ A;  2EK6 A;  3GJQ B;  8RUC A;  3QT5 A;  1QE1 A;  1OYD A;  2AYM A;  3N6N A;  1YJR A;  2YQ3 A;  2F5G A;  4CO1 A;  2ZC3 A;  3CIZ A;  3CDE A;  2AU0 A;  4A8F A;  1FCA A;  4OZ5 A;  4QPX A;  1SB6 A;  3HLU A;  4QWB A;  3KLE A;  1B70 B;  4J9U E;  5HMZ A;  4YB5 A;  5LM7 E;  4CI0 B;  4DV0 J;  5FJ4 A;  2ILY A;  1V3Z A;  3UDE A;  4YY3 J;  3IN5 A;  3TEH B;  1H38 A;  1S57 A;  2CQ2 A;  2K3K A;  4M5H A;  4BBY A;  1SQE A;  1WG5 A;  2BM0 A;  3N01 A;  4RBV A;  1VRQ C;  3TUJ C;  4TY8 A;  2J6U A;  4KE5 A;  2RB7 A;  3BBF A;  2A3J A;  2ATL A;  2UU9 F;  5KG6 A;  1JK9 B;  2XMT A;  3PFE A;  2UVV A;  3D6F B;  3CCM S;  3QSY B;  1L3T A;  4OQJ A;  3C14 B;  3HXM A;  1FFG B;  2HMI A;  3ZNJ 1;  5E41 A;  2XGQ A;  3MUR P;  1WC5 A;  4NA2 A;  3SIP B;  2MXY A;  3JYT A;  3K5O A;  3HMJ G;  3CCR S;  5JUM A;  1O51 A;  2HQD A;  4IRC A;  2J6S A;  2R2S A;  2CPZ A;  2DEJ A;  2GVZ B;  2V2V A;  3HHL D;  1HWL A;  2YKO A;  3P5B P;  1U1O A;  3H4D A;  2FJW A;  4AUK A;  3S8S A;  2UXC F;  1DQ9 A;  3FQK A;  1PAE X;  4OYX A;  5ETK A;  4C11 B;  2MGZ A;  2FLL A;  3CC7 S;  4B3R J;  1S1X B;  1KP6 A;  5LL6 d;  4DPW A;  5EN1 A;  5AXM A;  3U7J A;  3W61 A;  5K9F A;  5IT4 A;  2ASD A;  1IQT A;  1VJQ A;  2XM3 A;  2KHD A;  3N0V A;  2NXN A;  5C2G A;  3GE9 A;  3D67 A;  3PJX A;  4I2P A;  3VR1 A;  3MAA B;  3NCR A;  2Y8Y A;  4ZVU B;  3DLK B;  4G3I A;  2D3Z A;  1CJU B;  3CJ8 A;  1Z4U A;  1FXR A;  3PJW A;  1Q1K A;  2FC9 A;  3K5N A;  3IR5 B;  5J1P A;  2VFS A;  2DNY A;  5B0D A;  4DX8 H;  4IOC Q;  3MM8 A;  4EI2 A;  3OVA A;  4IKA A;  3KLE B;  4QCL A;  2I8E A;  3GG1 A;  1TKX A;  5DLG A;  5CD4 H;  4RU9 A;  3MCN A;  3AAW B;  1ZM2 A;  2PA8 D;  4I56 A;  4DR5 F;  3D5M A;  4DS4 A;  4OL8 A;  3I4H X;  1UFW A;  3LA0 A;  3ZTS A;  2R8I A;  5J2Q A;  1U1M A;  2FLO A;  2QSF A;  2HG4 A;  1S12 A;  2CG4 A;  2YBV A;  3W9H A;  2W9C A;  3AJ2 A;  3B4M A;  2JX2 A;  4NLU A;  2DIS A;  4JI2 F;  5BYS A;  1NHU A;  3UR3 C;  1K0T A;  4DJB A;  2OH2 A;  3W3S A;  2HWH A;  3MCO A;  3U27 A;  1C2P A;  2CJY B;  3MI7 X;  3UWT A;  5A8R B;  2BE9 B;  3Q8R B;  1UW9 A;  2FZG B;  3ENW A;  4O4G B;  4RNN A;  2ASJ A;  4AQY J;  1TL1 A;  3MOJ B;  2KH9 A;  1QAY A;  4J5O A;  2Z2M A;  4ZP7 A;  2QA4 G;  3TAM A;  3M30 B;  3J80 U;  1T05 A;  1KFS A;  1WEL A;  1RBL A;  1X5S A;  3N5B A;  4F0K A;  2F8M A;  4C97 A;  4F50 A;  1GAO A;  1UA0 A;  2R3V A;  3AJD A;  4K4U A;  2N82 B;  2VJV A;  1NB7 A;  3MTJ A;  4Q7A A;  3PX4 A;  4M5M A;  3CT9 A;  1N5V A;  2MY8 A;  1C4A A;  3V5R A;  3R27 A;  4QWD A;  3CDB A;  3VQT A;  4JI0 F;  1G1X A;  1N88 A;  5HAO A;  4NCA A;  4JV5 F;  2DGT A;  2FZC B;  3U1M A;  3K5L A;  4ER8 A;  4C4W A;  3MM7 A;  3RYL A;  3J7A N;  4FXV A;  5CCM A;  4LF5 J;  1TFW A;  2EC2 A;  4CM0 A;  3QJJ A;  5B0G A;  4I6W A;  1J5E F;  3BGL A;  2WW4 A;  1S6P A;  2EW9 A;  4PAA A;  2DRB A;  2XI3 A;  4K59 A;  1WDT A;  2YKM A;  4WKY A;  3VZI A;  1FNO A;  3NCP A;  1HNX F;  1RWO B;  1SJ4 P;  1T9X A;  1VIX A;  1F2G A;  3DM2 B;  4LR8 A;  1FDN A;  2GC8 A;  2DGU A;  4YUD A;  3FCW A;  3G2X A;  3QWP A;  3CDU A;  1LK5 A;  2L08 A;  3IR6 B;  1CC8 A;  4RL1 A;  2XSJ B;  1KS2 A;  1RHQ B;  2F9D A;  2RQ4 A;  3TOQ A;  1PIE A;  2LEC A;  2Y0S D;  2MKY A;  1VRT A;  3H5S A;  3JTN A;  2FVQ A;  4B3T F;  1HMV B;  2KM8 B;  3NL0 A;  2JZ5 A;  4FYD A;  3F44 A;  2MDA A;  2BX6 A;  1OQ6 A;  3MM5 A;  1IWG A;  4HTJ A;  1U25 A;  3HF5 A;  3UI3 A;  4C11 A;  4DPO A;  2BW7 A;  2BRL A;  1W2B R;  1Y3J A;  1UZD A;  4YR3 A;  5L46 A;  5DGA A;  1S1W B;  2C2N A;  5FII A;  3PVX A;  3BPD A;  5FD1 A;  1KQG B;  4Q2L A;  2H54 B;  4P2M A;  4ZLJ A;  2DRD A;  1TKT A;  1LWC B;  2XBP A;  5KOX A;  1FD8 A;  3OLA A;  1RT7 B;  2VBW A;  2D3O R;  1AA1 B;  3VWS A;  3ZZP A;  2AGO A;  3CJ4 A;  1L3U A;  3VAG A;  1EQM A;  3HUL A;  1X9M A;  3BKF A;  4MAK A;  5KFS A;  2IVY A;  1RAI B;  3UE2 A;  1HHT P;  4L3N A;  4EFA C;  3W9J A;  2MKK A;  4K5S A;  5ETM A;  4JP8 A;  3B54 A;  1NRK A;  3TA1 A;  4J9O A;  1KOH A;  4AE5 A;  3IMQ J;  2M52 A;  3G82 B;  1VIS A;  1U2C A;  2OO4 A;  3AHP A;  2R7S A;  2HFV A;  4RR5 A;  5ETS A;  1UMJ A;  3BKT A;  1Q7Y T;  1BQM B;  3BSA A;  2GFF A;  1RAE B;  2ZD1 B;  3ZTQ A;  4X4T A;  1JLA A;  1ZPV A;  3ISN D;  2Y1L B;  4PR6 A;  4CT8 A;  4LR7 A;  4L6V 3;  4C3K A;  1FTR A;  1S9E A;  3D1H A;  4PWU A;  3C6U A;  2YNI B;  2XQC A;  3IR7 B;  4KH1 B;  4PG4 A;  3NNH A;  2ZE2 A;  1SI9 A;  3JSM A;  1Q82 T;  2LEA A;  1RWM B;  3ZZO A;  1HR0 F;  3BDP A;  2M9K A;  1S6P B;  5IS2 A;  2HVH A;  4PWD B;  2FB0 A;  2XZD B;  4M5G A;  4M5J A;  4F4X A;  5KT2 A;  3WX4 A;  3MFH A;  1UP1 A;  2C2E A;  1BWV A;  3IA0 A;  1IBM F;  2RVJ A;  4QIW D;  4B9T A;  1PYO B;  2B7C B;  4QJV A;  5DS7 A;  4ZPB A;  4ED1 A;  1TKX B;  5B08 A;  1ZA1 B;  2H5I B;  3CE8 A;  3SQG B;  1HBU A;  5GME A;  2HMI B;  3MAQ A;  1B0T A;  1DLO A;  1NBE B;  5DDR C;  1KSP A;  2CJQ A;  2K1R B;  3CIM A;  2DHS A;  4EZ6 A;  4F02 A;  1GH8 A;  2P9C A;  3H90 A;  2CQC A;  2R8G A;  1FRM A;  2F40 A;  1RHU B;  2CAD A;  3W60 A;  2LQB A;  1JKH B;  3BO4 A;  1U09 A;  2MZQ A;  4PYD A;  1WF1 A;  2G1D A;  3GCX P;  4JV1 A;  1YBT A;  2EXU A;  2VU5 A;  2KT5 A;  3PKM A;  2OLW A;  3CMA S;  4IR9 A;  2FHM A;  4ZHR A;  5A8R A;  3W5Z A;  4JI7 F;  3SDE B;  2AIR B;  4TY9 A;  4UOG A;  5CYM B;  3QT8 A;  2QA4 S;  3OJS A;  1WOR A;  4LSN B;  3VZH A;  2EFQ A;  4LSZ B;  3VHQ A;  1WKK A;  5E3P A;  3GV8 B;  4ECZ A;  2AGQ A;  2JH3 A;  1RU2 A;  2E66 A;  5L9N A;  1ZET A;  4FYW B;  3OTO J;  5IQ6 A;  2ALZ A;  3I4P A;  4NYZ A;  2IM0 A;  2IA6 A;  2DY9 A;  3DU5 A;  2VBX A;  4C0O C;  2Q6B A;  3GWC A;  5AE1 A;  2I9S A;  2RRB A;  1S7H A;  2RF2 B;  3RW6 A;  4ZN3 A;  2H9Z A;  2K3I A;  3MM8 B;  4QBU A;  4IDK B;  1FRH A;  1JLA B;  1R8A A;  2MQQ A;  4N41 A;  2KT3 A;  3MEC B;  4EYH B;  3AD9 C;  3L95 X;  1JJ2 R;  5KFY A;  4DUY F;  2RIL A;  1EKS A;  2Q6C A;  4OX9 F;  5HQ8 A;  2R7R A;  1RTD A;  1R6V A;  3OTB A;  4O44 B;  3BYR A;  5DQG A;  2KJV A;  1VHI A;  1U48 A;  1X9W A;  4PWW A;  1RBO B;  3CGI A;  3UN2 A;  3V4M A;  4A46 A;  1TQL A;  1SJ3 P;  4OHV A;  1RT4 B;  1YTY A;  3X1L B;  3L9Z A;  1LW0 A;  2J8S A;  2FJB B;  5D77 A;  3SI8 A;  4NXM F;  1VCT A;  4U67 Q;  3OUY B;  3D68 A;  1B7F A;  1E6Y B;  2IAJ A;  3PCO B;  3WZ0 A;  4AL5 A;  1S1X A;  5ITH A;  3PIP Q;  3NBP A;  4ZVP B;  2LQ5 A;  4DR4 F;  2ZJP Q;  1ULR A;  1NJX A;  4R5P A;  4PQU A;  2GAG C;  3FZB A;  3TZZ A;  2B9W A;  3CB4 A;  4AYB D;  1RKJ A;  2W4C A;  5E3R A;  4X2B A;  3W8P A;  2KHC A;  3BGO P;  2HQG A;  1NPR A;  2ZFH A;  3M2V A;  4C3L A;  1UFK A;  4DV1 J;  2CXE A;  2YWF A;  2IJN A;  1UJ6 A;  3Q2S C;  4DXL A;  3H2U B;  4DV6 J;  2AJF E;  2G2Y A;  1NME B;  1VJW A;  1YVF A;  3VCD A;  3C2P A;  4TYB A;  2CKW A;  2OPS B;  1FKP A;  3DXB A;  1HAR A;  2J9D E;  3MWB A;  5HAT A;  2HHH J;  4QU7 A;  2VG5 B;  4X62 J;  1Q95 G;  4FXW A;  3MMB A;  3LTO A;  3KFW X;  1OQ3 A;  2QL7 B;  2P5V A;  4I2Q B;  4CO2 A;  4IFV B;  2WHO A;  2AF6 A;  3POT A;  4KFB A;  4ZP6 A;  3MPD A;  4B17 A;  1R8B A;  3BSN A;  2BAN B;  2GIF A;  3R6L B;  2XTJ P;  4OI4 A;  1PG5 B;  2IDE A;  4CT9 A;  4Q8E A;  5KG2 A;  2J9D A;  3W7B A;  1I94 F;  3GFY A;  4ZVQ B;  1NDK A;  1UVJ A;  4NAS A;  3ETM A;  1KR4 A;  4IQM A;  3O8W A;  1YJT A;  1MWQ A;  5IWA F;  3FSX A;  4PAB A;  4L75 A;  3MXH P;  2RQM A;  3N5F A;  4AND A;  4X84 A;  2FJV A;  4M8L A;  1Y0H A;  5K8O A;  2EK1 A;  2IC3 B;  3DRR A;  4M5K A;  1BQN A;  2WSF C;  4QOT A;  3WHI A;  2DGV A;  3M8P A;  2C2K B;  1A7G E;  2P2C B;  4PKD B;  4A47 A;  1UTA A;  2YQ0 A;  2X51 A;  4YP3 A;  4CO0 A;  3MEG A;  1HBM A;  3I82 A;  2DXD A;  3H25 A;  4PG7 A;  4K4Z A;  1EQ0 A;  4PXB A;  3TZW A;  1WSV A;  1MG7 A;  4A8Y A;  3PAC A;  5IFM A;  4K5R A;  3SCL E;  4DZD A;  4ECQ A;  1ZYQ A;  4ZPD A;  2L9N A;  2RJZ A;  1VQN S;  2QFI A;  2QT7 A;  2VOO A;  4F36 A;  2QJ3 A;  3DOM B;  1MMN A;  4K8R A;  5LMU F;  3RB4 A;  5F9N A;  1O5J A;  3DKD A;  3KLG B;  1HW8 A;  2MQ8 A;  1MU2 A;  3GYG A;  4ZVR B;  4EBE A;  3CJ2 A;  4EU0 A;  3ZNU A;  1UWB B;  2AW0 A;  3GB0 A;  4G1I A;  1U1N A;  3M05 A;  4AD6 A;  2D1C A;  4JV2 A;  4P7T A;  4OJH A;  1R8P A;  1RU1 A;  1Y11 A;  2NUH A;  2C3Y A;  2N3L A;  2V67 A;  2ZNY A;  1DBD A;  3FBF A;  3LAL A;  1JLQ B;  3LUY A;  4NI2 A;  4ZMM A;  2HVI A;  2W8K A;  2CJX B;  5KFD A;  2UP1 A;  1DAR A;  4LFC F;  4U7C A;  3JXO A;  2VDH A;  5CAA A;  2R42 A;  4IG3 B;  4OHZ A;  3MUT P;  1JQG A;  1LWF A;  3A8E A;  4DL7 A;  2BQU A;  1I5O B;  1FDB A;  1SC6 A;  2GGP B;  3PHE A;  5D4L A;  3EVW A;  4CZC A;  1N6Q B;  3HJV A;  2RNE A;  4RW8 B;  3WIV A;  2MZ1 A;  2XZT B;  2Z57 B;  1DJ0 A;  1RDR A;  2RS8 A;  1IVZ A;  4J9V A;  5A0Y A;  5I3Q A;  2FIU A;  2JFD A;  1NHV A;  2K2P A;  4WK3 A;  4WFN Q;  2BJ8 A;  3LWL A;  1U02 A;  4CLU A;  5HJX A;  3B78 A;  3QT7 A;  1NPK A;  1RT5 B;  1XBW A;  2DBB A;  3EMT A;  1JWW A;  3BBB A;  1NH7 A;  3KLF B;  3HDS A;  4RNF A;  2W2N P;  1TUG B;  1JNR B;  1GXT A;  3AB4 B;  3LGM A;  4QIE A;  3ZO7 A;  5CQG A;  3KLF A;  4PWD A;  2ZVI A;  5EUH A;  4WP3 A;  1U8S A;  2KFY A;  3HHE A;  1IM6 A;  2XMJ A;  3CTR A;  2ZZN A;  2FJA B;  4YHH F;  5L1L A;  3G9C A;  4LMZ A;  2DIT A;  4H4K C;  2B0G A;  3TW0 A;  2B5J B;  3MTK A;  1FE0 A;  2CQB A;  4H4M A;  3DOL B;  3N6M A;  5AXL A;  4Q45 A;  4A8X A;  1HBO B;  4KO0 A;  3BV8 A;  2ZM6 J;  3PX0 A;  1TL7 B;  1T03 B;  1UVN A;  3R7N B;  3TVY A;  5H9E J;  1GTH A;  4X4R A;  3EZO A;  5EX3 A;  1BHN A;  3RBD A;  2YKN A;  1OO0 B;  3DNC A;  3HI9 A;  1YI2 S;  2MQO A;  4HL9 A;  1VGY A;  2OPR B;  4Q44 A;  4BCA A;  5LOQ A;  1P9Q C;  4DG1 B;  3V4I B;  4B3M F;  4CLZ A;  2RUS A;  2FVS A;  4G1P A;  2IFX A;  1FKO B;  4CLK A;  3T19 A;  5I42 B;  1PIL A;  4X4O A;  2PGC A;  3PYD A;  2N4D A;  3MMA B;  5KFG A;  1UET A;  2E5I A;  4JI8 F;  4O4R A;  4Y2C A;  4WTO B;  4HI2 A;  5D8H B;  2B4V A;  2M8H A;  4PRF A;  5L38 A;  2YWE A; 
#chains in the Genus database with same CATH homology
 4CRJ A;  1RTZ A;  5ETP A;  4PZV A;  3ILJ A;  4CYU A;  4CYU B;  5ETL A;  3HSJ A;  3MCO A;  1EQM A;  4M5G A;  4CWB A;  4M5L A;  1KBR A;  3HSG A;  3ILO A;  2CG8 A;  3HSZ A;  4M5J A;  5ETQ A;  1EQ0 A;  1RB0 A;  1TMM A;  1Q0N A;  4M5N A;  1HKA A;  1HQ2 A;  1RU2 A;  5ETM A;  3UDV A;  5ETN A;  1RAO A;  3HSD A;  1EX8 A;  2BMB A;  4M5I A;  5ETR A;  4F7V A;  3HCX A;  1DY3 A;  3HT0 A;  3MCM A;  3KUE A;  1CBK A;  1G4C A;  3ILI A;  3KUH A;  3MCN A;  4M5M A;  3UD5 A;  5ETS A;  3UDE A;  3IP0 A;  5ETK A;  5ETV A;  3KUG A;  4AD6 A;  3HD1 A;  5ETO A;  4M5H A;  1RU1 A;  2F63 A;  1F9H A;  5ETT A;  3HD2 A;  1TMJ A;  3ILL A;  4M5K A;  2F65 A;  3QBC A;  2QX0 A;  1IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...