3KUXA

Structure of the ypo2259 putative oxidoreductase from yersinia pestis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
352
structure length
349
Chain Sequence
b'SNAMADKIKVGLLGYGYASKTFHAPLIMGTPGLELAGVSSSDASKVHADWPAIPVVSDPQMLFNDPSIDLIVIPTPNDTHFPLAQSALAAGKHVVVDKPFTVTLSQANALKEHADDAGLLLSVFHNRRWDSDFLTLKTLLAEGSLGNVVYFESHFDRYRPEIRQRWREQGGGIWYDLGPHLLDQALQLFGLPETLNVDLGMLRPGSQSVDYFHAVLSYPGQRVVLHSTVLAAAETARYIVHGTQGSYIKFGVDPQEDRLKAGERLPQADWGYDMRDGIVTLSHDNVLTEKPLLTLPGNYPAYYAGIRDAIWGTAPNPVPATEAIKVMELIELGIASDQQKKALPIIAKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the YPO2259 putative oxidoreductase from Yersinia pestis
rcsb
molecule keywords Putative oxidoreductase
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 97
structure length 349
sequence length 352
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3kuxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kuxA01
1UXJA 5DN9A 4CM6A 1T2FA 4E13A 4QO7A 4ESOA 4UVHA 3NT2A 2WD8A 4B4VA 4IIVA 4RF3A 3KYCB 1WDMA 4U7WA 1AXEA 4EJ0A 2Z95A 3DZFA 1DEHA 3TZKA 1DO8A 3VZQA 2IYOA 2EIHA 1B2LA 1BXKA 2I66A 5JAQA 3ZHZA 1LRKA 4WEQA 1I8TA 1T2DA 4W7HA 2OHXA 3FBGA 1UXGA 3MEQA 4IGEA 4J91A 4B8ZA 3H4VA 3NAQA 5T64A 2I3AA 1I3NA 1IHYA 3IL2A 2BFPA 1CQJA 2Y93A 3WDSA 3A06A 1GV0A 2YHIB 2H1SA 2X0JA 3I9OA 1Y81A 1DOHA 4TSKA 3OECA 1U9JA 3DMYA 1T25A 1M76A 4MVJH 1EK6A 3JQFA 3TWOA 5CG2A 3WGIA 1PJCA 4GL4A 1K3TA 3KV3O 5C3MA 1HDOA 3PHJA 4A5OA 3UFXA 4OMUA 4L4XA 4BGIA 1IPEA 3DOCA 4YWJA 3ADOA 1A27A 3JQ9A 5CHEA 2HMUA 1ZZEA 4UVGA 5HRUA 4Y6SA 2OMEA 4LCEA 4JJIA 1UAGA 1Y9EA 2HMWA 2I67A 3ZU4A 1RKXA 1P45A 2DFDA 2X22A 3LT1A 3GDOA 1DXYA 1WMAA 3LU1A 4QX6A 4I5FA 3I9NA 4IJWA 2O2SA 5IDXA 4CMEA 1I2ZA 5CG1A 5HTOA 1DPGA 4RORA 1PGOA 1U8XX 3G79A 1TA4A 4RQUA 4CUZA 3DBRB 3IP1A 1ZK4A 1X14A 3AUAA 4J1QA 4JNKA 4XGIA 2GPTA 3QVOA 2EW2A 5ICSA 4CQLB 3D1LA 1PWZA 1LQTA 1WDKA 5K6AA 5EERA 3PYXA 1PJBA 5T8KA 3O26A 3FR8A 3C24A 3UXYA 1NX6A 4PLTA 3QVTA 2DUUA 4JX8A 2I5PO 4MVJE 4Z9XA 4H16A 1DRUA 5JXWA 4BNVA 2WD7B 1W8DA 3AUSA 1KEUA 3H6KA 2QHXA 3U0BA 1ZUD1 7MDHA 5JCJA 2NLOA 4ND4A 3PYMA 1MUUA 4PRLA 4ZVVA 4NG5A 2GD1O 1QR6A 5KIAA 2WSBA 1MA0A 1N1EA 1N5DA 4XIYA 5AOVA 4CMIA 2PGDA 2NADA 2Q2QA 2R6JA 4B79A 1LI4A 1NVMB 4TZTA 1GQQA 1QXSA 3D0OA 3DZKA 1WMBA 4FIZA 4GH5A 5JDIC 4L73A 1B8PA 5FFFA 6LDHA 1P77A 3PFFA 1E5QA 2B83A 1JA9A 3VPXA 1HL3A 3DEYX 3PWZA 2NV6A 5A9SB 1TI7A 1G1AA 1JDJA 3A9WA 3HNPA 3OQ1A 1E1LA 3GGPA 4RLSA 2P5YA 1KVTA 4AJLA 4CV0A 3PWKA 3WXBA 4E5YA 5AXBA 1PSDA 5DCWA 1H9BA 3GNSA 1DB3A 3RD5A 1YO6A 4RCVA 3HFGA 3RUIA 2I9PA 4B4WA 4IGFA 4BS9A 4OGWA 2FP4A 4DLBA 5COBA 4IDFA 4LSWA 2VZ8A 2Y1GA 2ZYDA 1ZSYA 1KEPA 5I7FA 1O5IA 4P8RA 1B3RA 2JAHA 2DBQA 4OXNA 1TLTA 5AXAA 4P4GA 2VWPA 1V3UA 4YJHB 3TZQA 4BO3A 2VYND 1R0SA 3WJ7A 3ITDA 3E9MA 1GUFA 2V6BA 3RBZA 1HF3A 4C7KA 3OF2A 2O48X 4E32A 1LX6A 3FTNA 3ZNNA 5IZCC 4DRYA 2CUKA 2O3RA 1QP8A 3VAZA 3L4SO 5HM8A 2VHWA 3JQEA 4WNIA 1D1TA 4CM4A 5JMWA 1GEGA 2X23A 1J49A 5ES3A 1SBYA 2HMTA 4Z9FA 3DWFA 3F46A 2VRCD 3PIIA 5TS3A 1BXGA 1NTOA 1TT7A 1U2GA 1A9ZA 1MG0A 1D1SA 2X9GA 4RF4A 3IUPA 3ENKA 2NQ8A 5IAAA 3GMSA 4MKZA 2EWMA 3MJTA 4RPKA 2O7QA 5IJZA 5L40A 3W6ZA 3JD1A 1HEUA 2O23A 1BRMA 3UVEA 2J3JA 2YZ7A 2R00A 4CMBA 3ZWVA 2J8ZA 4DQUA 3NT5A 1EVIA 3I52A 2B35A 3MJSA 2UV8A 3MJVA 4JBGA 2PV7A 3MJCA 4M49A 4R69A 3HWRA 4XGKA 3PQEA 4YT2A 2YFHA 4E5NA 4PLHA 1NR1A 2AA3A 3I9MA 3AM4A 4DWVA 3SC6A 3RJ5A 4DXHA 1GEEA 4OM8A 5IXYA 5JPIA 3D5TA 5BSGA 4HUJA 4KQXA 2V7PA 3OSUA 4PCVA 4UEJA 1IB6A 3V1TC 3FWNA 4DQVA 2AW5A 2RH4A 1K0UA 5GZ6A 3N74A 3GZNA 3I3OA 4NH4A 2NQTA 3PDUA 3VZRA 4R5MA 4QXMA 1TT5A 4BL5A 4P38A 1HE5A 4A73A 1C1XA 2ZB3A 4WPGA 4BNYA 3CZMA 4UVDA 4YT5A 3GK3A 3PQDA 4WOJA 4NBTA 2C29D 1A7AA 3Q9UA 1S7CA 4LN1A 3GGOA 1RM5A 2B0JA 2BF7A 3RC1A 2H9IA 3GA0A 1YWGO 4J3FA 1R16A 5G0TA 3BMCB 5LCXA 5L9AA 3PZBA 1ISJA 4A26A 3VPSA 4M87A 1GTMA 4ILKA 4BO5A 1UDCA 2G82A 3RU9A 3TZCA 4QTZA 1E6EA 4NMHA 1VL8A 3DOOA 3JQBC 4J16A 3BMNA 1PJSA 2GRAA 2BELA 2GSDA 4BNFA 4FQ8A 5KVVA 4MVJA 2VUUA 2EKPA 5JC8A 3PLRA 3PPIA 3VC7A 3RUHA 3K92A 2AG8A 2FSSA 1NPTO 2CFCA 3KVOA 5FWNA 4U0JA 3WQQA 2W90A 4LSMA 1HWYA 3AU9A 3RJ9A 2FMUA 5AVOA 3CZRA 3B6ZA 3OJEA 4K26A 4XYLA 4D43A 1PJQA 1I2CA 5JYAA 1CEQA 2HMSA 4NDNE 4R1UA 5L3ZA 1DFHA 4BNZA 4MKRA 1KETA 1I10A 3T7CA 4E4YA 1Y8RA 1JN0A 1U3TA 4BNKA 3DONA 2P4QA 3OICA 3JD3A 4PG4A 2O4CA 4TWRA 1K2WA 5I9MA 3MTJA 3ONDA 1V35A 3SXPA 1ZVMA 5A06A 1G0OA 2ZATA 3DFZA 3ZWWA 4DVJA 5CDYA 3ITKA 2IEDA 2VWGA 2W8ZA 4TVBA 3TL2A 1C0LA 4Q3DA 5KJFA 3LDHA 1HT0A 5KJCA 3VTFA 2PZJA 5AQ1A 3F9IA 2FR0A 1KEVA 2AQ8A 3QVSA 5TQVA 3W4JA 1QG6A 1LXCA 2D59A 4JXKA 2HJSA 2DPHA 3TJRA 3VVBA 3STHA 1R4NA 5G0WA 3QP9A 1TXGA 1YQXA 1B3BA 3WYBA 1ZKMA 5KVQA 3MCVA 4CLRB 3ORFA 4XGNA 1HZJA 1I30A 1GYRA 3VDRA 3HADA 3JYNA 1V0JA 4R54A 2Y68A 1SB8A 4ALIA 4LK3A 2OFPA 3G1UA 4RPHA 3PYLA 2ZJ0A 3QWHA 2QW8A 3AK4A 1GZ4A 4BB5A 1ZK2A 3SLGA 1F06A 3GVPA 3UH1A 4G81A 3B20A 1P0FA 5IDQA 3LK7A 2EJVA 1YDWA 4Y6RA 1UJMA 2VYVD 2FSVA 4ZQFA 3H2ZA 2YJZA 3D64A 3X2EA 2WMDA 3PGXA 3DBHB 3JYQA 3R0IA 1U5CA 4XRRA 4CODB 4UVEA 2JCXA 4RJTA 4NQZA 3GNTA 1I3LA 3K9QO 1E7QA 1ENYA 2VCYA 3VTZA 2V6GA 3RFXA 1PGJA 4CM1A 3ICCA 4IDBA 3WWZA 1SCUA 4OSPA 4A7PA 1YJ8A 1AUPA 3TL3A 1C3VA 1YONA 3L07A 4IS2A 4ND2A 1OOEA 3GVCA 2O50A 5ITWA 3F1KA 3V8BA 1WLYA 3R3JA 2PGLA 4GLLA 4MPDA 3DTYA 1E3WA 4XQGA 1EE9A 5FI3A 3TOXA 1GPJA 3CMMA 3DO5A 4J4BA 4BV9A 2D1YA 3N7UA 3V2UA 2WE8A 1N2SA 1DFGA 4IDDA 4TKMA 5CAEA 4LISA 1DIHA 1ZJZA 3V1YA 3EAGA 4XWYA 2Q50A 5A02A 1PJ4A 1EBUA 3ZWCA 5F21A 3P2OA 4D3DA 4S1VA 1K6IA 4CLHA 4U0KA 3PIDA 4Q3EA 1FJHA 3DTTA 1MXFA 5KOIA 5CDGA 2WTBA 3JQGB 5TRTA 3HDHA 4XZ3A 5B1YA 4YCAA 2EP7A 1ULUA 1WW8A 1W73A 1PS8A 4ROSA 2BFMA 3BXXA 5BSFA 1J6UA 1PEDA 1XLTA 4QEDA 4E2ZA 3KYCA 4CLEA 3W4KA 1EEHA 2DU8A 5A3JA 4RZHA 3GH3A 4MVJP 4NHEA 4CR6A 5ADHA 4IUYA 2I99A 2DVMA 4IJVA 1JVBA 4RPGA 1SO8A 1YL7A 1QYWA 4LMPA 3ZW9A 1JAYA 2GASA 2C7GA 3EY4A 1PS9A 3GF4A 4MP3A 3IMFA 3K73O 1NM5A 5CPBA 2PKQO 2Q3EA 3EW7A 4JP3A 3F1LA 2AE1A 1NPYA 2J5RA 2YHIA 4FFMA 3N58A 1EDOA 2GYYA 2C7VA 3VH3A 5L4SA 4FDAA 2WJPA 4GPD1 1UAYA 1NFFA 1ZSNA 4R4JA 4R1SA 4R41A 1C0KA 1GZ6A 2EGGA 5L7TA 1NVGA 4O59O 5A9TA 1HYGA 4LVCA 4P4LA 1GUZA 3ROQA 3ZU3A 3RSHA 4FJ0A 3O03A 5L4LA 3HDYA 4D7AA 4YPOA 2NSDA 1JQBA 1KVUA 3LC7O 1WDLA 1IE3A 4EW6A 3PJGA 3TRIA 3GPDG 3LC2O 4E33A 4Z0PA 1A4UA 4ZRNA 1X1EA 3BMOB 3HN7A 4OH1A 1XA0A 1R4MB 1JKIA 2DKNA 4FFRA 2FPIA 5BSHA 1NQOA 1U28A 4MOWA 9LDTA 3DBRA 1AE1A 2OUIA 4CQLA 4Z3KA 1S6YA 4E2YA 4XQEA 3PWSA 5ER9A 4DMLA 1O0SA 5ILOA 1YL5A 1N8KA 4B7UA 5JDIA 1E7YA 1PQUA 2WD7A 1KOLA 2F00A 1DC4A 2AE2A 1HZZA 1AXGA 1IPFA 4MIYA 2C2XA 3AI2A 3GRKA 1JWBB 1E1NA 2QG4A 1QKIA 4HX5A 4F45A 1B15A 2LDBA 2ZK7A 2O2YA 4EJMA 3HJAA 5IN4A 1PWXA 4MIOA 1BWSA 1ZO8A 3KEQA 5M6DA 1B7GO 1DIBA 3OFSA 5T5QA 3RUEA 1H9AA 3ZWBA 1VLLA 5JY6A 1ZJYA 5G4KB 4J6FA 4ALNA 2Z1MA 3BMQB 2PD4A 2VHVA 3EGOA 4ID9A 4OAQA 2YFQA 2YV2A 1H6DA 4JCOA 4PVCA 3AOEC 5JFOA 1HDYA 1Z82A 3U9LA 2VRBA 3JYOA 2V65A 2W4QA 3ETEA 5A9SA 4BQRA 1P1RA 2BH9A 3GVIA 3KM0A 4UAGA 1MB4A 3WNVA 2JCVA 3SC4A 4MKXA 4QQRA 3OA2A 4WE3A 4AJNA 4A27A 5G0SA 4FFOA 3GPIA 4TRNA 3W1VA 4WNCA 4ZICA 3ZI0A 3TQHA 4RGBA 3VVCA 1BHSA 1K6XA 4WLEA 1U3WA 3HDJA 4C7JA 1MC5A 1V9LA 1YBAA 4ALLA 1LSOA 2Q1TA 5IZCA 1SPXA 3I9KA 5I8WA 3Q6IA 3C1OA 1VM6A 4J2HA 3UW3A 5A5FA 2ET6A 4MO2A 4OXKA 3JYPA 3B1KA 3WNQA 5L4NA 5KVCA 1Y5MA 3ZZNA 1TVEA 3IOYA 5G4LA 2BI8A 2B5VA 2P4HX 2J6IA 3H9JA 2VTEA 1RPNA 3QV1A 5I7EA 3ZV5A 3PJEA 4EI2A 4YJHA 1N7HA 1Z45A 3C3XA 3NKLA 4UEKA 1E92A 1B8UA 3X2FA 1X13A 3KSZO 1PZEA 4XYBA 1D3AA 3GG9A 4FFNA 2DQ4A 4PLCA 3WLEA 4J9UE 1GYQA 2UYYA 3AUTA 4RF2A 3UHAA 4E2WA 2YHUA 1X0VA 3OJ0A 4CMGA 3C85A 2TMGA 4PLFA 3Q1LA 3F4BA 1VPDA 3IJRA 3IIEA 4R68A 1VJTA 2RHRA 4OQZA 5A1TA 1HDCA 3D4OA 4DIOA 1DSSG 1NQAO 1ENZA 2C82A 4Q9NA 3QW2A 3HQ4O 4FOSA 1CIVA 4M89A 5MGBA 5TLSA 1ISIA 3NTRA 3ADPA 4MP8A 1SOVA 3INGA 2G0TA 1P31A 1ZIDA 4I5DA 3WTCA 1CDOA 4HFNA 1UZNA 4JP2A 5TF4A 1DC3A 1ADCA 4G5HA 3LF1A 3WYEA 3GAZA 4NJOA 3ASUA 3TSCA 2PH5A 4IDAA 1GV1A 1XGKA 1MG5A 4XR4A 2ZKLA 5JS6A 4EZBA 3M2PA 1O9BA 2A35A 2J3IA 1N1GA 4BO8A 3JD0A 3AFMA 4DTIA 2BGMA 4YBZA 3FBTA 4FD3A 4IXWA 2G17A 4CMCA 4GWKA 4WEOA 3ZN2A 4EEXA 3BTUA 3BAZA 4CM5A 2VN8A 4QT0A 4KZPA 1VJ1A 1Y1PA 4NPCA 3BA1A 3VPHA 2BD0A 2TMDA 1E6WA 4FJ2A 4ZJUA 3L4BC 1U7HA 3RQSA 1XCBA 3L6EA 1U4OA 4NR0A 5A9RA 1NR7A 1UXIA 3JQBA 3A1NA 2HUNA 1QLJA 1U7TA 4S3MA 3VHRA 2OP0A 3OBBA 2Z5LA 1OC4A 2NWQA 3SJ7A 2X6TA 4GLOA 2RIRA 3HB5X 3NDJA 4BGVA 2DBRA 4H15A 1SZJG 3BMCA 4FB5A 4AJ4A 3WIEA 3FPLA 5AXDA 1WP4A 4M1QA 3GVXA 1HE4A 4BMNA 1MXHA 4D46A 2I6TA 4DMMA 2FY8A 3R1IA 1M66A 5JO0A 4E12A 2CDBA 2O4UX 3A28A 3O4RA 1PZFA 3RROA 3ASVA 1O95A 1YOVB 3I1JA 1SMKA 1LLQA 4RVDA 1Z74A 1P1KA 1GL3A 2OGUA 5JSFA 3OETA 5JC1A 3PZRA 4PG6A 3WX0A 2ZTVA 2Q22A 4KOAA 1U3VA 1HE2A 1E77A 3KEOA 3NTOA 1QYCA 3WLFA 5G0UA 5BQFA 3LLSA 4KUHA 2DUWA 1B14A 4KWHA 4F46A 3KBOA 1TB4A 4Z0HO 5AYVA 3B1JA 4NBWA 3HFSA 1L7DA 1ONNA 4BNLA 1P3DA 3ZWMA 4D42A 4BNTA 2D5CA 4NBRA 3VDQA 2O3SA 5DCUA 3PJDA 4RVFA 4RVSA 5GZ3A 2P2SA 4BO7A 3U3XA 5DOVA 2VT2A 1F8FA 1I33A 1N92A 4Y9DA 1CWUA 4N5MA 1Y7TA 2IZ1A 1H6BA 3M1LA 4PVDA 1A9YA 3IAHA 2GDZA 2X8LA 3FWZA 4PLPA 5C7IO 3I5MA 4UUNA 1M67A 3OP4A 4CMJA 2VYNA 2D8AA 2HMVA 5J9GA 1NFQA 2B69A 5KNLA 4ZGWA 1YH3A 1P0CA 5KWEA 3KYDB 3AFNA 3F5QA 3ZWAA 5BR7A 4BGEA 5J23A 4D3FA 4CLRA 1LA2A 3H2SA 2X9NA 3T4XA 1V6AA 5F5LA 2AG5A 1V3VA 2GGSA 4J7UA 3V5NA 3E1KA 1KC3A 4OL9A 1PR9A 4L4RA 2VRCA 4XEHA 4BQPA 4DBVO 1GZ3A 2Q4BA 1CRWG 3U49A 4AJ2A 1SC6A 5TT1A 4E5MA 1JKJA 2ZQZA 2DBVO 3C7DB 3DBLB 4CLXA 5L7YA 3EZLA 3CIFA 1Z75A 4ZD6A 4IQ8A 3SBOA 1YL6A 1MFZA 3O38A 3EUWA 3FPCA 5B37A 3AUUA 1MC4A 4UUMA 3QVWA 3QQPA 5JDCC 5HBRA 3CINA 4YR9A 1XWFA 3WOHA 3QWFA 1LDEA 3DBHA 1M75A 5KKAA 3PTZA 1LDNA 5C7OO 1ZXBA 1H93A 3AW9A 5I7SA 3ZW8A 4AJJA 1BG6A 2BFAA 1Y5RA 4D44A 5CEJA 4ALMA 5JCJD 2E6UX 2A4KA 4BKQA 1LLUA 4XD2A 1YQDA 2WYUA 3HE3A 3HUDA 3ZWOA 1PZGA 3KHUA 4GGOA 4YJGB 2HRBA 3I83A 4IM7A 1I0ZA 4IZIA 4DGSA 5JNLA 4TRMA 3H5NA 3NJ8A 4YDRA 1LDGA 5CFZA 3Q9NA 4B3HA 5T67A 4J1NA 1GDHA 3NYWA 1PIWA 2WM3A 5IG2A 4IQGA 3ST7A 4O63O 4KTVE 1IHXA 6ADHA 2CF6A 5TSDA 3JQ8B 5CEFA 3F6YA 4ZA2A 3OEYA 4R51A 2E37A 1UDAA 3F47A 5EESA 1HDXA 3QHAA 1WNTA 1BXZA 3WYCA 2NNLD 3E9QA 1P44A 3S8MA 1V3TA 2PK3A 3GUCA 3JD4A 3QSGA 3KETA 3ONEA 4BO0A 2A92A 4LVUA 2G76A 3S55A 2GZ2A 1GCUA 3H7AA 1EVYA 1PGQA 2HLPA 1P9LA 2NVUB 2PY6A 3WGGA 3FF4A 5DBFA 1XSEA 3M1AA 4BO4A 2HKIA 1DRVA 2HSDA 1B0AA 1QYVA 2Y0CA 4DC0A 1NNUA 2GR9A 2GLXA 5JYFA 1T2AA 4D0RA 1NXQA 4AVYA 2O3JA 1H2HA 1ZNQO 3FR7A 4J4HA 1LC3A 2CSUA 1WPQA 1M6HA 2J3HA 4K6FA 3HHPA 4R01A 4E21A 4PRKA 3I4FA 1PQPA 4N54A 2BHLA 4QFDA 4NNJA 4DPKA 2DM6A 4WLNA 2AHRA 3QWBA 5G2OA 1GD1O 1Y6JA 4ZHSA 1U3UA 3D3EA 5JE8A 5TC4A 3AI1A 3WSVA 1D8AA 3V2GA 3RFTA 1ULSA 1LTHR 5HS4A 5KCZA 3DL2A 1YKFA 3KLMX 4MP6A 3L0DA 4L74A 3RBVA 3AWDA 2UUOA 1UP6A 3VZSA 2RHCA 3DQPA 2IRWA 4YA6A 3T7EA 5L53A 1U5AA 3BYZA 4OO3A 5HA5A 4FFLA 2P91A 3C1AA 2DTEA 2JAPA 3WR5A 3NUGA 2W2LA 3DAPA 3INTA 4BUCA 2JJYA 4ZQHA 3SJUA 3LT4A 4BNJA 4PIVA 4IY1A 3LLVA 3CTMA 3KLPX 1HDZA 1ISHA 4A0SA 5DDIP 1T2CA 4RVHA 3DBVO 2Y1DA 2Y67A 4ND1A 3UF0A 4FC7A 2Q45A 2BGKA 1Y9AA 2HAEA 3WGZA 3BMOA 5COQA 4FSHA 3VH2A 3PVZA 1R4MA 1WZEA 3LT0A 2OBYA 1Z7EA 3DB2A 4QECA 4HWKA 1DC6A 3TPCA 3PLNA 5IXSA 1K6JA 2EW8A 2DPGA 1NPDA 3ZNPA 1NHWA 3OMLA 3UUWA 1BVRA 3FI9A 2B36A 3SX2A 5B12A 8ADHA 3QJ5A 3U62A 4CLDA 3FNEA 2BFOA 2XF8A 4MJLA 4GX0A 4EYEA 1PL6A 4X54A 2VYVA 3BHMA 4WLFA 3ZV6A 1UZMA 4OOEA 5KJEA 4HFJA 2ZB7A 3RI3A 4DBZA 3WMXA 4K1LA 2V6MA 1TEHA 3AOEA 3DZBA 2EV9A 2OOSA 4MVJG 3OHSX 4NJMB 4DIBA 5DOZA 3WGHA 1NAHA 3SLKA 2JD1A 3W8FA 3L6OO 1C0IA 3ULKA 3CH6A 3UOGA 4HBGA 1GADO 5K6AC 4KDEA 1IULA 5G4KA 2VHXA 1A7KA 4BMVA 3BMQA 2PH3A 4BNXA 2O3TA 3U4HA 3CMCO 4GQAA 3RCBA 3C1TA 3LZ6A 4GBJA 4DL9A 4MVJD 2Q1WA 3IP3A 4CMAA 1OMOA 1P33A 5DZSA 4IMRA 4OJNA 4NFHA 5T6BA 4W7IA 2VOJA 4JGBA 1LDYA 2VQ3A 4FW8A 3GRPA 5JBIA 3IC5A 1E7WA 1R66A 3FNGA 3TN7A 3IJPA 4MVJI 1XKQA 2AMFA 3TFQA 3K6JA 4YYZA 4LMRA 1HYEA 1VL0A 2EEZA 1PJLA 4TQGA 4BHTA 3EHEA 4GMFA 4W6ZA 3E5RA 4CUKA 1ZW1A 4I9UA 3TZHA 1ZMOA 3EZYA 2ZTUA 3I9LA 3WG9A 1A72A 4MINA 1L7EA 5I9NA 3DHYA 2XXJA 3H9GA 3UN1A 4EGFA 2W98A 3AU8A 2IZ0A 3ONFA 1ADBA 4EBFA 2AXQA 5F5NA 1B8VA 1RM4A 1E7MA 3EDMA 3RUFA 4BNHA 1E3LA 4JK3A 4U8GA 1ZK0A 2D2IA 2A9FA 1GYPA 1H0KA 1MFPA 3B70A 3ABIA 1R0KA 4UULA 4Z6KA 1QYDA 2CDAA 2XPCA 3DHEA 4KWIA 3G3EA 3GN2A 2B37A 3ETGA 4B3IA 3JSAA 3LC1O 1OC2A 3GHHA 4YT8A 2XXBA 3E48A 2QZZA 5F1OA 1EMDA 4O1MA 4YAIA 3B1FA 3M6IA 5TGDA 1E3SA 1U8FO 1QSGA 5MDHA 2EXXA 3IUSA 3MWDB 2X5JO 4M86A 4IINA 2IEBA 2ZCVA 5TT0A 3U4DA 1NWHA 4CL8A 5C7LO 1QORA 2ZYGA 1F14A 2VOEA 3L4BA 1W4ZA 3W4IA 4Q3AA 2EJWA 1DIGA 3WICA 1ONPA 3RAJA 1PJ3A 3JQCA 2HK9A 4MDHA 1I5RA 4BO1A 1IL0A 1O89A 1ISMA 3DDNA 4XDZA 3TDKA 2E48A 3D7LA 3HZZA 4N18A 5FEUA 3SEFA 2ZCUA 4JIGA 3DAFA 2JFFA 2HQ1A 1X15A 2EGHA 5GMOA 2IXBA 3EVNA 1MLDA 2BGLA 1E1KA 3MJEA 4DLLA 4NFYA 4XB1A 3TF5A 4WLOA 3E82A 1YXMA 3F5SA 3KRTA 2IDZA 1EE2A 1M6WA 3CSDA 3EYWA 1M2WA 2PD3A 3PHGA 1RYEA 4BMSA 4R16A 3AM5A 1ML3A 4PLYA 1V8BA 4YTEA 3RC2A 1GUYA 5U9CA 4W9NC 1ZK1A 3RIHA 1BW9B 1FDUA 4FGSA 2FR8A 2ZIZA 3K30A 3VPGA 3C8MA 4DA9A 3BTOA 4DUPA 4E0BA 2JD0A 3RKRA 1I2BA 4YEDA 3LF2A 5LDGA 1CJCA 4R9RA 2ZJ1A 2EERA 4N7RA 1MGOA 1FMCA 1IUKA 3BZUA 3AM3A 5IFLA 3H9EO 5KTKA 1UXHA 1HLPA 4FJ1A 2QIOA 2FZWA 1YOVA 2Q4EA 1E7RA 2C07A 3QWAA 4MVJF 4KP7A 5CDSA 4B4UA 4CM9D 4ZU3A 1GFSA 4J7CA 2PLAA 2E82A 3HG7A 3NT4A 1FDWA 1Q0HA 4Z3DA 2GN4A 2DLDA 1VE9A 2WYWA 5DP2A 1NQ5A 1JVSA 4YACA 1VRWA 2PWZA 2PKRA 4AJEA 3DXFA 2FPGA 1GCOA 1ZEJA 2F1KA 3AJRA 5C5IA 1EFKA 4I9HA 5CP8A 3CKYA 3E5MA 1DBVO 3JYLA 2JHGA 2QYTA 4PG7A 4WCDA 3BHJA 2P68A 1XG5A 1RJWA 2V6FA 4F6CA 5G0VA 2J3KA 1KC1A 2G1UA 3ZV4A 3RUCA 4EJ6A 1KYQA 2Q99A 1NBOA 3GT0A 4A10A 3JQAD 2Q2VA 1SOWA 3WWYA 4II3A 1YB1A 1KIFA 3DAGA 1Q7GA 3GN1A 2YW9A 3UCFA 4TZKA 5CDUA 4E5PA 4AL4A 1U2DA 3OA0A 4EUHA 3MOGA 1YE3A 4D79A 4GI2A 5TX7A 3OIFA 1SEVA 1P1HA 4CM7A 1P1IA 3V2HA 2Y99A 1K89A 1BSVA 3I6QA 4WK6A 2X5KO 3KYDA 1E3IA 3VKUA 8LDHA 2YDXA 5KVSA 4PG5A 1H5QA 2CF5A 1DLIA 5GZ1A 1B26A 4RZIA 1JU9A 5JDCA 1H6AA 5GY7A 1G6KA 1PX0A 3O8QB 2JD2A 4E2XA 4E31A 1UP7A 1ARZA 3U4IA 4IBOA 2X7HA 1XYGA 2X5OA 1CF2O 3ZHYA 4XB2A 4NK4A 4EEZA 4F3YA 1F0YA 2E49A 3GVHA 3TFOA 5TJ9A 4PLZA 3KXDA 2EHDA 3FTPA 3I6IA 5EN4A 3DBLA 5DBGA 3PRJA 1YBVA 3AY3A 4Q3CA 4CV1A 4O0LA 3PHLA 3NGXA 2RBEA 2ZB8A 3QE3A 1YVEI 4LW8A 3G0OA 2D5AA 3GQVA 4YRDA 1Q0LA 2POQX 1X0XA 5U4QA 3E9NA 2YYYA 4IQ0A 2ZYAA 2UVDA 4J0EA 4XX0A 5KKCA 4NU6A 4K9DA 1HRDA 2HU2A 2C20A 3P2YA 4BO9A 3ETDA 4NBVA 1LNQA 4Y67A 4LRSB 3ZCXA 2HJRA 3GLQA 3ON5A 5THQA 3KYBA 4KUGA 3D3WB 4ZQBA 4B4OA 3U5TA 1A4IA 1K5HA 4CMHA 1FDTA 3WBFA 4YJGA 1SNYA 2EKLA 1NASA 3WIDA 3QRWA 4DQXA 2I65A 2PFGA 2Y0EA 4B7CA 1CETA 2AQKA 4UREA 1N9GB 2NACA 1R0LA 1VL6A 2X9VA 4AJOA 4U6SA 2FPPA 3FCOA 5LC1A 1QMGA 1GY8A 3JQ7B 5A04A 2PZLA 3W6UA 5A05A 3JQ8A 1LJ8A 4WECA 4JLWA 1LQUA 3S1LA 1GR0A 1VKNA 4PFJA 4PZEA 1VI2A 1LDBA 2VZ9A 1LUAA 5EINA 1L1FA 3RUDA 3A4VA 4Y6PA 3GHYA 3P7MA 5EQDA 3NV9A 3U09A 1OBFO 1Q7CA 4QSMA 5DNAA 4N5NA 2W2KB 4CQMD 1ISGA 1YBMA 4UVIA 4ZRMA 2NVUA 4OQYA 3GG2A 3RWBA 4WCFB 5B4UA 4XYGA 1DIAA 3JV7A 2J5QA 1GPDG 3CPSA 2Y1EA 4OHUA 5LDHA 3PHHA 4GX5A 3UKOA 3FSRA 3TNLA 3HDQA 3WTBA 1G0NA 1H6CA 3ZDFA 3KOUA 2WDZA 3PDJA 4AICA 3LVFO 5EIOA 1XR3A 4WUVA 3MZ0A 2HCTA 5JYEA 3PI7A 4GVLA 1I36A 2YQ4A 3AOGA 3GUYA 3JD2A 2HO5A 5DULA 1T2EA 4HNHA 3PXXA 4L9RA 4JROA 1WVGA 2IODA 3H65A 2NTVA 4WCFC 2VNSA 1ZFNA 3DC2A 2NVWA 3VOSA 3T4EA 4J1TA 5DT9A 2I76A 1Q1NA 4BKRA 3MTGA 1PR3A 3JQAB 3KZVA 1LRLA 2DT5A 3FRJA 2G5CA 5KJ6A 3LYLA 5JY1A 4M55A 4C4OA 3ENNA 3WBBA 4BGUA 3NEPX 3KSUA 1CQIA 3C7AA 5EL0A 4B8WA 5L51A 5EMHA 2FWMX 4ITUA 2GN9A 4J7XA 3ZNQA 4U5QA 3BTSA 3ANNA 3BHIA 2VWHA 4H7PA 5DF1A 1E5LA 3LQFA 5ILGA 1PGPA 1EBFA 1FK8A 3PQFA 5H82A 2VHZA 3I23A 2Y1OA 4AFNA 4XR9A 1NAIA 3IKVA 2H5LA 4TMFA 1JKFA 4YJDA 4HFRA 3H9QA 5IDWA 2JKVA 2DBZA 1UZLA 4D41A 3LT2A 4BIIA 3UCEA 4FN4A 3O9ZA 1XIVA 4RPJA 2R2GA 5EQFA 3VH1A 4GWGA 2SCUA 1RM0A 2VTDA 5JW6A 4YT4A 2IXAA 3F3SA 3ZHBA 1PS0A 1EUZA 1ID1A 4FGWA 3PGJA 1SAYA 3D4NA 2FRDA 3DMTC 2NUAA 2Q1SA 3F4LA 3FN4A 1HDGO 1YQGA 4BKPA 1E1MA 3E18A 1B16A 3UCXA 4UUOA 1C1DB 3OQBA 2QRKA 4DIFA 4R1TA 3WJAA 4NIMA 4CLOB 4YJFB 3ROKA 3JQ6A 3OEWA 3QIVA 2H63A 4GSKA 4FC6A 4IDGA 3GDFA 1ISFA 1DRWA 2VWQA 1H94A 4NJMA 1HE3A 1RYDA 3I4CA 3ZH2A 2UAGA 2ZQYA 1T24A 4I08A 4RVGA 5BSEA 2X0NA 1EQ2A 2CNBA 2BKAA 1I01A 2AEMA 3GMDA 1OI7A 3PFWO 3OIDA 1NFRA 4U6QA 2J5KA 4CM8B 4G65A 4XYEA 1A5ZA 1IZ9A 1JAXA 4BNGA 5F3RA 3CXRA 3NRCA 1P74A 4IS3A 3FD8A 4ZQGA 2GN8A 3VH4A 1XQ6A 3GAFA 1A71A 1UH5A 3DR3A 4D0SA 2FOIA 4J43A 2EF1A 4UUPA 4DREA 5JAZA 5AXCA 4HFMA 3GFGA 1YGYA 1YRLA 2OBNA 2Q1UA 4HXYA 3H8VA 3NGLA 3E03A 4M54A 1T4DA 5L45A 4CM3A 4CV2A 4CQMB 2C54A 1FDVA 4L0QA 2XAAA 2HK7A 5TIIA 1J0XO 2WEKA 1JTVA 4BOYA 1O8CA 2NU8A 1D7OA 2UDPA 4I5GA 2X58A 4RVUA 3WGYA 2GCGA 2VUTA 2BLLA 4OIMA 2B5WA 4CMKA 1J4AA 3WGOA 1XEAA 3G49A 3K96A 5K9ZA 2AQHA 3E6AA 4XRGA 2QQ5A 4NZ9A 4PZDA 2DTDA 5A5EA 3LSYA 4QFCA 5JLAA 3RBXA 2BMAA 4WLVA 2B4RO 4AJHA 1U4SA 3WGTA 3WSWA 5H83A 2YV1A 4BNUA 4A2CA 4YVFA 1I24A 2Y1CA 3WQSB 5BT9A 3ZWYA 4E6PA 1HLDA 1HETA 3DOJA 5FYDA 1R15A 3VPFA 2CDCA 2PA3A 3P19A 5HWSA 3NTQA 2YQ5A 3W8DA 4KUEA 5JCXA 1ZH8A 3H3FA 3ANLA 1QYXA 4G2NA 1BGVA 2NU6A 4Y8VA 4L8VA 3ZWXA 1ONOA 4EDFA 1Y8QB 3JQGA 2DTXA 2JCYA 4W82A 3H5AA 4H3VA 4PGFA 2C5EA 1OZAA 1EK5A 1Z6ZA 3NJ4A 2JFGA 1ZBQA 2GN6A 5BNTA 2NVBA 1E6UA 2P9EA 4TRJA 5JAIA 3JCZA 2X86A 4DYDA 2C59A 3Q2KA 4IJKA 3K5PA 4RV9A 4FFPA 2WWRA 1DHTA 3H9UA 5ENVA 1DJQA 3RC9A 1HDRA 1EDZA 2RCYA 4PN3A 3WGQA 4L4SA 1EVJA 1LDMA 3OJFA 3NX4A 2GNAA 2C5AA 4W9NA 1PL7A 5ICMA 1KERA 4GGPA 3VKVA 1AHHA 1HXHA 3IS3A 4GAEA 5I9LA 3M2TA 1W6UA 4KMSA 3WB9A 3GEGA 4J9VA 4O6VA 4GVXA 2JFHA 2YUTA 5CEEA 1BDBA 3HB4X 1ZMTA 5TNXA 3W8EA 3OQ6A 2BRUA 1W0CA 2D3TA 4EUFA 1E7SA 2WYVA 4YAJA 2X1HA 4IMPA 1XU9A 1AGNA 3DZGA 3L6DA 4WKGA 3KTDA 2QRJA 1BW9A 4IIUA 1GQ2A 1MX3A 3OH8A 1PGNA 3ZHXA 1DHRA 5JAMA 1F12A 4XKJA 4ND3A 4M8SA 4MVJM 4L75A 4FBGA 5EPOA 2VHYA 1KVSA 2YV3A 2FZEA 2NTNA 3SVTA 3JQFC 4I1IA 2JHFA 4II2A 4B3JA 2HRZA 4WOKA 5DCYA 4FOOA 5I8ZA 1QV6A 1PU2A 7ADHA 3DZHA 3G17A 3QA9A 4HY3A 1BMDA 4OXYA 4TVOA 4J4TA 1R37A 1VSUA 2P5UA 3IDSA 2GF2A 3JQ9C 2VT3A 3U4CA 2WE7A 4WGGA 5JO9A 2DC1A 4Q3NA 2FHSA 4RL6A 2VNAA 3EVTA 1PTJA 5A3VA 5T57A 3DZIA 1IYZA 1Z73A 2XOXA 4JBIA 3K2BA 2GZ1A 1NVTA 1EVZA 2Q2WA 4IZHA 3QVXA 4Q39A 4Z9YA 3ROMA 4DLAA 3MOIA 4CR7A 3GGGA 3VZPA 4CMEC 4KTTE 5KJ1A 1NWCA 3MJ4A 2Y05A 4I8XA 1XHLA 4JJGA 5IN5A 1FF9A 3GEMA 4JBHA 1I3MA 5IZ4A 4TKLA 3PP8A 2NU7A 4RQTA 3EK2A 1NQTA 2B4TO 3OM9A 2QYSA 4AJPA 3V1UA 4CMIB 2VZ0A 3K31A 5T8KC 1C14A 2EP5A 4BNIA 1NHGA 2PKQP 3ROPA 3AY7A 4HP8A 4GX2A 1AN9A 2W2LD 2OZPA 3KSDO 3RKUA 1LU9A 9LDBA 5B4VA 1N7GA 2QRLA 3K8ZA 5HS6A 1KVQA 1KEWA 4P22A 1UDBA 3O8QA 3FHLA 2C2YA 3L9WA 1BVUA 4RO0A 2Z1NA 1VJ0A 4FCCA 5ITVA 3KB6A 4J0FA 4K28A 3I9JA 4INAA 1DFIA 2ZTMA 1U1IA 4LCJA 1HKUA 2IYPA 4HNGA 4GMGA 5FI5A 2IZZA 3TZ6A 3D5QA 1LSJA 2HDHA 1E3JA 1AHIA 5JYDA 3CE6A 4RDHA 4OOFA 3TOZA 3KUXA 1X1TA 3ZNOA 3CUKA 3KO8A 1CERA 4PLVA 4K6CA 3G1TA 1VC2A 3EMKA 4Y98A 2OO5A 1ENPA 1QV7A 1MV8A 3NDIA 2C0CA 3DZJA 5H81A 1C0PA 5EJ2A 3RVDA 1X7HA 2CVZA 4BKOA 3WMWA 1UR5A 3D3WA 4HV4A 1ZEMA 5BNFA 1LLCA 3RC7A 4E3ZA 4QO8A 2AEJA 4YRBA 2X0RA 1JW9B 4BKUA 1X7GA 1F8GA 5DP1A 5THKA 2DFVA 1H2BA 4CM4B 3PHIA 1DDOA 3GY0A 1N9GA 4NFSA 4Q3BA 4BNNA 1I3KA 1GQYA 2VUSA 1D4FA 4ZN6A 4JN6B 3ANMA 3DFUA 3Q3CA 4W99A 4XCVA 2UUPA 3JQ7A 1P1FA 2QX7A 1BXGB 4HKTA 2BI7A 1PJ2A 2Y0DA 2O3UA 1HSOA 4KQWA 4AJ1A 4N5LA 5L95A 2CMDA 3RU7A 4KDFA 1KY4A 1VSVA 1LSSA 4XIJA 3MWEB 4BVAA 4CV3A 4GKBA 1KBZA 3WS7A 1NYTA 2OORA 2QZ9A 2O7SA 2NTJA 1NP3A 3Q0EA 2W2KA 3GNQA 1YDEA 1T1RA 4YB8A 1EUDA 2DAPA 4YAGA 3EC7A 3RFVA 4IPTA 4L76A 2FN7A 4OKNA 4WCFA 4WJZA 2OL4A 3ZWPA 5CDTA 5I7VA 1KVRA 1Q0QA 1OAAA 1WZIA 4IJUA 1LRJA 3GFBA 4CM9A 3BTVA 2A94A 4JQCA 1DC5A 1LBEA 3ZU2A 4WASA 1T26A 5A03A 1Z7BA 3Q2IA 4R3WA 1UP4A 2YY7A 3S2IA 3PJFA 2PZMA 4XQCA 2R00C 3H5RA 4OYRA 2LDXA 4J49A 3AI3A 4WLUA 1VKOA 2GUGA 3GZNB 1LSUA 2PNFA 1ZCJA 2I3GA 4ZQEA 1TT5B 1ZXLA 4XJSA 2HK8A 1R6DA 4RLHA 3GC6A 4CL3A 1KY5A 3WFJA 4BNWA 2NM0A 1YB4A 5F1PA 1T1SA 1C1XB 4RPLA 4F6LA 4ALJA 1E0DA 4D45A 1RM3A 3HSKA 4ONEA 3JQAA 2Q46A 4YAEA 2CVOA 3Q11A 4DYVA 2D4AA 5IF3A 2FR1A 4YRAA 1GU7A 4I9NA 5DBIA 4FPXA 5JMPA 1P1JA 1ADGA 4CR8A 4J2OA 2OP1A 1DJNA 3GOHA 1PQWA 1MP0A 3UAGA 1HSZA 3RASA 1JLLA 3S2GA 3NDRA 1XQ1A 3OIGA 1LC0A 1F17A 3BMNB 2X0IA 2P9CA 3DMTA 4RDIA 3GEDA 3ZGYA 4BB6A 4B7XA 4NU5A 4BNMA 5FF9A 2B4QA 4AJIA 4BO2A 4QUKA 4I5EA 2EKQA 4XYMA 2Q49A 2P9GA 3UICA 1XELA 4GX1A 1E3EA 2E4AA 4IDCA 2D0IA 4FR5A 1KS9A 1GAEO 1FDSA 3R6DA 2CVQA 4AJKA 1HTBA 4BV8A 1WWKA 1Y8RB 2AQIA 1IOLA 1T4BA 3BIOA 1QLHA 1O6ZA 4PZCA 3OJLA 4PG8A 1SEPA 5T73A 1C1DA 4PLWA 3JQDA 1UUFA 3H3JA 4YXFA 2CD9A 4CLOA 4YJFA 3WQRA 2X4GA 3GDGA 1EUCA 5IDYA 1EZ4A 2JL1A 3DHNA 3K2EA 2CZCA 2ZB4A 1X7DA 1XDWA 3QY9A 3CEAA 2YDYA 4RF5A 4MIEA 3OJOA 1Q7BA 1PL8A 4OKIA 3HN2A 3P5SA 2OXIA 1R4NB 3PEFA 4J90A 1ORRA 3JTMA 4OSOA 4EUEA 3FNHA 5CPFA 2Y66A 2RAFA 4XDYA 3S2FA 5F1KA 2RH8A 4UEOA 3WFIA 4CM8A 2Y1FA 3PK0A 4CUJA 1YS4A 3FNFA 1CYDA 4AG3A 3ZWNA 4A03A 3E8XA 4YAKA 4JJFA 3ICPA 2GO1A 1XU7A 4DC1A 5ER6A 4LRTB 1HYHA 2ILTA 2NU9A 4YQYA 4J1SA 4NI5A 2ZTLA 1IZ0A 3AY6A 4NK5A 1DLJA 2EG9A 1ZSVA 4W4TA 1LLDA 2O3QA 3L9XA 1R12A 1PJTA 1FXSA 4Z0TA 3ZV3A 3INRA 4O5OA 4PLGA 4EITA 4CQMA 1LEHA 2H6EA 5A4DA 1EQUA 1BTOA 4CJXA 4DPLA 1UXKA 4YQZA 1SB9A 3L77A 1EFLA 4HADA 1DIRA 2PR2A 1DAPA 4P4NA 2IE0A 5COAA 3IKTA 3R3SA 3GZ4A 4CPDA 5K0ZA 5BNIA 1RWBA 1ZK3A 3D4PA 4E5KA 2PTGA 1Q2XA 4GKVA 4XQ9A 5B4TA 5TJHA 1PZHA 4GSLA 2GZ3A 3RUAA 1I32A 4IXTA 3QWIA 1O94A 1YB5A 4TROA 4XA8A 3ZU5A 1E3WB 4R3NA 3S2EA 4LGVA 1J5PA 1DAOA 5ENDA 3QLJA 4E30A 4TRRA 3C7CB 3IQDB 2PZKA 1QRRA 1IY8A 4NBUA 3COSA 4ND5A 2GERA 5L7WA 4ALKA 2CY0A 5C37A 1JWAB 4D3SA 5U1PA 4FS3A 4R9SA 1WXDA 4IDEA 4BO6A 1WAMA 2AEFA 1ADFA 4R5HA 4R1NA 3UGKA 1BDMA 1ENOA 1Y8QA 1YJQA 4XJTA 3GR6A 3A14A 2PD6A 4URFA 1OFGA 4DPMA 2PGJA
chains in the Genus database with same CATH superfamily
4PNPA 1UXJA 1CTQA 2XBLA 2PX2A 5IU6A 4QO7A 3DOEA 5A62A 3KL4A 1AQIA 4UBLA 3L82B 1RFLA 4NOMA 1ZUNA 2X1LA 4FYIA 1AXEA 1ZVQA 3A1UA 2H59A 1OBOA 1R5JA 2Z95A 3DZFA 4I55B 4OUDB 4N5IX 4C2TA 4ENQA 1UBEA 3T3GA 2CB9A 2IYOA 1G2OA 5EE3A 4RAOA 5JAQA 4C0LA 2I66A 2OHIA 1LRKA 3B7PA 2AEEA 4JS0A 3IDFA 1SRRA 4WACA 3OLCX 4O4LA 1KZHA 5IUNC 5AUNB 2AZDA 4ARVA 4TXJA 5EWMA 4KL8S 2I3AA 4O5AA 4WW0A 3TZLA 1HFKA 2HU5A 1H8HD 4B76A 3AF1A 3KPYA 2BFPA 2JLSA 1EG2A 4V02A 5KC8A 2QMUA 2YOFA 1ZRNA 4M1ZA 3ETNA 3WDSA 4L1KA 1PQ4A 4ZK2A 2VI5A 4S0ZA 3T5DA 5B58C 3B2EA 2XUPA 3K71B 5EUMA 2DY1A 3NVAA 4HTAA 2BF4A 1Y81A 1ZVKA 4OB8A 1EFVA 4BX2A 1DOHA 1XTSA 3QQ5A 4GNRA 3DMYA 1T25A 1SXQA 2JKYA 1M76A 2V45A 1EK6A 3PR3A 3TWOA 4ZTUB 1OD6A 1OZGA 1TM5E 3CNOA 2OXCA 3I2YX 3EOAI 4X9XA 3ZVNA 2YZ2A 4PICA 1E20A 4JCCA 3ZHSA 4D8WA 3PHJA 4LJAA 3KFVA 1ZA2A 5K8IA 5LQSA 2A0FA 3H11B 3T3PB 4OMUA 5JH7A 4L4XA 4MW5A 1IPEA 3DOCA 4F1JA 1NM5C 5L3SB 4I1VA 2BGTA 2XXAA 5CHEA 2ZU0C 4X6LA 3U1VA 2W2NA 2GKGA 1E1DA 3JVUA 2PYZA 4LWPA 5AM1A 5HRUA 2EFGA 2YXDA 5LP6B 4EZEA 1T9HA 1XQXA 2HMWA 2IOFK 1ZESA 3O92A 4GI5A 1RKXA 3ZU4A 4AD8A 1P45A 3WLKX 3V4OA 3RLIA 2BZ0A 1I4OA 1XVVA 4QX6A 5NLLA 3BH0A 2ZJOA 4MW4A 1GGNA 5AI6A 4IJWA 1KGDA 4CMEA 1PEKE 3CZ9A 1I2ZA 4YIKA 2FKNA 3IWCB 2DJ5A 3C39A 3UAWA 4A6XA 1E2LA 2VDUE 3OLYA 4Z54A 3AR8A 2VH2A 3G79A 1TA4A 2FTKE 5JR3A 4PCLA 2C57A 1X14A 3AUAA 4P32A 4O4JB 5DW0A 5BSTA 4N49A 5LZ5A 4CQLB 3K9CA 1IUOA 1PWZA 1Z07A 4E46A 5K6AA 3I5XA 4B5LA 1KI8A 3CEPB 1R5OA 3VPBA 2NYVA 2GXAA 1KAOA 2ZREA 5C1OA 5AOCA 3GLTA 4BU1A 3EG9B 3NIBA 1KJNA 4G41A 4JX8A 4MVJE 1YR2A 4Z9XA 1MABA 1TM1E 1QHYA 3KOZA 4WKBA 3ZXIA 2WD7B 2Z6UA 1H9CA 3P0JA 1JBEA 1G21E 2H51A 1TGVA 2RGNC 2WPDD 3AKEA 4GZ5A 1QGZA 4E5VA 4Z5XA 2CL0X 1YU6A 4GZ3A 1TF7A 1A2QA 5EKDA 3ZLUA 2HLNA 3HY3A 3KAJA 3O1IC 1T29A 2GD1O 4KJXA 4MW0A 2WSBA 4AMZA 4D3YA 2HLDA 4IHJA 3KSAC 2J67A 1L6IA 4DRXB 2NADA 1IC6A 1SELA 2Q2QA 3PUYA 2B34A 5HG0A 5LA6F 4Q1DA 1USKA 3C3DA 1LI4A 1NVMB 4JBLA 4JBYA 1NDQA 3D0OA 4NYJQ 1LY1A 1MOSA 2XWPA 3RAFC 4NH0A 3DR5A 5E4YA 1B8PA 3FJOA 5FOXA 4YRZA 4DANA 3E9DA 5ALWA 3QBEA 3SIRA 4XVCA 1Y7PA 1HZZC 2B83A 2H4YA 4C30A 4FLEA 5A0VA 2ZYVX 3CR3C 3IJEB 1E2NA 1HL3A 2WG1A 3MMSA 2NV6A 1W5AA 4QUGA 4OFBA 1PSWA 4D82A 1G1AA 3OU7A 1FA9A 1Q57A 1C7ZA 2V7WA 3FVWA 1WMDA 3KDPA 3A9WA 3IOBA 4MW1A 3U7HB 5HIIA 5BN5A 3MTDA 1FYFA 2P5YA 3KQOA 1SHZA 1PSDA 3O5AA 1I2MA 2H29A 5DCWA 4BZWA 5A6SA 1OLSB 2CB0A 3GNSA 3O1LA 4DV4B 2YKGA 5EP2A 3KKEA 3RD5A 4C3ZA 1NBIA 1SKUA 2C7RA 1U3CA 4RCVA 3HFGA 3ML1A 3RUIA 1ISRA 1WW2A 1P6XA 2OZLA 3F97A 3LUCA 4MV1A 1FRZA 1VKZA 4IGFA 3T35A 4B4WA 2IH2A 3IBGA 4KR2A 3BRSA 1T8PA 1WNFA 1UKCA 3MF4A 2R0QC 2A8YA 5COBA 4PC3A 3GMIA 4NSNA 3R9KA 2WWFA 1Q1BA 3TW6A 3LW8A 3B60A 5DEOA 2GTPA 1ZSYA 1GKIA 1KEPA 2KW5A 3LIPA 4KX5A 3QY0A 1NQXA 1MB2A 3H5TA 3USES 3PQ5A 1U9ZA 2JAHA 2QN1A 3A37A 1BE8A 2AMLA 4JH0A 4OXNA 4CCAA 4UATA 2XCTB 2W8BA 4PZYA 3EULA 3N6XA 3TZQA 1I51A 1U04A 2VYND 2RB5A 2IEAA 4KBFA 3E9MA 3IPYA 2FGJA 1CS4C 3TD2A 2O48X 4E32A 4U4AA 1P5ZB 4XAQA 4N65A 4FGZA 3ETJA 3SGLA 4D81A 3FPEA 2BEUB 3JW8A 3VAZA 3UJDA 1H8ED 1LPPA 3ZQKA 1FSGA 1D1TA 3BWDD 2UUBB 2J3MA 3VTAA 1FVFA 1SBYA 2HMTA 4LJ6A 2VF8A 1EE1A 1Y37A 5GJWC 1P17A 1ZP6A 3QELB 4HDQB 1VI6A 1KKMA 1VGQA 2YJ6A 1GG8A 2QNIA 1DX9A 1U11A 1FSPA 1PYDA 1A9ZA 1V39A 4HQFA 3BD9A 3D8SA 3IUPA 5GJVC 4C22A 5A5GA 2NQ8A 5LQRA 2ECOA 4AYTA 4A0HA 4MKZA 2BIFA 2EWMA 1NNLA 1MVOA 5IJZA 4K05A 1HEUA 3MWEA 3L0PA 1IIBA 4TYQA 3G5UA 1U8TA 1FPMA 2R00A 2J3JA 1WL8A 3U9TA 1V7QA 1HR0B 1OXXK 4JYAB 1P0PA 3AVVA 3W77A 4N6OA 2QL9A 1S2LA 3AFIA 1H1LB 3MJSA 5ELXA 2AMVA 2OBMA 4P5DA 4L5YA 4X91A 4D9BA 5JATA 4E5NA 1UBUS 4HWSA 2V98A 2HA6A 2CDRA 3AM4A 2V7QA 1IEXA 3VI3B 5C8YF 4MGZR 3QKSA 1X9GA 1MO2A 2JH3A 3KP1A 3USCS 3CUVA 2CFIA 7REQA 1QPZA 4YRPA 1QAMA 1ZG3A 1RTTA 2FKAA 1PDOA 2QMZA 2GJKA 4HUJA 5TS2A 4D6XA 1TF5A 1V4BA 1Q1EA 1F1BA 3GLRA 4UEJA 1K97A 1IB6A 3NWBA 3PUXA 5LDDC 2OFOA 4KXFB 4DQVA 3UAZA 3N74A 3U7GA 5KHOC 3OF5A 1CNFA 2C84A 1XJCA 1A9PA 3N0TA 2OAGA 2G3YA 2RI1A 5K2MA 1PT5A 3T6KA 2GKOA 4BL5A 1JLKA 1N2EA 4PSDA 3AEKB 1L1QA 3BE4A 3MRSA 3NTVA 2J7PA 1Q20A 1C1XA 4FE7A 1UC4B 2JGNA 2NZUG 4UVDA 3GK3A 2GVDC 2HIAA 4JSTA 4NBTA 4CG0A 3CCBA 3Q9UA 5BNZA 4M1TA 4A6PA 1XZBA 4IOJA 2WAYA 2BEVA 3RC1A 1NY6A 1DEAA 1O96B 3TZBA 4F11A 3NXSA 3NAGA 5LBIA 1DAMA 1Z28A 4C01A 4EGJA 2CFSA 5JNTA 1CUJA 1U1GA 4A26A 4DV3B 1KXJA 1GAXA 4BFTA 3AR6A 1JR3D 3LY9A 5IAJA 1W581 1QQTA 5EYPB 2P3LA 1J8FA 3TBHA 1FEZA 2G82A 2O2XA 1RR6A 2F48A 1NI4B 4O8JA 2WJ6A 1CKEA 4IOMA 4WOCA 5JV5A 1KI1A 4JT9A 1VL8A 4CEHA 4ZO4A 1BCRA 5C8ZA 3PDIA 4C6SA 3CRZA 2OO7A 4HQKA 1LB1B 5FJIA 1NW8A 2OCBA 1UEJA 2HJ9A 3GUUA 2VTKA 4MVJA 1EGQA 4AQYB 5KO2A 5J59A 2EKPA 4J3NA 5JC8A 2BZGA 1ZU4A 4KREA 1W0KA 3ZJ4A 4MV7A 2IUFA 5FD8A 1G21A 2FSSA 3MAJA 4MRNA 2CCKA 1RDFA 3QE0A 3KVOA 3TQQA 1I7SB 2XF2A 3WQQA 4U2BA 3G2QA 1HWYA 3K72B 1L9KA 2Q27A 2WVGA 3F90A 3CZRA 4MPPA 4I3HA 2GK6A 3WWDA 1W47A 2FWPA 4D43A 1PJQA 3G0BA 5JYAA 1CEQA 2XADA 4MR9B 2QX9A 4GU5A 2P1ZA 4BNZA 5JSKA 1KETA 2QAGB 1I10A 2KB0A 5FPQA 1N78A 1JEJA 1VSBA 2XE4A 4AWAA 2ZYSA 4RH0A 4DLTA 1JN0A 4A2QA 3TEJA 1O95C 2HSZA 1SU6A 1KSJA 4HK4A 4IFEA 4C4YA 5FR2A 4TL7A 5KQSA 1K2WA 2RSLA 4FT2A 4UNRA 2QVCA 5JNSA 1V35A 2CC2A 4DVJA 5A06A 3ZWWA 3ILYA 3ITKA 5CDYA 4MWOA 4TVBA 1T6YA 3F0TA 3H3XA 2BEKA 3TL2A 2I4OA 4P7FA 2CHQA 1RLIA 4RTKA 1CZHA 3B6JA 4LGYA 5BURA 1PHPA 3WLAA 4MV8A 4J7AA 4PXAA 4E4YA 4C4XA 3SZOA 3ZQJA 4ZGBA 5DNCA 3L6CA 3QVSA 2R6DA 3RC8A 3ZBUA 3Q9LA 3TJRA 3VVBA 3KDAA 4RM3A 2PWPA 3ZVKA 4QOJA 3OE7A 2BGWA 2DF8A 3WYBA 1KJYA 2PKCA 3DVLA 1EJ0A 3MCVA 4FYPA 4LQCA 1FTWA 2X19A 4F2HA 1A2KC 4GKAA 3U0VA 2AXEA 1U2EA 2GPWA 1GR1A 3PR2B 3L4EA 3AJAA 3JYNA 1I7QB 2C61A 2K7FA 3W5JA 2Q9AA 3HYNA 3EEOA 3E9RA 1E96A 2Q5HA 3HCOA 1PEYA 1V43A 4L0CA 4DW8A 2OFPA 3A32A 3G1UA 2J32A 2TRSB 2D74A 1HORA 1BMQA 2QW8A 1YZNA 1GZ4A 4DSUA 1ZK2A 3SLGA 1RACA 4E03A 1F06A 3NEAA 2HXYA 1PR2A 1P0FA 5EY5B 4FFSA 1H2ZA 1DCMA 4IF4A 4QQNA 4D4JA 5IDQA 4U7GA 3IUYA 5IT5A 3EF3A 1E2IA 4TTSA 2PH1A 1TKRA 3IP9A 4R84A 1G6Q1 2VYVD 3H4IA 4XM2A 4QXAA 2FSVA 4ZQFA 3H2ZA 1E2HA 1QGAA 2QPTA 3H2GA 4I99A 4KYTA 4R8KA 1KSGA 3X2EA 3SS8A 4AXXA 3HCEA 3ND7A 4Z4IA 1ULHA 2O8EB 4CODB 2G4CA 3N39C 2O2ZA 4UVEA 4S1NA 1Z5WA 2GTHA 4KPGA 3K9QO 1IN4A 1E7QA 2FEKA 4X8OA 3VTZA 4F85A 4BLUA 1RVDA 5A4AA 3LCJA 4LXQA 3GLSA 3JR3A 4Z7QB 5ALYA 5CIQA 4IDBA 2ZUTA 3SXJA 3WWZA 4M37A 2DB3A 1V47A 2QTWB 1MAHA 1N5IA 4UBMA 3ZJ5A 5DXJA 1M72A 4PSAA 1PKXA 4P9NA 4ZI2A 4QM7A 1FFEA 1NKVA 5DRYA 5ITWA 3UGJA 3WLSA 4P4UA 4YUXA 3NBMA 3F1KA 3HKEA 5BN4B 2RGYA 1RI5A 3EFEA 3IJ5A 3R3JA 4QQKA 4PHGA 5AKIA 3DTYA 2FI1A 1ECBA 3ZGXA 4XQGA 4NJEB 5FI3A 3SC2A 1GPJA 3SYRA 3WYNA 3EY9A 3CMMA 4EX7A 1PVDA 1QHGA 3GBPA 2R97A 4CEIB 1XZQA 5BP7A 2WE8A 1XLWA 4XCXA 4IDDA 5EHIA 1L4LA 1DIHA 4TT3D 1Z0SA 1Z06A 1H2YA 2R8PA 2Q50A 3MN1A 3O8OB 1PJ4A 4NPHA 3GLVA 2KJQA 2JBAA 3GLKA 3MW8A 5H3HA 4YPVA 2ZI9A 4DWOA 3UMFA 1QC5B 2W2TA 3CS3A 1TQDA 1RFGE 4OAOA 4QYSA 1VE7A 2GAIA 3HO8A 3PIDA 3KR0A 4Q3EA 4F4CA 5FTLA 5I48A 2D6FA 1GCGA 3LX4A 5KOIA 1T4CB 3PA6A 1QV9A 4MAAA 5CDGA 1DMRA 4V03A 4UHKA 5CJJA 3UWKA 4WNAA 1T36B 4D9EA 1Y3AA 2WG0A 4XZ3A 1QTQA 3KQKA 3R3XA 1JUDA 1RWQA 1AQJA 1VZ3A 2BFMA 4UM7A 5BSFA 1J6UA 1KFCB 1PEDA 1UFQA 3K0FA 3ZW7A 1FLVA 5L3VA 4CFZA 4HLUA 1LWOA 1EEHA 1S2IA 5CW2A 4ZVOA 3M6LA 3WP0A 5DM60 1FUEA 4ES6A 5E1OA 1XMXA 2ADMA 5CB6A 3CVUA 5K8JB 1OUMA 3OG9A 1KZ6A 2YIVX 2Z3VA 3MMXA 3FPBA 4IUYA 2O8BA 2DVMA 2IOYA 4IJVA 5KHLB 5MFPA 2ZR7A 3LO5A 5B5SA 4AJ9A 2C7GA 3FTCA 3BXPA 1QFMA 1Z0JA 1CG6A 2VK8A 3GF4A 3A7DA 1TF2A 4L3VA 4UD2A 1NM5A 1CUXA 1ECJA 5C18A 5B3AA 2AE1A 2ZUSA 1V1RB 4OQXA 1L8AA 2PZFA 3DYBA 3LTEA 1O87A 2BGNA 3N58A 4N5HX 1EDOA 2GM3A 3T3HA 1N2OA 1RPJA 3VH3A 4FDAA 4XUCA 1NFFA 3DVSX 4R1SA 3T0GA 2D1TA 1RBMA 4R41A 4E70A 5L7TA 2EGGA 3WLMA 1NVGA 4N41A 3BE5A 1DKLA 4CN9A 4EX6A 4P4LA 1GUZA 2WHYA 3ROQA 3OCWA 3ZU3A 3LYAA 1F4LA 4UNSA 4BMYA 4BDSA 4B3XA 1DBQA 1XQVA 2QAJA 2VKTA 2B1RA 4NATA 3AMVA 4RKFA 1TUBB 2PSSA 3AC0A 5H0IA 4DLNA 4EENA 4GECA 1WDWB 1BE6A 4LDJA 3ANSA 2W71A 4GMKA 1KVUA 3SYTA 2VQDA 4EW6A 2I4IA 1L7AA 2G09A 3HCAA 5BR4A 3Q7TA 5GQSA 2QWXA 2AKAB 4GOKA 1ZOSA 4MR7A 3K9LA 4PX5A 4Z0PA 3GA5A 5FQNA 1XZEA 4M38A 4ZRNA 4C03A 2JLYA 2G08A 4P98A 5SY6A 2BRUC 1XA0A 2RGNA 2IXEA 3ESRA 3FUVA 5FOUA 4D8VA 1Q3KA 5BN3A 3IH5A 1XTZA 3LPAA 3ZC3A 4DABA 4BWFB 4U8HA 4RW0A 1MEJA 4IH9A 1NLYA 1ZCAA 2MSWA 3B48A 3DBRA 2R8OA 5CLIA 5AH0A 1G55A 5CM8B 3A1EA 3KAQA 5DK4A 4X1IA 1VGRA 4IHQA 4ZWNA 1ZGJA 3I9V1 5I4CA 1S6YA 1SG0A 2D5IA 2AI3A 4E2YA 3M6FA 2AF4C 5ER9A 1KH2A 2PRZA 3M4YA 5JYCA 4MH0R 1VRCA 2R5FA 4MPJA 4RD1A 3FVQA 2IU0A 3WGNA 1E7YA 4FYMA 4BZQA 1KOLA 2LKDA 4ZO6A 1RJGA 3W1EA 5E4JA 4NCAA 1HZZA 3EJ6A 1AXGA 1CEXA 4XASA 4C5BA 3AI2A 5AKKA 1R8JA 1QFZA 1BU8A 1W49A 2IYVA 2NW6A 4C07A 1B15A 1L3BA 1K7XB 2XKJE 1F8UA 2ZDQA 2ZK7A 1F6BA 3JRNA 4G4IA 4O4IF 4GQIA 2QJOA 5HDQA 3HJAA 4EJMA 2VPQA 1LPNA 1NUTA 1BWSA 2ZWOA 3M89A 3I62A 3PGLA 2XUGA 3OZ7A 1G63A 3FRIA 5T5QA 4RHEA 4B6PA 4MHTA 1QRUA 3PUJA 5HJ2A 4I4CA 2WWVD 2Z2XA 1ZJYA 4Y9UA 3ZWBA 2IS1A 1TRHA 2OR3A 4J6FA 3I09A 4QVIA 1ZVVA 3JASA 4ID9A 3AF6A 5G1OA 1AKMA 5H4HA 5H8WA 2YFQA 1NBAA 2YASA 3AHJA 5LZ8A 3CURA 5JFOA 1Z82A 2H4JA 5A9SA 5FCDA 2V65A 5GONB 4G1CA 4F3CA 2YIJA 2VP0A 1PUXA 3KZCA 3KM0A 2FMHA 1VP9A 4KYIB 5IC6A 4O2AB 1KORA 3P0FA 4WE3A 3WHPA 2Z08A 3X2FA 1R6TA 2X14A 3GPIA 3ZI0A 4RHYA 4WNCA 4WK4B 3FDIA 4CU5A 1BHSA 4WLEA 5SZJA 1U3WA 2KX7A 3HDJA 3V4ZA 3BFKA 1E94E 3IDZA 1X8XA 1M6YA 4DMUB 2WZQA 1T3GA 4DLPA 5EIEA 2HHAA 3F3YA 5IK2A 2V4MA 3IQIX 3UW3A 4J2HA 3T3MB 4PSCA 4ACAA 5LLDA 1FTYA 4AKIA 1M8KA 3VU8A 3JYPA 3THYB 2E3JA 3PQ8A 1MIHA 2D62A 3VDMA 3WNQA 1D2GA 5JANA 1HX7A 3NRBA 1EWTA 3EYAA 4DC9A 1LNSA 3OCZA 2IYTA 1FNBA 2ZFUA 5H3LA 3RANA 3TCXB 2JS7A 4LOIA 4MQMA 4X24A 1HLFA 1LZLA 3HKDA 3URKA 2F3PA 1R9NA 3KQWA 4HD8A 1M3SA 3PJEA 1Y3CE 4NU8X 5JJLA 1ZPDA 1N7HA 4MX8A 4UTPA 1OLOA 2XSZA 1B8UA 5BPHA 1E5VA 3IAXA 3IUNA 3QGMA 4XYBA 3RYHB 3GG9A 3TEMA 1HY3A 1DKUA 2P9ZA 4BZZA 4J9UE 1GYQA 1Z6TA 5EZ6B 4AF6A 4UOQA 4E2WA 2WW8A 4ZVMA 3OJ0A 3UUGA 1FBTA 2YWHA 3C85A 1Y98A 4PLFA 5EJ9A 5DWQA 4S1TA 5A0FA 1J23A 4UZEA 2YJ3A 3IIEA 2G06A 4FYVA 3ENVA 4IL5A 1VJTA 2R1ZA 4L0MA 4OQZA 3ZHRA 3P0HA 2Q4RA 4B2YA 4RFSB 4CVNA 4IV8A 2J9ZB 5A1TA 4U2CA 3U2QA 3ETLA 4I6EA 1NQAO 1ENZA 3L0OA 4Q9NA 1H23A 2H1LA 4M88A 3TVYA 1CIVA 1RC8A 1KYXA 5TLSA 3CEMA 3L79A 3SFZA 4HWPA 3AJ8A 2DYKA 4MP8A 4CL2A 3KJQA 5C52B 4GKJB 2G0TA 1P31A 2M98A 1TAGA 2OSVA 1CDOA 4BFXA 4HFNA 2J1LA 4JP2A 4F92B 4ZEVA 3D2BA 4RJJA 3KB1A 4G5HA 3LF1A 1C9KA 4JWTA 4QRIA 5F76A 3HCNA 4X1OA 3RSFA 2PH5A 3LQQA 3HR8A 3EPPA 4GI1A 4PO3X 3HJGA 2HHLA 2J6HA 5HNKA 4XR4A 3OMXA 2JAUA 4EZBA 2XRFA 1O9BA 1J1ZA 1XQYA 2ID9A 4LRYA 4JC8A 1YAJA 3V1KA 4DTIA 2B4AA 4B7ZA 5JS8A 1KJZA 4CMCA 4HG2A 2O2HA 3F6BX 2FQYA 3BTUA 2WZCA 5IS2A 2IBSA 5E7QA 5LWHA 5JWRA 1X7YB 3IV6A 4NFLA 4I6JA 5CNIA 1X87A 1VJ1A 2R1VA 3PXGA 4KRXA 5CX1A 4COOA 1CUCA 2APJA 2BD0A 2PS1A 1E6WA 2IPNA 2TYSB 3JVEA 4KXYA 4YI5A 3V9AA 2GPJA 4ZJUA 5ITSA 1EWVA 3A6JA 2JF0A 1WA5A 4COKA 3EFOB 4RQBA 4BNDA 5A9RA 5KMGB 1HG0A 2CXTA 1PE0A 1QCDA 1Z0ZA 3DHWC 2BEJA 4AULA 1U7TA 2FUNB 4S3MA 5H68A 1XFDA 3RQIA 3L5OA 1ZD2P 3OBBA 2Z5LA 4ZYVA 4D4KA 3N2GA 2RARA 2XNDD 2FOXA 1UKVY 2RIRA 4AMBA 2XZPA 1E2GA 4QDJA 4BGVA 1PK9A 4I3GA 2DHQA 2B8WA 3LH5A 2QV7A 3L8GA 1G5RA 2GAOA 3CLUC 3EXG2 1MB3A 4RTQA 1JSLA 2RHBA 4TUYA 1HE4A 4DA4A 5ICGA 4D46A 3H1EA 4Q05A 2CLLB 3NHKA 4YMGA 4XOUA 1MOQA 2FSUA 1XL1A 4D8XA 5JO0A 4YPFA 4C2AA 1SWVA 1C9MA 4BB0A 3DTVB 3A28A 3O4RA 4Q1FA 5SZKB 5CJ2A 1I2DA 1JEQA 3IQGX 3ASVA 1O95A 3I1JA 2YUIA 4JU9A 5FA8A 3IT2A 5MN5A 4RA6B 1Z74A 3VHQA 2P78A 3VC1A 2L42A 2Z2YA 3G89A 4A0QA 4Q00A 4JC5A 3CG0A 5EP4A 1HE2A 3PRYA 4XTCS 1RC1A 3NTOA 3DE4X 5G0UA 3VR3A 3WI7A 4JNCA 1BJKA 2YNMD 4JMPA 1SKQA 5CTAA 1RI3A 1A82A 3KU4A 1P7YA 4Z0HO 1R9JA 1T5OA 5AYVA 3EPLA 5IYZA 1U7OA 1A9RA 1UK7A 3IB3A 4JEHA 4O2RA 3AVWA 4OP3A 4D42A 3VDQA 4YUZA 2AUMA 2O3SA 4FWBA 4TV9F 3KXIA 5DCUA 5GZ3A 4HPJB 4A9AA 2WFMA 4ZOCA 4BV3A 2ZT5A 2ZE8A 4CIXA 2MMCA 1YCDA 2JJ1D 5KX5F 1I33A 3P2JA 5ALVA 1GTVA 1PW7A 4EQ6A 4Z3OA 2BC9A 3Q8KA 1G59A 1ECGA 4N5MA 1Y7TA 4PV7A 4WK2B 2R7NA 3M1LA 4PVDA 4AYXA 5PGMA 1ID8A 4MQFB 4RPIA 3NWOA 4G9BA 4PLPA 1W0JA 3F5FA 4PQRA 1D6SA 3O84A 3MTIA 5ALIA 3R23A 3JQQA 2FPSA 3TXYA 2HMVA 2WM2A 5J9GA 3V7UA 1NFQA 1Z25A 1DKOA 1CF9A 3CRMA 4KBGA 3T12A 5KDDA 3KUKA 1A1SA 3RTCA 1JBKA 5KWEA 3KYDB 1M5TA 3H8SA 4MQ6A 3F5QA 3KKNA 3ZWAA 4HDRA 3RABA 1WSDA 1NVKA 3TMKA 4YMTA 5J23A 1XXHB 2A14A 1RYNA 4X45A 4E3WA 3H2SA 5GTDA 4XD7A 5FA5A 3DXYA 3KXPA 3OOYA 5AK5A 2AG5A 1U1CA 4H27A 1KC3A 2CUNA 4OL9A 1PR9A 1XUOA 5ENZA 1OPRA 1SULA 3BQ9A 1JJ7A 2WNIA 1CJTC 1AVTA 3RNLA 1SKBA 2FN4A 3JX9A 4DBVO 2R6HA 3C74A 5DHTA 4BQPA 2V7GA 1CRWG 1G5TA 1C8LA 3WOVA 1OB5A 3K53A 5LQNA 1SC6A 3S8EA 3F8SA 3X1WA 4EELA 4IFIA 5L7YA 2OSBA 5GIPE 3CIFA 1RRFA 4U2FA 1V41E 1N4DA 3B5EA 4N8EA 4NZOA 5K3OA 4ARBA 3AIIA 3CNBA 1NOIA 4BUZA 1UBKS 1BA3A 2ZIAA 4GMDA 3I92A 2HC9A 4DIKA 1UZAA 1V1MA 2GILA 3QQPA 1A8PA 2GLTA 4C7XA 1NZFA 4UCFA 4XX0B 1XWFA 3FVVA 5MGBA 1IY9A 2OK7A 2NUBA 1X80B 4CKEA 4YXWD 4X7MA 2BBWA 2WT8A 3M8KA 4LJ9A 4I1RA 3HKCA 1ZXBA 2WTXA 2ST1A 3NB0A 1KP2A 3AINA 4I5IA 3ZW8A 5AM3A 4IQ4A 3H0VB 1DV1A 2KLBA 3WO0A 4P3XA 4ALMA 3S8YA 2A9KA 3LOQA 1YQDA 2GUWA 4DHWA 2V4UA 3AT1A 3HUDA 1PZGA 3KHUA 4R9NA 4N03A 3RSSA 4IM7A 1QDLB 3N3BC 1RWMA 5JNLA 3QUTA 4TRMA 2VP3A 3H5NA 4L07A 3M6AA 2VAVA 5EJ8A 1UC5B 2VJLA 1GDHA 1PIWA 7GPBA 2WM3A 2FPPB 5IG2A 4IQGA 4IOLA 2ZE5A 5F78A 6ADHA 2NP7A 5ALFA 3GYBA 5CEFA 4GEGA 3Q3IA 5CA0A 1YJXA 1UDAA 2E37A 3QHAA 2NNLD 4IDQA 4RIEA 4RV5A 4YS6A 1IHOA 3CFYA 4FBLA 3DDCA 5D6OA 3SN6A 1JR4A 4AUMA 3KETA 3N2IA 2IV3A 2BCGY 3H84A 2GZ2A 1GCUA 4L2IA 3LS2A 1FFCA 3UOWA 1YA6A 4OHOA 3G5AA 3WHKA 4F3RA 1JALA 1P9LA 4R2JA 2QRPA 3EPJA 2X77A 1QBGA 3FF4A 4QEKA 1DG3A 3M1AA 3PEYA 4P83A 3V8QA 1Q1ZA 3AR2A 1QYVA 2ZIGA 4QICA 3O8NA 2XTAA 2GR9A 1U0GA 4Z2AA 1JJBA 1W7AA 4LDAA 1TTTA 1T2AA 2REQB 2XX3A 1F0PA 2R3SA 3BIXA 3ZI4A 1NXQA 4AVYA 1TVKA 3RWOA 3IE1A 2C4WA 1LC3A 5KSZA 1VYVA 1WPQA 3WYAA 2J3HA 1W9HA 5CVEA 3N0WA 3X3HA 4FD2A 4R01A 4JJAA 3RJZA 3PGVA 1S8OA 2Z58A 3PEVA 4OGGA 2WLSA 3L01A 3REQB 2QR5A 4MI1A 4MMZB 4JKYA 4Q03A 4NNJA 3O4IA 5WRFA 3TLEA 1O77A 1ZJ6A 2JAXA 5G2OA 2Q3FA 2ZRDA 5TF0A 5FWAA 3H99A 4OXQA 1Y6JA 3M9WA 1E8MA 2HRCA 2OLJA 3MILA 4IKOA 4CHGA 3DNMA 4FHFA 3HJBA 2UZ4A 3AI1A 2PA0A 1BVHA 1OSNA 2QNBA 1R0CA 2D2EA 4IV5A 1Y1LA 5IJAA 4OI0A 5LQMA 4BLOA 1TVMA 2XMQA 2GN0A 3UA4A 2W6NA 3A9TA 4YRRA 5EMNA 3WKCA 1CUBA 3L0DA 1FU8A 3V1MA 1SHKA 1UP6A 2HLHA 2YXNA 2XUQA 3SIXA 4ZYYA 1UBMS 2VPTA 1AKYA 1U5AA 2E85A 4H1HA 3WR5A 3EWAA 2XB4A 4BUCA 4XM1A 3HM2A 3EIHA 1L5GB 4AC9A 1JDBC 2PT6A 3EA5A 3UK7A 4M36A 1Q0UA 2MYPA 1WF6A 1JIJA 3S5JA 3Q7QA 5HSGA 3ORSA 1HG1A 2GPBA 3CTMA 3KLPX 1ISHA 4A0SA 3T7IA 5DDIP 1T2CA 3V2IA 3LYUA 2Y1DA 3UF0A 4CHTA 1WPXA 3QFFA 1Y6GA 1TMGE 2B1JA 2Q45A 3WGMA 4H6PA 3WJ2A 4X20A 3BMOA 2QXTA 1E2FA 4FSHA 3VH2A 1E2UA 3PVZA 3SQWA 1ELOA 1G3IA 5LXTB 1F2UB 1V8DA 3COVA 1MJGM 3DL0A 3N7AA 4YJKA 2HWKA 3TPCA 3PLNA 2ADOA 1FLNA 1Z6QA 2IK8A 3OMLA 3UUWA 2OO3A 3FI9A 3ND9A 2FX3A 2NUAB 3MBOA 3K0HA 4RIHA 2AZXA 4X61A 3QJ5A 1I5EA 1Q74A 2QTGA 2XGGA 3K2IA 3O2QB 4R2LA 3NBUA 4JLAA 2BFOA 2XF8A 1QVRA 1NONA 4EY6A 1WXHA 4ZOQI 4RTOA 4B47A 2A78A 2AJCA 2PVPA 3TR5A 5C51B 3ZV6A 5IWAB 5GADl 4KWTA 4HFJA 4KE7A 1Q11A 3ZWKA 1FW8A 3WMXA 3D2AA 4D92A 3F5DA 5JXGA 3MMPA 4EG6A 4F4IA 3S3TA 1E63A 2IP1A 3K1YA 3AUJB 5EZQA 5J2TF 1U3DA 2EQ5A 3B9QA 1KJQA 1DUSA 4YJ3A 1TUEA 1TQ6A 3HB0A 4URUR 2QM3A 1Z2AA 3B6MA 1C0IA 5FL7D 3W8FA 4AAYA 3AM1A 3UOGA 2XDQB 2QI9C 4AW9A 3SDBA 5I01A 5G4KA 1RHMA 4PZ9A 4OY3A 4BMVA 3BMQA 3MT0A 2PH3A 1DMSA 2FW1A 1E1QA 1E1RD 1SBNE 3HVKA 4KMRA 2AV6A 1G8FA 3CMCO 1VPLA 4RESA 4G0WA 2EJCA 4GQAA 1T2NA 4ZOEA 1S8AA 3QPDA 3LVRE 1KJWA 2X9QA 3CO5A 2RCNA 3DCYA 4IMRA 3VSBA 4LDQA 3LQYA 4NFHA 2HF7A 3KZNA 5L6MB 2GH1A 1MHMB 3NOVA 4W7IA 1CEEA 4YMIA 4OA8A 5CD1A 4Z1MD 4O08A 2C4KA 2AN1A 1LDYA 2VP9A 2VQ3A 1BH2A 3PVCA 4DMFA 2XVYA 5JBIA 4CQNA 2W11A 2ZJ5A 3F8WA 2QRNA 3CONA 3TN7A 3KTAB 3IJPA 3CNNA 1HM5A 1PV2A 3EP5B 1FFDA 3TFQA 2X76A 3WRYC 2NPOA 4DUGD 4TQGA 1DT3A 4DAOA 4WOPA 2J9YB 2Q5CA 3CR8A 4CUKA 2DQZA 5JCOC 2D2XA 2C9BA 4WFQA 2QE6A 3QKTA 2Q6IA 1IOVA 3TZHA 4OGLA 3U3ZA 1ZMOA 2RIPA 3EVZA 3FCXA 4BX8A 6PFKA 4MINA 2VBGA 4N3AA 5KOHA 1II0A 2XXJA 4RY2A 4EGFA 1XK6A 3LCCA 1K3FA 3PX7A 2IYNA 1ADBA 2WHPA 3EGXA 2G4LA 4TYNA 5HKBA 3IA7A 5B55A 3AUXA 2D2IA 3AKYA 3JARB 4ER0A 3ZDAA 3O83A 1T0IA 3QJGA 2P0EA 5CXSA 3ZXXA 4PNEA 2ZSAA 4PYJA 1MA3A 5K7SA 1TMKA 4KLAA 2VDWA 4UULA 1U63A 2XPCA 1NZJA 3DDWA 4G8BA 3LXRA 2SECE 4KQMA 2AZTA 3ETGA 3M82A 2H2FA 4RK5A 3LC1O 1FVHA 1OC2A 1TM7E 2O8FA 2XXBA 1K88A 3KOYA 5FPTA 1D8TA 4O1MA 2DUNA 4ID3A 4KXQA 1Z4KA 3I2HA 5E7MA 1TC1A 1R8SA 3BEDA 2FK7A 1E5DA 1FRVA 1Z16A 1J8YF 1GU1A 2R1TA 3MWDB 2JGAA 4JVSB 2NIPA 3KZKA 2C2GA 2JIMA 3MJFA 1OX6A 3BB3A 1DDGA 3O4JA 2VJNA 3HYCA 3R20A 5TT0A 4U02A 4Q5IA 2IY7A 1E4EB 4IEFB 2C2ZA 1NC3A 1NWHA 3RK4A 1KYYA 3REGA 1OB2A 3GPBA 4TV8B 5BV1A 1I79B 1PJZA 2VOEA 3EZNA 4L5AA 1W4ZA 4G0NA 5LBUA 3BGOS 1ZC3A 3VNSA 5HQ3A 4P86A 1RZ3A 1NLUA 1YK1A 2XMPA 1E0JA 5ALJA 1JSXA 3UQYS 4B44A 1F2TA 3HKBA 3RAJA 1EX1A 1W88B 1VE5A 4DG9A 4UQPA 4TWAA 3ZE1B 1NN5A 3GQBA 1BKYA 3RRNA 3T9FA 2E48A 1SCJA 3HZZA 3R0ZA 4FHGA 4EY3A 6GPBA 4OYYA 5KTNA 3LGSA 1U0TA 1GNTA 2HQ1A 3M5CA 2JAOA 2AVNA 4K0RA 3ORQA 3EVNA 4DM7A 1MLDA 4LHZA 2B4KA 3QOWA 1OJLA 1QRAA 2HQSA 2ZOSA 4XEUA 2WF7A 2JK0A 5E8RA 3OU2A 1GA6A 5EEHA 4E5UA 3MJEA 3GRRA 2QN9A 3ZK8A 4FXPA 4RKRA 5KYXB 4RLFA 5GJCA 1XZGA 2K6GA 1M6WA 2G8LA 3P2KA 1YCHA 2GBLA 4N0PA 5E3JA 3BSSA 1M2WA 1R9GA 1N0HA 5KWSA 4K88A 5CYGA 2JVJA 4GE3A 4RBNA 1M2FA 3SFTA 2D1QA 4R16A 1QQBA 1JAZA 3ES9A 4PZ0A 2P1DA 4BC1A 1AZSC 1EI9A 4JEMA 3V7YA 4N8DA 3SFVA 3R0JA 4Z1MA 3OX2A 5C5CA 3LX8A 4INOA 3DHVA 3IUMA 3E0XA 1K8XB 3MWYW 2JD0A 1N2BA 3RKRA 1Q83A 5KSPA 4LZOA 1M7BA 2OEPA 3KG2A 5LDGA 2EERA 4N7RA 4QWWA 3ISVA 2ZR8A 3DDZX 1IUKA 3FSJX 5HJ7A 3BZUA 5IFLA 2XZLA 2GX6A 4GW3A 2P8SA 3T1TA 4FJ1A 2C8LA 2CCJA 2XTZA 4H7FA 5IAEA 2FZWA 4CEJA 1CZOA 1YOVA 2C07A 2G8NA 3OZAA 4MVJF 4FEAA 5AKEA 2FMTA 3S6JA 5LU8A 2CV0A 4B4UA 5IAOA 4J7CA 2DULA 1VXOA 1WOYA 2PLAA 4MA5A 4V3CA 4GC5A 1NY5A 4G0XA 2WYWA 1P0IA 3CQ9A 3L7KA 4BB9A 2QZPA 3IODA 4CWAA 1RI1A 3LA6A 2WOJA 2V97A 3K9HA 3U4GA 2CL7X 4TLBA 1TKBA 1ZEJA 3O74A 1EWQA 2HO4A 5EJGA 4I9HA 5CP8A 2DSNA 1DBVO 1FTQA 5A3RA 2CLHB 10MHA 4UEQA 4E1VA 2QYTA 4V2UA 5JALA 2W83A 3BHJA 4WCDA 3OZRA 2P68A 4QGGA 2BFWA 2Q4TA 2J3KA 2G1UA 5K0CA 1CJUC 4DA8A 2CUTA 3RUCA 4EJ6A 4YRIA 3FJYA 4O2LA 5HM6A 4G0ZA 4A10A 2Q2VA 4U7TB 1M34B 3HU1A 1MORA 5AVUA 2I7XA 1IWOA 2AD1A 1KARA 2AN3A 2IY8A 3WWYA 3UBTA 3SZLA 2PX3A 4DADA 3GN1A 3UCFA 4QYIA 3AFOA 3MINB 1NW7A 3FNQA 2Z9DA 3IMGA 4G1FA 3B2NA 1YE3A 3I1IA 1Q84A 2I1QA 4GI2A 3ZXSA 4RIFA 5CBPA 3HJUA 4J0HA 2NMVA 3CF0A 1T6XA 2C4UA 3HBMA 4PAOA 3DUFB 1K89A 5F77A 2BY4A 3NU1A 1XV5A 3A0UA 4K87A 1TMOA 2QMOA 3K0AB 3BWBA 4UD6A 5HUHA 1YR3A 3NYRA 1E32A 3NIFB 4PG5A 2YY6A 1QLWA 2G7MC 4O3MA 1AKWA 1UBJS 5DGIA 3L0CA 1QGOA 4BRWA 1KI7A 2ARKA 3E84A 4CCYB 1XZDA 1LV8A 3OZVA 3CKKA 1NYRA 2JD2A 1UP7A 1B00A 1W85A 2BEWA 1U0SY 2C31A 5TPWA 4FXOA 3B9BA 3DQQA 4EEZA 5LQJA 4EG7A 1G4UR 4W5WA 3VMFA 3KXDA 1G41A 1WB9A 4MWGA 1QCCA 2JKZA 4IAOA 2WSSA 5K51A 3I6IA 3THXA 5JPDA 2TSYB 5IMSA 4ZU6X 1KDTA 4QNRA 3TS1A 1YBVA 1XAGA 4MW2A 4UNQA 4O0LA 5D2CA 3SSMA 4CV1A 4REQB 3NGXA 4OAPA 2C9MA 2YYAA 3OTQA 1R6AA 4LW8A 4NKRA 2G07A 1TU0A 4ISCA 3OSZ