3KUXA

Structure of the ypo2259 putative oxidoreductase from yersinia pestis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
352
structure length
349
Chain Sequence
SNAMADKIKVGLLGYGYASKTFHAPLIMGTPGLELAGVSSSDASKVHADWPAIPVVSDPQMLFNDPSIDLIVIPTPNDTHFPLAQSALAAGKHVVVDKPFTVTLSQANALKEHADDAGLLLSVFHNRRWDSDFLTLKTLLAEGSLGNVVYFESHFDRYRPEIRQRWREQGGGIWYDLGPHLLDQALQLFGLPETLNVDLGMLRPGSQSVDYFHAVLSYPGQRVVLHSTVLAAAETARYIVHGTQGSYIKFGVDPQEDRLKAGERLPQADWGYDMRDGIVTLSHDNVLTEKPLLTLPGNYPAYYAGIRDAIWGTAPNPVPATEAIKVMELIELGIASDQQKKALPIIAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Structure of the YPO2259 putative oxidoreductase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 97
structure length 349
sequence length 352
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3kuxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kuxA01
2GR9A 4CR6A 4CLXA 3G1UA 1FXSA 3E6AA 2H6EA 2IDZA 3RBZA 1NQAO 2CY0A 1YDWA 3LLVA 1ULSA 3IUSA 3U4IA 4WE3A 5DF1A 1DC4A 3D5TA 4UAGA 2HMTA 2O3UA 1ZH8A 4INAA 1PU2A 1LNQA 2HRZA 1V35A 3NTOA 4XQ9A 3ANMA 2QRJA 3DMTA 3D7LA 2E4AA 2OFPA 5CDYA 2PNFA 3ZWPA 4B8ZA 4WEOA 2BMAA 3U4DA 1MG0A 1QYDA 4BO4A 3KYDB 1DC5A 2ZQYA 3GQVA 3MWDB 3Q9UA 4DIBA 4YXFA 4ZRNA 4MKXA 3W8DA 5AOVA 4PVDA 1B15A 4OQYA 3INGA 4JBGA 3DEYX 4NJOA 3DONA 1X15A 5EQDA 3ZU4A 5LDHA 1OZAA 3NRCA 3P5SA 4J90A 2VT3A 3NEPX 2W2KB 2H1SA 1ADGA 5EJ2A 3FBGA 1MUUA 4BNGA 1KEVA 2X6TA 3L9XA 4B4VA 2C07A 1YL7A 3QY9A 1MG5A 1HDCA 4XR9A 4L4SA 4N5NA 5EL0A 1HE2A 2BELA 2D1YA 3FR8A 1GCUA 1A5ZA 1XGKA 3GR6A 4E5PA 3UCFA 1ONPA 3WTCA 4CM4B 1AE1A 5C37A 3AM3A 4AL4A 2P5YA 4DYDA 2OORA 3C24A 1L1FA 4BNKA 1BWSA 3AOGA 4CUJA 3IKTA 2DU8A 4B7UA 4R3WA 3UKOA 2EJWA 5CG2A 4KDFA 1UAYA 4TKLA 4YT4A 1H9AA 1VJ1A 3ZWYA 4WCFA 5DULA 2OGUA 4GGOA 4PN3A 3GNQA 1J0XO 1VJ0A 3MJVA 4BL5A 3M6IA 1S7CA 3S2IA 1YBMA 1P1HA 4RPHA 1TB4A 1C1DB 2X5KO 4ND3A 1B3RA 2DUWA 2VZ9A 5LCXA 1YGYA 2B0JA 2DT5A 3CXRA 5CG1A 4FDAA 3BHMA 3LC1O 4IMRA 5JYAA 2YYYA 4WLVA 4OXKA 2Q2WA 3JV7A 1K6JA 2W4QA 2CNBA 2OXIA 3IMFA 2Q49A 3K6JA 4YAJA 3NT2A 4S3MA 1M75A 1WPQA 4KUHA 2AG8A 3SEFA 4HV4A 1VKOA 4R1UA 4Q39A 1X7HA 3UN1A 3TOZA 3JQBC 2NSDA 4NK5A 2GN4A 4GX0A 3GDFA 3ASUA 2O48X 1V8BA 4LK3A 3E5RA 5L4LA 2EERA 3SLKA 4Q3DA 4D3SA 5JCJD 5L45A 3ORFA 3AI1A 3GVIA 4LCEA 2WYWA 1LTHR 5KJFA 4A03A 4FCCA 4OO3A 4R4JA 4JBIA 2YV3A 3JD4A 1Q1NA 2OMEA 3WIDA 2EXXA 4GVLA 4DLAA 4FPXA 2FN7A 1IHYA 3WNQA 5A1TA 1KEWA 3W8FA 2ZB3A 3WQRA 1ADBA 3LF1A 1SZJG 3AY3A 2OZPA 2JCYA 3RFXA 4ZICA 1HE3A 1FDVA 1MXFA 1Z73A 4KTVE 4A27A 2P4HX 4LGVA 3WG9A 1L7EA 4FFLA 2YHIA 3G3EA 3ZWBA 1U3WA 3FD8A 3WJAA 3KETA 2ZJ1A 4YT2A 1F8FA 1QSGA 3GOHA 1DDOA 4MVJG 1O94A 1DHRA 3PIDA 4XJSA 2FR0A 3S8MA 3ZW8A 1TT5A 4NJMB 2DPGA 3W8EA 4Q3CA 1X7DA 4EZBA 3KB6A 4BNJA 1EMDA 1RKXA 2PLAA 1U2DA 2HQ1A 3VPHA 5EN4A 4O1MA 3V5NA 1N1EA 2Q46A 4G81A 5H81A 1ZK3A 3LT0A 4IGFA 4B4UA 2OBYA 2FPGA 3L6OO 2TMDA 2A92A 3WQSB 5ITWA 2J3HA 3G49A 4NBRA 4CV0A 4I5FA 4LSMA 2J5RA 3X2EA 3H4VA 3FWZA 4BS9A 3U9LA 3KYCA 4YR9A 2V6GA 3WX0A 1QYVA 2QYTA 5AVOA 3HFGA 4TZTA 1SNYA 1D7OA 4WNIA 4CMBA 3U3XA 3BMOB 4LISA 4YT8A 3G0OA 3RCBA 1NWCA 2RAFA 4QFCA 3KUXA 3JD3A 1VSVA 1QXSA 1P77A 3E9MA 3I9JA 1ZMTA 1F14A 3AY6A 1LDBA 1JAYA 4H15A 4B4OA 3TFOA 3D4NA 1DLJA 1U4OA 1LRLA 2Q1TA 3HWRA 5G4KB 1TXGA 3D1LA 3OIDA 3H9GA 2VYNA 3HSKA 4NBWA 2AW5A 5AXDA 4UVGA 1GYPA 5BSEA 5IN4A 1WZEA 3D5QA 5A05A 3AM5A 2ET6A 2IE0A 4ZRMA 2JKVA 2Q4EA 3HFSA 1IUKA 3OQ1A 1PS0A 3K31A 4A73A 4EJ0A 2DVMA 2X0NA 3ZWVA 4RL6A 4YAKA 5DDIP 4NFHA 2OO5A 4GMFA 1LRJA 3FNHA 2Q4BA 1RM3A 1B7GO 3PWSA 1EUCA 1NHWA 2P2SA 2XPCA 2Y66A 3PLNA 1GUZA 4UVDA 3BZUA 2CSUA 2EP7A 4CJXA 3FNFA 1N2SA 3JQ9A 4I8XA 1NP3A 5C5IA 3I52A 3ZU3A 4CR8A 5CDTA 4YT5A 3Q6IA 4CMEC 4CLOB 2I67A 1H2BA 1YVEI 2V6FA 1YS4A 2YJZA 3EYWA 3VOSA 1DPGA 4NNJA 1PWZA 3FR7A 4HXYA 3ZWOA 5K0ZA 1Q7GA 1DXYA 1K6IA 3WFIA 1ZJYA 4BNUA 1GFSA 5G0UA 2NU7A 1KY5A 1AHHA 4PLWA 2IZ1A 3JYLA 2NTJA 3L77A 2X0IA 4AJIA 5K6AA 4FGWA 4R3NA 2I99A 1FDUA 1BVUA 2Y1DA 2NVWA 2C7GA 5KCZA 4AVYA 4HUJA 4D43A 3TF5A 1E3WB 3I9LA 2JJYA 4ZGWA 2AEMA 3MWEB 3ROKA 3B1JA 1R4NB 4NFYA 5I7VA 2WYVA 3I23A 1E6WA 5JDIA 1XSEA 1FDWA 4LVUA 4Q3NA 4J9VA 1I2CA 4TROA 4M54A 4E3ZA 5DN9A 5F1KA 4XA8A 3DZJA 4EEZA 4KUEA 1OI7A 1PTJA 3NKLA 1GV0A 1HYHA 1E7RA 2G5CA 2W2KA 4MVJD 3MZ0A 4FD3A 5AXBA 3OA0A 2GN8A 1E7MA 1NAHA 1Q0QA 4NPCA 3SLGA 3QIVA 2O7QA 4JX8A 5JDCC 4Y8VA 1ZW1A 1N7HA 3WLEA 4OYRA 1BRMA 5TX7A 3RWBA 4CM4A 1LA2A 2OBNA 1KC1A 4IPTA 3T7EA 4NIMA 4XB2A 4DPMA 4OIMA 5F1PA 1KC3A 5TGDA 3VH1A 1NAIA 5T67A 3ZV3A 4K6FA 1GQ2A 3QWBA 2GNAA 1LQUA 2H9IA 2X86A 4FOOA 2PV7A 3DR3A 1QYCA 4MP8A 3OSUA 5IXSA 1DFHA 3V1UA 4RVSA 1DB3A 1IOLA 1F12A 4XIYA 1NVMB 3PJEA 5U1PA 2QW8A 4D79A 3V2GA 4KUGA 1C1DA 4BMNA 3G1TA 3KHUA 5JFOA 5JBIA 3F47A 4CM6A 3DXFA 4P38A 2AG5A 1NQTA 1QLHA 3C7AA 3G17A 3GHYA 3N74A 4RQTA 3LC7O 4W99A 3QW2A 5IN5A 2VHXA 2B36A 5JYEA 1Y8RB 3LZ6A 3RU7A 2NTNA 4IXTA 3JQ8B 3FPCA 4D44A 1QORA 2JCXA 4U6SA 1LLCA 1GADO 3QJ5A 3VTZA 1Q0HA 2PKRA 4WPGA 3D0OA 2GCGA 2D8AA 1WWKA 4WJZA 2ZB7A 2YQ5A 2HK9A 5A9SB 1X0VA 4LMPA 5K9ZA 3O03A 4L8VA 4YRAA 4FOSA 3NT4A 3LF2A 5I9NA 3E48A 2PTGA 3DOOA 3TNLA 2WEKA 4DA9A 4PZCA 4OL9A 1HEUA 4J7CA 3DL2A 2NQTA 2EKQA 3OJEA 5F5NA 4R5MA 1ZNQO 1JVBA 1PL6A 1QP8A 1GAEO 4YQZA 1X7GA 2X0JA 2A94A 1DAPA 4U7WA 2C2YA 5LC1A 3ZHZA 4P8RA 1HRDA 3LDHA 2Y1OA 1MC4A 1UDBA 1PS9A 4XGNA 1Z45A 4CQMD 5L53A 3RI3A 3PK0A 3Q2KA 2FR8A 4EBFA 4W4TA 3TQHA 4UULA 3JD2A 1X1TA 1ZVMA 1M67A 3GFGA 3ZH2A 3E82A 4RPLA 1TEHA 2X9VA 3MJTA 2X8LA 1C1XB 3OIGA 1Y8QB 4RDHA 4EGFA 2E48A 3R3SA 5AQ1A 3RU9A 5A5EA 3MOIA 5KWEA 1R12A 2XAAA 3VZQA 3EW7A 4WK6A 4II3A 1MFPA 3UXYA 1LLDA 4NJMA 4OOFA 2QX7A 5HWSA 3RUAA 1ZSVA 3NDRA 4CLDA 1UR5A 3OJFA 5HA5A 3WGIA 3OEWA 5GY7A 3TOXA 3VH3A 2EGGA 5TS3A 3ZGYA 1WLYA 4BKQA 4ALIA 4IZHA 4YCAA 1H6BA 1ZK2A 3RD5A 1O89A 5JYDA 1YH3A 1R4MB 2B5VA 3OJ0A 2PD6A 4FIZA 5F5LA 3AOEA 2ZQZA 3CTMA 3QLJA 3RUFA 1DO8A 3RFVA 4QXMA 4BV8A 4CMAA 4MVJP 4XYBA 4Z3DA 3VPSA 4MIOA 3BMOA 3FBTA 2IXBA 2HRBA 1ZZEA 2ZTVA 4HP8A 4NBVA 5JE8A 3GT0A 4D0RA 3ADPA 2VWQA 2ZYDA 3AW9A 4WLUA 3OQBA 2BD0A 3WNVA 4CM7A 2PK3A 3TJRA 3PZBA 2X7HA 3UICA 5A03A 3ICPA 2Y05A 1N5DA 3AU8A 3GVCA 4IJKA 4Y6SA 3WJ7A 4HADA 1PJSA 2O2YA 4Y6PA 3ZWCA 5JNLA 3GPDG 1VE9A 3OBBA 1IE3A 5BNFA 1VJTA 3D64A 2X58A 4RDIA 3V1TC 4MINA 1UP4A 5G4KA 3NDIA 5U9CA 3B20A 2O3QA 3C8MA 3UVEA 2VUUA 4HWKA 4BKPA 2IODA 5L95A 3IUPA 1K3TA 1CQIA 3E8XA 2RH4A 2YZ7A 3UAGA 4EITA 3OETA 5KVQA 2C5EA 2FWMX 3AUAA 4IQ8A 5G0VA 5TT0A 4MO2A 3RROA 2FZWA 2B37A 5G0TA 4YA6A 1DC6A 1F17A 4OAQA 5J9GA 2D5AA 3JYOA 3OMLA 4UEOA 4DWVA 4JN6B 4MP3A 2I3GA 2GO1A 3INTA 3EVNA 1O8CA 1NX6A 1E1NA 2C59A 1U8XX 1N8KA 1P74A 1XELA 3RFTA 4RF2A 4TWRA 4DTIA 1SEVA 3GAFA 4MPDA 4W6ZA 3DBRB 3S55A 1YE3A 3UHAA 3INRA 4YJHB 3WFJA 3CMMA 4CLOA 3FSRA 5KTKA 1IB6A 4GX2A 2E49A 1C0IA 2IEDA 1NVGA 4EDFA 4Q3BA 5T8KA 2NADA 4I5GA 3WYBA 2O4UX 3BAZA 2GERA 1BSVA 1GZ6A 1D3AA 1Y6JA 4Z6KA 1U9JA 3JQ7B 2CVQA 1NPTO 2GN9A 3QVWA 4G2NA 3KSDO 1NXQA 2J5QA 4GL4A 3PYXA 1UH5A 4WGGA 1E3WA 2VYVD 3VKVA 2R00A 4ZQFA 3RUEA 4B7XA 4EI2A 1YKFA 2OL4A 4IDBA 3OFSA 3AK4A 3IIEA 1ISJA 4YQYA 4BO7A 2BGLA 5ILGA 3PHHA 3H6KA 4GWGA 1PJ3A 4MKZA 1U7TA 4RVFA 5JLAA 1MGOA 4J91A 2DPHA 3CZRA 2E82A 3DFUA 4DRYA 3ULKA 4OKIA 3BTSA 3VPFA 3CKYA 2O3RA 1PGOA 1H6AA 3ETDA 4YDRA 3L6EA 3STHA 4G65A 4JROA 4Z9YA 5IZ4A 2WWRA 3PJFA 5I7FA 5DOVA 3NGXA 2EV9A 3F3SA 5EMHA 5IAAA 1NNUA 3JQAB 5DBFA 1HDXA 3L4BA 4U5QA 1GU7A 4D3FA 4AJKA 1P3DA 3DAPA 3Q1LA 3WGZA 1BHSA 2C29D 2C0CA 3I5MA 2C2XA 3PQEA 3VZPA 1GEEA 4Y98A 3GVXA 3E03A 1DIHA 4RVDA 4GWKA 2FPIA 3IC5A 1T26A 5A3JA 5GZ1A 2X1HA 4GH5A 1GUYA 4GSKA 4II2A 5CFZA 4L73A 2Y0DA 5C7LO 3I9KA 1NPDA 2AA3A 3S1LA 3GRPA 4BIIA 5B4VA 5DCYA 4IUYA 5TJHA 2GD1O 1K2WA 3BTVA 1A27A 3UF0A 2RH8A 4KWIA 3CUKA 1NFRA 3UOGA 1Y8RA 3VPGA 3JQ8A 4M86A 5M6DA 3LLSA 4KZPA 4Z3KA 5A02A 2VNSA 4GLLA 2Z95A 3UCEA 4O5OA 1GQQA 2YFQA 1EE9A 1LC0A 4IDDA 3TZKA 1U3TA 5G2OA 3WMWA 5DP1A 1KVUA 4B8WA 1UZMA 4ALNA 1SO8A 2CMDA 4BO3A 3Q0EA 2GLXA 4BV9A 5A9SA 1I32A 1G6KA 4BHTA 5EINA 3GMDA 1PGQA 2I3AA 1GL3A 3HZZA 1KETA 1UDCA 3HNPA 1H6CA 3BMCB 4PRLA 3ONDA 2FP4A 2W2LD 1DHTA 3W4JA 4RPGA 2WYUA 2ZCUA 3LYLA 4BNNA 2FR1A 2PD3A 4RQUA 3EVTA 2VCYA 1E3EA 1EVJA 3RSHA 2VHZA 4NH4A 4CM5A 4NHEA 1YRLA 5TSDA 4DMMA 2UYYA 1U28A 4AG3A 4ZN6A 1HL3A 2FSSA 4FSHA 4W7IA 1JKFA 4K9DA 2AEJA 4BNVA 5BSGA 5DZSA 2I65A 4BMVA 1T24A 1PJTA 4R41A 2Y68A 1O5IA 4P4NA 5FEUA 1I8TA 2C5AA 4K6CA 2DBRA 4BKOA 3U49A 1YQGA 3GA0A 1AXGA 2VRBA 1Z82A 4CODB 1C1XA 2D2IA 4PG6A 1UAGA 1Y8QA 2HUNA 4DQUA 2OP0A 1ZK4A 4CLRB 4Q9NA 1AN9A 3JTMA 1Y9AA 3A28A 5KJEA 2HU2A 1U2GA 2CDAA 3WDSA 3HDQA 2NM0A 4NU5A 4LVCA 1KBZA 5F21A 4Z0TA 1W8DA 1I5RA 2VT2A 1H0KA 3DO5A 1ID1A 4B3HA 1E6UA 1Q7CA 4OHUA 1GDHA 2W90A 3TL3A 3O38A 2X0RA 1LDNA 2R6JA 2EF1A 2EW8A 2IYOA 2NU9A 3LT2A 1P1FA 5ILOA 1YJ8A 2JCVA 3UW3A 5G4LA 2GSDA 3NV9A 2DAPA 2Y93A 4OSPA 3WIEA 4A10A 4BMSA 1LSUA 5I9LA 5JC8A 2W98A 4F46A 3ST7A 4E5YA 1GV1A 4Z9FA 3WGGA 4PIVA 1ZIDA 3MJCA 2VRCA 3E9QA 4WOJA 2C7VA 3PVZA 3H2ZA 4OOEA 5IJZA 3MJ4A 5JYFA 3AUUA 3KLMX 4J2OA 4IJVA 1PZGA 3BMQB 1DFGA 3TN7A 4UUNA 4CL3A 2EG9A 1GZ3A 4E5NA 1T25A 1KVSA 4J1NA 3ZN2A 5JMPA 1LBEA 2HMVA 2CVZA 3DZKA 3GLQA 3C85A 3I9OA 2ZCVA 2RCYA 3MOGA 1PZEA 4ND2A 1N9GB 3WGTA 1IPFA 2ZYGA 4BGVA 1YL6A 5MDHA 1WDLA 4JP2A 4JXKA 3BA1A 3PPIA 2X22A 3OF2A 3WBBA 2FOIA 5FI5A 3RUHA 1J6UA 1I36A 4PRKA 1CETA 3TSCA 5DCWA 4CV2A 3DZBA 1LLUA 3NJ8A 1NYTA 1KY4A 1GD1O 4A7PA 2H63A 4BNWA 1CF2O 3JCZA 4IJWA 3QWFA 1HSZA 2AEFA 3U4HA 3IKVA 4PLFA 4E2ZA 2C82A 2UDPA 3SXPA 5U4QA 1PJ2A 3ON5A 3GEDA 1WP4A 3PDJA 4J1QA 5BNIA 4J0FA 2QHXA 1AXEA 3A9WA 3PQDA 4DVJA 1DRVA 1XU9A 2EHDA 1HXHA 2VOEA 3DBRA 3I1JA 3JYQA 3PTZA 3TRIA 5LDGA 1OMOA 1WXDA 4YJHA 4DC0A 2FPPA 5CHEA 4GGPA 4HKTA 3DC2A 2PZKA 4GX1A 2B35A 3JYPA 3A4VA 3ZHYA 5JPIA 3A1NA 3DZGA 3GVPA 1E6EA 2OOSA 5THKA 4DBZA 3GEGA 4C7KA 3JQ7A 3QWHA 1IULA 9LDTA 4F3YA 4IGEA 3WICA 1Z7EA 3TPCA 4DQVA 1PL7A 1ISFA 1OOEA 3PGJA 1H2HA 3PFFA 4BO6A 2LDBA 3DBVO 4HNGA 3EY4A 1J5PA 2HJSA 4GAEA 1NFFA 3WOHA 1Q7BA 1WNTA 3NTQA 4O59O 4RPKA 4FC6A 2X4GA 1VM6A 4RO0A 2CD9A 1F8GA 4JJIA 5DOZA 5KVSA 1ZSYA 3GUYA 5FI3A 4IJUA 4CM8B 3FNEA 1YBAA 4E30A 3KSUA 4R5HA 1CIVA 2ILTA 5IZCC 5TLSA 4D3DA 3PXXA 1ENPA 4MVJI 3COSA 3GNSA 3QWAA 4MIYA 1WMBA 2X23A 4DYVA 1PQUA 4EUEA 4CM9A 3WGQA 5GZ6A 3I4FA 3NX4A 1F06A 3JQBA 1FDSA 3DB2A 3WMXA 4DC1A 4ESOA 5BQFA 3EZYA 1RWBA 2X9GA 3SC6A 2Q22A 1PJCA 3C7CB 3JSAA 1G0NA 3JQAA 2QZZA 4W9NA 2I9PA 4MIEA 3AFNA 4CM3A 1LXCA 1KVTA 4F45A 5F3RA 1E1LA 4ZU3A 4YPOA 3SX2A 4BB6A 4E21A 1Y7TA 2DTEA 3WB9A 2PWZA 4QUKA 3ZWXA 1R16A 3ROQA 5G0SA 1ZSNA 2A35A 1ZCJA 4H16A 4BGEA 1Z6ZA 1HDGO 2BFMA 2YY7A 4ZHSA 4WEQA 4OJNA 4PFJA 1UXJA 2J3IA 5G0WA 1XQ1A 1BXGB 1M66A 1YONA 4TVOA 3JD0A 4EJMA 3DZHA 1CWUA 3S2GA 1I2BA 2H5LA 3SC4A 3TZ6A 1TI7A 1X13A 4PZEA 3D3EA 3ITKA 1CQJA 1EUZA 2EJVA 2NVUB 3AU9A 4FR5A 4M87A 1IY8A 4CUZA 1TVEA 1LDGA 2Y67A 3ZWNA 3KYDA 4A26A 4B3IA 2UVDA 2HMSA 2QIOA 2ZJ0A 3ANLA 4DLLA 4Y9DA 1H94A 4N7RA 4ALMA 3OQ6A 1ISGA 4EYEA 1VSUA 1F0YA 1HLPA 2DTDA 3O8QB 1T2EA 2PR2A 3K2EA 5ITVA 5FF9A 5IXYA 3KZVA 2PA3A 3EC7A 2UUOA 3GN2A 4JP3A 1UDAA 5AXCA 4N5LA 1PJBA 2HSDA 5L51A 3P2YA 1FMCA 3TZCA 4B7CA 2ZIZA 5ENDA 4JCOA 1E77A 1U4SA 4FS3A 1PX0A 3U4CA 1ZEMA 3BMCA 3QVOA 4MDHA 5JAMA 2B4TO 3DBLB 3UH1A 3PP8A 3ENKA 1KERA 4HFMA 8LDHA 3EUWA 4J2HA 2I66A 1GTMA 2WE8A 2PGLA 2UAGA 3VVBA 1UJMA 3HADA 4XYGA 4E32A 1HLDA 4BNMA 2GGSA 2Q45A 5EQFA 5T73A 3F4LA 1NPYA 2PKQO 4J1SA 2AQHA 2VN8A 4Z0HO 2JL1A 2D0IA 4AJLA 1RPNA 2QQ5A 1B14A 4U8GA 1LJ8A 4PG4A 3CINA 1DAOA 4CLRA 4E4YA 1E7WA 3BHJA 1GYQA 5T57A 5COBA 5FWNA 2ZKLA 2D4AA 4YYZA 1HETA 1BW9B 1ONOA 2NU6A 3B1FA 4XQCA 1MLDA 3NUGA 2VYND 3OJOA 5KJ1A 2D3TA 1ZK0A 4IZIA 5DBIA 4CMCA 1A7AA 4HFNA 1P31A 4YEDA 2CDBA 1FDTA 1I10A 1KVRA 2NV6A 4NK4A 4BVAA 5JAZA 4R68A 1UP6A 1HTBA 4QQRA 3E9NA 1NHGA 3ETEA 4PLYA 1C0KA 2E37A 3VH2A 1TT7A 3ROPA 4TMFA 3NJ4A 3DOJA 1R37A 5B4UA 5L4NA 2J6IA 2QYSA 2GZ1A 3L07A 1LC3A 1B8PA 5DT9A 3ZDFA 1O9BA 3PI7A 2GF2A 3CH6A 1RJWA 3BMQA 4QX6A 3ZV4A 3ZV6A 4EUFA 2FSVA 5JCXA 3K73O 3QVXA 2LDXA 5A3VA 3WYCA 3EAGA 1PJ4A 4LSWA 4WLOA 4B4WA 3JQFC 5L7WA 5BT9A 1ZBQA 4KOAA 1XQ6A 3A06A 4J4HA 3TWOA 1P45A 1Y9EA 3WYEA 4DPKA 2X5OA 3OP4A 3KO8A 2AE1A 3GGGA 3M2TA 1N9GA 2GZ2A 1WAMA 2O4CA 2PZMA 2YDXA 4KMSA 4YAEA 5B12A 3RC7A 1VRWA 2P9EA 1YO6A 1A4UA 2CVOA 2YW9A 1R0LA 1PR3A 3WGYA 3H3FA 3K30A 3GG9A 4XX0A 3GVHA 5JY1A 4EUHA 5B37A 4J43A 1D4FA 4L4RA 4PLTA 3FTPA 3VC7A 2WDZA 4FGSA 3M1AA 4IIVA 4PZDA 4BKRA 1LDYA 1BTOA 4XYMA 1VC2A 2Q3EA 2JD2A 3F5SA 2GN6A 1T2DA 1K5HA 4J7XA 5TIIA 4YJGB 3CZMA 3AY7A 1BDBA 1OC2A 4RZHA 2HK7A 1EZ4A 3W4IA 4ALLA 1E3LA 4WCDA 1ENZA 4KTTE 2Q2VA 4NZ9A 1E1MA 4WNCA 3AM4A 4JBHA 1VL6A 2JD0A 4RVHA 4UUMA 4NMHA 1JA9A 4E6PA 1R15A 3K92A 3HQ4O 4DQXA 1PJLA 3H9EO 1ZMOA 5JDCA 4FFOA 4DPLA 4P4LA 4XB1A 1EK5A 1I30A 3RIHA 3QV1A 4FJ2A 1EBUA 1SPXA 2C54A 4E31A 2B4QA 4KDEA 5I8WA 2HKIA 2HMWA 5A06A 3LSYA 3RUDA 1MB4A 3PHJA 2CFCA 3IL2A 4LMRA 5H83A 2RBEA 4QTZA 2J5KA 1GPDG 1XLTA 2BFPA 2WM3A 3O4RA 3DHYA 3K96A 4FC7A 4M49A 5CEJA 5ICMA 4YBZA 4H3VA 4XZ3A 4RPJA 1ONNA 3IAHA 5TRTA 5KIAA 1YL5A 1GUFA 2NLOA 1HE4A 4UVHA 4CMKA 5IDWA 2AE2A 1ENOA 5EIOA 1CYDA 1GQYA 4CMJA 1NTOA 1P33A 3P7MA 1XYGA 4UVIA 2BFAA 4TRJA 3CPSA 3DTYA 3OH8A 5B1YA 4CM8A 1I0ZA 1YBVA 4QT0A 1GYRA 1U3VA 4GSLA 3ZHXA 4IS2A 1IHXA 2B83A 4GVXA 3UCXA 1AHIA 1PGNA 1E3JA 5ER6A 2A9FA 3C1OA 5GMOA 1C0PA 2BI8A 2WE7A 1U8FO 2UUPA 1G1AA 4A5OA 4JNKA 1OBFO 4CQLB 2G82A 3NDJA 3KOUA 1EEHA 3AWDA 2DFDA 2E6UX 2I6TA 2XXBA 3VAZA 5A04A 3Q3CA 2VWHA 1SBYA 2JFFA 2DLDA 3OICA 4M55A 2DFVA 2VUSA 3DMTC 4XDZA 1X0XA 4KQWA 2IZZA 2CF5A 2GASA 5ER9A 2J3JA 3ZZNA 1PQWA 4D0SA 1JAXA 1V3VA 3DAGA 3RJ9A 1VL0A 4IIUA 4ND1A 2VWGA 1PEDA 1TT5B 1ARZA 3JQDA 2HLPA 3EHEA 3VTFA 2NUAA 5JAIA 4CLEA 3PQFA 1BXGA 4C4OA 2QG4A 3JQ6A 4E0BA 1A9YA 4DBVO 1EQ2A 1MA0A 4E2XA 4YJFB 2WJPA 4ALJA 4TQGA 3HN7A 2JFGA 1Y5RA 4RVUA 4IQGA 1E7SA 2QRLA 1U1IA 3I4CA 1FF9A 2Q99A 4PLGA 3DHNA 2XF8A 3KSZO 4D7AA 3KRTA 1R4NA 3DFZA 4B3JA 4S1VA 1LDMA 1WDKA 2P9GA 2W2LA 5HS4A 4I5DA 4XR4A 3GDOA 1DIGA 5IDXA 4EJ6A 4TRMA 4XKJA 4JQCA 5THQA 3QSGA 3ZHBA 2Y1FA 5H82A 1H9BA 3ZNPA 3O8QA 1KEUA 2RHRA 1UXIA 5T6BA 3WWYA 2WSBA 4O63O 1B2LA 2ZTMA 3LU1A 2ZATA 1E7QA 3DMYA 4CMIB 4D45A 1ZFNA 1R6DA 1YB4A 4L9RA 3BMNB 2DBVO 1T2AA 3C1TA 3MTGA 3ONFA 4I9NA 4E5KA 5L7TA 1ISMA 3HHPA 2PY6A 4WCFC 1YOVB 3DBLA 2SCUA 5HRUA 3KEOA 4B79A 2AQ8A 5L9AA 3F46A 4Q3EA 1XDWA 1B26A 2DQ4A 4CMHA 2GDZA 3LT4A 4YWJA 1HDOA 4AFNA 1LDEA 4YRDA 2NACA 2P4QA 1JKJA 2Y1EA 1W6UA 4GKBA 4AJ1A 6ADHA 4FBGA 5JC1A 3H8VA 4ZQBA 2G1UA 3DHEA 5A5FA 3ETGA 1EQUA 2BF7A 1OFGA 3BYZA 5DBGA 1E5QA 4PLCA 3E1KA 4CPDA 1CERA 3A14A 4XJTA 1YDEA 5TF4A 3L4SO 3FPLA 1UZLA 1KS9A 1C0LA 1BW9A 2PZLA 1SOVA 4PG8A 4TRRA 5JO0A 1PZFA 3I6QA 1SB9A 2BKAA 2HJRA 2PZJA 2GYYA 4WKGA 5KOIA 3GH3A 4BNZA 2JAPA 1XHLA 5JCJA 4WECA 3RC9A 4QFDA 2EEZA 3W1VA 1QG6A 1PGJA 4JK3A 2AHRA 4BNXA 3WQQA 3PIIA 5KKCA 3X2FA 4Z9XA 3H3JA 2PGJA 1ISHA 3K2BA 3K9QO 2A4KA 1LEHA 1MFZA 1T2FA 5IFLA 5IDQA 4AJ4A 4BNIA 4BOYA 3HUDA 3NGLA 1EFKA 4CQMB 5C7IO 4IM7A 4KP7A 4C7JA 1MX3A 3ANNA 4RF3A 2PH5A 2EP5A 1RM4A 3PEFA 3R0IA 4RLSA 5KKAA 3RKUA 4E12A 3KVOA 5ICSA 4IY1A 5IG2A 3PYLA 2AQIA 3E18A 1I3MA 2O2SA 3HB4X 1O95A 4MKRA 1P0FA 3I6IA 1P44A 2YFHA 2YV1A 4IS3A 3KV3O 4K1LA 1IZ0A 4U0JA 1UXGA 4R16A 1EE2A 3KYBA 4QO7A 1KOLA 2P91A 3H5AA 4IDGA 3PHLA 3OJLA 3DBHB 4IMPA 3PDUA 3WTBA 1JWBB 4MOWA 5COAA 9LDBA 4MVJE 4PG5A 1I2ZA 4PLZA 2NQ8A 1P1JA 3PRJA 4IDAA 4ZQEA 5FYDA 2Q1SA 4TRNA 2IRWA 4A0SA 4IDEA 1YWGO 1AUPA 1B8VA 2F00A 4J9UE 3ROMA 3VHRA 3EDMA 3ZWAA 1LSSA 2QRKA 3JD1A 5COQA 1ZKMA 3OIFA 4OMUA 1DIRA 3AUSA 1P9LA 3RBVA 4NI5A 1N7GA 1VLLA 4PLVA 1Y5MA 1O0SA 5A4DA 1LSOA 1H93A 1GY8A 1K0UA 1LLQA 5CEEA 1P1KA 3FTNA 4YJGA 1O6ZA 4HFRA 3ZV5A 2IEBA 3UGKA 1Z74A 3L9WA 4J7UA 4BNYA 4XRRA 1I3LA 3TFQA 3U62A 1JDJA 4KWHA 3TL2A 4XQGA 2O3TA 4DMLA 1HYEA 2CUKA 3I3OA 1PS8A 4EW6A 4RF4A 1TLTA 4XWYA 4BNTA 4IINA 4RVGA 1T1SA 2ZTLA 1HZZA 2AXQA 4NBTA 8ADHA 4R69A 3M2PA 4R1SA 1PIWA 4L4XA 1ZK1A 3LK7A 1R4MA 5JO9A 3HDYA 3EZLA 3GRKA 3ASVA 2BHLA 1I24A 1DBVO 5CPFA 3OA2A 4XYLA 1HT0A 5CDSA 5KJ6A 1HSOA 5L7YA 3GY0A 4OKNA 1JWAB 2POQX 5T5QA 3WXBA 4F6CA 4E2YA 4DIOA 4WLEA 2ZB4A 4CR7A 1JLLA 3RJ5A 2YDYA 4A2CA 4KQXA 3U5TA 4OXNA 4CL8A 1E92A 3VKUA 1DIBA 2EWMA 5CEFA 1PZHA 1U5CA 4XGKA 1EK6A 1HDYA 5KVCA 4GBJA 4M89A 3CIFA 3MTJA 3OEYA 2BLLA 4OSOA 4DGSA 3IP3A 4W9NC 3B70A 3JQEA 1GZ4A 2Q1WA 2ZK7A 3GFBA 1IZ9A 1QKIA 7MDHA 4LRSB 3GNTA 4U6QA 3H9UA 4GKVA 3JQ9C 3PJDA 3ZNOA 2VTEA 5TC4A 3GF4A 3JQCA 1H5QA 1SB8A 4TSKA 1HE5A 1DJNA 2F1KA 3DWFA 3T4XA 1M76A 1D1SA 5DP2A 4FJ0A 2WD7B 2B5WA 4TZKA 3F6YA 5A9RA 3AI2A 1V9LA 1Y81A 3ICCA 4CQLA 1GEGA 3Q11A 7ADHA 2NU8A 5IDYA 3OHSX 4LCJA 3VVCA 1JTVA 3C3XA 1KVQA 4FJ1A 4MP6A 3OM9A 5KNLA 5I7SA 4YACA 5K6AC 4IXWA 2DKNA 3WSWA 4ROSA 3BIOA 2PFGA 5FFFA 1J49A 3GZNB 4QEDA 1B3BA 3D4OA 2UV8A 2V65A 2DTXA 2NTVA 1NR7A 1XEAA 3IJRA 3QVSA 5JW6A 4FW8A 5DCUA 3PZRA 1KYQA 5JDIC 5HTOA 1QRRA 4R01A 3TZHA 3GHHA 4I1IA 4FB5A 4W7HA 3FI9A 2Y1GA 2GUGA 2Y0CA 4XRGA 4YJFA 4MJLA 3HB5X 4Q3AA 2BFOA 3GEMA 4N18A 4MVJA 4RLHA 5BSHA 1I3NA 3KTDA 2W8ZA 2P9CA 1DJQA 1EDZA 5CPBA 4UUPA 1QLJA 1IL0A 4XIJA 1E3SA 4PCVA 4FFRA 3GUCA 1VI2A 4BNHA 1A72A 4BO2A 1ISIA 4P22A 5AYVA 3QRWA 5KJCA 4E5MA 3MEQA 1T1RA 1UZNA 5JY6A 3F1KA 4IDCA 4DLBA 3QHAA 4URFA 1B8UA 3N7UA 4NFSA 3RUIA 4L0QA 5IF3A 4GLOA 3G79A 1E3IA 4CMIA 5J23A 4MVJM 1HF3A 3R3JA 3IJPA 2Z1NA 3BMNA 1QMGA 3R6DA 3RQSA 2DUUA 2WD8A 1YOVA 3I9MA 1W4ZA 1IPEA 3PLRA 3ZU5A 3ITDA 1NQ5A 2CF6A 3T7CA 4XQEA 4BO9A 4K28A 4DL9A 1R0KA 2VRCD 3GAZA 3RVDA 3ZU2A 2ZB8A 1PQPA 5GZ3A 4ID9A 4JJFA 3EMKA 3GPIA 4JGBA 3K5PA 4L76A 2VHYA 2I76A 4XYEA 3WSVA 2Y1CA 1BG6A 3RC1A 4K26A 3RKRA 3VZSA 3DDNA 4YTEA 3SBOA 4BGUA 3CE6A 4R51A 1PWXA 2XXJA 2FMUA 2CDCA 1XIVA 4J6FA 5EPOA 4DIFA 1X14A 3FNGA 1D1TA 4GI2A 4QO8A 1JVSA 2HK8A 2CZCA 3GMSA 3DZIA 4UVEA 5B4TA 1RM5A 2EKLA 4YAGA 2IZ0A 1NFQA 4OXYA 4PLPA 1A9ZA 4MVJF 1X1EA 1ZEJA 1JN0A 2X5JO 1HDZA 4AJEA 4U0KA 3DOCA 2YHUA 3MJEA 3ZI0A 3P2OA 4Y67A 4O0LA 3KLPX 3CMCO 4D46A 1HWYA 4ONEA 2JHGA 5L40A 5F1OA 2B69A 4XD2A 1QV7A 4R9SA 1DIAA 3S2EA 5I9MA 4LW8A 3AFMA 4GX5A 1BVRA 4O6VA 2HCTA 3D3WB 3MCVA 5JAQA 1LX6A 4OM8A 4HY3A 4RORA 3GGPA 4X54A 4CQMA 5TNXA 1UXHA 2EGHA 4CUKA 4YAIA 2GPTA 2I5PO 1MP0A 2Y0EA 3H65A 3NYWA 4M8SA 3PHIA 1XR3A 4J16A 4GMGA 4I9UA 1LI4A 4G5HA 3VH4A 3HJAA 3B1KA 4IBOA 4MVJH 4J4TA 4ND5A 1JU9A 3RBXA 2RIRA 2EKPA 4I5EA 5BNTA 3RUCA 3JQGB 3DAFA 4ND4A 3CEAA 3GN1A 3WBFA 2BGMA 3BTOA 4DXHA 1I33A 5EERA 3U09A 4RF5A 3DBHA 1VPDA 2VHVA 5ES3A 1ORRA 2NWQA 1OAAA 1S6YA 1HZJA 1OC4A 4PGFA 1RYEA 1FJHA 2Q50A 3U0BA 2FHSA 2EIHA 1J4AA 1FK8A 3F5QA 4TVBA 4BO5A 1YJQA 1P0CA 1NBOA 3T4EA 4R54A 4AJJA 3FHLA 1D8AA 1A71A 3DZFA 4GPD1 1WZIA 4QECA 3AOEC 1N1GA 3I9NA 4NU6A 4CV3A 2Q1UA 3GZ4A 2OHXA 1Y1PA 4YVFA 3V8BA 4PLHA 5IZCA 1R66A 3LC2O 4P4GA 3RAJA 4ALKA 2P5UA 4NBUA 1WVGA 2J8ZA 3R1IA 1YB1A 3O26A 4CM9D 1QR6A 4CV1A 4JJGA 1T4DA 1MXHA 3GDGA 3FN4A 2VZ8A 1NWHA 3VZRA 1T4BA 2JAHA 3JQAD 3H2SA 2GRAA 1U5AA 4J3FA 1CEQA 4BNLA 1DRUA 2IXAA 4ZA2A 3M1LA 1LU9A 4RJTA 4J4BA 4FQ8A 2VNAA 2WTBA 4NG5A 3O9ZA 1KIFA 4CMEA 2XOXA 4FFMA 4ZD6A 3ZNNA 4PG7A 1E1KA 1CDOA 3ZW9A 1ML3A 1YQDA 2HO5A 3HE3A 2AMFA 4Z0PA 3C1AA 3JYNA 1CJCA 5TJ9A 4AJ2A 4ZQGA 3PYMA 1SMKA 1KEPA 4BO8A 1XG5A 4W82A 3WWZA 3ZWMA 1K89A 3H9JA 1M6WA 3WR5A 2GZ3A 4XGIA 3IQDB 3W6UA 1UUFA 4WOKA 1MV8A 2V7PA 3RASA 3SJUA 4DUPA 1Q2XA 3GC6A 1P1RA 2BRUA 5TT1A 1NM5A 2DBZA 1QYXA 2JHFA 2O50A 1WW8A 4WASA 4HBGA 3C7DB 2G0TA 3ABIA 3H9QA 1ZXBA 2JFHA 1M2WA 4UEKA 4D41A 1BDMA 2WD7A 4UEJA 1PR9A 1T2CA 4LN1A 1NR1A 5JXWA 1BXZA 1ZJZA 1NQOA 5T8KC 1DEHA 4AJHA 3F9IA 1XA0A 4YB8A 3Q2IA 2HMUA 3W6ZA 1JQBA 2P68A 4F6LA 4FN4A 3WS7A 3IDSA 1NASA 5CDGA 3QE3A 1ENYA 1AGNA 4EEXA 1JW9B 3L6DA 2WMDA 3BTUA 3GZNA 1I01A 4WCFB 1SC6A 2VYVA 2VTDA 4L75A 1H6DA 5JMWA 1DSSG 2R00C 4WUVA 4I08A 2HAEA 4JIGA 5CP8A 4CLHA 3AI3A 5I7EA 4AJNA 1UP7A 1Z7BA 3VDRA 5HS6A 1E0DA 4RCVA 2ZYAA 3ADOA 4NDNE 3IS3A 4R9RA 3D4PA 1SCUA 1V3TA 5TQVA 1V0JA 4AICA 2ZTUA 2G17A 1C14A 3KBOA 4LRTB 1HYGA 5MGBA 4R1NA 1LQTA 3KM0A 3F1LA 2BGKA 1EVZA 1WMAA 3AJRA 4ZJUA 4IDFA 2D5CA 2PGDA 1TA4A 4J1TA 1B16A 4GQAA 5ENVA 5JSFA 1N92A 1ZXLA 2C20A 2DC1A 2TMGA 4H7PA 4CM1A 1ADCA 4XCVA 2FZEA 1VKNA 2VUTA 3L4BC 1GR0A 3QVTA 4YJDA 1PSDA 4QSMA 3UUWA 2QZ9A 1CRWG 3P19A 3NAQA 4ZVVA 1E5LA 3LVFO 1LSJA 3GGOA 4E13A 3F4BA 2R2GA 1DOHA 2VQ3A 4TKMA 1IYZA 1DFIA 4BB5A 1EVYA 5CDUA 3LQFA 1MC5A 1ULUA 1V3UA 4BKUA 5T64A 4UREA 2YUTA 2OUIA 5A9TA 3KEQA 4OGWA 1M6HA 3CSDA 3HDJA 4ITUA 3FCOA 1PGPA 4E2WA 5ADHA 3OECA 5EESA 1RM0A 2IYPA 1WDMA 4L74A 4PVCA 1LRKA 3NT5A 4I9HA 1ZUD1 2G76A 2O3SA 4ZQHA 5BSFA 2BH9A 1U3UA 3HN2A 2NVBA 1Z75A 3QP9A 3HDHA 3JQFA 2OP1A 2YQ4A 2YHIB 3H7AA 5HM8A 1JKIA 3L0DA 4RZIA 5L4SA 2VWPA 2VOJA 1XWFA 4NQZA 6LDHA 3K8ZA 3PWZA 4N54A 1VL8A 1BMDA 2Q2QA 5C3MA 3DTTA 1EBFA 3TZQA 4RV9A 1GPJA 2O3JA 2RHCA 3FWNA 4J49A 2V6BA 3VPXA 3V2UA 5C7OO 2V6MA 2DM6A 4BUCA 1A7KA 1SAYA 1W73A 3LT1A 5JS6A 3PJGA 4RGBA 2NVUA 3QA9A 3GK3A 3GG2A 1W0CA 1YB5A 2HDHA 4HNHA 3EK2A 3DQPA 4Y6RA 5DNAA 2NNLD 3KYCB 2JD1A 4ILKA 1C3VA 3EGOA 5I8ZA 1RYDA 4OQZA 3D3WA 1L7DA 1PJQA 3RC2A 3N58A 2O7SA 3IP1A 2B4RO 4WLFA 1G0OA 3E5MA 1DLIA 3KXDA 1U7HA 2Z5LA 3SJ7A 3WGHA 4OH1A 4E33A 4JLWA 3ZCXA 4WLNA 1XU7A 1ADFA 1HKUA 2J3KA 1E7YA 2BI7A 3TDKA 3HG7A 4UUOA 2VZ0A 1A4IA 3BXXA 2D59A 3S2FA 4IQ0A 4BO0A 1SOWA 4FFPA 2YV2A 4AJPA 5AXAA 4HX5A 3H5RA 3QWIA 4FFNA 1EDOA 4BQPA 1EFLA 2EW2A 3JQGA 1QYWA 1ZO8A 2PD4A 3IOYA 3ENNA 4J0EA 3ZNQA 1NVTA 1BXKA 3V1YA 2DBQA 2FY8A 4BGIA 3W4KA 4CMGA 2PKQP 3FF4A 1P1IA 1GCOA 1K6XA 3FRJA 3UFXA 4M1QA 4BQRA 2VHWA 4YRBA 1HDRA 1XKQA 3BHIA 3WGOA 1Q0LA 5L3ZA 3V2HA 3PWKA 4HFJA 3AUTA 3ONEA 4DREA 3PHGA 2FRDA 4R1TA 3MJSA 1QV6A 3ZWWA 3VDQA 1EVIA 4XDYA 2O23A 1SEPA 4XEHA 4BNFA 3SVTA 4N5MA 1I3KA 1YQXA 3PFWO 1V6AA 1DC3A 3WLFA 3H5NA 1B0AA 1LUAA 1UXKA 2Y99A 3Q9NA 1XCBA 4NR0A 5HBRA 4AJOA 5BR7A 3NTRA 1PL8A 2X9NA 2AQKA 4BO1A 4D42A 3I83A 1YXMA 2Z1MA 1BGVA 3QQPA 3B6ZA 1R0SA 2PH3A 5CAEA 3PGXA 5KVVA 1DRWA 1EUDA
chains in the Genus database with same CATH superfamily
1SU8A 2GR9A 3DOHA 4C4YA 3OKPA 3IJ5A 2AI1A 1KFCB 2B99A 4KXQA 4P7KA 5TPZA 2IDZA 1U8CB 1OXKB 2CY0A 4ZC8A 3RBZA 4F8JA 3JVUA 5EEHA 2ENWA 2JBWA 4LHYA 3U4IA 5GJVC 3NYQA 3D5TA 4QYXA 2HMTA 4LY3A 1B6GA 4X1IA 2BGUA 3DEJA 4INAA 4EL0A 1LNQA 4YMVA 4HQ0A 5EKTA 3SXUA 1DDIA 4XQ9A 2Z2IA 2IVZA 3AVPA 1T34A 1J9EA 3O31A 3IAS1 5CDYA 2OMKA 1GAWA 3BXPA 4WEOA 1G7SA 3WIVA 3OIVA 3VKGA 3Q9UA 4JI7B 1BIFA 1EM6A 3IRVA 4BRZA 7REQA 1KDZA 1NUUA 1FU4A 5TVGA 5AW4A 2QVXX 5CK5A 2PT6A 3INGA 2PX3A 4JBGA 3BH7A 4KGXA 3ZU4A 1PV1A 2PAFA 1NTRA 3K9BA 1WXGA 1EFPA 2I7CA 1SKBA 3NASA 2VT3A 2NTYC 4WXEA 2OFOA 2C3MA 4L7QA 4MUMA 2OV2A 5CT6A 1ADGA 2C7BA 4IV8A 3CVVA 4Q24A 1KEVA 4IOJA 2PT5A 3L9XA 1K27A 3CKMA 1CNEA 4HAUA 3HR8A 1ODFA 2O06A 2ZJ7A 1L5RA 1PVOA 1DPFA 3KZNA 4XR9A 3A1EA 2MINB 3HEAA 1HE2A 4HDNA 1GCUA 2H4JA 3CEMA 3MPUA 4CU5A 1FNMA 2PJUA 4R9NA 4ZI3A 4XUDA 1KKUA 3WTCA 1MAAA 1KZ6A 4O5AA 4DYDA 3DULA 1W34A 1RHKA 3X0DA 1QO0D 2IOFA 1E63A 1SXGA 3KTFA 3EQ6A 4DWWA 2DU8A 3IKTA 1T2VA 2QU8A 4UNNA 2WMNB 5KX5A 5EHGA 5CA1A 5CG2A 3TK1A 1G20E 1UJ2A 2QM7A 1V6CA 1H9AA 4MVCA 1LFDB 1VJ1A 4YT4A 4ZDKA 4RETA 1HKHA 1EZ1A 2OBXA 4PN3A 3GNQA 1J0XO 1VJ0A 3H19A 4QOEA 1QB7A 1I7QB 1QVWA 2B6NA 3M6IA 1RC8A 4DJTA 2IHJA 3MMNA 4K8RB 1OD6A 2A7XA 4RPHA 1K1EA 1SC9A 5FPHA 3VDMA 1N77A 1Q3TA 1ECFA 4E03A 2D62A 1YGYA 2FEAA 3F7NA 4JD5A 3CXRA 2YMQA 1OUMA 1TU4A 1EKXA 2WVGA 4L5JA 3KLNA 4CKYA 1OFIA 2YYYA 3D4BA 2A5YB 2QOEA 2Q2WA 2QTWB 3O8BA 4OXKA 1JZTA 4WHMA 5DX8A 1R9MA 5EJIA 5JJCA 1YS2X 3B13B 3QVVA 2OXIA 1CDDA 1NRWA 3AJ8A 2I54A 4QBGB 2Q49A 4FYWA 3EEBA 4MARA 1OA0A 3OAAD 5FO1A 1LVGA 3Q5GA 1YTUA 2PCJA 2WP0A 1OI2A 3EJWA 2LCFA 3SEFA 2ONKA 1FC0A 3DZ8A 4JH0A 5AM1A 1AQYA 3LUBA 4DLTA 1L8OA 3C1UA 3K6KA 4H7FA 4URWR 3UN1A 2CCGA 4X64B 1T0PA 4NJEA 4NK5A 4KNYA 1CUUA 1N4DA 1KE1A 5J4LA 2RHOA 4N7JA 1CZLA 1DOAA 4UARA 1RXWA 1KJ9A 4IX9A 3ENZA 4REMA 3KQYA 3ZGLA 3AIKA 4Y1RB 2ODTX 1Z37A 1EIWA 5L45A 3AVXA 4Z2YA 3H6HA 3VC2A 4UM7A 2WYWA 4W1PA 4AYWA 2F48A 2FHPA 1QF6A 4WK0B 4R2XA 3JD4A 2P5SA 2VTKA 4BFYA 1JSRA 2GOYA 1A5TA 2EXXA 2Q3HA 2RJOA 4LWOA 2V6JA 3MJHA 1NKTA 4MUFA 4DM4A 1XV5A 2QVGA 3CVJA 3WQRA 3B85A 4PQYA 3BWYA 3OT4A 3ZQJA 1C30A 3AY3A 2JLWA 4KODA 3S8YA 3RFXA 2ZUDA 1MXFA 1Z73A 3T9AA 1RTKA 2PXHA 4A27A 3N6XA 2HFKA 1N2HA 3G6WA 3WG9A 1YAJA 4FFLA 4ZXFA 2EFHB 2DFTA 1NUQA 2UXBB 4A15A 1MJGA 2CLLB 1H4SA 3A9VA 4NNPA 5AQEA 3WJAA 3TPFA 2HJGA 1B6SA 1U90A 5AK5A 1WUKS 3GOHA 4P2GA 1GNSA 4UZFA 3WO1A 1O94A 2P79A 4XJSA 1CRQA 3T35A 3TQCA 5EWLB 3VC3A 4TLBA 2UZ0A 2V1XA 1XEWY 2ZS7A 2QAGA 1AF4A 3M3HA 1E3DA 1E5DA 4IMJB 2Q7OE 4ASUA 4C6SA 1KP2A 3HVRA 1NV8A 2PGXA 4TMVA 2OPBA 4RJ2A 5TR9A 1VRCA 1L4GA 2COEA 2WR8A 1U2DA 3A9CA 3IVCA 3N1UA 4DLUA 2J48A 3V5NA 2D7CA 2Q46A 5EXPA 1ABFA 5H81A 5J2UB 5IHXA 3KWLA 4D6XA 4B4UA 2FPGA 4CW7A 3L6OO 2WJ4A 1KO5A 3Q8LA 5BW6B 4NMMA 3WQSB 3WK8A 3G49A 2J41A 4NBRA 2ZOSA 4YALA 4CV0A 3R7WB 4M2LA 3F67A 1ZUHA 1AB6A 3ZBTA 1H9CA 4DN6A 4RHEA 4L28A 2RHBA 1DBPA 2VPZA 3FWZA 3V34A 3U9LA 1YBHA 3KYCA 2V6GA 1IC6A 3FGZA 1ILEA 1QYVA 2QYTA 5AVOA 3TW4A 4B3CA 4TZTA 1D7OA 2ACWA 4D8VA 5K7SA 3KHSA 3U1VA 2D00A 4A1OA 2B9EA 2IYFA 3QKSA 4ECEA 1INLA 2FX2A 3KGDA 4YP9A 1SM4A 1V11A 2GVDC 3SC2A 4XB6B 3H9CA 1IM2A 4CIDA 3NM4A 3NHYA 2A5JA 4W1SA 1QXSA 3AYXB 3CG4A 4FDTA 2E5FA 3QYJA 2VJKA 4NDAA 1F14A 4C3VA 4ER5A 1E59A 4QXOA 4BMYA 4J29A 1JAYA 3WYFA 4EKYA 2J30A 3DNFA 2I1QA 4I3HA 1DTEA 1JFRA 3D4NA 5AM3A 4X66B 1CUVA 2X5NA 1DAMA 2VJOA 3HWRA 5H3CA 3T9BA 2G8NA 1TXGA 3D1LA 3OIDA 5JARA 1TU3A 4QDZA 1JFTA 4MEJA 2WTUA 3WHKA 3O84A 5JQGF 1BEZA 4JVNA 2WMOB 1GYPA 1TC2A 4GSYA 1CQIB 1WPXA 4YJ2B 3BILA 4EJSC 2G67A 3AH8A 5A05A 5CLHA 4UHEA 3WLNA 4KAFA 1FU7A 2IE0A 3HFSA 4K5QA 3PVSA 4XWAA 2R6DA 2BSXA 3BGWA 3O4FA 2ZBQA 3TE7A 1D1PA 3R09A 4A73A 3V00A 2CNWA 1E0JA 4O89A 3EXHC 3K0AA 3SX0A 4HO1X 2WM9B 3PEUA 3NVMB 3ZWVA 3EBPA 2ODNA 3HU1A 5DDIP 3SDBA 3FNHA 3OFNA 5CYGA 3A1UA 1XTSA 1B7GO 1GFZA 2XPCA 3N05A 4IDPA 4MDYA 3ZVLA 3IPCA 3BZUA 4UVDA 3PFIA 2CSUA 1S96A 2EP7A 1DUIA 1JSCA 1T6XA 1WB5A 4A91A 3MNFA 2RAUA 1N2SA 4KLNA 4GM4A 4HWTA 5ARBA 2IEIA 3DV2A 3ZU3A 4F97A 4I7EA 2FPUA 3Q6IA 2CL5A 4CMEC 4YLYA 4CLOB 2PX2A 1GAJA 1H2BA 1YVEI 3HCAA 3SS9X 4QOFA 4GGMX 3ZY6A 4M3NA 3IAAA 3C3AA 1Z56C 3DQQA 2VUHB 3FR7A 3M4ZA 2FPKA 3E9CA 4OB8A 2NSLA 3CTPA 1Q7GA 1DXYA 1LCIA 5EXEA 1E32A 1ZJYA 1LNSA 1GZDA 3K0FB 4G9BA 4AMYA 4W6QA 4ZT5A 2QL6A 5ED4A 5G0UA 1AA6A 2VSQA 2CC2A 1AHHA 4K6OA 2AUNA 2IZ1A 5CFRA 3K15A 4PNPA 4AJIA 4DV2B 4Q6BA 2ZE5A 1A9SA 3VR6H 2I99A 3WRXA 2H2AA 3HKDA 1FDUA 5KCZA 2C7GA 1RCFA 4PBSA 5FOUA 5K0LA 4HUJA 3ZVRA 1E3WB 4DXDA 2JJYA 4ZGWA 4CIBA 4ZVMA 5TY0A 4YUVA 3ROKA 3U1BA 2FW6A 4NECA 5C31A 3QU5A 1VP3A 2R7AA 4KU4A 5DGIA 2L69A 3LUDA 1E6WA 2JLZA 3UXHA 3Q87B 2BE9A 2GBCA 3JVDA 4M9QA 3LWZA 1BS9A 1I2CA 4O3FA 3R7NA 4HWSA 1KI2A 1NUHA 1VBFA 3QLVA 4D74A 4EYKA 1NBIA 4F6RA 4ND6A 4QDTA 1A0OA 1QG2A 2GPNA 3A6GA 2HRQA 1T9KA 5TQ2A 3VR4A 1X39A 1H0RA 4IGAA 2IBMA 4S12A 4MVJD 4FD3A 3ZDRA 2J7PA 4PSVA 3KEMA 1FFAA 1YCFA 2VJYA 2YNMC 1SCNE 2Q41A 1AKNA 1QGZA 1V1MB 4BAZA 5D85A 1UBCA 1E7MA 2I4MA 2VI5A 2I22A 2WTNA 4WN9B 4G9EA 3J7TA 5GQSA 4UHJA 2VLBA 2AMLA 1J9GA 4N0DA 4RKYA 2WSLA 4TS1A 2R8BA 2NYUA 4AY2A 5J2TA 1ZW1A 4XUCA 1KZ4A 3T15A 1X7ZB 1W9MA 4N48A 5TX7A 3EZ6A 3UO8B 2OBNA 1WX1A 2G4VA 1KPGA 3MSXA 4PFSA 3T7EA 4PINA 3DDUA 4M0PA 4NIMA 4DPMA 2OB2A 5JZOA 1T4GA 1YRYE 9MHTA 1JH9A 2XMRA 1P0PA 3VH1A 5DWVA 1YR9A 2Y4NA 4XI9A 3PWTA 3D4IA 2JLUA 1LQUA 2OFFA 1S8NA 1V1JA 4HDMB 1RWKA 3OPQA 4HH1A 2GPJA 3HCRA 2PUWA 5E95A 4CCAA 1TEZA 4GI1A 2Z3VA 4F4CA 1Q1GA 4RVSA 2GA9A 3O8LA 5HOQA 3MTDA 4DS3A 4D79A 3V2GA 5LYJF 4KR9A 4MGKR 3HJFA 3KHUA 3OTGA 5DTIA 4JL8A 5JBIA 5K0SA 2A9JA 1BFUA 2W83A 2V96A 2WVHA 3AILA 3C7AA 1JUDA 3K9FC 2C94A 3NRBA 5JNSA 3SDSA 2Q5IA 4W99A 3QW2A 4PX3A 1S2NA 5IN5A 2FMTA 3PBKA 4Z99A 2V9ZA 4REQA 4CF5A 1I3OA 3JQ8B 3MTEA 5A5VA 1E6LA 1HDIA 3D7KA 1FNNA 4X5OA 5KSPA 3TQRA 1Z06A 5EUQB 3PC6A 3QJ5A 2IWHA 2FA9A 2WHXA 4WT7A 1IEWA 1CZOA 4H60A 4LTNA 1Z6PA 3SEZA 4OJQA 3ZY4A 1A9RA 4YY3B 4MWBA 2FMFA 5LOVA 1H8EA 1F5SA 2D8AA 4WJZA 3D7NA 5CT9A 1N0WA 4I9FA 2H7CA 3S4YA 5BMVF 3A32A 2FI1A 4ZKEA 3ECAA 3IX7A 5A9SB 1V8DA 5MFZA 4S05A 5LP6A 3CXUA 1J20A 4YRAA 1EX1A 2C8JA 2ZUUA 2XZLA 1AK1A 2SKEA 2GB4A 3T1YB 4OHOA 2ZSUA 4JKYA 2ZUFA 5EP3A 1L5NA 5F76A 5B7NA 4KVZA 2ZUEA 1MX5A 2CT8A 3ZCPA 2WEKA 3IFSA 3FI0A 3S27A 4FOTA 1GPBA 4MPRA 4PZCA 5C52B 4OL9A 3UFBA 1KQFA 1EQAA 3DL2A 2EKQA 3ZG6A 5JSKA 5ALMA 2DE0X 3OJEA 1MIOA 4R5MA 2WJGA 4M0CA 2XRMA 3OZAA 1PL6A 1QP8A 2QRUA 3NUZA 2Q3BA 3R44A 5J4YA 2JLVA 3HVJA 1JXOA 2OHFA 2X2PA 2PUHA 4YQZA 4ZOQI 2IL1A 2CMFA 3PQ6A 2IY7A 4U7WA 5KYVA 2LIPA 3GGCA 1CVLA 1G7RA 3L06A 4P8RA 3LDHA 3ZC3A 3R0XA 2Y1OA 4GMHA 1PS9A 1W5EA 4LFAB 1G42A 4CQMD 1LK7A 1IN5A 3NXSA 4K9PA 3PK0A 3Q2KA 3HYNA 4CTKA 4XOUA 3TD6A 2QSZA 2VHEA 5BYKA 1SXJC 1X1TA 3JD2A 3O8DA 3GFGA 1CRPA 2PKWA 2RD2A 1Q0PA 1HQYE 1I4TD 1T9HA 2OUKA 2X8LA 4Q9KA 5E6UB 1UDWA 3WLJA 5AQ1A 1NATA 2PIAA 1JR3D 4BVJA 1R12A 3V2IA 5LQDA 1TA9A 2XVXA 4J07A 4NV3A 2O52A 4MSUA 3UXYA 1WA5A 4M1WA 4OOFA 1P7WA 4UBJA 3HP1A 4DIDA 3RUAA 2ZIAA 5FHQA 1LS1A 2BKVA 4Q05A 3QJGA 4CLDA 1J06A 3ESXA 3UC5A 2HSZA 3WGIA 5HA5A 5GY7A 5FOQA 1H0HA 2G5PA 5IWAB 1TKRA 4TLDA 3C45A 4KQIA 1XTUA 1K92A 4JQZA 5HFAA 3UMCA 4DLBA 3DEFA 1PT8A 1WLYA 1IN6A 2H85A 3E84A 5BSTA 4ESEA 5BV1A 5FV4A 3G0HA 1OPRA 1A5AB 4BKQA 2PA0A 4KNWA 4DCNA 1CUAA 3N8DA 1SOAA 2DKOA 5EIAA 3RD5A 3HWX1 1R4MB 2HF7A 1Q83A 2PD6A 2XB2A 3IEVA 4JP8A 3RRJA 3RUFA 1DO8A 5J58A 2YL2A 1N2JA 2H2GA 2WFAA 2B4AA 2ZG6A 1HTWA 4M8LA 2EFYA 3F6SA 3OHPA 4UBIA 4DA4A 2CFRA 4O4JF 3UJPA 1ZZEA 2ZTVA 1VLJA 1KR2A 2X8JA 3I9V6 1P60A 4WLUA 3QF4B 5I6DA 1XDSA 2FQ1A 4ZDWA 4INZA 1RXCA 3WNVA 2DPYA 1FE8A 1QC5A 3PZBA 1EXWA 3ZJ5A 2X7HA 3UICA 2VDPB 4R8VA 2XMZA 1R18A 1YVRA 1ZW6A 4ZQIA 1OH8A 1QP7A 3U4QA 1L5LA 3RYHB 4URZR 4PFQA 1LPMA 3ZWCA 1EESA 4PZ0A 4BCCA 3P5BA 4FYPA 4JVSB 4QPZA 4FEYA 1S4QA 2R5WA 3S2ZA 1EHIA 1UP4A 2HPVA 2YOHA 1Q7RA 5G4KA 2ECPA 3R9WA 1TYBE 5EXSA 4NE2A 2RH5A 5DLPA 3NHJA 3W5HA 4YXWA 2V4ZA 2IODA 5NLLA 2H54A 2VKTA 4Z9AA 3EPKA 5TMPA 1H2ZA 1UPXA 1XZDA 5EIEA 1J9ZA 1U0OC 5KVQA 1WR8A 2O1SA 3MBIA 5AI6A 1YR7A 3ORYA 5ESDA 3QKWA 2JA2A 4RCZA 3UENA 2Q5EA 4WFKA 3LQRA 5G0TA 3T1VA 4OAQA 4KN9S 3RSQA 3TNDA 1FRVA 5BSRA 5J9GA 3D3JA 3SK0A 2FMIA 3Q0IA 3SIPA 4KIGA 2UUCB 1QS0A 4KSYA 4FCTA 3B5IA 4RKFA 1FMTA 3INTA 1O8CA 4OCZA 1NX6A 4NMXB 1ZESA 2H17A 4MWGA 4DSTA 4OI2A 1XELA 3RFTA 1GSIA 4RF2A 3M34A 3CR8A 3IMGA 4G36A 2CK3D 4KMOA 4N5DA 4DMFA 3DBRB 1X19A 1YE3A 3OQVA 3UHAA 1E4OA 1FTGA 4QPNA 4Y2TA 2FPPB 3FSRA 3KZOA 3LFUA 1DVRA 1XVTA 4JJAA 4KBGA 4LZLA 4P08A 4PX9A 2WAYA 3VUEA 1D6MA 2GPAA 4FN5A 3UT6A 1C0IA 1O95C 1L5HB 2NADA 5CFMA 3KVNA 4EGJA 1TC1A 4XVHA 3AF2A 3BAZA 3F49S 2YRWA 2QZJA 2FDCA 2AKAB 1GZ6A 3LCJA 2W6ID 3DZ5B 1Q6ZA 2BYTA 1RWWA 3JQ7B 3IP8A 1UEJA 3QVWA 1GARA 2BGJA 3OOJA 4G2NA 5E1OA 1NXQA 3R2JA 3IV7A 2E55A 2Z2ZA 4LY9A 4XE5A 4UAUA 2H1CA 3W5BA 2RGWA 2WJVA 2VYVD 3WK9A 3ZHRA 4ZQFA 2MTBA 2PZGA 1N7IA 4HBZA 4WACA 4MQEB 4HEJA 3UXMA 2OL4A 4EPRA 5IXJA 2QN7A 1VE6A 4HN4B 2F4VB 1NBEA 4HZUA 3OY2A 4O2RA 1P8AA 1X7YA 4YQYA 1A2KC 2BGLA 3VU3A 5DM4A 2TS1A 3BULA 1XWWA 3PHHA 4OL0A 1Y1RA 3H6KA 3S68A 4GWGA 1PT5A 1ODLA 3NEYA 3WIUA 4ETMA 1U7TA 3QVLA 5KYUA 2WOOA 3KQTA 4MMXB 3CZRA 5JH7A 5A4IS 5FWYA 2HBYA 3A7EA 2IUEA 4IUCS 2FNAA 2ADMA 3BTSA 3FPEA 2OFWA 4BVLA 4IOLA 5LQCA 3EXAA 3P32A 2O3RA 1X7XB 3FZQA 4JLSA 2F55A 3VR2D 1EJ6A 2FG7C 2DF8A 2I1VB 3E9YA 3EMBA 3ETDA 3CONA 3BE4A 4YDRA 1S8OA 3STHA 4G65A 2XMDA 3O8CA 2WWRA 2GJ4A 2VQSA 3LK6A 3PJFA 3TAHA 1YGPA 4OHCA 5I7FA 2DEUA 3SF8A 1HPLA 2EV9A 1IQPA 1Z2PX 4JEUA 3H2KA 5K05A 5DBFA 3QBJA 1HDXA 4BY9E 3L4BA 3U3MA 3TLKA 1WB4A 4BLWA 3AJEA 4FMBB 3DAPA 1R0WA 1UZUA 1OB2A 1DKLA 3JALB 1QRDA 3KQWA 3AKDA 4Y98A 2F43A 3GJ6A 3TRDA 1HT1E 1Y3BE 3S44A 2BFWA 2AGVA 2EBFX 4ECAA 1J0CA 5AKZA 3PE6A 4RVDA 2PBRA 4GWKA 1GCGA 1PR0A 2FPIA 4JUIA 2NPOA 4N01A 5GZ1A 4TKUB 2RH9B 4GSKA 3HBFA 4JR1A 1LBSA 2AVDA 1MV5A 3NALA 3IXMA 1FTSA 4G84A 4L73A 4LYJA 4C87A 3I9KA 5C7LO 2OYCA 4BRSA 2IYYA 4NV0A 3UW1A 5I51A 5KQRA 3QKUA 3O73A 3UKJA 2PT7A 4M6WA 2E4UA 3STVA 1L9XA 3BGSA 1M2EA 4I1SA 4IUYA 2KB0A 3SPXA 5AVXA 2J87A 3ZR4B 5D51S 2GD1O 2WFLA 3DKIA 4L3OA 3VOBA 5KBYA 4MICA 1J42A 3UF0A 2RH8A 4ZV7A 3DMGA 3I64A 1S02A 4O2BA 1H4VB 1CQJB 4B6FA 2G80A 4XJXA 4GYJA 4GR4A 2JBAA 4M86A 3VPGA 1PVDA 4L6IA 2VNSA 2ASEA 1BX3A 1N6NA 3FMOB 1ZN8A 4HAWA 4JL6A 1Z68A 2YMPA 2AFRA 1LC0A 3PNPA 1ZMXA 2AJLI 4G8DA 4AD8A 3TZKA 4BVHA 1KRXA 3WMWA 3ZLJA 1KVUA 1UMKA 3CH7A 2PYZA 4ALNA 1K5DA 1ORHA 3GLFA 5AOCA 3WNCA 1F1BA 2J1LA 5DGXA 2WJZB 2H5JA 4MCAA 5JYBA 2QP4A 4ZEWA 5HUHA 1Y9DA 4NCXA 1RPJA 2H65A 1GL3A 3HZZA 3AVWA 2YJ3A 3NWEA 1X2BA 1E2HA 4QUEA 3AJ9A 4D3YA 3HNPA 1H6CA 2YWCA 4WK4B 3BMCB 1JJ7A 1WQ4A 4GC5A 2FP4A 3K4PA 2WQZA 3QXJA 4BLOA 5JFTA 2WYUA 3LYLA 5ECWA 2PMEA 3SFVA 4H6VA 1OWLA 4NS4A 3R0JA 4MMZB 3BE5A 3F7OA 2YZ2A 2Q5LA 3LM8A 2VHZA 3L41A 3G2QA 3LFHA 1YRLA 4COOA 4CM5A 5LXTB 4KDRA 1V1RA 2V7XA 3ZHQA 2D2FA 2QRVA 4BNVA 1M5RA 5REQA 4ZYZA 3EDOA 5K8TA 2FEXA 4L57A 1CJSA 1T24A 4R41A 1EWTA 2B82A 3EVGA 3IR6A 2QM3A 2F1IA 3Q7TA 4KGVA 3KQQA 4XTCS 1KFEB 3QLUC 3QXXA 1G6Q1 4Z8YA 1A8UA 5L3SA 3R9XA 1IUOA 1NQVA 3KHKA 1R9JA 4NFLA 1YQGA 4Q5IA 4F5EA 1Q1EA 1ESCA 1SBCA 1Z82A 2OG2A 3KJHA 3OZBA 4XM0A 1E2JA 1LV8A 1DZIA 2QORA 2C77A 2YMLA 1UAGA 3DSRA 3FYDA 3VYUB 3ZTWA 2OP0A 4G0NA 4PQRA 4C2BA 4DQUA 2GXAA 1G9XA 1AN9A 2AZ4A 2RI0A 2P2LA 3DPUA 5DASA 3JPWA 1Y9AA 3AR3A 1HE1C 1XL0A 2N9UA 2QLNA 5DSTA 5SY4A 4C4XA 2GBPA 1U2GA 2QL7A 4KLRA 3FWYA 2QD5A 1TJ4A 2HNAA 2ZJFA 3T0IA 2OV4A 5DYNA 4CTNA 4FNGA 2PTHA 4ZI7A 3P9NA 4DTCA 4MV4A 3T1OA 1VMDA 3EEQA 1E6UA 4EJSB 4OHUA 1LDNA 2R6JA 2WIFA 1WKBA 4FWIB 3LT2A 2OAP1 3EXHB 5KHAA 3FPFA 2ZS8A 1BKYA 1W4CA 2PXAA 3DTNA 1P7ZA 3LPNA 2Y93A 3CEJA 4YQFA 4FGUA 3EUAA 2W98A 3QNWA 4F46A 4MHSA 3RYFB 1A4XA 1R8QA 2B9VA 3R23A 2GYUA 4IFTA 5ICCA 2WU3A 5ILQA 4ZDJA 3JR7A 3T41A 4KPEC 3WK5A 1IZ8A 1G3RA 1ZIDA 3E9QA 3IOMA 2JK1A 2AI2A 3MJ4A 2JBHA 3BXEA 4J2OA 1FLAA 2Q3FA 4Y9UA 3U3ZA 5IK2D 1DFGA 4LF8B 4DRXA 4QDXA 1QG4A 4Q66C 4K9NA 3UAZA 2HA3A 2XDAA 4HUTA 2P2CA 2Y0BA 2YXBA 3NAGA 1TTHA 4FSDA 4E5NA 1KVSA 1UMBB 5CM8B 2QPAA 4TTJA 1X3LA 3SBEA 4O02B 3EH1A 3KTAA 1QCZA 4HT3B 5LZ7A 1ZD9A 5EAIA 1LTKA 3DBOB 1R9NA 1TK2A 4O4LB 3G7NA 4E15A 3MOGA 4PC6A 4DA0A 2I2WA 1YA8A 2J08A 5KHLB 2HJHA 2HT6A 3CURA 4XLTA 3GRCA 1IPFA 4FMCB 2ZYGA 3RC3A 4BGVA 3DDOA 2IXDA 1Z4OA 3E05A 4PQFA 4UKDA 3L7NA 5EUCA 3KU4A 4KQCA 4EVQA 1DX9A 4QVKA 1WVMA 1G5IA 1Q19A 1YAHA 3PPIA 3WBBA 2FOIA 5FI5A 1VTKA 1ZOSA 4LDPA 1J6UA 4XX0B 3RUHA 5CA0F 1D5CA 1P6QA 2DZDA 4B44A 2FOXA 1PV2A 5EGNA 4CT5A 3H1PA 3EX7C 3NJ8A 4ZHQA 4EG6A 4P92A 2WJIA 1GD1O 3KT6A 4AWAA 4A7PA 4EDHA 2OZLA 3IV6A 2H63A 1E5XA 4IXDA 3PDIB 1QGYA 4X1YB 3QWFA 1HH4A 3UAXA 3PQ3A 1Q0SA 2BE7A 2AN5A 3OM1A 5DWDA 4E2ZA 4RTMA 2H1FA 121PA 3ZUPA 5U4QA 1K06A 5FDFA 2V74B 2BFCA 2Q6LA 2F1RA 3NH9A 3PDJA 4RWEA 1P29A 3OPYI 4NATA 4TL8A 1QWSA 1AXEA 1OZHA 2P2DA 4IDNA 1JDZA 1G2OA 2DHEA 1A95A 1XU9A 3HJUA 3JYQA 2W7TA 3Q7PA 2I4IA 5LDGA 1WXDA 4YJHA 4YCCA 2CB0A 3H16A 1BFDA 5CHEA 1JR3E 5C5EA 4KHZA 1DEXA 3AMVA 3QITA 2QLJA 1U7WA 2DJIA 1U0BB 3WRYA 5KVAA 4Z4GA 3A4VA 1O77A 3LBAA 3MB5A 1VLZA 4BJ3A 5JPIA 3QX7A 1E61A 2Q3JA 3DZGA 4AYXA 1MOPA 3GVPA 4QYTA 4QASA 4JLOA 2GCNA 4E07A 2XUIA 1M7BA 4BRWA 5HILA 2FSFA 3GMIA 1IXRC 5FBKA 2VP5A 3P0FA 1Z7EA 2VP0A 3TPCA 1M7HA 2Q4RA 4ACBA 3VU9B 1ORDA 1ISFA 1TQDA 1H2HA 3PFFA 1FVFA 1SHKA 3A4LA 1J2EA 4LRYA 1GPWB 1YVUA 3A8TA 5BUSA 1G20A 2B8TA 4CCYA 3BWEA 1XTZA 2GLTA 1BCSB 3PC8A 2X8WA 1ZI8A 4BN0A 1FS5A 1WNTA 2NZYA 3LBIA 2PWBA 4A16A 3ZDYB 3RJTA 3EGDB 4A0FA 4OK5A 4OQLA 2X4GA 1MR3F 4RL4A 3VVLA 5J47A 1SXPA 2CLHB 5DOZA 1F8GA 1K63A 1UANA 4JJIA 3IKJA 5IKOA 3SZMA 3QUTA 4IJUA 4OHWA 5FWAA 1YBAA 4CM8B 2JAXA 3V33A 4E30A 2O8DA 4MVWA 3N8KA 4CDNA 1CIVA 3LKVA 3HBJA 3NTLA 3KPWA 3MC1A 3EVDA 4RD1A 4D3DA 4F0JA 4B75A 1M34A 1N6KA 2V9CA 3QWAA 3M81A 1W25A 2Z98A 1XOIA 4MIYA 1WMBA 2VH2A 5PNTA 1NKVA 1GG8A 1TF2A 1J70A 4YI3A 1XYVA 4KE8A 4ZO9A 1FQKA 3V4OA 3B6KA 3WMXA 3Q7RA 4PZLA 3ZHSA 5JALA 5CBKA 3EZYA 3MIIA 1RZRD 1RWBA 1TX4B 2C9OA 3JQAA 4Y1EA 4TWZA 4IKPA 2LGJA 4W9NA 1Z0DA 3PNVA 5E0OA 1CR2A 5ALVA 4JXZA 1LXCA 2IYTA 1IOZA 1E5VA 2C2WA 4KQFA 5F3RA 4F45A 2PJRA 1DEAA 3AEYA 5F98A 5DLYA 3BT7A 2Q4OA 1WULS 1WVIA 3SX2A 3IUMA 1PDWA 4E21A 1NC3A 1PNVA 1B23P 1J97A 2HIHA 1L4KA 1B43A 1XZCA 2ZR0A 5JVDB 4DR2B 1FXWF 2EQBA 5E7MA 4BVFA 1R16A 3KQSA 4PF1A 3KXLA 2YKGA 5TVKA 1V3QE 1J25A 3QYAA 4H16A 1T3TA 4ZAZA 2I33A 4HNUA 1Z6ZA 1QPGA 3K0KA 4R0MA 2IHKA 4HNTA 2E1PA 1UOOA 4ISCA 4LJ5A 1MQ8B 1VIVA 3AR7A 5AHXA 1UXJA 1XQ9A 4I5IA 4RW0A 2NUAB 2H18A 5G0WA 4YP0A 5T4BA 4AMVA 3IWCB 4L8GA 1Y42X 2MOKA 1HYQA 2NO9A 2VHQA 3EDYA 4FUTA 2XR1A 5T4EA 3SZLA 3V4VB 1SXJB 4FLFA 2H5LA 1RQLA 1FPMA 2NO6A 2WSSA 3TZ6A 1TI7A 1X13A 3HXOA 4JUCA 5I7WA 3QVGB 4MRAA 1ZUNB 1FNCA 2NVUB 4FFBB 2AKYA 1H2FA 3KYJB 5C4GB 3BQ9A 4BRUA 4A0RA 1QQ6A 1WW3A 3TUZC 4B3IA 4P32A 1CJKC 3PICA 4HAIA 1W30A 4Y9DA 4N7RA 4RKRA 1NZDA 5C8YA 3BS4A 3HCOA 1SK8A 1YMVA 2QYHA 3UB2A 2DTDA 1L8QA 1T2EA 1DO0A 1OTYA 1N3LA 1NU8A 1R8YA 1G41A 2UUOA 2WMYA 1S01A 3GBSA 3GA7A 1WHTA 3RPEA 1FNSA 2XNDD 3CF4A 2XD4A 3F2VA 4BEBA 1NONA 3X1YA 4N5LA 2HSDA 5L51A 4TTTS 3P2YA 5CB4A 5ENDA 4JCOA 3UYKA 5LUAA 1ZD2P 3RC8A 4HNSA 5JAMA 1C9JA 1MTZA 3QVOA 4MDHA 1C2TA 2VDMB 5BSUA 1WMSA 1JYFA 4UOQA 2IBSA 3DBLB 4IHJA 4UFOA 2VJNA 4XUEA 1KERA 8LDHA 4X8LA 4BUJA 2I66A 1GTMA 5K3FA 1FX0A 4XVUA 2UAGA 5BWCA 5D87A 3IA7A 2PPVA 1V7QA 3CGWA 1N2BA 3GH1A 2QE7A 4ROTA 5FUXA 2GRUA 6Q21A 2AH5A 2OCAA 4GR9A 3T0GA 4DIKA 5CNMA 5EQFA 3QX8A 5T73A 1Z0JA 1NXXA 1WJGA 2CJWB 2GM9A 2MMGA 2R4UA 4HMPA 4I4TF 1JXQA 3N28A 1KF0A 4MYCA 1JIIA 5JNWA 1THTA 2OHHA 1QTQA 4FKMA 4Z0HO 2ORYA 1DQSA 5ALOA 3WDLA 1L1EA 5HX7A 2D1TA 5KSOA 1T29A 1RPNA 4NE9A 1KSGA 2QQ5A 4AJLA 1KEEB 1W1WA 2HT1A 1G8SA 2R65A 4LOHA 1QAOA 3AW8A 3ESDA 1DO2A 4PG4A 1GITA 4U8GA 1DAOA 5D01A 5AKJA 1FYXA 3ZDQA 5B6PA 2XVAA 3D6TB 5T57A 2VBGA 3QPVA 4LZOA 2UVPB 1XP8A 2H92A 5AVJA 4AF6A 3KTOA 4D3ZA 1X1RA 5BW5A 1GRRA 4U3JB 3K32A 4YYZA 4JB8A 1IBSA 2HIMA 4KI7A 4LTMA 1KQNA 4J75A 3QELB 4MI9A 3NUGA 2VYND 5J1TB 3NB0A 4RPCA 1IHOA 3QOYA 4B31A 1WXHA 1OVMA 1KOJA 3MK31 3O2QB 1ZM9A 3EP6B 4IZIA 4OM7A 4CMCA 3I1IA 1CTQA 4CYMA 1NY5A 3AKEA 1JU3A 1P31A 4YEDA 5BN5B 3NDBB 4YMHA 1ZNZA 4CDRA 5FL7A 2I4LA 2GAIA 2NV6A 4R2HA 3AKZA 4JT8A 1EFAA 1E1QD 1HTBA 3UPUA 3B7PA 3HI4A 4JOCA 4US1R 2C92A 1XD9A 2FG6C 4JU9A 1SQ6A 2Z58A 1TT7A 3MS4A 1P7CA 1KQOA 2JA1A 3ROPA 4C7MA 2OLEA 5FX2A 3WB1A 4U2CA 4A36A 1J56A 1XAJA 3I5YA 2J6IA 3U3RA 2QYSA 1BMFD 1B8PA 5CNKA 5DT9A 3ZOKA 3ZDFA 3GZTB 1KI6B 1V2HE 1W93A 3UG7A 5L6MB 5B36A 1DL5A 1JDUA 3BMQA 3G9UA 1OBOA 4EI9A 3DO8A 2P6UA 5C1DA 3GCDA 2V3WA 3IDZA 3K73O 1HV8A 1D9ZA 1WCWA 5E4TA 3WYCA 5GAJA 5L7WA 3FZEA 5BT9A 5LWQA 5CYFA 1Y89A 3ZWDA 1ES9A 2MU1A 2V7EA 4BNDA 4KOAA 3A06A 1NE7A 4FT2A 1KK0A 3TWOA 1YT5A 4CF4A 1RYFA 1RSZA 1H3EA 5GVRA 2NZXA 2X5OA 2WM2A 3GGGA 3NFRA 1KO1A 2PZMA 2GZ2A 2GPWA 3G82C 4HB0A 4HB2A 1S1CA 4RIIA 4NBNA 2Z3WA 2QY9A 2D1RA 3I9FA 1UBFA 4LHZA 1SXJE 1N1MA 4C30A 1A4UA 2WF9A 4P4UA 1JHMA 4I1RA 1R0LA 4X9XA 2NO7A 3WQBA 1NVWQ 1BJTA 5JY1A 2DETA 3IKLA 5HIMA 1R2QA 4RA6B 3PCXA 1L7RA 4L4RA 1VG8A 4L9WA 1E0AA 2WDZA 1IQUA 1CRZA 4FGSA 4IIVA 3VUFA 1J90A 1H69A 5DSZA 4OJKA 2WWTA 2VA9A 1JEQB 4ZC1A 3HV2A 2VQEB 4IRXA 4KE9A 1S2DA 4PNEA 1IM8A 1G6OA 3N5KA 4F71A 5ADVA 4HUQB 3UMMA 1QHFA 4FKBA 4AKHA 4LF7B 3LP5A 4WKPA 3IAUA 3A4YA 1OC2A 3AY7A 1VECA 2HK7A 4EFLA 1G2IA 2V3VA 3PDCA 3IBFA 2Q2OA 4WCDA 1KAGA 1UOEA 1CB0A 1KI9A 2O6HA 4G0QA 3ZE1B 4JBHA 3LZDA 4OEHA 2QRHA 2CBZA 1XVUA 3AQ4A 5F35A 1CY7A 2O5VA 4RVHA 4GP9A 1GN9A 4RVCA 4UUMA 4UBOA 3ZXXA 2OQVA 4E6PA 3ZCRA 4BMOB 1FS6A 3HQ4O 3U17A 1PJLA 3ZV3A 4AP9A 1L4YA 3W5DA 1UBKS 2ECKA 3RIXA 1ZMOA 4W1QA 1J7KA 1H3NA 1KYTA 1EK5A 2ZSHA 4MVXA 2ZVDA 1DUSA 2CXTA 3ZBPA 1SPXA 4U7HA 1V5WA 2CJXA 1II8A 2PPLA 1Z4KA 2QJRA 3I58A 3R6WA 4JJEA 4AZ3B 4ESVA 2G7MC 4V0OA 2OHOA 3GT7A 5I8WA 1TADA 3DLPX 2EX4A 3RUDA 1T13A 3UA4A 2REBA 3N8NA 2BEUA 3IL2A 4LMRA 2M6SA 5BRAA 1YV9A 4LC0A 3FUUA 1XLTA 2BFPA 2WM3A 3O4RA 4AQDA 2B30A 3IIJA 3DHYA 1FUYB 1JHAA 2J0UA 4M49A 4OQFA 3BPSA 1C9KA 5B6IA 5LMCA 5CEJA 3A2KA 3KT3A 4YBZA 3VSCA 1C3XA 4LDZA 1LS6A 5FPYA 3RQIA 3P2KA 2O6LA 3WB2A 2BFFB 1VDMA 4NCNA 4Y2HA 4IOKA 5DBHX 3AB7A 4C7OA 1EGAA 3N7TA 1C7ZA 1CJVC 3BEDA 4MRPA 2YINC 1CYDA 3E7FA 3X1KA 3B5EA 4PO3X 4UVIA 5LPNA 4TRJA 1WM1A 4YV1A 1QVZA 2C03A 1I0ZA 4H4CA 1XA4A 3OCXA 1UQTA 1U3VA 2FLVA 4GSLA 4LVOA 4CLQA 5IAEA 1XTBA 8GPBA 1SZDA 2IZ5A 2JIBA 1RBQA 2JI4A 3L7OA 2VSXA 2BZSA 4URXR 1QCYA 4OGGA 2Z43A 5GMOA 5SV2A 4BAGA 2BI8A 4CIYA 4OFXA 3JZFA 3TQQA 5ES4B 2JFZA 5F2EA 3FBWA 2CXOA 3KIPA 1OBFO 2ODPA 3NDJA 3QU9A 3S7TA 2IT1A 2ZIGA 3EVAA 5KREA 2E6UX 2E4WA 2HWYA 2QTRA 3NM6B 3WLOA 5EMMA 5A04A 4Z0NA 3L0IB 2K5UA 4I1PA 2JFFA 4H1UA 4W5TA 3OCCA 1YHZA 3R6TA 3AJAA 5DNYB 5FWXB 5EIWA 2VUSA 3DMTC 3JAWA 2PH7A 1QRUA 3BXFA 1WHSB 2ZI5A 3A1WA 3F71A 1BJRE 4KQWA 2CF5A 3R3WA 4XFJA 2J3JA 5ER9A 1F2TB 1GPNA 2G63A 1YQUA 4GMXA 4JYBA 4Y2SA 4D0SA 3IVXA 3BK7A 1V3VA 4EHLA 2ACEA 5KQPA 3MUNA 4DV3B 1TT5B 2GBFA 5ALIA 3CLVA 5IARA 4PGAA 2Y76A 3LRXA 1OFVA 1V45E 1BXGA 2GSWA 1GUAA 1SFRA 4RA9B 2QG4A 4MQMA 1ZM3A 2EOAA 1QQ7A 3IELA 4DBVO 1EQ2A 1MA0A 3R3VA 4B3FX 1OI4A 1T5OA 2WJPA 2ZP1A 3GWZA 1F51E 4I50F 3R76A 3TLCA 5IFKA 4IQGA 1NDUA 4MR9B 2ZETA 1UPTA 1KMHA 3BMXA 3QJYA 2VZLA 1G63A 1R64A 2Q99A 3DHNA 3UQYS 3CIOA 2BGRA 3OP1A 3T7AA 4H08A 1T5HX 1WDKA 3A6DA 3CZ5A 4KFCA 4XR4A 4I5DA 3GDOA 5KCMA