3KUXA

Structure of the ypo2259 putative oxidoreductase from yersinia pestis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
352
structure length
349
Chain Sequence
SNAMADKIKVGLLGYGYASKTFHAPLIMGTPGLELAGVSSSDASKVHADWPAIPVVSDPQMLFNDPSIDLIVIPTPNDTHFPLAQSALAAGKHVVVDKPFTVTLSQANALKEHADDAGLLLSVFHNRRWDSDFLTLKTLLAEGSLGNVVYFESHFDRYRPEIRQRWREQGGGIWYDLGPHLLDQALQLFGLPETLNVDLGMLRPGSQSVDYFHAVLSYPGQRVVLHSTVLAAAETARYIVHGTQGSYIKFGVDPQEDRLKAGERLPQADWGYDMRDGIVTLSHDNVLTEKPLLTLPGNYPAYYAGIRDAIWGTAPNPVPATEAIKVMELIELGIASDQQKKALPIIAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative oxidoreductase
publication title Structure of the YPO2259 putative oxidoreductase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
total genus 97
structure length 349
sequence length 352
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3kuxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kuxA01
4ID9A 3LC1O 4U5QA 2DBVO 1F14A 2FZWA 4BO5A 1O9BA 4CMGA 2Q4BA 2Y99A 4NFSA 2YV2A 2DT5A 4U0KA 1M6HA 4Y8VA 3PIDA 3WJ7A 1N1EA 1NTOA 1FK8A 3O4RA 3UGKA 3WB9A 5GMOA 1WDLA 3TZQA 1LQUA 3QVSA 4HFNA 1QKIA 4PG8A 1GV0A 1HYEA 2EHDA 2CVZA 5TT1A 3U4CA 4E5PA 4R68A 3FF4A 2I66A 4LRTB 3RFXA 4P8RA 4B79A 4Y6PA 1HXHA 3LT2A 4E5NA 4PLCA 1R4NA 4FFNA 1YGYA 1V9LA 3D3EA 4FS3A 3WYEA 1X0VA 1PJ3A 2QQ5A 1ISIA 3SC4A 4P4NA 3E5RA 4IS3A 3K6JA 3ZWXA 4OJNA 2RAFA 3GVPA 4IDDA 1Z45A 4I5DA 5LCXA 3M2TA 4IY1A 3GA0A 3KYDA 4W7IA 1HWYA 4L4RA 4BO6A 3QIVA 3GNTA 4J2HA 4DWVA 5TLSA 3H9JA 4H7PA 3MJVA 1IPEA 2PH5A 2CY0A 2YUTA 3A06A 5JPIA 3ZWOA 1U2GA 3BMCA 4DQXA 4MVJF 2X0JA 4CMBA 2CDAA 1M76A 4IUYA 2YHIA 1U4OA 4YJFA 1GPDG 3VVCA 4FJ0A 5L4LA 3HQ4O 3QE3A 5IF3A 3JQ6A 3VH1A 1BVRA 1T24A 3P2OA 3WMWA 3VVBA 4CMEC 5A9SA 1T2FA 2WYVA 2FPGA 1MFZA 4BO3A 4RDHA 4EEZA 2O2SA 2WMDA 1OC2A 3MWDB 2DTDA 4GL4A 3U62A 2PTGA 2P9CA 5KVCA 1QV6A 2FHSA 2Y0CA 3JQEA 4D79A 1ENOA 1JLLA 2PKRA 1E3JA 3AUSA 4J4TA 2YYYA 3F46A 5JAQA 3ANNA 3WBFA 1ONPA 4L74A 3RFVA 1NPDA 2C5AA 3KHUA 3NJ8A 1MX3A 3QLJA 1XGKA 4XB1A 3I9NA 4CODB 3QVWA 2VT2A 2CF5A 3BTUA 2VOEA 2GUGA 1PJ2A 4KUGA 2NU8A 2FP4A 3QVXA 4R5MA 5TT0A 1ISFA 2Y05A 3WSWA 4DYDA 3UCEA 1CF2O 3U9LA 4R9SA 1UP6A 4PLVA 4IM7A 1ISJA 1A27A 4UEOA 2UV8A 3OHSX 3CPSA 4TZKA 3DQPA 3F3SA 3PJFA 4YYZA 4AJJA 4Z0PA 4XR9A 4EW6A 3TWOA 3N74A 4R41A 4NQZA 1GCUA 2X6TA 4RF5A 2CVOA 4HV4A 3NT5A 3RSHA 3EAGA 2Q45A 1K6IA 1DJQA 3IC5A 4GX1A 4BNIA 2GO1A 1PZHA 2DPGA 4LN1A 4XD2A 5FWNA 3S2GA 2H5LA 4EBFA 4IDCA 5K9ZA 5EESA 4P4GA 2QYSA 4GI2A 4TRMA 4YVFA 2FSVA 2RHCA 1BXGA 5TIIA 4IJVA 5DULA 3NV9A 4BNJA 3D5TA 3Q9NA 2GZ1A 1R4NB 1TT7A 1XELA 3LLSA 4WCFC 2J3HA 3MEQA 4GMGA 1LLCA 2ZB3A 5DT9A 3BAZA 2LDBA 2W2LD 1J5PA 3ZV4A 4C7KA 2C59A 4L4SA 1QSGA 3CIFA 1PQPA 1I3NA 2QRJA 3KYDB 2VN8A 5L4NA 4JN6B 4IXWA 5KWEA 1J4AA 1XSEA 4FC7A 3HB5X 1FMCA 1V35A 3QQPA 4EJMA 1NPTO 2DM6A 5A9RA 3FSRA 1IOLA 3WDSA 1ZO8A 1Q0QA 4HX5A 4AJ1A 4TVOA 2PZMA 1LRLA 2GDZA 3BMCB 3I1JA 4RPLA 3LT4A 1HLDA 2YHIB 3IIEA 4UVHA 4D7AA 5EPOA 1JWAB 1T1RA 1WMBA 1X0XA 4LMPA 1GZ6A 5ER9A 5A9SB 5C3MA 4JROA 3IP1A 5G2OA 2ZTLA 4PLPA 2HDHA 1BXZA 4CMIA 4IDFA 5JO0A 3PYLA 3GHHA 2C2YA 4CLOA 1Y1PA 3WX0A 2ZB4A 3PHLA 4BNHA 2UDPA 4RV9A 1UXJA 1W8DA 3CSDA 4E3ZA 4UUPA 4IXTA 1C0KA 2OFPA 2YDYA 5IZCA 4CJXA 4JLWA 2FRDA 2NUAA 2EERA 1KS9A 5G0VA 3ST7A 1E5LA 3E03A 3RUCA 1EFKA 5MDHA 5IDQA 3IAHA 2A92A 1YL7A 2I99A 3EZYA 4Y6SA 3T7CA 3VH3A 1S6YA 1MUUA 5JYAA 3VTFA 4YAJA 3PLRA 2VZ0A 1I10A 1HETA 1M66A 2BELA 4EDFA 5DCUA 5G0WA 1IZ0A 3PTZA 4BO7A 1Z75A 1VL0A 1ZBQA 1SCUA 3CKYA 1FDWA 3O9ZA 1AE1A 4D3FA 4AJHA 1UXGA 3RUFA 2RH8A 1NVMB 3UN1A 1P1RA 3V2GA 4CR8A 4BNTA 2Q1SA 1ADCA 4XA8A 4INAA 1UDAA 2AHRA 5ENVA 5ITVA 5L3ZA 3HDQA 3ADPA 1XEAA 3WJAA 2QRLA 3HN7A 3ZWAA 2WYWA 1Q7CA 2ZTVA 4W9NC 3I6IA 3Q6IA 1VL8A 3UW3A 3COSA 1VJ1A 1V6AA 3JQBC 1NX6A 3JQ7A 3QWAA 4O59O 4XX0A 1LQTA 3DBVO 3FWZA 1BXGB 1I3LA 4ND5A 5ADHA 3PWSA 1I30A 1H94A 3D4NA 4IQ8A 3RKUA 2BFPA 5JDIA 1YS4A 4FBGA 4IBOA 3K2EA 3EC7A 4GBJA 2OMEA 4AVYA 4WNCA 5DP2A 1EE9A 1DOHA 3NRCA 4E5KA 1DFGA 1NASA 2G5CA 2J3IA 2VHWA 5K6AC 4JJFA 2WM3A 3IQDB 3PK0A 1AHHA 3K73O 3RJ5A 3VPGA 1LDMA 1FDUA 4FR5A 1WXDA 1RM3A 3F5SA 5KIAA 7MDHA 3MCVA 5KJFA 4YAIA 1H5QA 4RQTA 1ZK2A 1MP0A 3TFOA 1IYZA 4O6VA 2B4QA 4W6ZA 3I6QA 4UVIA 4BV9A 3LYLA 1F12A 3AY7A 2UYYA 3GRPA 4BNVA 3K9QO 1VRWA 1B0AA 4ILKA 1H0KA 2O7QA 2A94A 1QR6A 9LDBA 2X9NA 3WQRA 2WYUA 4XYEA 3DEYX 1A5ZA 3DAGA 3EVNA 4M49A 4CLOB 1MC4A 4JBGA 5TRTA 2AQ8A 4QQRA 3HADA 1A9ZA 1E3LA 3LT1A 1DPGA 4XYGA 3PHJA 2OHXA 2ZYGA 4YJGA 5B4TA 4IPTA 5BSFA 4PZCA 4CLEA 2GSDA 5CDSA 4RVUA 2GD1O 4I5GA 4BNYA 1G6KA 5JY1A 1YE3A 4ZU3A 3JYLA 1EUCA 1HL3A 3D0OA 4R5HA 2VHVA 3HDHA 4EI2A 2BGLA 2RBEA 5GZ3A 4GVLA 1EK5A 1IY8A 3V2UA 3VDRA 2O3SA 4E2WA 3DTTA 1WWKA 3TOXA 2PZKA 2EKPA 1T2AA 2HQ1A 2HAEA 4XB2A 2ZIZA 2VRCA 1UDBA 4MVJE 3O8QA 4E13A 4K26A 2D59A 5C37A 3FPCA 2ZCVA 3L4SO 1WW8A 4KOAA 2V7PA 3GHYA 1GUZA 4DVJA 3GK3A 1QLHA 3GAFA 4BHTA 5IJZA 5FF9A 4CLXA 1I3KA 1NXQA 1U9JA 1JTVA 3JD2A 4HBGA 3UVEA 3ZHXA 4JK3A 4YR9A 1YBVA 4DGSA 1DC5A 1FDVA 2FY8A 5COBA 2YDXA 3JD0A 5DBFA 1X1TA 4K6FA 2O4UX 3AFNA 1PS0A 3VDQA 1X7DA 3JQ7B 1NP3A 2HK9A 1P1IA 4FGWA 5L51A 1NR1A 3BA1A 1PL7A 1PSDA 3K2BA 5F1KA 1JKIA 3WFIA 3IP3A 4R54A 1HYGA 1PJTA 1V3TA 4M87A 3ROMA 1GZ4A 2Q1TA 5DN9A 4A27A 4D41A 1DXYA 1NNUA 1QP8A 5ILGA 3L9XA 5TJHA 3S2FA 4AJKA 1HDXA 1OI7A 2C2XA 1HE2A 4GSKA 4ALIA 3QY9A 3EK2A 1EEHA 5A9TA 1Y9EA 4FW8A 2HMUA 2A35A 3F4LA 5CP8A 1EDOA 2E4AA 1UZLA 4I8XA 2IZ0A 3T4XA 4GGOA 3M1AA 4BB6A 2A9FA 4IMPA 3BHMA 5JLAA 2VUTA 9LDTA 1WZEA 1H9BA 3QRWA 2BH9A 1YO6A 2DAPA 1UP7A 1YH3A 4WLEA 4WCDA 1I3MA 5EMHA 3FBTA 1QYDA 4CUJA 4RF2A 1OMOA 4RORA 1DBVO 3E18A 4Q3BA 1CIVA 5T8KA 4JGBA 4EJ0A 1O6ZA 4YJGB 4AICA 3H9UA 4FDAA 1FF9A 3I23A 3AOGA 5T67A 4XYLA 1HE3A 3JQ8A 3R1IA 2OL4A 5G0UA 3MOIA 3RBZA 1PIWA 4YRAA 1CEQA 1LTHR 1UP4A 4ZQEA 1ZK1A 4E2YA 3NJ4A 1K0UA 3IKVA 3KETA 2GZ2A 1PGNA 2X1HA 3ZW8A 1OFGA 3WGOA 3FRJA 2W2LA 2I3AA 1DJNA 1AHIA 1I32A 2NADA 3OQ1A 2PNFA 4NBTA 3D3WB 2JHFA 4S3MA 1QV7A 5FI5A 2WD8A 3LK7A 1Z73A 1JQBA 2VT3A 4IJWA 6ADHA 4EJ6A 1H6DA 4CM6A 3O8QB 5GY7A 1N2SA 4I08A 3UF0A 3UUWA 1NVGA 2VWQA 2W8ZA 2XOXA 3EVTA 4WK6A 1UZNA 5HM8A 4YDRA 5AQ1A 4RCVA 2GN9A 3R3SA 3L07A 4JIGA 3NDRA 3DAFA 3OJ0A 2X23A 4FFLA 4K6CA 3FNGA 4BKQA 1SBYA 3GOHA 4CM3A 1DRUA 3GG9A 3VPSA 3V1YA 1YDEA 1X13A 3DB2A 1YJ8A 4J90A 3LF1A 3OF2A 5A02A 1X14A 3DC2A 1KOLA 4PN3A 3GN1A 5I7EA 4E30A 3RU9A 3TL3A 2O48X 4K28A 1B3BA 4YAGA 2DBZA 3ETDA 2Y1DA 4NBVA 4CM7A 2P2SA 3GEMA 4DC1A 2DVMA 2AE1A 1GU7A 4G65A 2ZTUA 1GR0A 3NKLA 4L8VA 4CLRA 4A73A 3JQGA 2X5KO 2CFCA 1XHLA 3HDJA 4RPGA 3WGTA 3ROQA 3ZNPA 5CEFA 5TF4A 1SB8A 4CLHA 2JD1A 4YB8A 2R00C 5F1PA 4J7CA 2X5OA 4N5LA 3AOEC 4FQ8A 1YOVA 4R16A 3DZFA 2YV1A 5L7TA 3VKVA 2HU2A 3NTRA 4XGIA 3RBVA 2B36A 4GKBA 1KETA 2JFGA 2G0TA 4MVJI 2DU8A 1MXHA 1A7AA 2PD3A 3GFGA 5TQVA 1P31A 3P2YA 4CQLA 1ORRA 3WNVA 1H6BA 4BNUA 2ZYAA 4ALKA 4RF3A 4D44A 4DMLA 1ADFA 3ON5A 3WIEA 3KYBA 1BSVA 2PD4A 1I24A 1NQTA 3WGIA 3WYCA 4GQAA 1DO8A 1ZZEA 1J6UA 1AXEA 2VUUA 4PCVA 4EUFA 3MOGA 1PTJA 1LUAA 4NG5A 1VC2A 3AK4A 4AFNA 4XCVA 1XLTA 2DC1A 5B4UA 2DFDA 3INRA 2DPHA 3W8EA 1VE9A 1N9GA 3OBBA 1AN9A 1C1XA 5T57A 3JQ8B 4ZHSA 1NQOA 1BVUA 1O95A 1ZK4A 1Q7GA 2JFHA 3C7CB 3AI2A 2P5YA 4JX8A 4NFYA 4CMKA 3S2IA 5L7YA 4TKMA 4AJNA 4C4OA 4XRGA 3PFWO 5L95A 3FTPA 2R6JA 3L77A 2JD0A 5A5FA 3B1JA 5TSDA 3DZHA 4E0BA 4BGEA 2C07A 3QWIA 2OZPA 1I36A 2ZQZA 3Q2IA 2AG5A 3DZIA 4WLUA 4F6CA 1L7DA 1LXCA 1A4IA 3ROKA 5JW6A 4J43A 1S7CA 4H15A 5JSFA 1AXGA 3JYOA 1H6CA 3FCOA 2Q2WA 3TSCA 1NFFA 1NVTA 1VPDA 2JJYA 4NDNE 4NJOA 3I9OA 1DRWA 3QV1A 3STHA 5FFFA 3VZSA 2GN6A 2CDBA 1Y8RA 3KRTA 3V8BA 1GQ2A 1IB6A 2NVBA 3A28A 1SZJG 2O23A 4J1NA 4BO9A 3SLGA 4W82A 5HS4A 4CV1A 1TB4A 4XJTA 2DTXA 2EEZA 3RAJA 2DQ4A 4U0JA 2JFFA 3OJLA 1BGVA 3GUYA 1ADGA 4WLNA 2AQHA 2GF2A 4OKIA 5A3VA 2V65A 3V2HA 4R51A 3ZU2A 2AEFA 4B4OA 1RM0A 3LF2A 4ND4A 1E0DA 1KEVA 4MOWA 4KDFA 4PRLA 4XQCA 1DIHA 3JQDA 3QHAA 1EVYA 1Y8QA 2QW8A 4CLRB 3JQGB 1EE2A 3AI1A 2I9PA 1RJWA 3OA2A 1U5CA 1ZW1A 2Y1FA 1X1EA 4FFRA 4E2XA 4P38A 2EG9A 4XIJA 4FPXA 3BIOA 1YBAA 4YT5A 1GYPA 1PU2A 1YOVB 4DREA 5GZ6A 2RIRA 3L4BA 1XU7A 3T4EA 2O3JA 3ETEA 5JC8A 2ZB7A 2WE8A 4GX2A 1LSUA 4JQCA 4R69A 2NTVA 3F9IA 4CQLB 2WD7B 1QG6A 3K5PA 1NHWA 4S1VA 1UUFA 4HFMA 3JSAA 5IXYA 4O1MA 3W6UA 1ZH8A 2BHLA 1EVJA 3GNSA 1DIAA 4OIMA 2W4QA 3MJCA 4NFHA 2VRCD 5DOVA 3ZGYA 4KUHA 3GVHA 2HK8A 1PZFA 2CMDA 1YQXA 2EKLA 2EGGA 2ZTMA 4XR4A 4KQWA 3H3FA 1PGOA 1R6DA 1UAYA 3LU1A 2DLDA 4RO0A 1D4FA 3RC7A 4TSKA 1N9GB 4IGEA 4J0EA 4OQZA 1C1XB 5EQDA 2HO5A 1DHTA 3PHHA 4ZJUA 3MJTA 3HB4X 4CR7A 2AEMA 4PVCA 1LDGA 4IIVA 3W4KA 3CTMA 1P77A 2JAHA 4PVDA 2HKIA 3UICA 5TGDA 2G82A 3IL2A 3I9LA 3LDHA 5ENDA 2AMFA 3IOYA 3EHEA 1P1KA 2H63A 2JHGA 4J4BA 2BI8A 3PQFA 3QVTA 1LU9A 2GCGA 3H5RA 4Z9FA 4B7XA 4IZIA 5JCXA 4RPHA 5THQA 1YB5A 5I9MA 3S2EA 4QXMA 4ESOA 5JC1A 4R1NA 2OORA 5DP1A 1J49A 1GFSA 1ADBA 4NR0A 2X7HA 1SOVA 1E7YA 1Y8RB 1ISMA 4KWIA 3F5QA 5U9CA 3ZWWA 1P74A 2POQX 2P68A 2QIOA 3ZZNA 3R3JA 3ZHYA 1HDZA 2I76A 1ZCJA 3CUKA 4BOYA 2AE2A 4KUEA 1JN0A 3KSZO 1BMDA 1KBZA 4B4VA 5IN4A 3MJSA 4LMRA 3C1OA 3P7MA 1YJQA 2VYNA 1L7EA 1N1GA 2BRUA 2UUPA 3PJDA 3Q0EA 3CH6A 2E49A 3IJRA 2VOJA 3DFUA 3H5NA 2JL1A 2VNSA 4E6PA 4LK3A 5JYDA 1EMDA 1Q0LA 4RJTA 3WS7A 5L45A 3FN4A 1I2BA 3FNEA 1Y8QB 4WLFA 4DC0A 4AJ4A 4CMEA 4WEOA 3I3OA 3BTOA 4Q3AA 2PKQP 1SNYA 3NAQA 2OP1A 4R9RA 4TROA 4WEQA 2Y93A 1E1NA 4NH4A 2V6GA 4RDIA 5I9NA 4J4HA 3G49A 4AJIA 3AY6A 1PL6A 4J49A 5AVOA 1KEWA 4BGIA 3GMSA 1DDOA 2J5KA 5AXAA 3P19A 4YRDA 3ZV6A 2P9EA 3OQBA 4E21A 3WLEA 4O63O 4JJIA 4Z9YA 5IZCC 4R1UA 2QX7A 4RVFA 3R0IA 5HS6A 1WMAA 1ONNA 1ZVMA 4YPOA 3HN2A 3PFFA 4LGVA 2DBQA 4YT4A 3PJGA 2NU9A 3FWNA 4LCEA 1PWZA 4XIYA 3DAPA 4B3JA 4L4XA 3AW9A 3GEDA 5HTOA 3E1KA 4BGUA 4CPDA 4XQGA 3JQFC 2NSDA 5HRUA 1E6UA 3KBOA 3JV7A 3ZWPA 5A1TA 5A4DA 2Q1UA 4WOJA 4BKOA 4HKTA 4PG5A 3ICPA 3NX4A 4ROSA 1HLPA 1WZIA 2HMTA 3HWRA 4D46A 3IJPA 5H83A 2PY6A 2DBRA 4MP3A 2NWQA 4FD3A 3U09A 1KYQA 3PHIA 1SEVA 2EW2A 4YEDA 3KM0A 1H93A 2IE0A 3OQ6A 3RUAA 1E6WA 4JBIA 1JKFA 4II2A 3L9WA 3OFSA 3LZ6A 1U3VA 1H2HA 1T2DA 1MG0A 1Z7EA 1W0CA 2F00A 2X9VA 3KEQA 3ULKA 1CRWG 2VTEA 5DBIA 5H82A 2BLLA 4H16A 3R6DA 3DHEA 3U0BA 1JVSA 4HFRA 2VHXA 2X22A 4JXKA 4K1LA 1B26A 3GGOA 4MKZA 2EP7A 3ICCA 1LRKA 4FGSA 3QW2A 4JBHA 2QG4A 5LC1A 4OMUA 3ZH2A 5K0ZA 3JQCA 4BO4A 1NPYA 4XGNA 3ZHZA 3NT2A 4XZ3A 1YVEI 3G79A 1M6WA 2ILTA 4LISA 2CNBA 1P0CA 2AEJA 5BR7A 1XIVA 3LSYA 5JAMA 3C8MA 5T5QA 3WICA 4I9HA 1KY5A 3HHPA 4Y67A 5CDGA 3X2FA 2EF1A 2HJSA 4CUZA 4NIMA 5JXWA 3TZCA 5KJCA 4LSMA 3DR3A 3PYMA 4HADA 4N5NA 1WDKA 3L6DA 1PS9A 5CAEA 4YTEA 2G17A 3INTA 1OAAA 3IUSA 4PIVA 4E5MA 2X5JO 4Q3CA 4A26A 4MVJA 2Y1OA 3ZDFA 5IAAA 1YQGA 2A4KA 4K9DA 3NYWA 3PI7A 3H6KA 3H9EO 1TT5B 4GH5A 3F4BA 4IQ0A 1LLQA 5G4LA 4TVBA 1I5RA 1NM5A 1I01A 1CETA 2DKNA 1PEDA 3PPIA 3FNFA 3INGA 3C3XA 1LX6A 5FEUA 8LDHA 2C20A 1YL6A 2NLOA 4Q3DA 5JE8A 5U4QA 2VQ3A 4GVXA 4BVAA 2G76A 1I0ZA 5I8WA 4LVCA 1Y5RA 4JP2A 3WQSB 2J8ZA 2VZ9A 4B3IA 3GGGA 4ALJA 3E9NA 3JTMA 2O3RA 3TL2A 1XQ6A 4MIYA 3KB6A 2I6TA 2WTBA 4GLLA 3V5NA 1E92A 4RVGA 3I4FA 4BKUA 3GPDG 3GVCA 3G1TA 2F1KA 3CEAA 1SB9A 3TZHA 4UEKA 3JYQA 3FNHA 2Q2VA 4XRRA 2R2GA 3VPFA 3RC9A 4RLSA 1GV1A 1M75A 1NHGA 2HUNA 5BSGA 4Y98A 1DLJA 2TMDA 4U6QA 2BKAA 3DONA 1U3UA 2CD9A 1NFRA 5KTKA 2VYVD 4MO2A 3U4HA 1E7QA 1WVGA 3IUPA 4J9VA 1B2LA 4NMHA 3ZV5A 3GRKA 3SEFA 4W9NA 2W2KA 1SO8A 4Q39A 3Q9UA 4DTIA 4BIIA 2YV3A 1UAGA 1CDOA 2OXIA 1N7GA 2OBNA 3JQBA 5EERA 1X15A 3UCFA 3KZVA 4KZPA 4LRSB 3DMTC 3ZWYA 1NFQA 1J0XO 1E7MA 4BNZA 3GAZA 5A03A 4J0FA 5JNLA 4N7RA 4PLGA 4J6FA 1K6XA 4RGBA 1YDWA 1RWBA 3K30A 1KC1A 4FSHA 5BT9A 4WCFB 5J23A 3N58A 4P4LA 3OJEA 3SVTA 1HTBA 1U28A 2EJWA 4Z3DA 3D3WA 4AJLA 4YT2A 5CDUA 1PJBA 3H9QA 5K6AA 2D5AA 2B4TO 3RCBA 4BO0A 4LVUA 2PGLA 5TX7A 1U2DA 4UVGA 2Z1MA 2P4QA 2W90A 3D5QA 1LA2A 4BL5A 1TA4A 1ML3A 2IDZA 3HZZA 2CDCA 4YXFA 4RPJA 2VHZA 1E3EA 5KVVA 3UHAA 5ICMA 5BNTA 4OM8A 1ZSVA 2O3QA 2ZATA 3WTBA 4DBZA 1B16A 2C29D 3WSVA 1PR3A 1P1FA 2YW9A 4R4JA 4RVHA 4KQXA 5L40A 2O7SA 4PLTA 2XXBA 4D42A 3M2PA 3VZQA 5B37A 4ALLA 1TLTA 5ICSA 3L0DA 1KVRA 4R01A 1LRJA 4BGVA 1LNQA 2IZ1A 2VWHA 3PIIA 4RVSA 4HWKA 3KO8A 3RUIA 1QORA 4B4UA 2IYOA 1QMGA 2PWZA 3RU7A 1O94A 3N7UA 3AFMA 4MP8A 5IZ4A 5JYFA 4I5FA 2C5EA 3WMXA 2YQ4A 4OO3A 1PQWA 1F17A 4IDEA 4ZQHA 5EQFA 2ZJ0A 3EYWA 4UREA 4ND1A 2C82A 4F45A 4NU6A 4YJHA 3WIDA 3ZU5A 3O03A 3TPCA 2EW8A 3GLQA 1VSVA 4EUHA 1Z74A 4ZGWA 4CL8A 2XF8A 3HUDA 4B3HA 5LDGA 5IXSA 2BGKA 5A04A 2HRBA 1K6JA 4FN4A 1D3AA 3NEPX 4HNHA 4AJOA 3FBGA 1A71A 3MWEB 4OGWA 4FB5A 3C1TA 4B8ZA 1KERA 4J91A 3K96A 2FN7A 1HSZA 3E48A 4MVJP 2GZ3A 2JCXA 2XPCA 4CM9A 4CQMD 2VYND 3EDMA 1L1FA 1YL5A 3OA0A 4YACA 3QVOA 1V3UA 3W6ZA 5ITWA 2W2KB 1ZMOA 3PJEA 4BO1A 1ULSA 2P91A 4YBZA 4ALNA 3PLNA 4OSPA 1LSJA 3UFXA 1FJHA 4OAQA 1XA0A 1E77A 4BNXA 3AM4A 2VCYA 3RJ9A 3SBOA 2J3JA 1Q0HA 3OSUA 4MINA 2YY7A 1QYVA 1ZNQO 3Q2KA 3HE3A 4R1SA 2X58A 4TKLA 4L9RA 3DOOA 2HMWA 4HP8A 3C7DB 3A14A 1KVTA 3EY4A 4J16A 1QLJA 4RVDA 5CEEA 3ABIA 1KEUA 1PS8A 3WXBA 4QO8A 1KVUA 5CG2A 4ONEA 3H9GA 2JCYA 4O0LA 4CMCA 5KVSA 1E1MA 3O26A 4PLWA 1TXGA 1JDJA 4QECA 4W99A 4HXYA 4GX5A 2CZCA 1P33A 1DFHA 4Q9NA 2CUKA 5U1PA 3M6IA 5CDYA 2BD0A 3OIFA 5JS6A 1VJTA 4RPKA 4ZRNA 1B8VA 3U4IA 2XXJA 3DTYA 1LDEA 2OO5A 3GUCA 4TRJA 2HCTA 3AM5A 3PXXA 3FI9A 3WGYA 4A03A 4A7PA 1E3SA 3L6OO 4AG3A 1HDRA 2HLPA 3CMCO 3E9QA 3NDJA 2EWMA 2D0IA 3OIDA 2B35A 4MP6A 2Q50A 3TRIA 5DF1A 3G3EA 1CQIA 1PJSA 3JD3A 4M89A 4XGKA 3AY3A 3DBRA 5KKCA 2BFMA 2JAPA 4IMRA 3WGHA 1QYXA 2YHUA 3D4PA 4J1SA 3RC2A 3PQEA 4BQPA 4TWRA 3Q3CA 4WUVA 4DIBA 4EYEA 1HDCA 3QWBA 1O5IA 3GVXA 1C3VA 1LDBA 1NYTA 4DL9A 2VTDA 2WJPA 2D3TA 5KOIA 2X9GA 2X0NA 3ZWBA 4RZHA 1EBUA 2V6BA 2QRKA 4YJHB 2B69A 4YRBA 3PVZA 4ZA2A 5MGBA 5FYDA 3K92A 4E4YA 1PJLA 3C7AA 4EUEA 3RFTA 1T25A 2WD7A 3L6EA 3DOCA 4QTZA 3JYNA 1R0KA 4DYVA 1D1SA 3H65A 1RPNA 2EKQA 4KTVE 3JQ9C 1EVIA 1GCOA 3FD8A 2PD6A 3H2ZA 4IDBA 3G1UA 1VKNA 4MVJM 4R3NA 5JCJA 3WYBA 2J6IA 4Z0TA 4D43A 1KY4A 1M67A 1ZMTA 3TZKA 1PJQA 4NNJA 3W4IA 1HDOA 1B15A 2Q2QA 2YJZA 4I5EA 2Q99A 1PQUA 2EP5A 1B3RA 3VZPA 2QZ9A 3I9MA 4UUNA 3RWBA 3RASA 4B4WA 3MTGA 4XDZA 4N5MA 3H3JA 5A5EA 4ZQFA 3W4JA 1GAEO 3OMLA 3O38A 2EXXA 1FDSA 3OICA 4WASA 2WDZA 4WECA 3X2EA 2PZLA 4XQEA 4OXYA 4MVJD 3OECA 3ZWCA 3GG2A 3GY0A 3OP4A 1I2ZA 1GY8A 3DZJA 4J1TA 4BV8A 3U3XA 4QUKA 4D0SA 1PGQA 4ITUA 4EGFA 2FSSA 3I52A 4XJSA 2Q1WA 3ZU4A 3RKRA 4JJGA 1IZ9A 4RZIA 5JYEA 3DBHA 1CYDA 3NGLA 2NTJA 1OBFO 4WJZA 1KEPA 2VNAA 2H1SA 3GVIA 4GKVA 4E5YA 5KJ1A 1EVZA 3WOHA 5DCWA 5G4KB 3DO5A 5A06A 4GWGA 2X86A 4BMNA 2VUSA 1JA9A 3AI3A 4AJ2A 1W6UA 3JD1A 3VZRA 4QO7A 4ZN6A 4DLLA 4BO8A 4ZICA 3AUTA 3I5MA 1P1JA 4A0SA 2VYVA 5BSEA 1DHRA 1HE5A 1ZK0A 1PL8A 5KKAA 1OZAA 4CM4A 4LCJA 4BNWA 1YRLA 2NQ8A 4I9UA 3H5AA 3MTJA 4QSMA 3HJAA 3DOJA 3DBRB 3WLFA 2NVWA 3BTSA 1U8XX 3KYCA 1RYDA 3T7EA 2D8AA 4IJUA 4M8SA 5L7WA 4EEXA 1R16A 3IMFA 1GPJA 1O89A 1ZKMA 1XQ1A 3GNQA 3I83A 3QJ5A 1MB4A 3BMNA 3BZUA 1UJMA 5A3JA 1SC6A 4E33A 4WOKA 4NHEA 1M2WA 3NDIA 3ENKA 1VLLA 5T64A 3NTOA 3BMOA 1A72A 4UUOA 3GN2A 1WP4A 3ZWNA 3DZGA 1NAIA 3D1LA 3PQDA 1GYRA 2HMSA 3OEYA 3EUWA 1GQYA 4BKRA 4WPGA 5JDCA 2Z95A 3E82A 2HMVA 5F3RA 1BHSA 3UOGA 3TOZA 2FR0A 3UKOA 1WNTA 1DFIA 4Z3KA 1Z7BA 3LC2O 1MG5A 5IG2A 4NBUA 1IHXA 5AOVA 4YQZA 4J7UA 3IS3A 1EQUA 3TJRA 3JYPA 4PG6A 1BTOA 3CE6A 3HG7A 1W4ZA 3RROA 5AXBA 1RM4A 1ZSNA 1A7KA 1B8UA 5AYVA 1F0YA 3KEOA 1MLDA 4R1TA 5JMPA 4PRKA 1WPQA 5TJ9A 1EUDA 2PV7A 3BHIA 4CM8A 3CZRA 1PWXA 2P9GA 2Y68A 3IKTA 4CMAA 1U3TA 4FOOA 1OOEA 4HNGA 4B8WA 1XYGA 5C7IO 5CPBA 4DXHA 3W8DA 1MC5A 1EFLA 2HRZA 1N92A 5JAIA 1TI7A 4E2ZA 1LEHA 2Q49A 1I8TA 1ZJZA 1EK6A 1U7HA 1YONA 1BW9A 2XAAA 1E1KA 5DOZA 2FR1A 3F47A 3ZHBA 4DPLA 3G17A 3HNPA 3GH3A 4CMHA 1DC6A 1FDTA 2PR2A 3DZKA 4OXNA 4J9UE 4XKJA 2E37A 1JAXA 3AUUA 3DBHB 4AJEA 4CV3A 4OSOA 1UXIA 1U4SA 3ASVA 1EZ4A 3PGJA 3SJ7A 3E6AA 1LLUA 1T2CA 2GPTA 1E7SA 3PYXA 1ENZA 3VAZA 2NNLD 3D64A 5EJ2A 3RUHA 4BS9A 4MJLA 1VI2A 1YQDA 5ER6A 4AL4A 4DQVA 4KDEA 1T4DA 3DDNA 1JW9B 4FJ1A 4I9NA 4LW8A 2GN8A 4Q3NA 2Y1GA 4MDHA 3QA9A 4RF4A 1T26A 2NTNA 1SEPA 1K89A 4WNIA 1E5QA 2HK7A 3OJOA 4IINA 1V0JA 4CQMA 4CM4B 5HWSA 2DUWA 3DMYA 3JCZA 5BNIA 1HZJA 5KJEA 3RC1A 4MIEA 3PWKA 2DTEA 2D1YA 1RYEA 2Y66A 3DL2A 1TVEA 1MXFA 1ONOA 2FPPA 4ZQBA 1OC4A 1LSOA 1XG5A 3KYCB 4WGGA 4D3DA 1YKFA 1ZJYA 4DPKA 1D7OA 1Y9AA 4CV2A 1HKUA 4CM9D 4WLVA 4CLDA 4FFPA 1V3VA 2G1UA 2X8LA 1ENYA 3BMNB 4J2OA 2VRBA 3H2SA 3PGXA 1H6AA 1K5HA 4BNLA 4L0QA 4MKRA 4PZEA 2Y67A 3S55A 4MVJH 3BMOB 3MZ0A 3GZ4A 4NZ9A 1TT5A 1X7GA 3B70A 3OH8A 4URFA 4OOFA 3B6ZA 4A10A 2OGUA 4G81A 2UVDA 1Z6ZA 2BI7A 1P9LA 1A4UA 7ADHA 5C7OO 4GSLA 1DAPA 1BDMA 3PHGA 4FIZA 3ONFA 4YQYA 3WGZA 1YB4A 6LDHA 2PLAA 3B1KA 3GZNA 4DIOA 1I33A 1XWFA 4EITA 3TN7A 1B8PA 3HFGA 4B7UA 4Z9XA 4C7JA 4DRYA 5CDTA 3I9JA 5COAA 3M1LA 5JBIA 5F5NA 5IDXA 4HUJA 4CM1A 3GDGA 2I65A 4XEHA 1HDGO 3ZNOA 4DIFA 3FPLA 1EUZA 3GGPA 3AUAA 3GPIA 3P5SA 1YXMA 2C54A 1T2EA 4N18A 3WGQA 2PGJA 1EQ2A 5EN4A 4D0RA 2D2IA 4CM8B 1PR9A 2Y1EA 4DA9A 2X4GA 1LBEA 2EIHA 1VKOA 2AW5A 1HE4A 4Y6RA 5EIOA 5L53A 2Q4EA 3ZV3A 3U49A 2UAGA 4YT8A 5TNXA 4BMSA 3VH2A 2EGHA 4PG7A 1K2WA 1IL0A 1O0SA 1SOWA 1ZEMA 2EJVA 5CFZA 4CUKA 4YJFB 5KNLA 1BW9B 2PGDA 2D5CA 1Z82A 2V6FA 5TS3A 1KVSA 4W7HA 4CMJA 1ULUA 3NTQA 5G0SA 2ZQYA 4BNNA 1B7GO 2GERA 1GTMA 5JMWA 1LDNA 4DUPA 2YFHA 1CJCA 1R0LA 2Y1CA 1SAYA 4MIOA 1X7HA 1C14A 3NT4A 3W1VA 1QYWA 4TQGA 3W8FA 4XYBA 1K3TA 1N5DA 5I7FA 1KC3A 2QHXA 4ZVVA 4WCFA 1RKXA 2WSBA 2IXBA 4YA6A 4IZHA 5JDIC 1NAHA 1R4MA 1VM6A 5JY6A 1NWCA 1HSOA 5BNFA 4UVEA 2GGSA 3NUGA 1U1IA 4KP7A 2TMGA 1Y6JA 2H9IA 5T6BA 4MKXA 3A1NA 1QXSA 2X0RA 1LSSA 3JD4A 1U7TA 8ADHA 1ENPA 1CQJA 1XKQA 1GYQA 1RM5A 4DPMA 1WDMA 3MJ4A 4CQMB 1LLDA 1GUYA 1E3WA 4BB5A 1DIGA 2GASA 4NK4A 4W4TA 2HJRA 4QT0A 1D8AA 3JQFA 1KVQA 1I2CA 5DDIP 2GR9A 5JCJD 2YFQA 2LDXA 4FFOA 3D7LA 2JCVA 1DC4A 2I67A 1JAYA 4N54A 1HYHA 3WWYA 3ITDA 3OIGA 3WNQA 4IGFA 3WWZA 3GR6A 4OQYA 3VH4A 4B7CA 4U7WA 5ES3A 5KVQA 3LLVA 1WLYA 4F6LA 4A5OA 4RL6A 3SX2A 3KV3O 4O5OA 4II3A 3WR5A 2Q46A 4UEJA 1ZIDA 3OEWA 3PEFA 1YB1A 4DMMA 1R12A 5J9GA 3ITKA 3PRJA 1C0IA 3IDSA 3DWFA 4IJKA 3WBBA 5IDWA 3GZNB 1ZUD1 3Q11A 1XCBA 3GDOA 3CXRA 2Q22A 1PGPA 4FCCA 1PZGA 4GAEA 4ZRMA 1VSUA 1P0FA 4M54A 5AXCA 3RBXA 5HBRA 1CERA 2FZEA 4PLFA 3LC7O 1U3WA 5B12A 3PWZA 2DUUA 2IODA 1KIFA 2BFAA 5F21A 4GMFA 5B1YA 4WKGA 2PK3A 3WFJA 3TFQA 2VHYA 3NGXA 4GLOA 1B14A 4GGPA 1LDYA 4J7XA 4YAEA 3ZN2A 2FPIA 1DC3A 1P45A 2ET6A 1NBOA 3KTDA 5H81A 4F46A 4NBRA 4XQ9A 2CVQA 1H9AA 3VTZA 2O3TA 1EBFA 2RH4A 3I9KA 3JQAA 1F06A 3GEGA 1PJ4A 4E31A 3SJUA 1D1TA 3KXDA 2IXAA 3PDUA 1ZFNA 4GX0A 3TQHA 2GN4A 1N8KA 1YBMA 3BTVA 3B20A 3KOUA 2O50A 4CMIB 1UXHA 4CM5A 4QFCA 3RI3A 3K8ZA 2GNAA 4QFDA 3GC6A 3EW7A 4X54A 4ZQGA 2WWRA 1UZMA 5BQFA 2NQTA 4YJDA 2SCUA 3FHLA 3Q1LA 1ZSYA 1R4MB 3HSKA 1MGOA 1GL3A 1IHYA 3ENNA 4WE3A 1G1AA 4L73A 5L4SA 4YCAA 5COQA 5C7LO 1DAOA 2IRWA 3MJEA 1Q1NA 1Y7TA 4WLOA 4DBVO 3DFZA 3E5MA 2NM0A 1BG6A 1E3IA 3WG9A 4OOEA 4MPDA 2JKVA 3AU8A 2OBYA 3F1LA 1T4BA 1IUKA 3EMKA 2Q3EA 4J1QA 2OUIA 5JO9A 1E3WB 3S1LA 4XYMA 1P1HA 4PG4A 1C0LA 1QRRA 4OH1A 3I4CA 1XU9A 2FR8A 3U4DA 4UVDA 3SC6A 3AM3A 3FR8A 1Y81A 2C7GA 4EZBA 2NU6A 2OOSA 4OHUA 5DZSA 2GLXA 4H3VA 2E82A 4CL3A 3HDYA 4RLHA 1C1DA 3PZRA 2C7VA 2BGMA 1TEHA 1UDCA 4PLYA 5EINA 3GDFA 1VL6A 3DZBA 4PZDA 2IEBA 5AXDA 4YAKA 1VJ0A 3UAGA 3VC7A 2JD2A 4G2NA 3SLKA 4BNKA 1PX0A 2P5UA 1R37A 2E48A 3HFSA 5T8KC 2ZCUA 1HRDA 3SXPA 4PLHA 1MV8A 2J3KA 4JP3A 3ZW9A 3PDJA 3DMTA 1IULA 3ASUA 2J5QA 3OETA 4ND3A 1XR3A 1XDWA 2VWGA 3C1AA 1T1SA 3AWDA 4MVJG 4Q3EA 1G0OA 4NJMA 3UXYA 2BF7A 4NBWA 5EL0A 1NR7A 5I7VA 1JWBB 2NU7A 4BNGA 1NWHA 2FMUA 1LJ8A 3V1TC 2YZ7A 5BSHA 1HEUA 1GQQA 4J3FA 2X0IA 1DIRA 4NPCA 4F3YA 1DLIA 4IS2A 5CEJA 3DXFA 2Y0EA 4AJPA 4L76A 2E6UX 2Y0DA 2CSUA 3TF5A 1UXKA 2NV6A 3EGOA 1ZK3A 3JQAB 5GZ1A 3AJRA 3BHJA 4I1IA 2H6EA 4LSWA 4IDAA 2HSDA 1YWGO 3BMQA 2Z5LA 3C85A 4FOSA 2VWPA 4ND2A 2BFOA 2YQ5A 3D4OA 3A4VA 4U6SA 1GD1O 3DHYA 4CR6A 1LC0A 1MFPA 2QZZA 3BYZA 4YWJA 4BQRA 4IQGA 1SMKA 1GDHA 5CG1A 3ZCXA 5F1OA 4OYRA 4JCOA 4JNKA 4BNMA 2I5PO 4UAGA 5C5IA 1H2BA 4D3SA 4QX6A 3ZNQA 4P22A 1ZEJA 1MA0A 1HZZA 3GFBA 1GUFA 3ZWMA 4QEDA 3DHNA 1CWUA 2O3UA 2IZZA 1DEHA 1R66A 2ZYDA 1BRMA 4CV0A 2NVUA 3G0OA 1E7WA 1DRVA 1LI4A 1QYCA 1UR5A 4FFMA 4NI5A 3A9WA 3FR7A 4BO2A 2PA3A 4FJ2A 1UH5A 3K31A 3LQFA 4RQUA 4TZTA 5G4KA 3VHRA 3ANLA 4M55A 1V8BA 3ZNNA 2AA3A 2QYTA 1E6EA 2V6MA 5TC4A 2PZJA 4M86A 5A05A 1JVBA 3KSDO 1JKJA 1P3DA 4G5HA 3LVFO 3ADOA 5I7SA 3TNLA 2VZ8A 1C1DB 5FI3A 1R15A 2IYPA 2ZK7A 3KLMX 4R3WA 1U8FO 1F8FA 4E12A 4Z6KA 4OXKA 1HDYA 2B0JA 4Y9DA 4HFJA 4KWHA 3E9MA 2P4HX 1E7RA 3GMDA 1N7HA 4PFJA 5G0TA 2B83A 1PGJA 3WTCA 1HT0A 5DCYA 2B5WA 2B4RO 1GEEA 4PLZA 3DBLA 4A2CA 1ISGA 3TDKA 4GWKA 1PJCA 1W73A 1NQ5A 5KJ6A 1LC3A 3QWHA 2GYYA 4M1QA 2EV9A 3ONEA 5HA5A 4D45A 4UUMA 2GRAA 2ZKLA 1U5AA 1NQAO 1G0NA 3BXXA 3PZBA 2PFGA 2PH3A 4NJMB 4ZD6A 3ZWVA 4ALMA 3TZ6A 1IE3A 2B5VA 5DNAA 5IDYA 3LT0A 2ZJ1A 5CPFA 5I8ZA 4XDYA 2AQKA 2WEKA 5B4VA 1A9YA 3RVDA 3WQQA 1JU9A 5IFLA 3CMMA 4BUCA 3CINA 3FTNA 2NACA 2Z1NA 4DQUA 2UUOA 1ID1A 1ARZA 2RCYA 3RIHA 4PGFA 4TMFA 3ONDA 4BMVA 5IN5A 3KSUA 1AUPA 4L75A 2AQIA 4TRRA 3KVOA 2PKQO 4KTTE 3RQSA 1E1LA 2D4AA 1ZXLA 3WGGA 3VPHA 2DFVA 1Y5MA 3F1KA 3BMQB 3QP9A 3B1FA 4OKNA 5LDHA 2O4CA 1DIBA 3F6YA 3H8VA 3H4VA 3KLPX 1DB3A 3GT0A 4OL9A 2WE7A 5JAZA 1GADO 4Z0HO 3ROPA 3VPXA 3RUEA 5I9LA 1WAMA 2AXQA 5THKA 4KMSA 3U5TA 2FOIA 3OM9A 3ORFA 4TRNA 1DSSG 3V1UA 4E32A 1BXKA 3KUXA 3QWFA 1F8GA 5T73A 1R0SA 4XWYA 3C24A 3PP8A 1O8CA 4FC6A 1Q2XA 1ZXBA 4HY3A 2NVUB 5ILOA 1FXSA 2R00A 3QSGA 1ISHA 4U8GA 5DBGA 3AOEA 4GPD1 2B37A 1AGNA 1C0PA 3E8XA 1BDBA 1BWSA 4NK5A 4DLAA 4IIUA 1IPFA 3L4BC 2AG8A 3VOSA 3UCXA 1HF3A 5M6DA 3ETGA 3OJFA 2CF6A 4IDGA 3RUDA 2I3GA 3AU9A 1P44A 3CZMA 5JDCC 3S8MA 3VKUA 3ZI0A 3GF4A 3H7AA 5JFOA 4DLBA 2FWMX 3JQ9A 3GQVA 2J5RA 4BKPA 5F5LA 2ZB8A 5L9AA 2O2YA 3UH1A 3ZU3A 2RHRA 2IEDA 3ANMA 4BNFA 4NU5A 4UULA 2OP0A 1PZEA 1EDZA 3EZLA 2W98A 1GZ3A 5KCZA 2BMAA 1Q7BA 3DBLB 3RD5A 2C0CA 3JQAD 1GEGA 5CHEA 1SPXA
chains in the Genus database with same CATH superfamily
3QM1A 2IL1A 4ID9A 4MYUA 3QPVA 1NIJA 4EA8A 1ZGBA 4U5QA 3BDVA 4BNDB 2H8KA 4YCLA 5LOVA 3ROFA 2DBVO 4Y9TA 4BO5A 2Y99A 4NFSA 4U0KA 1MENA 1RCFA 4CDGA 3PIDA 4EL5A 3O4RA 1KZ6A 2BGIA 3KJQA 3RV4A 4ZT6A 3TZQA 4HFNA 2PUCA 4JAVC 1HYEA 3EWIA 4C06A 2EHDA 3EVAA 5EZYF 5C1PA 4W63A 5J3JA 3N8NA 1QUEA 2EAUA 2BSQA 2AK3A 2HADA 4WOBA 2DHCA 5E6RB 3C0KA 1U0GA 3KDSE 4B79A 5LKRA 4FK8A 4LYDA 4UZFA 4WXMA 3QEOA 3N8HA 2OHOA 3ABZA 2CXRA 3ZIUA 5AMXA 5KTYA 1GGEA 3D3EA 4NCHA 5DGTA 5KEIA 2VPTA 4D0GA 1AS3A 3SC4A 4OJNA 1UOQA 2CNWD 3U3DA 4JQZA 2IELA 3NVMB 1ZISA 5AI8A 3VX4A 4I5DA 3MHTA 3LXRA 3AETA 2IH5A 1UKAA 2AT1A 1SU4A 4BO6A 2JNWA 2L17A 1BQ3A 2ZXFA 1JG1A 3SIPA 4L08A 4BMZA 2PT9A 4BEBA 5TLSA 4A0GA 3A1CA 1ZD4A 1RYZA 1F20A 2YUTA 3A06A 5A5DA 1H4QA 3F6RA 1UT8A 1KZ1A 1ID8A 1P4AA 5LYYA 3PVSA 4QGSA 5C53B 1AMOA 4M1EA 4PGGA 3OZSA 3RS4A 2BDEA 2OCPA 1KDTA 3VVCA 1QP4A 1BD4A 4UTXA 3ZHUA 5IF3A 1R10A 5GJBA 2PXAA 3B12A 4XWTA 4WFKA 3HBFA 4CMEC 3VNSA 1ZHFA 5A9SA 3RK1A 2WYVA 2X3UA 2QVXX 4MUXA 4LTNA 4URWR 3HLKA 2YOHA 5HF5A 6REQB 4BO3A 3D6TB 4LFAB 2P2NA 2O2SA 4MQUA 4JZYA 2R25B 4GL4A 3GGDA 3JWIA 4TXMA 2KHZA 4TMWA 2XX3A 2W70A 3U62A 4KXMA 4KAFA 2IYSA 2JGRA 3TCXB 4ID3A 1V5GA 1GGMA 4IDHA 1C4XA 3PNQA 3TQCA 3D0QA 4KXNA 2FEWB 2L42A 4PCAA 3T06B 1UM9A 2XBLA 5DM2A 3EZGA 3LFTA 4GC9A 4UM9B 1XN1A 3F46A 5JISA 3ANNA 1ONPA 1W2HA 1A8QA 3H2JA 4R1OA 3QLJA 1QV9A 1WSBA 2HGZA 4N9WA 1IBMB 2PGIA 1D6NA 4G86A 4ZAWA 3QVWA 2VT2A 2UXCB 2VOEA 2WA1A 2GUGA 2PUHA 1NN0A 2FP4A 1XLWA 2EDCA 4R5MA 3G8YA 4P5PA 5EIBC 2V8OA 2YIDA 4NZNA 5AKXA 3H99A 2P6PA 5SY4A 1U9IA 4R9SA 1TZJA 2QUHA 4PLVA 1CR6A 1RP1A 3RSFA 2ZYIA 2I91A 3R7BA 1TX4B 1EFDN 3GCZA 4FN5A 2VHUA 3ABRB 4OA8A 5D1NA 4BVGA 5M29A 3I1IA 4A1OA 2PJRA 4UEOA 4GRAA 4I2VA 4A91A 5T4BA 3P9CA 4IYJA 1KSJA 4NAVA 4PAWA 5MN4A 4TZKA 4R98A 1CR1A 1W35A 5IAGA 5IWCA 1IN4A 4YJ2F 3TLYA 1N3LA 1A1SA 3WP0A 4YYZA 5J47A 4Z0PA 3AHDA 5HTKA 5LQDA 1GPLA 5FB3A 3ZDDA 3LGXA 1PR6A 5FV4A 3B2EA 3ZK9A 4NCAA 2X6TA 3KK0A 5AJHA 4RF5A 5J5VA 5GOTA 3NT5A 2DWUA 4C0QC 1AKMA 1F3OA 3EAGA 1DJQA 1MW8X 1R00A 3A1TA 5EP1A 2AR7A 2OM6A 3LIPA 3AKEA 5K8IA 1RCTE 4XXHA 2VQFB 5JD4A 2H5LA 4FZ5A 2YBEA 4QUIA 4ZVRA 2J3QA 3WLJA 1YFJA 1Z35A 4BTVA 5EESA 4JC4A 2WT8A 1SKQA 2FFQA 1FIUA 4TRMA 3C43A 4L95C 1KI8A 4YVFA 2RHCA 5EJIA 4EKGA 3P2KA 3QOWA 5TIIA 5C51B 5BPFA 3Q9NA 2GZ1A 2YY5A 4FYVA 4ADSG 1Q0UA 1I7LA 4DOMA 3PXUA 1HNZB 1IQPA 1UBRS 4TTIA 3RYTC 3BAZA 2QS9A 3UWPA 4GMHA 2F3PA 4ZJPA 3FGZA 1U63A 1YIAA 3G0DA 4ND8B 5EE1A 1QSGA 1U7OA 2QRJA 3KYDB 2QTTA 3FYSA 1B4DA 2Q8PA 1XAIA 4LBZA 4X8OA 2WOJA 2W6JA 3DF7A 4OGKA 3JRWA 1FYXA 1Z5ZA 3I3SR 3H42B 4LWOA 1V35A 1XYVA 1Z5GA 1F5NA 4FHGA 2JATA 5DNVA 3FSRA 3OKCA 1T91A 2GCOA 4HH0A 4HX5A 1Q0QA 3WDSA 3JAMA 1M5UA 2Z5FA 4TVOA 1LRLA 3BMCB 4FNMA 3RGWS 2HLHA 4RPLA 2ECQA 4YCBA 1P18A 1JL3A 1YCGA 2QTFA 5ILQA 2PSJA 2YHIB 1XVUA 4L9WA 1RCUA 3M9WA 2FV8A 4NOLA 4Q1AA 1FPMA 1S2MA 1IIBA 1T1RA 2O8NA 1D0IA 1KAHA 4RL4A 3AO0B 3KEGA 3RF7A 1C81A 1CNFA 1V5EA 4IIJA 2XLCA 3HU1A 4PANA 1C7ZA 1SK8A 2OZVA 4KQFA 4CFZA 3GFRA 4CMIA 1I13A 3SZUA 5FIUA 2P9TA 5I7WA 2ZIEA 4BTLA 3PYLA 2QRVB 2C2YA 1BA2A 3ACDA 3AC0A 1Y1PA 3F6EX 4G23A 4MUFA 5DXJA 3B9PA 3TCNA 8OHMA 2VZLA 2I2DA 1XXLA 1I7BB 2XUPA 1SOAA 4Q21A 1ISRA 1W8DA 1X2EA 4ESHA 5JZOA 1XMVA 4OEHA 4IV5A 5CCBA 1AY0A 1NM5C 2ODAA 2WF8A 4IXTA 2YDYA 3WNBA 1JBKA 2WKSA 2I4TA 3WBJA 3KOWA 2VCEA 1KS9A 5JTTA 2JS7A 1QOPB 3ST7A 3BORA 1EFKA 2QMQA 4EIWA 3IAHA 3UYLA 4Z4HA 1XJCA 1X7XA 3FMIA 3A2LA 4WBNB 3DQZA 1W0JD 4JQOA 3CNLA 1S6YA 4ZAFA 4ZODA 1TJ4A 2BAGA 2NU8B 3SE0A 4DUGD 4EDFA 2ID8A 2QVLA 1W25A 2QTMA 2D06A 4IKEA 1KFBB 2NYVA 3N2NA 3DB1A 1AD2A 4LIPD 2R44A 5BWNA 2H7VA 2BEUB 2OTCA 1SCUA 3CKYA 1ML4A 1AE1A 1VLVA 1Z5WA 3HJHA 1UXGA 4YRPA 4XVRA 3W79A 3WKDA 1L5LA 2FN9A 4ATNA 4KPYA 2JC3A 4KRYA 3M6AA 4NECA 3UN1A 3A6ZA 1GZVA 4CR8A 2Q1SA 2JGFA 1TVKA 4XA8A 1UDAA 4RVNA 2X9LA 4DIMA 5I47A 3KSBC 3FJOA 3ADPA 5C52B 3WJAA 3C87A 1M3SA 5JMOA 3BIXA 4KSYA 3HN7A 3LLUA 1EWVA 2WYWA 1DX6A 4CHGA 3MWKA 5M3BA 1E9SA 4W9NC 3I6IA 3U81A 4BJHB 2YXLA 1VJ1A 4KAAA 4JITA 3AR6A 1T5DX 3FRIA 1IOWA 1NX6A 3JQ7A 2BUCA 2ZAMA 4OPMA 4XX0A 1V4VA 5AM2A 3FWZA 3DBVO 2J7PA 5C4GB 3DOHA 4R6XA 2HIGA 2ICAA 3PWSA 1I30A 3SYNA 1COZA 2UYGA 1NMQA 3D4NA 3GLFB 3RKUA 4ZCTA 1WCYA 5JDIA 3EVCA 4KWTA 1S01A 1YI1A 3K2EA 4FBGA 4IAOA 1KFCB 3EC7A 3T0GA 2OMEA 2WAAA 1W87A 1AOXA 3GEBA 2VCHA 5DGCA 4WNCA 3UMYA 2CWWA 5GJVC 5LUAA 3L49A 1NASA 2VHWA 3LLMA 3HB0A 1Z4MA 2L19A 3IQDB 4EZIA 2DSTA 4CDRA 3IBTA 1SC3A 3DMRA 4FR5A 4HDNA 4YQFA 2XYGA 2OK7A 3CX3A 1GJRA 1NI5A 3F5SA 4PR0A 4JLPA 4EA9A 4ETIA 5BUQA 4GL2A 1C3OB 1JEEA 3L1JA 1H5QA 5AK5A 5JH7A 1G3RA 1ZK2A 1OU4A 4ECEA 1IYZA 4OHZA 1DO2A 2QGFA 4KPUB 3RVBA 3WGUA 4ND6A 2HJHA 3EIFA 4FEEA 3MTBA 4MSUA 1V2HE 5E1MA 2J4CA 1QIFA 3B53X 3DCNA 5TV2A 3GRPA 1Z4IA 3OM1A 2VH5R 5JS7A 1Y89A 2BJVA 4PSAA 4DSAA 4DV0B 3S7TA 9LDBA 4IVQA 4HLDA 3WV5A 4MGHA 2YFKA 4NEGA 1CDZA 1PN3A 3DAGA 1U1GA 4M49A 2Q3JA 1K9VF 4H17A 1M0EA 4HPJB 3VPCA 4JYZA 1SKMA 1Q7EA 2AQ8A 3KQWA 4QQRA 1SCDA 2CXSA 5JXHA 4MDFA 2GF0A 4X97A 1J5EB 1XFDA 1DPGA 2P1ZA 3PHJA 6ADHA 2OHXA 2ZYGA 4IV8A 5IW8A 2Q3FA 1JWLA 4IPTA 3O92A 5BSFA 3R2JA 3EIEA 1JIXA 2BMWA 3A1VA 2J7KA 2GSDA 2NUAB 1KY2A 5AUOB 5E4YA 1TUIA 2FZCA 3UV7A 5JECA 4BNYA 1CZKA 5JY1A 1EK1A 5EJ6A 2E6KA 4RHXA 2VATA 5B1SA 3F8SA 4B84A 4JY7A 2WKQA 2M1ZA 3WGMA 4P5DA 1SULA 3AGQA 2H0QA 5LZ9A 1G21B 3D31A 4V0QA 4EI2A 4MB0A 2BGLA 3DKPA 3TW8B 2I2CA 3NKFA 3SMVA 1R18A 1Z08A 3FDXA 1DPFA 3AHHA 3OCZA 3QH4A 3TXAA 4MQLA 2OCYC 5ITZB 3QMMA 2IUEA 4ENPA 1JEAA 3BF7A 2EKPA 2W6OA 5ADWA 2W2PA 4QVGA 3H1BA 5IVDA 2ZIZA 3LUDA 3RIGA 4R2HA 1W4CA 4MDEA 2ORVA 3O8QA 4PHHA 4XM0A 4LV5B 4KZKA 2OOKA 1EGQA 2GJ4A 1MHMB 2WU1A 3I39X 4RFSB 3H5WA 1FFDA 2BFNA 1BGXT 3GK3A 5IVHA 2ZKIA 3I6MA 4ZQFA 3EBLA 4YPFA 4BHTA 5IRCD 5K3OA 4RQBA 1JTVA 2OAP1 3KXPA 3N0RA 1TEXA 2HSJA 5JZ9A 1DC5A 1FDVA 2FY8A 3R09A 4UU0A 2AK2A 1UFVA 5BSTA 2KI5A 4RK7A 2GEKA 3TBFA 2HQBA 3BL5A 3FDJA 2PMDA 3AFNA 3M3DA 1WTCA 3GP8A 3F98A 2ZVQX 4B3CA 2HK9A 1NXSA 2QP9X 4FGWA 5B3KA 2D2EA 5J9FA 4WKCA 3BWXA 4YI5A 3TSZA 4LX0A 5F1KA 3O9VA 1JKIA 1J42A 5KX5A 1C2YA 3ZDZB 3HP4A 3NC1C 3IP3A 4R54A 3QG5A 4X5OA 3WFIA 3WHPA 2CNNA 4M9CA 4C4XA 3L7CA 1HYGA 4RS4A 3P0HA 4IJQA 4K2HA 1B8OA 4LHYA 3SWWA 2R65A 3V4SA 2ZIAA 3H18A 3HZOA 2QJRA 3CEHA 4NONA 3UAOA 4EFDA 5C8YB 4CEJA 4QM6A 2AFIB 2FG7C 2CLKB 3A32A 4AJKA 3KYJB 4LX8A 4PRYA 4YDQA 4CTMA 1UPFA 1E5VA 1RYMA 1T4GA 2GXUA 2V74B 4TYWA 4E1AA 3FKQA 2D2XA 4Y1RB 1M6NA 4KIWA 3EN0A 2QEQA 4Y9RA 3T1VA 3LY5A 1GHTA 3WLSA 2H11A 4AZ3A 4FW8A 4Z9BA 2HMUA 2A35A 1JU4A 5CP8A 3BJIC 4I8XA 1QRTA 3I2YX 4R2JA 3WLIA 1F51E 3ZDXB 2QM7A 4IMPA 4P3NA 1NF2A 4B9EA 1C2TA 1H9BA 1Y37A 1IEVA 1E9RA 1Q1AA 2D62A 4JENA 1K98A 1ZN7A 4N6GA 2BH9A 1VIMA 4ZVQA 3SD7A 4BFYA 4DSZA 5F9MA 3K1TA 4ARZA 4NXMB 4WLEA 3T1OA 1JEYB 4MLZA 1W36D 3MA0A 3L04A 3DW1X 4BC1A 1TK3A 1UJCA 3KX2A 4HLQB 4UCFA 2QXTA 3TSAA 4CUJA 3CZPA 4UMEA 4DMGA 1VIYA 4NYJQ 1QMHA 2FW6A 4LJ5A 5IYZB 5KOHB 3E18A 4PQRA 2II6A 4Q3BA 4JGBA 3DYBA 3IJEB 1KMHA 4GZ5A 3FLAA 4KGDA 5JYCA 3I23A 5T67A 4ZAGA 2Z5GA 2KM1A 1RHJA 2OL4A 4Q47A 4YRAA 1ZCBA 3NJ4A 5CVUA 1EM8A 1KH2A 3BBPA 5DTEA 5KNDD 1VKRA 3S27A 2O20A 3KETA 1ZONA 2YIVX 1Z0ZA 1RYNA 1DXOA 1VLMA 2ZSFA 3DVSX 4EAQA 1EUCB 4WV3A 1M6VA 3FRJA 2NO7A 3L8YA 1YS9A 2CMGA 1ZMBA 2I3AA 4TV8B 2Q07A 5E4JA 1I32A 3B1WA 4LRWA 4D80A 4JDPA 2P3QA 3FF1A 2NADA 4ZVTA 1TVCA 2BBOA 2GPBA 4S3MA 3S6JA 4JUAA 2PHZA 5L3VA 1Z73A 2PRJA 3ND6A 3V4LA 4IJWA 1U04A 3OZUA 5EFZA 1QBGA 1WXEA 3OQJA 3OIVA 1KI7A 1KPIA 1N2SA 1SHKA 2VDVE 2BI4A 3RIXA 2CV1A 1TTPB 1XF9A 1CY2A 2VWQA 2W8ZA 2XOXA 4V0NA 4WACA 5HM8A 5AQ1A 4EX7A 2H5IA 1BJTA 1JDNA 1F8XA 2GN9A 1FFCA 1EXNA 2P9HA 3NQ41 4RNCA 5KOYA 2X4LA 4BMCA 1JJAA 3NDRA 4BX8A 4PZZA 3E4DA 4K6CA 3UIEA 3L5OA 5HFNA 1OTYA 3AYXB 3DP9A 1LPAB 3EQ8A 2ZWVA 3VR5A 4Z53A 3V1YA 4M99A 3VYVA 1H2FA 2JIZA 2OXEA 3GLHA 5JRZA 3E3OA 2ZUVA 3OF2A 1PR1A 4W6QA 5DIFA 4TS3A 4PN3A 1PNRA 3CPEA 5ED0A 1DTWA 2G4LA 1HDEA 3WL6A 4CKEA 5I7EA 1VDZA 4HLNA 2F9MA 3OE4A 4QTUB 3WRXA 4F6RA 2QTZA 1OA1A 5IH3A 2DBZA 2AN3A 2QJTA 4NBVA 1V8OA 1IU9A 4GZLA 1CR2A 2C4TA 4CM7A 3W5HA 1FSZA 2YCBA 2JG3A 1OLUA 2R97A 1U99A 3AEUA 4DC1A 3E7PA 1U0NA 1GU7A 4UOZA 2XVMA 3E84A 1WB4A 4GR4A 2QPTA 1GR0A 2A78A 2BM8A 3FI0A 3NKLA 5DHQA 3DLBA 4IRXA 4L0DA 4CLRA 3V6LA 3JQGA 3FW1A 2CFCA 4RPGA 3WGTA 3Q8LA 3ROQA 2R8ZA 2JZCA 2VSOA 2OVBA 5AKKA 2G6TA 2JD1A 4YB8A 5F1PA 4S1WA 3IKMB 2YV4A 5CH3A 3TLKA 4J7CA 1MCZA 2X5OA 3W04A 4DUGA 5K8JB 4X95A 3ERCA 1RADA 5CT5A 5LN1A 4ARIA 4G24A 2XUAA 2YV1A 5AHWA 1UBEA 4EVIA 3EISA 4F5YA 4XGIA 3IEVA 5EXDA 3K6SB 3CLSD 4YYEA 2CL7X 4WW0A 4CDNA 2FMKA 1YTLA 3V4VB 5FUMA 3TTWA 3GFGA 4DMHA 4CQLA 4R2IA 3WNVA 4YV2A 3N3AC 4LRUA 3NHRA 2VUHB 4RF3A 4REQA 4ALKA 5I5EA 3FMGA 4G0UA 4U4AA 2FRVA 1CVLA 4Q1FA 3A9TA 3R5KA 2OQ2A 3KYBA 4DRZA 1JPJA 4Q4AA 1J6UA 2VUUA 2AHOA 1D2RA 1PD0A 4HN4B 3L1UA 1F38A 1PTJA 3PGKA 2GNPA 3DCJA 3QEMB 1G38A 1R2QA 4ARCA 2Q3BA 4DG9A 2NOAA 3CA8A 3URKA 2DFDA 4IIXA 4C4AA 1VE9A 3OF3A 2RE8A 1N9GA 3K8OE 2XWSA 1TIPA 1WXHA 2A9PA 1C1XA 1OASA 5T57A 5KTRA 4AWXA 3JQ8B 1BVUA 1TUEA 1ZK4A 2ODEA 1Q7GA 4KXVA 3VKHA 1B93A 4RANA 1RRFA 1KI4A 1II9A 3CLVA 3S2IA 2J3LA 4OXXA 4DXAA 2R1VA 3FYCA 2JAOA 3H1AA 1SXQA 4NJEA 2D4HA 2K5UA 3H5IA 3KZ1E 3L77A 5E7IA 1M5RA 2JD0A 1ICEA 2W22A 3DZHA 5TSDA 4QG7A 5K0SA 3LBHA 3HKDA 1EBBA 4QXQA 1QMPA 3DZIA 3Q2IA 4Y0VA 2QP3A 5AW6A 1VYVA 3OPMA 2HCFA 5DGXA 1J97A 3Q7EA 2J41A 1SZDA 3RYFB 4EG1A 5FCDA 4H15A 4LKRA 2WSLA 2Q2WA 2RHLA 3L43A 1C7EA 2R62A 3V00A 2BGNA 1GA6A 1XKLA 4MQFB 1FLVA 4RIEA 1VPDA 4E07A 2VBFA 2WY2D 1DRWA 2A0UA 3STHA 3VZSA 3QU4A 4PC1A 1FBTA 4LWZA 4YMVA 1PDVA 1RLUA 1UODA 2HFJA 3KRTA 5C34B 4KHZA 4EMUA 1GA1A 3CRVA 4UQLA 1CUEA 4A3SA 2ZBRA 2FEMA 1U8YA 3VV2A 5SV2A 5K1ZA 4F9TA 4JJZA 5JRJA 3IMEA 2DQKA 2RGDA 2YMPA 3B6MA 3KKOA 2JFFA 1Z7WA 3MT9A 1UBMS 1CJTC 4J29A 1SVMA 3A26A 3GUYA 4WLNA 4TQAA 2PCJA 1N9ZA 2GT1A 3AKYA 1G8AA 2ETXA 3ZU2A 5C8DA 1RM0A 1ZGAA 3LF2A 2WG1A 1VMDA 3S0JA 5B7PA 1RJ9A 1X19A 1ODTC 2AC4A 3DWIA 4KDFA 4DJFC 4Q9DA 1WM1A 3QHAA 5J2TA 1PG2A 5ELMA 1COWD 1Y8QA 1U2SA 5JQGA 2MHCA 1EE2A 3AI1A 1Z6QA 1RJWA 2OENG 1U5CA 1CEXA 1ODCA 2FQ1A 2XTZA 1X1EA 2Y1FA 3C5EA 3HCFA 4E2XA 1M1UA 4KAXA 3TM5A 4MRPA 3RGGA 4XIJA 3VPBA 2C2OA 4F93B 1QZZA 1EXDA 1PU2A 1YOVB 1DE0A 1K92A 2VJDA 3D4LA 3SZRA 4DREA 3T4EA 3ETEA 3BWDD 5B2EA 3ZCUA 2IEAA 4P3PA 3AB8A 1OXTA 1D9ZA 1MKYA 1Z2NX 2D1RA 1T3ZA 1CC1S 1U0LA 2AZDA 3F9IA 3INNA 3P0JA 3TQOA 4O3MA 3L8FA 2WD7B 4WZAB 1V25A 1OE0A 3EXHC 3MF4A 4H7HA 5J5CA 4DCOA 3I09A 1UUFA 2EFHB 4S1VA 5IXYA 1ZM4A 4ER0A 2OSVA 4O1MA 4CF4A 1J9EA 4CG3A 2F8TA 2BHLA 1XZGA 3DV0B 1DIAA 4HAVA 2AX4A 3I8OA 3MJCA 4C9BA 4NFHA 3P27A 5DOVA 1SBTA 4CGYA 5B6JA 3OU7A 1KJ9A 5KSOA 1T6BY 1IK6A 3A6LA 4OP3A 2E85A 1V4BA 4KQWA 3H3FA 3RS0A 1PGOA 2A9RA 4DYHA 3NH6A 7YASA 1UAYA 3LU1A 4RO0A 4IDQA 3A36A 1O4WA 3CLHA 4P4TA 4P08A 4FHDA 2NPFA 3EFHA 3MJTA 3NBQA 4B0OA 5I7OA 2ZUFA 3O1IC 4K8RB 4MHOA 5T4EA 3U4AA 2ZBPA 5WRFA 2HA5A 5JZSA 1G7TA 2QMEA 2R86A 3BWMA 5DEIA 3R23A 4AP5A 5LZ2A 5BW6B 2C7BA 1WD7A 4EMTA 4J0DA 1P77A 1CZLA 1VCNA 3GXBA 3U61B 5F3WB 4B3GA 1XU4A 5CHYA 1GO2A 2RJNA 5K3EA 1ZD2P 2FFJA 2J45A 2XEDA 4HVAA 2XA1A 4PR3A 5TGDA 1I7QB 3I9LA 4B32A 3IOYA 4WBXC 1FS4A 3OZIA 1RKQA 4O4LB 2H63A 2O14A 2X1MA 3FBWA 3GNLA 121PA 1JEQA 2YXEA 4LECA 5CLIA 5JYBA 5IMSA 3QVTA 1LU9A 1P72A 2GCGA 1N6LA 3H5RA 1WUYA 4AUEA 1PNVA 2B34A 1ZRHA 1T3TA 4RPHA 1SCJA 1SUDA 3HJNA 3VAAA 1PKXA 2OORA 2PIAA 2IW1A 2O05A 2FSVC 1GCAA 1GFSA 1N0HA 3V9AA 2B94A 4NR0A 2X7HA 4PX9A 2QYOA 4E46A 1ISMA 4PO9A 1M2GA 5IU6A 5LQMA 3ZWWA 4KXWA 1M6YA 3KFVA 5EP4A 3T7KA 3RSQA 4IOMA 4WXRA 1HDZA 3V8MA 1HR0B 1NMYA 4JA2A 5D3MA 2VPQA 3DLTA 1I9CA 1AG9A 1JN0A 1BMDA 1NDQA 2H1FA 1VCOA 1KNXA 4K6MA 4D8VA 3W5DA 1HG1A 1Z8HA 1YR2A 2AJTA 2PUJA 3C1OA 4LMRA 3QX7A 1T34A 1KKUA 4ZAXA 2BRUA 1YQEA 1KMQA 1NE7A 4H4DA 1O8BA 5BNZA 1IJEA 4IUDS 3OPVA 1SHUX 2VOJA 4R2MA 3P9PA 2JGLA 4TLLB 3WQHA 3EIQA 1SWWA 4I55F 1OIVA 1JFFB 1XZHA 4FLFA 4LK3A 4EMBA 3A58B 1KDOA 3WS7A 1KFJB 2EARA 3TUZC 4K9PA 2MSWA 1Z39A 4BEVA 5CB6A 4UTOA 3F6CA 2PBZA 5KNDA 1J22A 1H66A 3IE1A 4DC0A 4JLMA 1ZU5A 3PUHA 4L4YA 5I7AA 5IKOA 4D81A 1GTRA 2SKEA 1MPXA 3NAQA 4XUGB 4BN5A 5JI3E 4ZOBA 2GXSA 3SGLA 2GD6A 2D1SA 2SHKA 4GZ3A 4AKSA 4Z7NB 2XNDD 3O21A 5EWLB 1KI2A 3DJFA 4E2FA 4MCAA 5C2JB 4BGDA 2FZ4A 3H13A 4X90A 1NN3A 2P9EA 1U2EA 4NV1A 1J8FA 2AG0A 4FGLA 4JELA 5IKPA 3WLEA 4O63O 2H2AA 4JJIA 1QOQB 4Z9YA 5KYTA 4RVFA 5CXSA 1WMAA 2XOKD 1FUKA 1ZVMA 3ESYA 3HN2A 4LGVA 1KRHA 3BJEA 4BRZA 3KVRA 3LH5A 2JCGA 1E9DA 1U0BB 4K9OA 3AHIA 2QR5A 4OHBA 3NWJA 5CLLA 3PUYA 3WISA 1K4YA 3FM9A 4HXGA 1FFWA 4B3JA 5C5CA 4XB6B 5HTOA 3AW9A 1CUIA 3GEDA 3HKCB 4BVLA 1EJBA 4CPDA 3R3HA 4XW2A 3JQFC 2ZYSA 1E98A 4NVRA 1ZBDA 7GPBA 3ENZA 4JOBA 2NZXA 2XQFA 3N8KA 4RZXA 1RZVA 3JV7A 5FLEX 3HYSA 4KFSA 5A1TA 5HRUA 4EY3A 1EH5A 4RIFA 3C48A 1YIDA 3ICPA 4WWHA 2Z0MA 3NX4A 2J6CA 1WZIA 4RUKA 3C70A 1IN1A 5H83A 2DBRA 4AAYA 4D5GA 5DYIA 1X1CA 1KRXA 3I9FA 3EX7C 5AW9A 4FD3A 1N7JA 4NCBA 3R6TA 1EFPB 1KYQA 1CPYA 3PHIA 3HY6A 4II7A 3HKBA 4EG8A 2EW2A 1VFPA 2XKJE 2PX8A 4GOLD 2ZEJA 4RTQA 1OH6A 2WAMA 2IE0A 2ZRBA 4BFSA 3OIWA 1HT3A 3CLKA 3VOBA 1E6WA 4JBIA 1KYXA 3U40A 2QGZA 2JAUA 1H2HA 3UC9A 3GU3A 3TKYA 2HHHB 3W9BA 1CRWG 1FB5A 2IY7A 2VTEA 4QG3A 3ENVA 4GP7A 1DX4A 1TUBA 3DHEA 1KAOA 1JVSA 2XRMA 1RKVA 2GHRA 2LCIA 3UT6A 2VHXA 4I4TB 2WJGA 3L4JA 3EZ6A 3G5MA 4JXKA 4K1LA 4LJKA 3S2SA 1L7VC 2ZWIA 5K3FB 2VA9A 3Q8MA 4C6TB 4XD7A 2WU4A 1Y4DE 4CDMA 4G6ZA 1DXHA 4D0NA 1CUVA 1R1DA 1NUHA 4EB6B 1NPYA 4EBBA 1GRNA 1F2TB 4JODA 4XZ3A 16PKA 4RHFA 4BYMA 3G79A 4PZ0A 2OVFA 1P1BA 4QQFA 1Y3BE 4UPVA 2YXDA 4O4JB 5CM2Z 1Q91A 1FDOA 5EJ8A 4BY9E 4S24A 1UKYA 3I2KA 3AT1A 5FADA 1KWKA 3W9YA 5JAMA 2EZ9A 3RYCB 3RVNA 3NDPA 5T5QA 3KQVA 4RJLA 4WESA 4I9HA 3WICA 1KY5A 2WHRA 5A1JA 1XV5A 5JS8A 3SXUA 5JXGA 2EF1A 2YMLA 1OX5A 1IMOA 3A31A 1T5LA 3C6XA 3SZOA 5JXWA 4QUJA 3ZU6A 2G1KA 4FYYA 4EHJA 3DR3A 1S2DA 3SQMA 4HADA 3QMVA 3C7TA 1HQCA 2WWHA 1QHGA 5TQ0B 4NU0A 5CAEA 3IODA 2FUNB 4H1TA 3INTA 2X5JO 2JPDA 2GCIA 5AUQA 2VDNB 3ZDFA 5IAAA 4QWWA 2A4KA 4PNPA 1ODJA 5JZVA 1M34E 2CLIB 4CFSA 5BY2A 1O2DA 1U7DA 3OY7A 1RKBA 2X2PA 4V0ME 5A7FA 3H9EO 3I72A 3B3GA 3DCIA 1U1CA 5G4LA 5AW0A 1Y1SA 3P0EA 2OO7A 3PPIA 1XQVA 3LP6A 3C3XA 2JRCA 4KX5A 1JAHA 4UHCA 2HDOA 1AUOA 4G8CA 4C7OA 3EASA 1N2EA 3LKZA 4BVAA 3QF4B 3REQA 3S99A 1GRVA 4BJ1A 3PS9A 5JEDA 1C3XA 3TJZA 5IXJA 2CMKA 3LQ1A 4B3IA 2NUPA 4OKSA 4QHTA 1OI4A 1OLXB 4ALJA 3JTMA 2O3RA 4DV7B 4MIYA 2X19A 5JVDF 2WTBA 3AHGA 3FWHA 4IUCS 4JVMA 2FR8C 1N2CE 2IGTA 1SB9A 4UEKA 4H4EA 3W3AD 4FUQA 5E0KB 2NP7A 3TGPA 3L4KA 1AV7A 1G2PA 2QTHA 1XNHA 2XYVA 1PSZA 5BSGA 5AESA 1DLJA 4J0KA 4JLOA 4RD0A 1ZD5A 2BKAA 2DCMA 2FWIA 4FX5A 3QGMA 4U6QA 4AN4A 5LSAA 5AM3A 2XDQA 1DWUA 5AVVA 4HBZA 5ED4A 3W2GA 3SNKA 4RHTA 4TMKA 4J9VA 3IUPA 1JR3E 2C3YA 1NJ6A 1NT2A 4YX9A 2O7NA 1AMUA 2PWAA 3RS7A 5GADl 3E9EA 3SEFA 2DXIA 2W2KA 1BQ4A 4Q39A 3LWZA 4BIIA 2YV3A 4OMDA 2DQYA 2WUDA 1BYUA 2R7KA 2B9EA 2Y0BA 4IIFA 1N7GA 1E4OA 1X1RA 4LNUA 4OYYA 4QD3A 4RC9A 3GUUA 4UMFA 3ZHTA 1M8JA 1HEIA 4ETWA 1SXJE 5KHOC 1J0XO 4PXAA 3VDXA 2FHPA 4RD3A 5JNLA 1CY8A 2AOXA 3Q2OA 4AS2A 3KJZA 1K6XA 2ODPA 4J0JA 4F96A 1YDWA 1Q1ZA 3NW9A 3G68A 3VSBA 1RWBA 3HCPA 5K0CA 2HWWA 2XMDA 5DHAA 2X8JA 5DGDA 3T9FA 4HTFA 2L18A 3SVTA 1IZ7A 1GFIA 2EJWA 1U28A 2OLJA 4Z3DA 4AG6A 4YT2A 2Y27A 3H9QA 4UHJA 5K6AA 3QX3A 4A8JA 4YCCA 3V7NA 2B8TA 3KDPA 2RHHA 3EVEA 4BO0A 2PGLA 2X0EA 4M0DA 1B43A 2FTKE 5BSRA 1Z68A 3EPRA 5CYGA 2P4QA 5EJ9A 1GTZA 3KSMA 1KO7A 2EFDB 2KLHA 3STUA 3KEMA 5KQSA 5HE8A 4D5EA 1ML3A 1F5SA 3HZZA 1R8JA 2CDCA 1WO8A 2JJ8A 3A9RA 4Y1FA 5DN6D 3TRFA 3UHAA 4OM8A 4QJ3A 1T5IA 1TOAA 4CL2A 2OFXA 2C29D 1N9KA 2JJ2A 3PB3A 4AIRA 1ZC4A 3IDFA 2YW9A 1QRDA 1P2TA 4M46A 4Q02A 3EPKA 1YR9A 4RVHA 4JBLA 5LM3A 3VR5H 2Z2KA 4TKZA 1IZYA 5LJLA 3ZE9A 4MV0A 1ZNYA 3GD7A 4BLUA 5C9ZA 4OLBA 2PKYX 1H5NA 3INYA 1Q11A 2XHEA 4U9IS 2I1WA 4ZVPA 1IY2A 5E4FA 3FVQA 4JC5A 1LRJA 2FOXA 3ZOKA 4D4MA 4X62B 2F6RA 2IZ1A 5BUCA 4ZCMA 3PR2B 3RQIA 4EQZA 3IQEA 4HNQA 1TLLA 1OYWA 3GBSA 3CR8A 3O91A 4YAFA 4Y2PA 1T0JB 1VPWA 2J0UB 1JI0A 5TPZA 1QORA 1H69A 2IYOA 4B4UA 5BOSA 3ZJUA 2IV7A 1MJNA 1CDEA 3BGIA 2VK4A 1HKHA 2HHLA 4I5FA 4JP8A 4QLAA 4OO3A 4G37A 2G25A 1F17A 3MK31 3B1YA 3TNFA 5DTQA 4NSNA 1Z2DA 4RWEA 2DH6A 2F1RA 3MCTA 4TQ9A 1XVAA 4ND1A 2C82A 4RZSA 5P8WA 4EJFA 1CCWA 4KRGA 2EW8A 4U7GA 5FI1B 2H65A 3AXTA 3LCRA 3G1WA 2G70A 1TQ6A 3VYUB 2R7MA 4Q1DA 4WK4B 1D3AA 2BSAA 4TS9A 1SVIA 4HYQA 1A71A 3U26A 1POXA 1M2NA 3VR4H 4GOND 3ESDA 1AQ6A 3KZMA 4NCNA 5AUPB 4UNQA 3NPMA 4JI0B 4LZAA 1TAGA 1KERA 4J91A 4AXBA 3I61A 4DR4B 1T3SA 3BSWA 4G8JA 5B6PA 3JZAA 2JRLA 4JR1A 1KJYA 3MCAA 3DO8A 2OXFA 3TEMA 3U7FB 3KJIA 1N6IA 1SOUA 2JGJA 2V9PA 3EDMA 1YL5A 3OA0A 2O1EA 3IRVA 3KUCA 4FE7A 4U2FA 4Y2QA 1V3UA 3OMXA 2RC6A 4JT2A 3FPHA 4WN9B 4BO1A 3P71T 5ITWA 4F2GA 2P91A 1YKSA 4AZWA 1AIPA 2MOKA 4FE3A 1Q15A 2AUTA 3BZWA 3PLNA 5TY0A 4ALNA 2XB2A 1K7EB 1AX9A 1P2UA 4TT3D 3TOCA 3A05A 1T5OA 3P5BA 3AM4A 5AJVB 2VCYA 1MA3A 4Z0NA 4F2HA 3SBOA 4YRJA 2A30A 1Q0HA 3OSUA 1DKRA 1N6HA 1ZNQO 4JB8A 5CLQA 2B8WA 3ZIAA 2X58A 2HMWA 2WQZA 2CHUA 3AG5A 1FZTA 3NI2A 2QRNA 1KVTA 3EY4A 4MUAA 3UWKA 1NW4A 5J2UB 2FDCA 2F3TA 1KEUA 4TLBA 2H1IA 1KVUA 4PS0A 4N3BA 5CW2A 5CG2A 1TZKA 1TKCA 4DWWA 2JCYA 4CMCA 1YJXA 2E3JA 1QH8A 2H7YA 1TXGA 4QGAA 4P32A 1JDJA 4W99A 2OC9A 5FOXA 1WXWA 1YT5A 3N6RA 4BPBA 1J2UA 4GX5A 1YZVA 1C3EA 3FOCA 4U6NA 3KALA 4QFMA 2MR6A 2EG5A 3KJNA 4MQ6A 5U1PA 5KYNA 5CDYA 4DLNA 1SUIA 3AUYA 2OPHA 2HRRA 4DC9A 4RPKA 5HKAA 2Z4SA 5KDDA 1X8KA 1LKZA 2F43B 2IPOA 1T9BA 3L7NA 2XXJA 2OO5A 3G8AA 2M9MA 4MROA 4EHIA 2YBDA 3FI9A 4A03A 5CX4A 3BWCA 4F3TA 1XTPA 5D6NA 4ER7A 3K9FC 3LUCA 1HDRA 1UEJA 1P1CA 4XE5A 3HXPA 5B3JA 1NRXA 2HLPA 3VHXB 1XHEA 3NDJA 4LHSA 2Z1DA 3WO0A 1T1IA 2WWFA 2B35A 2QAGC 2ZRGA 2Q50A 3MWLA 1YS6A 5DF1A 3TRIA 5AVYA 5KSWB 2Z2YA 1UADA 2ES4A 3E9RA 3FUVA 3VA7A 1WE2A 3S2YA 3ICOA 2B3TA 3EF0A 1L3CA 3RT9A 2BFMA 4CVNA 4G0QA 6NULA 2WRZA 2ARKA 3GLSA 3D4PA 2QL7A 2WPDD 3RC2A 1Y4UA 2WWVD 3NC0C 3PNBA 2O1SA 2I7XA 1TPZA 4OBWA 4BQPA 2IU6A 1BHO1 1INLA 4PYQA 1XLUA 4CKWA 2RH9B 4PPYA 3PGLA 1DJLA 2X9GA 4HB4A 3PPVA 3R4CA 3NHJA 3ZUGA 1EBUA 1IWBB 1EFVA 1O08A 2H59A 3EG5A 3DEJA 3W6PA 4YRBA 4BU0A 4XLLA 4Z7OB 3CRW1 5HF9A 4EJSA 1I3CA 1PJLA 4EUEA 3IIJA 4LI0A 3W3ZB 3DOCA 1MB0A 1E9EA 3JAWA 2P7HA 3JYNA 3H65A 3PD0A 4PPNA 4QTZA 3U3KA 4F85A 4A6XA 2G09A 2OFFA 4KYUA 3HMKA 1PBTA 2QL9A 2A67A 1EVIA 1A82A 3DT9A 1S7GA 5K3BA 4EFKA 1HC7A 3DE4X 5DGHA 4Q37A 4CTJA 4AS3A 3IAS1 2VF2A 1DEXA 1C9MA 3WYBA 2G06A 1DWQA 1MDBA 2OZKA 3EW9A 4MRSA 1M67A 2Q9AA 3TZKA 1DEKA 1HDOA 2IVZA 3BWYA 3RV3A 3OZCA 1B15A 4KJZA 2VNJA 3RB8A 3T7IA 4G4GA 3X2SA 3EWNA 1A2BA 2P11A 3IR5A 4EF5A 3LQRA 3RASA 1TQHA 4GXNA 1GUBA 2J3MA 1Z0SA 1GRQA 5L3QB 3NR2A 1MQ8B 4N5MA 4ZPXA 1WY7A 5IJ0A 3H3JA 3OZFA 4AQ7A 3K70D 1O3YA 4X93A 3GGJA 1V4NA 1YULA 2ZRNA 4QPJC 1NLZA 3OUTA 1GWNA 4GYKA 4MW4A 1M83A 2A7QA 1JIUA 1TCBA 4AMVA 3DUFA 4F2DA 1VYUA 1SA0B 1WEHA 3X2EA 1HNXB 4D9JA 2IK8A 4B87A 3T4UA 1X70A 2WNHA 1F4VA 2BTQB 4E94A 3HGMA 5KWJA 1UBLS 1I2ZA 1GY8A 2A1UB 1NXVA 1H2AS 1NVKA 2FEXA 4J90A 1K08A 4PO8A 3RHZA 4EPWA 3H0CA 3HY4A 4AWAA 4EGFA 2IV3A 1P5RA 3I52A 4D0SA 3ZVLA 5IKMA 3EGIA 1IZ9A 2UVQA 2Q5CA 1PG5A 2XGMA 5JYEA 1F9AA 2XW6A 4GNKA 2ZAIA 3A3YA 4RZIA 4X3CA 5CXXA 5JSYA 4KH0A 4S1PA 5TQ2A 2LIPA 2GTPA 4WJZA 4B3RB 1XDBA 4GKVA 2ZBQA 4RSGA 3SR3A 2VEOA 3H5OA 5DCWA 2HA6A 1Q50A 5A06A 1W93A 4GWGA 2H4WA 5EE0A 4BMNA 4YRZA 5E38A