3KUXA

Structure of the ypo2259 putative oxidoreductase from yersinia pestis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
352
structure length
349
Chain Sequence
SNAMADKIKVGLLGYGYASKTFHAPLIMGTPGLELAGVSSSDASKVHADWPAIPVVSDPQMLFNDPSIDLIVIPTPNDTHFPLAQSALAAGKHVVVDKPFTVTLSQANALKEHADDAGLLLSVFHNRRWDSDFLTLKTLLAEGSLGNVVYFESHFDRYRPEIRQRWREQGGGIWYDLGPHLLDQALQLFGLPETLNVDLGMLRPGSQSVDYFHAVLSYPGQRVVLHSTVLAAAETARYIVHGTQGSYIKFGVDPQEDRLKAGERLPQADWGYDMRDGIVTLSHDNVLTEKPLLTLPGNYPAYYAGIRDAIWGTAPNPVPATEAIKVMELIELGIASDQQKKALPIIAKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the YPO2259 putative oxidoreductase from Yersinia pestis
rcsb
source organism Yersinia pestis
molecule tags Oxidoreductase
molecule keywords Putative oxidoreductase
total genus 97
structure length 349
sequence length 352
ec nomenclature
pdb deposition date 2009-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 3kuxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kuxA01
4KWHA 4PG5A 3AY7A 3B70A 5CEEA 1X13A 3VOSA 3M6IA 4MDHA 2UAGA 3ST7A 4CV2A 2WE7A 2CD9A 3NUGA 4J9VA 4J4TA 2VYND 3NYWA 4QUKA 4YT5A 2C2XA 2FP4A 4LVUA 2WYVA 4CLRB 2GR9A 1NAHA 1KS9A 2NU9A 4GSLA 4RV9A 5JY1A 4DYVA 3S2IA 4ND4A 4QTZA 5JCJA 1Y8QA 1P31A 2FSSA 4EEXA 4HUJA 3G0OA 4A73A 2I3AA 3PJEA 3WMWA 1H6AA 2O3UA 1OC2A 2VCYA 3VPFA 2HRBA 2Q22A 3JYLA 1U28A 1HLPA 4BKQA 4J91A 3BMQA 5ER6A 1NQOA 2IYPA 3NT4A 1GPJA 1NPDA 3P5SA 5DP1A 1JTVA 4D45A 1PS0A 3FF4A 4FIZA 1ZIDA 1N9GA 4D0RA 3BTSA 1U4OA 3Q2IA 1U2DA 3M1AA 1KY4A 3GFBA 3BMOA 4I5FA 3ZU2A 1D1TA 3GEGA 2GF2A 3K73O 5JMPA 4MOWA 4GVXA 1H2HA 3OQBA 2B0JA 4Q39A 1KEWA 1U7HA 4WCFB 4YWJA 2ZQZA 4U6QA 1FXSA 3GPDG 5FYDA 4RPJA 1PIWA 4WK6A 2H6EA 4DREA 4IS2A 2Y0EA 4I9UA 3S8MA 3HQ4O 2Q99A 1GQYA 4MVJG 1T2DA 3N7UA 1Z45A 4U0JA 3H9JA 4XX0A 2EW8A 1MFZA 3EW7A 3FI9A 4J3FA 1TT7A 2FN7A 1CIVA 2EJVA 1C0IA 5C5IA 3D3WB 4CR7A 4HY3A 3TZQA 1T1SA 4IDGA 2EP7A 1B8VA 1W6UA 5MGBA 1K5HA 1F12A 4OAQA 1V8BA 4MVJF 1H6DA 3A06A 3DTYA 3LC1O 2YHUA 2J5RA 4QFCA 4JP3A 1FDWA 2B37A 2VHWA 2D5CA 1HDZA 3AUTA 3MEQA 5C7LO 5DBFA 4FPXA 2Q2VA 3LT0A 1C1DB 1LX6A 3PFWO 4W7IA 5EPOA 3JYOA 2NUAA 5G0WA 4AJ1A 5FFFA 3L6EA 1K6JA 2O2SA 3GN2A 2X22A 4N54A 4X54A 1BXKA 4N5LA 1R4NB 4ALLA 1X7DA 1GCUA 3ASUA 1K3TA 4URFA 5IZCA 3L9XA 3AY3A 4TKLA 4AICA 4J7CA 4Z0TA 4PZDA 5J23A 5TIIA 3IOYA 2EKPA 3PWSA 2EV9A 1I0ZA 3MJTA 1NTOA 1A4UA 1C0KA 4J1NA 4EI2A 2YV3A 3RC9A 4U5QA 1H6BA 2FSVA 3WB9A 4QO8A 1NASA 1ZK2A 4P4GA 4PG8A 1B3RA 1UAYA 3V1TC 4E13A 2DVMA 4CM5A 3VC7A 5H82A 4J90A 4GGPA 3RUFA 2O23A 3F5QA 4CM7A 2CMDA 3FWNA 4DMLA 3O38A 1YRLA 5DBGA 3KRTA 2CZCA 2I9PA 3NT2A 4DQVA 3I9NA 3TNLA 1QYXA 3JQAB 2P4QA 2ZATA 5TT0A 3U62A 4R16A 3KHUA 4MIEA 4Q9NA 2X5OA 4B3JA 2PZKA 2O7SA 3FBGA 2DBQA 1H94A 4HFRA 1EVZA 4RQUA 2P9CA 3NT5A 3F1KA 1N8KA 3KV3O 4YCAA 1DPGA 4IXWA 3HE3A 4BO8A 1AHHA 4YAEA 1GADO 3GGGA 1YL6A 1X1EA 1RM0A 4RVHA 4UEJA 2ZK7A 4K6FA 4FS3A 3IJRA 3GN1A 4CLXA 2WWRA 1UUFA 2B69A 2O50A 3S1LA 2ZTLA 2XOXA 3OICA 2O7QA 1O0SA 4HV4A 4LRSB 2VWPA 1AHIA 4HKTA 3HADA 3V5NA 2FZEA 3P2OA 3HNPA 3PHJA 5F1KA 2C82A 3MJSA 2X7HA 4K26A 3MJ4A 1LDEA 3QE3A 3GG9A 3I83A 3CPSA 3QRWA 2A9FA 1WDMA 1QYDA 2O3SA 3H2ZA 3LZ6A 2XF8A 1CEQA 1ENYA 2D3TA 2BELA 3HFGA 3OIFA 4LMRA 2BHLA 3I4FA 4XDYA 1HYHA 2C29D 1E1NA 2JL1A 3B1JA 5KWEA 5EINA 3PJDA 4G2NA 2QRKA 3KBOA 4HFJA 5ENDA 5IN4A 1LDGA 3TL2A 3CE6A 3TN7A 2FRDA 3PVZA 4PVCA 4W7HA 1DC4A 3GZNA 4JXKA 2VOJA 1H2BA 5KJ1A 4WCFC 3H2SA 3KEOA 1FDUA 8LDHA 2OP0A 3S55A 1PQPA 4ZRMA 2FR0A 5G0SA 4IZHA 4ESOA 1O6ZA 3H6KA 4OXYA 4PN3A 4GKBA 3KLMX 2NU7A 1DSSG 1T2AA 3G1TA 4PLTA 3X2EA 3C7DB 1PJLA 2Y66A 3LK7A 4MVJP 1M75A 5B37A 5I9LA 4U0KA 1QV6A 2VHXA 4UEKA 2LDXA 4YRAA 1XIVA 1FJHA 3T7EA 1SOWA 1IYZA 1EUDA 1PGPA 3GUYA 2FR8A 3GNTA 2HO5A 1YDWA 3ZWWA 4LN1A 1ZMTA 1EDOA 1PJ4A 1ZXLA 2NADA 4LSMA 1N5DA 4J0EA 4XQ9A 4ZU3A 2YFHA 4DBVO 1VLLA 1X7HA 2GASA 4AJHA 2UDPA 1H0KA 2V6GA 3I52A 5DCWA 1YL5A 2E6UX 5A5FA 3MJVA 1YJ8A 3RD5A 2C2YA 2P68A 2CUKA 2DUUA 1DIBA 1ZSNA 1JDJA 3JQAD 5A04A 5BT9A 3TZCA 4B4VA 4RO0A 4CMKA 4CQLB 4PLZA 3GPIA 4CLOA 1V3VA 3IP3A 3CIFA 3DB2A 2HSDA 4RVUA 4FJ2A 3BTOA 3RIHA 1C0LA 3ITKA 4ALNA 4AJ4A 2ZCUA 4QECA 2RHRA 1QXSA 3DZBA 3QSGA 4YJHA 5G0UA 4R1TA 1YGYA 1EQ2A 2HMSA 3Q1LA 3AI1A 1CETA 1DIGA 2P5UA 1CQJA 1HYEA 3ONEA 4MVJI 1YS4A 1DIHA 3B1KA 4GI2A 1ZEJA 5JLAA 1E1KA 3OIDA 4H3VA 4Y67A 2YDYA 1HT0A 3C85A 1IB6A 4UULA 1QSGA 3SXPA 1PX0A 4K1LA 2I6TA 1WNTA 3PQEA 3GF4A 1Y5RA 1B8UA 2BGKA 2E49A 3V2GA 4BNMA 3TZHA 1X0VA 4NDNE 1BXGB 3CZMA 1H9AA 1OFGA 4BO6A 1EDZA 1K89A 3DZJA 4MINA 3GRKA 3ROKA 4H16A 4GQAA 5IG2A 1I3MA 4N5MA 4FR5A 5CDGA 2WYWA 3JTMA 4NBRA 3QIVA 5L40A 1E7SA 3HDYA 3UCEA 3PHGA 4ROSA 1GCOA 2WDZA 2Y1OA 4CODB 2NLOA 1NBOA 4D3SA 2EIHA 4M49A 1W73A 4OXNA 4NJOA 2XXJA 3OBBA 4B4WA 5CEFA 5K0ZA 5G4KB 1P1IA 2FR1A 1E3WA 2WD7A 4E31A 4BKRA 4AJ2A 2Q2WA 3V2HA 1LBEA 3KYCB 4GGOA 2JHFA 3WIEA 4R51A 3JQ8B 4J0FA 1YONA 4II2A 5JYDA 1I8TA 2YY7A 4M55A 3C24A 4OSPA 4BGIA 1Y5MA 2PKQO 5G0TA 3RFTA 3GFGA 2GZ1A 3LVFO 1V35A 4D3DA 2WMDA 3WYBA 1Y7TA 5KOIA 3V2UA 3NV9A 4EJMA 3SJ7A 2OP1A 1HSOA 4IDCA 1ZNQO 4BO2A 2LDBA 2E37A 4IJVA 4WOJA 1HE5A 4G81A 3PYMA 3DHEA 4PG7A 3JV7A 3MTGA 5KIAA 2R00C 3ZGYA 2IXAA 4HADA 2P9GA 2CNBA 3OHSX 1PJ3A 3PWZA 3JQGB 4BV9A 1HZZA 3EY4A 4XZ3A 1J49A 4NU6A 5EJ2A 3U0BA 3AU9A 1E3LA 2VHVA 1E3SA 4ZHSA 1ZSYA 3RC2A 4LGVA 4RL6A 1X0XA 2C59A 3I4CA 4YAJA 4F6LA 1P33A 5KCZA 1D7OA 1EUCA 4J1TA 5LCXA 2AW5A 3KXDA 3D4OA 4BB6A 1B26A 3MCVA 3OEYA 4KOAA 2JJYA 4FJ0A 3LT2A 4LCJA 1LUAA 1EVJA 1SAYA 5AOVA 4DLBA 2R6JA 1R4MB 4KQWA 3VPHA 1ADGA 5BQFA 2GDZA 1M6WA 1LRJA 1SBYA 4AJOA 1JLLA 1XU7A 1V9LA 2IEDA 2XAAA 3PJGA 4Y8VA 1YBVA 3W8EA 3U4IA 1M76A 3TZ6A 4M89A 1VSUA 1HF3A 1LSJA 3VAZA 3FCOA 3GG2A 4O6VA 4UEOA 4B3HA 1AE1A 2VNSA 1BVUA 1BTOA 3D3WA 4JLWA 5IAAA 1I5RA 1T2EA 4CLHA 3H7AA 5G4KA 4JBGA 3LQFA 4JJGA 3WNVA 4R5MA 4WLEA 5DT9A 3ZWPA 1Y9EA 4ILKA 1JKFA 3AWDA 3AW9A 1ZXBA 1UXHA 5JDIA 3EYWA 4OO3A 4I9NA 1QV7A 4CMGA 2GGSA 5TLSA 1BG6A 3UF0A 1A7AA 1YJQA 4YAKA 3U4HA 2P9EA 1KBZA 3WGIA 2EEZA 5KJEA 2EERA 3B1FA 2TMDA 3HHPA 1NHGA 1VPDA 4DQXA 2PY6A 3QHAA 3DHYA 1Q0HA 4XGKA 3O4RA 1ZKMA 2EGGA 1R37A 3NDIA 5EERA 3E03A 2B4QA 4HWKA 1KVTA 2VRCA 2CVOA 1U8XX 4YACA 1I24A 1Z73A 4NI5A 1P9LA 3SLKA 3OJFA 3NJ4A 4EW6A 3ZZNA 4PRKA 1F17A 3TQHA 4BO7A 3RUCA 3H9UA 1VJ0A 5L4NA 1GU7A 4ND5A 1V3UA 3K5PA 4QSMA 4BO4A 3JQDA 1CQIA 4IQ0A 4RORA 3JYQA 4L73A 4Y6SA 1EK6A 4KTTE 1YVEI 4XGIA 3VTFA 1NX6A 2CDBA 4IM7A 4E5NA 4Z3DA 4E2WA 1PS8A 3ICPA 3ZW8A 3KO8A 1O94A 1XCBA 5GMOA 5I8WA 4E0BA 2HLPA 4E33A 3PDUA 4MVJM 5TGDA 4CLEA 2Y68A 1JKIA 4CMEA 2WYUA 5TNXA 4DPLA 1NVMB 4MJLA 2HRZA 4FFOA 1R16A 4CM1A 3FBTA 1ID1A 2VRCD 1Z75A 4KTVE 4RLSA 4BKPA 1B0AA 5JC8A 3OP4A 1LRKA 1H93A 4LISA 3WNQA 4FFNA 4DC0A 4LMPA 2PA3A 2Y1CA 1HE3A 1PQWA 3NAQA 4OXKA 4MP8A 2NV6A 1WZEA 4L75A 5JMWA 2Y1EA 1NFFA 3GH3A 3Q11A 2D5AA 2O2YA 4OOEA 4D41A 3QWBA 3DFUA 2QG4A 4CQMD 4HX5A 3PQDA 2JFHA 4NJMB 4CQMB 3DR3A 4BO5A 3W6UA 4ND1A 1WAMA 2Z1MA 4CMCA 2J3KA 2Q1SA 4LSWA 5T8KC 1CRWG 5HS6A 3NTOA 3H9EO 1XG5A 4PG4A 1P74A 3DBLB 3UCXA 2GO1A 1PJ2A 3GEMA 4YPOA 4DPMA 2E4AA 3CZRA 4ITUA 4UVIA 5KJ6A 2PTGA 2O3QA 4XYMA 2V6BA 1R15A 2GERA 3VDQA 3S2FA 1PJQA 1IZ0A 5F21A 3PYLA 5KVCA 3IL2A 5A3JA 2VWGA 2H1SA 2X0RA 1RKXA 3GDFA 4M87A 1RYDA 1XHLA 1C1XA 2Q4BA 1NWHA 1EZ4A 1GTMA 4EJ0A 4II3A 4CLOB 2V6MA 1W0CA 4Z6KA 3AI3A 1WLYA 3GVCA 2Q4EA 1SNYA 3GZ4A 4WLUA 2X0NA 3GDGA 4BQRA 4YYZA 4L74A 4YDRA 2CVZA 2J8ZA 3OMLA 3T7CA 5FEUA 4R5HA 1DC6A 1I3NA 3FTPA 2JD0A 4A7PA 3VPGA 3OSUA 4U8GA 2PGLA 1NNUA 3W8FA 1MG0A 4QFDA 2VWHA 3V8BA 4UAGA 4RDIA 1YBMA 7MDHA 1TB4A 3W8DA 4AG3A 4W9NA 2TMGA 3EUWA 2ZQYA 1NM5A 1Y1PA 4TRNA 4AJEA 1T24A 2Y93A 4YT8A 3JD4A 4JBIA 4XCVA 2C20A 1LDNA 3M2PA 2VZ9A 2B5WA 4BS9A 5DN9A 1JQBA 4BV8A 3TSCA 1Z82A 4UVDA 1YQGA 2EJWA 3RROA 1JAXA 1A71A 2A4KA 5L7TA 2CY0A 1DB3A 1QKIA 2JCXA 4C7KA 2AG8A 5A9TA 1SB9A 3ANMA 3EVTA 4XDZA 1YDEA 4MPDA 4G5HA 2PR2A 5H83A 4PLWA 1NR7A 4BIIA 5F5LA 5L4SA 2D0IA 3RKUA 2NVBA 2QZZA 4ZGWA 3JQBA 2YFQA 1G6KA 4IJKA 4ZQHA 1NFQA 1HRDA 2X4GA 1I36A 2UUPA 3DAGA 3UHAA 1Z7BA 5F1OA 4KDEA 4WCDA 4IIUA 3INTA 3GLQA 1KC3A 2BFAA 3W4IA 2YV2A 3F5SA 1YO6A 1QG6A 4XWYA 5AVOA 3SLGA 1Q2XA 3R3SA 3HB4X 4QEDA 3UGKA 1HTBA 5KJCA 1LU9A 4OGWA 2H5LA 3F3SA 4RQTA 4Y6RA 4NG5A 3WGGA 3HUDA 3ADOA 4BNVA 3A28A 1O89A 5CG1A 3UVEA 1GEGA 3ETDA 1CYDA 4L4RA 4BHTA 4YBZA 4ID9A 3RUIA 4JN6B 1PTJA 3FWZA 1VKNA 1OMOA 1OI7A 3LC2O 1Z7EA 3OFSA 4QT0A 1NVTA 4CJXA 3HN7A 3DBRB 4E3ZA 4A2CA 1KETA 3D4NA 1R0SA 3M1LA 1QLHA 2DQ4A 4B4OA 1DJNA 2EXXA 5T6BA 5A4DA 4BNGA 3GQVA 3JQ7A 3LLSA 3JQEA 1A27A 1ZFNA 4K28A 1XKQA 2HQ1A 3LF2A 1XQ1A 5L51A 2EGHA 5M6DA 5T57A 1JU9A 1RM3A 1YB4A 5IFLA 2C0CA 1P1HA 3A9WA 5H81A 1LLDA 4GX1A 4PIVA 5GZ3A 4S3MA 1N1EA 4JIGA 2EKLA 3DFZA 5JAMA 1HXHA 1R4NA 3E9QA 3NTQA 3FRJA 3PXXA 3FNEA 2JFFA 5COAA 4D0SA 4JQCA 3F4BA 3WGTA 1HWYA 3ZCXA 2IRWA 3OIGA 1YH3A 3SC4A 4G65A 5TF4A 5CDYA 1L7EA 4A03A 4B4UA 1HDGO 3Q0EA 3VHRA 1YB5A 2BKAA 1IL0A 4A26A 2QQ5A 3WQRA 2YDXA 3DOJA 1WMBA 3G17A 3GRPA 5U1PA 2RCYA 1GPDG 2QZ9A 1UP7A 3OEWA 4ALIA 5JSFA 3ZHBA 1ZUD1 4FGSA 3PHIA 5DCYA 1EBFA 3GGOA 1D1SA 2I3GA 3ZWCA 4CUJA 5CEJA 2BI7A 5BNIA 1XDWA 2DPHA 1DO8A 2ZB3A 4FW8A 1KOLA 1WDKA 3N74A 3JYPA 5HBRA 5JY6A 5BSEA 3WLFA 3ZV4A 2Y1FA 5IXYA 1GZ3A 4DA9A 2W2KB 3QJ5A 1E7YA 4WCFA 5KJFA 3R6DA 2WJPA 4XEHA 2O48X 4GLLA 1BSVA 1I2CA 2BFMA 1HETA 3I6QA 1OBFO 3L6OO 3DEYX 1U1IA 2VHYA 3IS3A 5FF9A 3EZYA 1QMGA 4J16A 1KY5A 1UR5A 3KLPX 1D4FA 3QVWA 2X5JO 2NNLD 3BHIA 3DQPA 1T2FA 3PWKA 1E7WA 3DDNA 1IULA 3GY0A 3NJ8A 3BMCA 3H5RA 3UUWA 3OQ6A 3BXXA 3L4BA 4XJSA 2OFPA 3TL3A 5EMHA 1KEUA 3GA0A 4R1UA 5HA5A 2DBZA 1JVSA 4TZTA 5A02A 2AA3A 1A4IA 2D2IA 3L4BC 1PJBA 3VKVA 1Y8QB 1T4BA 3NGXA 5G4LA 1YBAA 1SOVA 2FPGA 1IPEA 2OHXA 2WD8A 3UOGA 3DL2A 3KVOA 1GQQA 3RBZA 4NBWA 4YT2A 3VZSA 3EGOA 1NYTA 3PIIA 1I30A 3BMQB 2IDZA 3DWFA 3ICCA 2V65A 3AU8A 1M2WA 3I9OA 8ADHA 5KNLA 3E9MA 5CFZA 3FPLA 3QW2A 2O3TA 2IZ0A 3D4PA 3GDOA 1LQUA 5KVSA 3ORFA 2YW9A 4J1QA 1Y6JA 5CPBA 3UAGA 4CLRA 3PGJA 4FOSA 1P1RA 2HAEA 4BUCA 1XA0A 3ZWMA 5JW6A 4FBGA 1D3AA 3FPCA 2DFDA 2GN6A 3BMNB 4CV1A 3U5TA 2V6FA 3S2GA 2GN9A 5JDCA 3LLVA 3PP8A 1PGJA 3KEQA 1H6CA 4R3NA 1QRRA 5G0VA 2GZ3A 4Q3DA 2JAPA 4CLDA 1NQTA 2BGMA 1RPNA 5L3ZA 4LW8A 1I2ZA 1HDCA 2ZJ0A 5I8ZA 5F1PA 2FHSA 3ZWNA 3BA1A 2QRLA 1C14A 3WWZA 4MKZA 4OL9A 2AHRA 1UP4A 4RJTA 3ENKA 3C3XA 5I7FA 4UUNA 4GL4A 4YQZA 3ZHZA 1LTHR 2UV8A 3EVNA 3OA2A 3JQAA 1D8AA 3ZW9A 2BFOA 4IQ8A 3GUCA 2VRBA 4GLOA 3GOHA 4H7PA 1SO8A 3LDHA 5AXDA 1P45A 5A06A 4RVDA 4TROA 5BSFA 3OQ1A 1DDOA 3ZN2A 3JQ6A 2Y67A 3SBOA 3BHMA 3MZ0A 1XWFA 1ULSA 3RFVA 3ZNPA 4I08A 1TLTA 3I9JA 4FD3A 1ZW1A 4M1QA 2HDHA 3AUSA 1UXKA 3H5NA 5IJZA 4GBJA 4E5MA 3KYDA 1E6EA 5TSDA 1DFGA 5T64A 4D43A 3CMCO 5L7YA 1CWUA 4CUKA 4FFPA 2ZCVA 3PZBA 1JAYA 4PLVA 4A5OA 5HRUA 2QIOA 3U3XA 4ZRNA 2BI8A 1VRWA 3NEPX 4CMIB 1SPXA 4I5GA 1FDVA 4NBTA 3ULKA 5DNAA 2AEMA 4ZQGA 5ILOA 4CM4B 5TRTA 2VYVA 3VPXA 1VSVA 1ADFA 1TVEA 4QX6A 2Q46A 3ZWBA 5DZSA 1EFLA 2GCGA 5A9SA 4CMBA 1VE9A 2GYYA 1I2BA 3HWRA 2JAHA 1L1FA 3JD1A 1KVSA 4YB8A 3GHHA 1UJMA 4Q3AA 1CJCA 4FOOA 5KVQA 1LEHA 2VUSA 3UKOA 1MGOA 5JYAA 1LDMA 1W8DA 3DMTC 4KUGA 1TI7A 3AFNA 4I5EA 3PYXA 3B20A 3OECA 3E5MA 2WD7B 2POQX 2IODA 1Q0LA 5DBIA 4N7RA 2NVUB 5L9AA 2VQ3A 1J0XO 3ANNA 2YUTA 4BNFA 1FF9A 2X0IA 3QWIA 4ZQBA 2I67A 3QVXA 1WW8A 2YJZA 5JCJD 4AL4A 1UXIA 4LRTB 3FD8A 5AXCA 5I7SA 1WDLA 3JD3A 1VL6A 2HU2A 3KOUA 1E77A 2O4UX 1MA0A 3WDSA 3BAZA 2Y1GA 1I33A 2FZWA 3RUDA 3PQFA 3RUEA 4E2ZA 5B12A 4HBGA 3NRCA 4ALJA 5ADHA 3O8QB 3PHHA 1HDRA 1PWZA 3WOHA 2Z5LA 1E5QA 1HKUA 4GMFA 1R0KA 2HMVA 3SX2A 1I10A 3I1JA 1B8PA 2Q3EA 3ZH2A 4AJLA 4BO0A 1HDOA 1LI4A 1Z74A 5BSGA 3SVTA 4IIVA 1U3TA 4PVDA 2X8LA 2NVWA 2X58A 4E2YA 3ASVA 3VH3A 3WIDA 4IJUA 4Z0HO 4JBHA 1LSSA 3IC5A 3EAGA 1IZ9A 4WECA 4L4XA 2E48A 3DBHA 4U7WA 1R6DA 5AXAA 3DMTA 5HS4A 9LDTA 3IQDB 3Q3CA 3WYCA 3E5RA 1J4AA 2D4AA 3QLJA 4J7UA 4TRMA 3WMXA 5HTOA 1B16A 4IDDA 3WICA 3BMOB 3L77A 4DGSA 1KERA 5C7IO 3TFOA 1UDCA 3VZQA 5CPFA 3N58A 1EFKA 3BHJA 3MWEB 4GAEA 5CAEA 5DOZA 3K96A 3G3EA 4A27A 4O59O 2JCVA 2JHGA 2ZB4A 4CMJA 4DYDA 1WP4A 3SEFA 5B4UA 2PD3A 3LYLA 4OOFA 1HLDA 4JJIA 1E1MA 2D1YA 2DLDA 1NQ5A 1QYWA 2W4QA 2BRUA 1DAOA 2VYVD 3FR7A 2W2LA 4E30A 1T4DA 3FNGA 2BF7A 4TWRA 2VOEA 4S1VA 3WLEA 3QVSA 4JROA 1LA2A 1PQUA 2X23A 4CM8B 3W4KA 1PL7A 1JW9B 1JKJA 1XLTA 1DJQA 2VN8A 4D3FA 3CH6A 4GX2A 3IUPA 2JD1A 3CKYA 1UP6A 4CM9D 2GN8A 4Z3KA 4FN4A 4B8ZA 1R0LA 2Q50A 1SMKA 5FI3A 1DEHA 2CVQA 1AUPA 1DXYA 3GR6A 4GX0A 3W1VA 4BMVA 3PFFA 3L07A 3DZHA 1U9JA 2PZMA 3DXFA 5DDIP 1AXGA 1TEHA 4ZA2A 1JN0A 4IXTA 2IZ1A 5THKA 1LLUA 1SEVA 2P2SA 1PZFA 4BNTA 4FFLA 3LF1A 1ZBQA 3X2FA 7ADHA 1MFPA 1F14A 4QO7A 3GEDA 1DHTA 4XQEA 4RPLA 1PR3A 3ZU3A 1SZJG 2QHXA 3AY6A 3GMSA 4TQGA 3IKTA 2E82A 3GK3A 1TA4A 2Z1NA 3AOEC 3RFXA 1O95A 3BYZA 3WSWA 3TZKA 1XELA 2IXBA 3O03A 4DTIA 2DTDA 1ZK3A 1PL6A 1DOHA 2C7VA 4KQXA 4XYEA 5EIOA 3WGQA 4PZEA 3WFIA 3VZRA 4HP8A 5TS3A 4WEQA 2CSUA 3VH2A 4OSOA 3UW3A 1WXDA 3F1LA 4R1NA 3OETA 4WNIA 2BGLA 2J5KA 3GVHA 3DZGA 5ES3A 3U9LA 3OJLA 3ZU4A 3DC2A 1IY8A 3DTTA 4YJFA 2X9GA 3TPCA 3KYBA 4NBUA 2OXIA 2AG5A 4IQGA 4WASA 3QVTA 1X14A 4AJNA 1JWAB 1U3VA 2RH8A 4JX8A 2UUOA 3K92A 3D5QA 3WYEA 5I9MA 3GVIA 4IDAA 4J7XA 4OKNA 5C37A 4YT4A 5AYVA 2VYNA 1X1TA 2ZB7A 3JQ9C 4GPD1 1F06A 1N7HA 1PSDA 1KVQA 4R4JA 4EYEA 2XPCA 2NM0A 1ENPA 1P1KA 4WLFA 4LCEA 4DUPA 3E18A 3U49A 5L53A 4Z9XA 4KUEA 2JD2A 4PLGA 5L7WA 3RI3A 1BHSA 2DBRA 2QW8A 2OGUA 3RAJA 3ETGA 3RBXA 3RBVA 4EDFA 4TVBA 2G76A 2ZTVA 4PFJA 2A94A 5A3VA 3VH1A 3W4JA 3WJAA 2D59A 5JE8A 4BO9A 3D5TA 3QY9A 3PPIA 4P4NA 2I76A 4NFSA 1PGOA 4F45A 3BTUA 1EVYA 3INGA 3QP9A 4E5KA 3VZPA 4ZD6A 1S7CA 3ANLA 1LXCA 3HN2A 2C07A 2VHZA 5HM8A 5LDGA 4UUOA 3T4EA 4Q3CA 4MIYA 1R66A 3VKUA 1NWCA 5THQA 1GDHA 4RVSA 1OZAA 4INAA 2WM3A 2NWQA 1YWGO 5ICMA 2AQ8A 3PLRA 2V7PA 3AUUA 4YJFB 4E12A 5JBIA 3R1IA 5J9GA 3FTNA 1YQXA 4HNHA 5GZ1A 1BDMA 3FSRA 3JQ9A 2C54A 1AGNA 1P3DA 4AVYA 2FWMX 1HYGA 1O5IA 1PR9A 1Q7CA 2B5VA 4NH4A 2HK9A 1ARZA 2DUWA 1ZO8A 4XRGA 1EUZA 1OOEA 3DO5A 5DULA 1YQDA 3C1OA 2YHIB 1C1DA 1EVIA 1VM6A 1HL3A 4XYLA 1I32A 3KSUA 3L4SO 3L0DA 3SJUA 1DIAA 1E92A 2QRJA 5AXBA 1B3BA 3V1YA 2J6IA 2X9NA 4YTEA 5I7VA 5FWNA 1ENZA 4O1MA 5G2OA 4MVJD 3RASA 2AQHA 3MOGA 4MP6A 3QVOA 1JVBA 2VT3A 4OH1A 4PLPA 4FFMA 1NFRA 4J1SA 2AQIA 4TVOA 4B3IA 1ISIA 4D44A 3U4DA 3HFSA 5L95A 4YXFA 4J49A 5I7EA 3IDSA 1M67A 1GYRA 1O8CA 1P1JA 2PNFA 2Y99A 2G82A 4R54A 4OQYA 4QQRA 3WWYA 1DFHA 3LT4A 2NU6A 4MKXA 3MJEA 4RGBA 4UUPA 2AE1A 5CDUA 4YJGB 4GX5A 1NVGA 4RDHA 1ULUA 1SEPA 4Q3EA 1IHYA 1ZH8A 3IIEA 1P44A 3BMCB 2GRAA 3OH8A 4GH5A 3CEAA 1SC6A 4GSKA 4BGVA 4ZJUA 3A1NA 2OOSA 2I5PO 3DAFA 5IZ4A 1LQTA 2EKQA 4BL5A 4ALMA 4TRRA 1T25A 4J2HA 3BZUA 2PFGA 2EW2A 1LSOA 1N9GB 4PRLA 3ZWVA 3ZWAA 2FPIA 4DLLA 2DPGA 3ON5A 4IMRA 5C7OO 1B14A 3SC6A 3D3EA 4IMPA 2EHDA 4E21A 5CDSA 5LDHA 3C7AA 1FMCA 1QORA 1AXEA 5BR7A 3ZU5A 2J5QA 5B1YA 5A03A 3A14A 1U2GA 3DBRA 1E3IA 4KP7A 4CM4A 2NQ8A 1F8GA 4RVFA 4Y6PA 1GZ6A 3WR5A 3U09A 3HG7A 4NQZA 4XJTA 4CMIA 4EITA 4CMEC 1ML3A 1QR6A 2AEJA 2EF1A 3NDRA 4R9SA 2DAPA 3Q6IA 4BNZA 1FK8A 4RVGA 5CHEA 5JYEA 1BMDA 4UREA 4WLVA 4XGNA 4BNUA 4B8WA 1TXGA 2BLLA 3I6IA 3DOCA 1PGNA 2OORA 2Q49A 2O3RA 4PZCA 3QV1A 1HE4A 3AUAA 4WLOA 3KYDB 3AM5A 4FDAA 4B7XA 3UH1A 5EL0A 1XGKA 4ZICA 5K9ZA 1GUFA 2J3JA 4KWIA 4P8RA 4FC7A 3TRIA 1GV0A 5IDYA 3TFQA 1ONOA 5DOVA 5IN5A 2Y1DA 3TDKA 4RPHA 5I9NA 1EMDA 3PZRA 4IDBA 1A7KA 1UZNA 1P0CA 3FN4A 1DRVA 4WGGA 4PGFA 1DLIA 2EWMA 2ILTA 1I3KA 4TMFA 2HK8A 1ONPA 4Z9YA 1GV1A 3HDJA 3K6JA 2DKNA 1R4MA 5IDQA 1PJCA 3FNFA 2A92A 1Z6ZA 1LC3A 3ROPA 3GZNB 1ISJA 2DT5A 3WFJA 3JQFC 1F8FA 1ISHA 1U4SA 5CDTA 2CDCA 3BIOA 1GEEA 1PWXA 3ETEA 4DMMA 2AE2A 5A5EA 1UZMA 2D8AA 3AOGA 3CTMA 1DFIA 1ZVMA 2F1KA 1MB4A 3MJCA 1HSZA 2PWZA 3PGXA 1HE2A 4IBOA 5IXSA 3EMKA 1B2LA 3G49A 3AFMA 4XYGA 1XYGA 4OYRA 5KKAA 2IEBA 2HMUA 3BMNA 2W2LD 3FHLA 4CMHA 2PGJA 4U6SA 3KUXA 4IINA 3JQFA 1K2WA 1Q1NA 3GVPA 4I9HA 1VJ1A 3LT1A 1YKFA 4RF4A 4EUEA 5A9SB 3GVXA 3UFXA 1LDYA 4UVEA 3ZV6A 2QYTA 1X15A 3OJ0A 4AJJA 5IZCC 4BB5A 5KVVA 1C3VA 3E1KA 1W4ZA 4FJ1A 3H9QA 3Q2KA 4RLHA 4L0QA 1N92A 3H4VA 5T73A 3TJRA 3WQQA 1LLCA 4NK5A 5KTKA 4IZIA 1GAEO 1ZJYA 2PZJA 2H63A 3ZNNA 1KVRA 1B7GO 2HMTA 4W99A 5A05A 4CL8A 3OF2A 1RM4A 3DMYA 4ND3A 3H5AA 4LK3A 2CDAA 5DCUA 2NSDA 2NTJA 5JPIA 1HEUA 1KC1A 4Z0PA 4D79A 1DRWA 1Q0QA 4PLFA 3TF5A 4K6CA 4ZQFA 1GYQA 4GVLA 2PGDA 4L4SA 1J5PA 3I3OA 3O26A 5JS6A 2DFVA 1Y8RB 3GMDA 3GC6A 3K2EA 2AQKA 1WPQA 1NXQA 5IDWA 2W90A 4JJFA 3KSZO 3QWHA 5JNLA 5JAQA 1JA9A 9LDBA 6LDHA 3IAHA 2IYOA 2H9IA 5T67A 1E6UA 4NK4A 2OUIA 2DBVO 4NJMA 4CQMA 1DIRA 4BNHA 1F0YA 1PJSA 4CPDA 5C3MA 2O3JA 1O9BA 2PKRA 3EHEA 4NFYA 3RWBA 3U4CA 1VL8A 2IE0A 3ZV5A 1WZIA 4ZQEA 4BNLA 4H15A 3WJ7A 1TT5A 2I66A 3ROMA 4PG6A 3P2YA 2B83A 4DLAA 2UVDA 1DLJA 4UUMA 4P4LA 3MTJA 1RWBA 3E9NA 3F6YA 3WGOA 3NDJA 3DZKA 2Z95A 3F9IA 2G0TA 1ISGA 5EQFA 2GZ2A 3TWOA 4JCOA 1K6XA 2VWQA 3HZZA 4FC6A 4N5NA 5HWSA 1GQ2A 1H5QA 4BMSA 3PK0A 4J43A 2DC1A 1C1XB 2IZZA 1LDBA 1A9YA 3DBHB 2C7GA 4CM6A 3BTVA 1HDXA 4DL9A 3A4VA 3MWDB 3DONA 4B7CA 1EE2A 2X1HA 1ADCA 2B35A 4DRYA 1U3UA 1L7DA 2Q1UA 3O9ZA 3PDJA 1XQ6A 4MVJH 1LSUA 1NHWA 4CM8A 3H3FA 3K9QO 1HZJA 5A9RA 2FMUA 4YAIA 3NX4A 2HUNA 2YQ4A 4RPGA 1E7MA 4RZIA 1Q7GA 2FOIA 3O8QA 5LC1A 5JC1A 3Q9NA 4XIYA 4EBFA 1ISMA 4RZHA 1C0PA 3WTCA 4PCVA 4BNNA 4WOKA 1U7TA 2VUUA 4BQPA 3DBLA 2G17A 4C7JA 1PU2A 1DHRA 3D0OA 3PIDA 5COBA 5EESA 3TOZA 3D1LA 4DIOA 2HK7A 1BWSA 2YV1A 3QWFA 1GUZA 1Y9AA 3LU1A 3V1UA 4IS3A 1MX3A 1QYVA 3K8ZA 5JFOA 1GR0A 3OJEA 3CXRA 4M54A 4D46A 4E4YA 5BSHA 1XR3A 1U3WA 3LC7O 2P5YA 2FY8A 4EZBA 2ZIZA 3S2EA 1ZK4A 1UDBA 2BFPA 1BVRA 3P7MA 2BH9A 4D7AA 3I9KA 4GMGA 2X0JA 3STHA 1T26A 4DXHA 4R41A 3GAFA 3VDRA 5JAZA 4W6ZA 3AI2A 4NPCA 4F46A 2RHCA 5JO9A 4GWGA 3HJAA 3RCBA 1KYQA 2X9VA 1GFSA 2RAFA 5T8KA 4TRJA 3JQBC 2PD6A 5DP2A 4BGEA 1PZHA 3C1AA 1BRMA 2B4RO 3FNHA 1XU9A 4CR6A 3WBBA 1NQAO 1ENOA 1V6AA 4BKOA 1MUUA 5B4TA 3M2TA 3KSDO 1E1LA 1ZSVA 1WMAA 3RJ9A 3CUKA 2Q1WA 3K2BA 5ILGA 5ER9A 5K6AA 3NGLA 2YZ7A 4IPTA 4P22A 4LVCA 4A0SA 3ZWYA 2X86A 5CP8A 5JDCC 1ZZEA 4PLHA 2VZ0A 1V0JA 3WQSB 1UXGA 1IOLA 2P91A 4M8SA 4FB5A 2GUGA 4IDEA 4OHUA 4R01A 3WBFA 2WTBA 1AN9A 3RSHA 4JK3A 2NVUA 3ABIA 2YYYA 3JQ7B 4F6CA 4BGUA 4DC1A 1PZGA 4E32A 3VPSA 4TZKA 2A35A 4YRDA 3WTBA 3QQPA 4NU5A 1G0NA 3HB5X 4I1IA 1EE9A 2OBNA 3PHLA 4NIMA 5EQDA 1CERA 3DOOA 5K6AC 2EG9A 1DC5A 1LRLA 2DTXA 2OO5A 4GWKA 2JCYA 5JAIA 1IUKA 3RUHA 3I23A 3R0IA 4J2OA 3L9WA 5L4LA 3L6DA 3CMMA 4BNYA 1VKOA 5IDXA 1E5LA 4YEDA 3KETA 3E82A 2Y0CA 2C5EA 1YOVA 3IJPA 1T1RA 3JYNA 1ADBA 1UDAA 2ZTUA 4OM8A 4N18A 5U9CA 4NZ9A 3COSA 4XIJA 5DF1A 2PK3A 1ZJZA 3IMFA 4AJPA 4PLYA 4E5PA 2GPTA 2RH4A 4DVJA 1U5CA 3CSDA 3RUAA 3NKLA 4BKUA 4BNIA 1PGQA 5IF3A 4CR8A 2W98A 4HXYA 4IDFA 4Q3NA 4BVAA 4WEOA 3GHYA 3ZWXA 1YOVB 4DIFA 1J6UA 4MKRA 5F5NA 3PJFA 1NPTO 1YL7A 3ADPA 2G5CA 2DTEA 4JGBA 5TT1A 2WE8A 3PRJA 1X7GA 1VJTA 3ZI0A 4YJDA 4XB2A 4MO2A 1E3JA 4QXMA 4CV0A 5JDIC 2Y0DA 3QWAA 5BNTA 4BOYA 2ET6A 2YQ5A 3JCZA 2AXQA 2NU8A 3DZFA 5ITWA 4HFMA 3W6ZA 4FCCA 3DAPA 5GY7A 3FR8A 3UICA 4Z9FA 4ND2A 4R68A 2QX7A 4AJKA 1MXHA 3WGZA 4W82A 1GZ4A 3JSAA 1VL0A 1YE3A 2B4TO 2GN4A 5CG2A 4GKVA 1EQUA 3H3JA 4CV3A 1IPFA 3CINA 3JQCA 3HDHA 4JNKA 4TSKA 4MIOA 3B6ZA 5TC4A 1YXMA 4WNCA 4YJHB 1GYPA 3E48A 3KYCA 4CL3A 1A5ZA 2VNAA 3ZNQA 2VZ8A 4HNGA 4XR4A 4ALKA 4R69A 1QYCA 4DPKA 3AOEA 4OJNA 4HFNA 1GY8A 1ZCJA 1FDTA 2BD0A 5FI5A 1M6HA 2I99A 4I5DA 4MVJE 2ZJ1A 3PEFA 2OL4A 1SCUA 1N7GA 5T5QA 4RPKA 1WWKA 4EJ6A 5COQA 3MOIA 1NR1A 3PTZA 2ZKLA 2ZYDA 2PH5A 4EUHA 3E6AA 4XQCA 5BNFA 4D42A 1ZK0A 5JYFA 4L8VA 2G1UA 2VUTA 1T2CA 2JFGA 2W2KA 2PV7A 3KM0A 3RVDA 2JKVA 4CQLA 2Q1TA 5ENVA 4R1SA 1GD1O 1NAIA 4WUVA 3WXBA 3VVCA 4AJIA 2WEKA 1SB8A 1PZEA 2BMAA 3AM4A 4NFHA 3UN1A 4OMUA 1N1GA 1P1FA 3INRA 1V3TA 2O4CA 4J9UE 1S6YA 5AQ1A 3IUSA 1Q7BA 1E7RA 3AM3A 2NQTA 3C8MA 3GNSA 4CUZA 3TOXA 2ZB8A 3AJRA 3ZV3A 4XD2A 1PEDA 4CMAA 3WS7A 4W9NC 3H9GA 4JP2A 4BMNA 5TX7A 4Y9DA 4KMSA 4XB1A 1M66A 2XXBA 3DHNA 1U5AA 1N2SA 4J4BA 4XA8A 3RKRA 4BNJA 4DQUA 1Y81A 3PLNA 1P0FA 2YHIA 1ONNA 2ZYAA 3GNQA 4P38A 4XRRA 3D7LA 5U4QA 1ZMOA 4MP3A 1MXFA 3DZIA 4FFRA 2UYYA 4C4OA 1BGVA 4J4HA 3P19A 3OA0A 1PL8A 4NR0A 4YJGA 1H9BA 3T4XA 2PD4A 1KEPA 1UZLA 1ZEMA 2RBEA 3WG9A 2DM6A 1UAGA 1DRUA 5TJHA 3D64A 5TJ9A 4B79A 1UH5A 4FGWA 1E6WA 2B36A 2OMEA 3F46A 4YAGA 1ORRA 1OC4A 1KVUA 4RCVA 3RU9A 3ENNA 4EEZA 1BW9B 3K31A 3R3JA 5L45A 1QP8A 4YVFA 2Q2QA 5ITVA 4DBZA 1LC0A 2SCUA 1CF2O 2GLXA 3H65A 3HDQA 3WSVA 3ITDA 1GUYA 1IE3A 4L76A 4OKIA 5JCXA 4NNJA 1U8FO 2EP5A 3EDMA 3HSKA 3OM9A 3VTZA 3Q9UA 4B7UA 3EC7A 1PS9A 1EEHA 3IKVA 3JD2A 3ZHYA 1MP0A 4BO1A 2R00A 2NTNA 4E5YA 4YR9A 4BNKA 4R9RA 1MC5A 3H8VA 4WLNA 3WGHA 2P4HX 1DC3A 3QA9A 4EUFA 3UXYA 1I01A 2QYSA 4WPGA 1FDSA 4UVGA 2CF5A 3PI7A 1XSEA 4NMHA 5EN4A 4BO3A 4E2XA 3GAZA 3I5MA 2WSBA 2GSDA 2NTVA 4XQGA 1LNQA 2R2GA 5F3RA 1ISFA 2I65A 3EZLA 3GGPA 4XYBA 3LSYA 5JO0A 1LJ8A 4NHEA 3K30A 3RU7A 2RIRA 4PLCA 1EBUA 1P77A 3RQSA 2VTEA 4AFNA 2PH3A 3VVBA 5ICSA 3ZHXA 1RJWA 2CFCA 3JQGA 1I3LA 1TT5B 2W8ZA 4J6FA 2NACA 1K6IA 4UVHA 1YB1A 3ONDA 3GT0A 3ZDFA 4Y98A 3JQ8A 2HKIA 4ONEA 3G1UA 4ZVVA 1ZK1A 4Q3BA 1XEAA 1GL3A 2X5KO 4O5OA 4KUHA 4O0LA 2AEFA 4WE3A 3C7CB 1E3WB 4YRBA 1G0OA 2X6TA 5B4VA 4RF5A 4NBVA 2OZPA 2GNAA 1DAPA 4MVJA 4F3YA 4XR9A 3I9LA 5JXWA 1B15A 4FQ8A 1Y8RA 1QLJA 2J3IA 1E3EA 1VI2A 1UXJA 3C1TA 4I8XA 3ZNOA 4DWVA 4EGFA 1RYEA 1JWBB 2GD1O 2OBYA 4W4TA 4CM9A 3RC7A 4DIBA 1A9ZA 4O63O 2AMFA 3RC1A 2Y05A 5MDHA 1IHXA 1MC4A 1BW9A 3I9MA 2C5AA 4IUYA 1BDBA 1DBVO 3KTDA 3ROQA 3WX0A 4L9RA 2ZYGA 3G79A 4K9DA 3ONFA 4FSHA 4CM3A 3JD0A 2PZLA 4WJZA 1BXGA 2HJSA 1OAAA 3OJOA 3ZWOA 3KB6A 1VC2A 3RJ5A 1EK5A 1NPYA 2J3HA 2HMWA 2VTDA 4KZPA 4M86A 5A1TA 1RM5A 1E7QA 1KEVA 3E8XA 3KZVA 3NTRA 1R12A 1WVGA 4IGEA 4OQZA 4OIMA 4YA6A 3IP1A 2VT2A 2F00A 4ZN6A 2DU8A 3F47A 4BNXA 2HCTA 4IGFA 2Q45A 3EK2A 4WKGA 1K0UA 1BXZA 1A72A 1MG5A 4A10A 1CDOA 6ADHA 4E6PA 2PLAA 4RF2A 2HJRA 5TQVA 1HDYA 3AK4A 4KDFA 3DBVO 1E0DA 2FPPA 2ZTMA 1KIFA 3VH4A 2PKQP 4IY1A 4RF3A 2CF6A 1MLDA 3UCFA 3F4LA 4BNWA 5GZ6A 3WGYA 1G1AA 1LLQA 4R3WA 1NP3A 4IJWA 4TKMA 1PJTA 4XKJA 1MV8A 4YQYA 5KKCA
chains in the Genus database with same CATH superfamily
3KIPA 9LDBA 4PEVA 1FVFA 2JLQA 2QN6A 1OLOA 2GHQA 1R27A 2Y6UA 4G0MA 1J7KA 5FFNA 1FMFA 5CEEA 5DGHA 2ZBVA 3OQPA 3VOSA 3M6IA 4LHZA 2UAGA 3IMEA 4MDHA 4LMAA 2CD9A 2WC1A 5J4LA 4J4TA 1E4EA 3BRCA 4N3AA 2JH9A 1KI6A 4DJEC 5EUMA 3QE2A 4QUKA 4TTIA 5BRJA 5B57C 1KL7A 3TLMA 3FYHA 3H83A 4GOLD 2GR9A 3W2IA 1VLJA 4PIPA 5MN4A 2XB9A 6NULA 1F6DA 2PL5A 3BB4A 3COZA 1M8JA 2CLCX 3LFTA 3IR7A 4ND4A 5AW3A 2XGJA 2OV6A 4QATA 1P31A 4PGHA 4BLVA 2JJQA 5K3SA 2H2IA 4ML3A 3G0OA 2FMXA 3S7TA 5HF9A 1H6AA 3VPFA 3L7DA 2QLFA 1KSHA 2VCYA 3AHDA 3G88A 4KIFA 4Q4HB 2X0EA 3RIMA 3JYLA 3BS4A 1SH7A 2ZUUA 1JR3A 4PSUA 4WXMA 4Q4CA 1W76A 1V7PC 1OAOA 3SVTA 4ZTZB 3V8EA 2QROA 2HIAA 2IYPA 2WHXA 3DQZA 3NT4A 3W6OA 3ZJ4A 4QODA 5DP1A 4LXTA 3BDVA 3D8UA 2GEDA 5ETJA 3W9BA 3FF4A 5JAPA 2XMCA 1USKA 3UMJA 3QLTA 1ZIDA 4J75A 4YJ3A 4LTDA 1SA0B 3BTSA 1C5KA 2R7AA 1U2DA 5U4XA 4RJ2A 1XX6A 5CIQA 5JT1A 4I5FA 3ZU2A 5D3ZA 4HVAA 3FGZA 2VPTA 4GVXA 2B0JA 3DGFC 3X0DA 1S2LA 5DLQC 1P18A 4WCFB 2ZQZA 3SMVA 5IU6A 2I2AA 4QWMA 4L8WB 5JLJA 1FXSA 1OFHA 1T5BA 1K63A 2OV3A 2YWJA 3O73A 4MQFB 4N5HX 1EX6A 1PIWA 5FYDA 5FV4A 4WK6A 4RMHA 1XAHA 3DE4X 3K1AA 5AI6A 3RYIA 2H17A 1QNFA 4I9UA 3RTBA 5IYZA 2MYPA 1YBHA 1RYHA 2Q99A 4ZAWA 4MVJG 3BE4A 4GOXA 4DUYB 4AECA 3GZJA 2W71A 2QNBA 2A33A 2WAAA 3BBPA 3EW7A 3JWEA 5CUQA 2MCFA 4RTKA 1ZI6A 2GDJA 3U40A 1QYRA 4HY3A 5JWHA 4LRUA 3A31A 1UPCA 1T1SA 3FOFC 4TMWA 1B8VA 4ERXA 3H99A 3UXMA 1G20E 3R0XA 4IV0A 2OAP1 4LV5B 4LWZA 2FLVA 1QGED 4N3CA 1KAEA 4QVKA 5ADWA 2ZT5A 1JLLB 3QBVA 4NATA 4PO1A 3RYCB 2ZBUA 3ZG6A 1L7AA 1IJFA 2D5CA 2WU4A 5AW8A 1BMTA 3DLTA 3A3OA 2V5UA 5DBFA 3DP7A 5SY4A 4AMBA 3FX2A 1EWQA 3MUOA 2Q2VA 3LT0A 1JXOA 1AZSC 5EPOA 4NYJQ 1Y5NA 1RHMA 4JGGA 5G0WA 1L8OA 3DKRA 2CL6X 1ZIPA 4UAVA 4DZRA 1ZWLA 1K6JA 1Y89A 3F96A 3KV1A 4OTZA 4NFLA 4N54A 1BXKA 1JUDA 2HZBA 5EE0A 3I9V1 3IIMA 3TLKA 4CIXA 1K6MA 1B8NA 1JHQA 1ORVA 5DGDA 5AVUA 3MHPA 1CHDA 2FDXA 3AF1A 5IZCA 3CA8A 4MVXA 1V6SA 1Z6XA 4Z0TA 3BHNA 4OREX 2OD7A 3LNTA 1XZPA 2UKDA 2H7XA 2CL5A 4XIGS 1Y6FA 4WQMA 1MVOA 1RBYA 4F56A 1NTOA 4DHEA 3UFXB 5AW6A 2XE6A 1FY2A 2PVPA 3FROA 3CLTD 3QELA 4FYKA 3AJDA 3HB0A 2FSVA 2WA2A 3Q87B 2I0FA 1ZK2A 2PHZA 3PT5A 1QVAA 2FPRA 2Z57A 4QO8A 5EXSA 2DVMA 2AJBA 3NOOA 4E13A 4AY4A 1G3IA 1U0HC 3VC7A 4M0CA 5H82A 4DLKA 4YRSA 4DMLA 4MYCA 3FWNA 3PXCX 5K3DA 2HDWA 2E3JA 1NLZA 3KRTA 3NT2A 3I9NA 3K0KA 1NQVA 3BE6A 3GD7A 4HDAA 5CHYA 5AIAA 3T5MA 3U62A 4FNGA 1DAHA 4K2AA 3UAOA 4B3JA 2OGTA 2R6AA 3NYIA 1IK6A 5CM2Z 3FBGA 2DBQA 1DUVG 1H94A 4H17A 3K2IA 4KV9A 1Q44A 4RQUA 1T9HA 2P9CA 3NT5A 1V1RA 3EFHA 2Z2JA 1YCHA 3D54D 3EULA 2HCBA 3F1KA 3I0ZA 1J8YF 3IDOA 4LQ4A 1NV8A 1DPGA 5F52A 3HE3A 1QDLB 2EYQA 2IXDA 1XTTA 1KHTA 3CLHA 4I4NA 2HH9A 1SVIA 2XWSA 4RVHA 1BJRE 1G42A 1KU6A 2WWRA 3H87A 4FNAA 3QM1A 2ZDGA 4MYUA 2O50A 4C0XA 1Y33E 4HZIA 2O7QA 1QO0D 4KQCA 3FFBA 3RU3A 6GPBA 4S1PA 4ABTA 1SBNE 1WXEA 4H1WA 3HADA 3V5NA 1UKAA 4Z9AA 2PSFA 3M9XA 2ORWA 1QWSA 4KBGA 4IFIA 3GV0A 2F17A 4DIMA 2IEAA 4QBFA 4K26A 3UMFA 5H0IA 2HF8A 4EM6A 3T5TA 3ODPA 2VEDA 1RQXA 1D6JA 3I83A 3GO4A 4MYTA 3B8EA 3KQYA 4BQSA 2IOYA 3WQBA 2WYIA 5F7OA 3AKDA 1U1DA 4EYSA 2O3SA 3A1VA 3H2ZA 1CEQA 2H51A 3HABA 3B48A 2BELA 1TM7E 3HFGA 3OIFA 4Q1BA 5F64A 2BHLA 1SVSA 3BD6A 3E53A 4FOLA 5SZKB 1IDN1 4XDYA 4D9BA 5HUQA 1PR2A 1OCEA 2IX3A 4G1EB 3B1JA 2C2WA 1RRMA 2HYDA 1PNRA 1K4YA 4GYJA 1L3BA 2H0QA 4G2NA 4E5VA 1YS6A 2JW5A 3WK9A 1CF4A 1CVRA 1NQUA 5BOVA 3KBOA 1JR4A 4W9MC 1LDGA 1NATA 2OFWA 3EGWA 3MT7A 3TL2A 2FRDA 4Y18A 4I8IA 3PVZA 3TN7A 4C04A 1Z15A 4PVCA 2YWGA 2IYFA 2AKAB 1YR6A 2YJTD 4W6QA 5E7IA 3N70A 1H2BA 1CHNA 2JGDA 4OHOA 1YQEA 4H6XA 3H2SA 4US0R 4KWEA 4RESA 2GAIA 1RC8A 2OP0A 2LWIA 1PQPA 1MIOA 3D6JA 4MQ6A 5DSXA 2HLDD 4GQBA 4S1TA 4K6KA 3LYUA 4M1ZA 4GR9A 1T6ZA 4OXYA 4OHVA 1JZQA 2Q5CA 2PV0A 1SIWA 1QS0B 4EMSA 3FTCA 3QHPA 3BGWA 2ZRIA 4KXNA 4D4HA 4GLBA 3SZUA 3C48A 1KAOA 3G5TA 3VR2A 4CEHA 2QAJA 3GARA 3CN9A 3ADDA 3NM4A 5CAEB 3WV5A 3K0EA 1ZM9A 2BGUA 3M89A 1QV6A 2VHXA 4MPTA 5B1DA 4YRAA 3PC8A 1FJHA 4N3BA 4UTZA 5DEOA 3K0AA 4XLZA 1IYZA 1PGPA 4B5LA 3BGIA 1Z0AA 2HO5A 3JPWA 4UPVA 4MV3A 4KRGA 3WB0A 1YRAA 2EARA 4YP0A 2FYTA 3REFA 3QEJA 4LSMA 1N5DA 1XZGA 1X7HA 1PSWA 2V6JA 3M1YA 1H0KA 2V6GA 2Z2IA 3GFQA 3I52A 5DCWA 2O8CB 3IHTA 2JANA 3WLJA 5GONB 4UOZA 1YJ8A 3RD5A 2P68A 4IX9A 4LF5B 1ZSNA 1DIBA 1GTJ1 4GBMA 5SZHB 4DJTA 3KPWA 4CKEA 2OLEA 2OZLA 3MTEA 1VJGA 3JQAD 3ETLA 4B4VA 2GT1A 4GMHA 3TZCA 3B82A 2Z56A 4PLZA 3UY4A 2EEPA 3IP3A 3RS8A 5LMZA 1N9ZA 3F6SA 3RIXA 3KKKA 4LBWA 4NS4A 5IT5A 4RSHA 1WKBA 4AWBA 5C1OA 1ECPA 5D5QA 4AJ4A 1Q1GA 3PVSA 4TUYB 4CEJB 1TGVA 4YY3B 4B3RB 4EGCB 1P4AA 5IVIA 1ND6A 3Q1LA 2FHPA 1N7IA 2O14A 2BEJA 3KAQA 2G70A 4FUQA 3PNBA 1U0BB 2QU7A 1G8AA 1UJCA 4WOCA 3UM9A 3N8IA 2IP2A 4W5HA 3GP3A 3RVSA 2QUZA 1E1KA 1U2TA 1UIRA 2CL7X 4MW0A 3OIDA 4H3VA 2GAFA 3ANYB 3F90A 1R8YA 2QUHA 4EPWA 4MROA 3K70C 3C85A 1IB6A 2IYTA 2TYSB 4UULA 2ZBPA 3FAKA 2ON6A 5CDHA 3BQ9A 1PX0A 3EVDA 3KOWA 1WNTA 2GJ9A 1WUJS 2H16A 1L5YA 3GF4A 4G2TA 4NF2A 3OY7A 3LQKA 4JBWA 2BGKA 1XMIA 5GGXA 3PUKA 4CF6A 4PC2A 3L1HA 4LYJA 1GZHB 1EVLA 2V7QD 1K89A 4NMMA 1LGYA 4UUQA 4BZQA 4DNFA 1GTZA 5FQOA 1ETHA 4RXUA 2PTHA 3SC2A 3N2GA 5DNEA 1IU9A 4M1KA 2OO3A 3EDCA 3KR2A 3JTMA 3D8RA 3QIVA 1IVNA 1VA4A 4I0WB 5JS1A 1E5DA 4MKHA 3UCEA 3PHGA 1YDFA 4ROSA 2IV7A 2AUMA 2WDZA 3IUBA 3MWGA 4REOA 2PFSA 2BDTA 4TTJA 2BM8A 4M49A 2B4KA 1F7UA 3OCCA 4NJOA 2XXJA 3A04A 3KPYA 3OBBA 5CEFA 3LOPA 4JI7B 5CFRA 1B6GA 1R5OA 5A2GA 1QZUA 2C9MA 2MYNA 2G4LA 4ER5A 2FR1A 3FGNA 1GPKA 3V1LA 1E3WA 4DM4A 2Y1WA 2PPVA 1L5FA 2VZLA 4AJ2A 1YBFA 3IE2A 1TAUA 3G23A 3R9IA 1LBEA 1H0HA 4OQQA 2A59A 3FYUC 3Q8WA 1VCNA 2FWBA 4ESHA 2YHSA 3ILVA 1GRQA 1SCQA 4CKBA 1KOJA 4RIIA 3EVZA 5G0TA 3MYYA 3RFTA 1TCVA 1ZMBA 2XB6A 1V35A 1U6KA 4RD1A 3WYBA 1FBTA 2ZIXB 3AR7A 2WHQA 3NV9A 4DBLE 3OCYA 3T1NA 1U1GA 3PNOA 4IDCA 1JMKC 2EFCB 4L6AA 3TXXA 3THWB 2NXWA 5IANA 1HE5A 3HKBB 4G81A 3PYMA 4Q02A 4CFYA 3KK0A 1TUEA 2R00C 4TSFA 4OA5A 2PBZA 1IN1A 2Z8XA 1PRYA 3PG5A 1GAJA 3VBEA 1M1NB 2QR3A 1XMOB 3VYRB 1B8OA 1N2CA 1Y5LA 4RW0A 5EMNA 3UJPA 1HZZA 2Y1XA 1L4NA 1RQPA 2CJPA 3KKQA 1W1IA 1BS1A 2OM6A 3DMDA 3ABQB 3MSXA 2FQXA 3ILYA 4ZHSA 4AY3A 5EQJB 4LGVA 4RL6A 1JIJA 2XZPA 5KDOA 1OH7A 1P33A 4YAFA 5KCZA 4Q9AA 3OQMA 4BB6A 3T5PA 1PD1A 2WTXA 5K0NA 1R8JA 2FRVA 4NCBA 1RHQA 1JFFB 2XTJA 1SAYA 2XUHA 4INJA 4XCXA 5AOVA 3E0XA 2F43B 3CWZA 5BYKA 1PJAA 3RC8A 2BR3A 2J9FA 1JLLA 4HMPA 4JWKA 4M2LA 1L5HA 3O4HA 2PN1A 1N0HA 2DECA 5A5GA 3CG4A 3WJ2A 3A1CA 4JR1A 4M89A 1YIDA 2F8TA 3FCOA 4RBNA 5KSWB 1L1RA 1EFPA 1P7PA 3V48A 1M1ZA 4JLWA 1Y3IA 4QASA 4XDGA 3QYFA 5FLKA 1NJ8A 4CLHA 4M36A 2NXNA 3LQFA 4JJGA 1SG9A 5HG0A 5L9AA 3WGMA 4EOGA 1JKFA 3AWDA 2IDKA 1PP4A 2IS1A 3Q6MA 1SWWA 1EH5A 4ZTUB 5LB2A 1UXHA 4JU9A 4JLKA 5KYYB 3SSMA 3DG9A 1DVRA 2G5GX 2QAGA 1TYAE 5IJ9B 4Q4AB 1QIMA 1V39A 3MQ2A 4OXIA 4GKKB 2C9OA 3LW8A 3TOSA 1KZHA 1BVYF 2GGSA 2P6OA 5AI8A 4TL6A 5HTKA 1RCFA 4JC5A 1VLMA 1A7AA 1YJQA 3BWDD 2FA9A 4FX5A 4P35A 4V0LA 3U4HA 2R96A 5JH7F 3TGPA 1MAVA 1EP9A 4CW7A 2P9EA 3K8OE 1KBZA 2FQ1A 1I1NA 2EEZA 3U31A 4CDNA 1Z38A 3F7TA 2M2IA 4HYTA 3T7SA 5DLYA 4B6FA 4AUNA 3KGDA 4BX2A 1A9TA 1Z5OA 1Q0HA 3O0DA 3O9MA 3QTTA 3O4RA 4XGKA 1K97A 3W1EA 4CIBA 1ZKMA 3NDIA 4YLYA 1MBZA 5EERA 4TKVB 4NBLA 4JX9A 4KIGA 5AKLA 1PKEA 4EY6A 5KNBD 1KVTA 1SBIA 3BGVA 5DYTA 5KPJA 1O94C 3O84A 2CVOA 4DIEA 3BD8A 1UYJA 1TQDA 1I24A 3ZQ4A 4NI5A 2GZHA 2YWRA 4I7EA 4OEHA 4TMYA 4C5AA 1VKHA 3V1KA 3DMGA 1MEJA 1Y4SA 3TM5A 5AVWA 4PRKA 3SPXA 1IBMB 1Z0SA 3TQHA 3WWEA 4AWXA 3BWMA 1E0AA 1WW2A 1T9AA 3RUCA 2NG1A 1V3UA 5E2BA 1O94D 4XSGA 4K40A 3ZXUB 4Y2UA 4OUDB 4QSMA 1HLGA 3BXPA 4LDZA 5JI3E 4RHCA 1XL1A 3FRHA 3QEKA 4OQXA 5H1YA 5IW8A 4BO4A 2BMFA 3JYQA 3M0EA 3M6UA 2XA9A 3QXCA 4WESB 5ALEA 4G5QA 4Y6SA 3E22A 1YF3A 3SY8A 1EK6A 4KTTE 1YVEI 1SGWA 4IM7A 4URUR 3EXFB 1QGOA 4XTCS 1KQOA 4URVR 1V2GA 3CR8A 3UWSA 4W63A 3ICPA 2BFBB 2BMVA 4Y3UA 3LUDA 4ZAZA 2NO9A 5I8WA 4DJAA 2XLCA 4DNQA 5TGDA 1E1QA 3L7AA 1PYOA 1KH3A 4LFAB 1XAJA 2WVHA 3CLUC 1AV7A 4P58A 3DE2X 4Q0MA 5ADUS 2WT8A 3O8OB 2DBYA 5E7JA 4F93B 4IOJA 2WYUA 3QBDA 4WBNA 3L0OA 4KXLA 4WUTA 1E6MA 4FFBA 4MJLA 3GRAA 4I1OA 3V8VA 1R16A 2AYYA 4UCWA 3GLGB 2XD4A 3B89A 5FT9A 621PA 1TF5A 3QXGA 4RLSA 1QRAA 1I3OA 1RLIA 4MMYB 1O54A 4BKPA 2OT3B 1LRKA 4JL6A 1H93A 2V0NA 3ACBA 4LISA 3VYVA 3K0AB 4ARBA 4AYTA 1SKUA 5EXXA 1PFYA 2YW2A 1C3OA 1YKGA 4JOQA 4LMPA 3V9PA 5D00A 1OV4A 4Q37A 3B1XA 3HEMA 4NCXA 1FQKA 2O2YA 3IHLA 3CLKA 2ECOA 3EFOB 3I76A 1D6NA 4ZHQB 3MCWA 5BMVF 3ELYA 2M1ZA 3HHEA 1NXOA 3ORYA 2JFHA 3WIVA 2XUZA 4I4TA 3DR3A 1MW9X 2I4RA 4ND1A 4BO5A 1U2SA 2AFIB 2Q7DA 1G16A 3T34A 1SZCA 2Z1MA 1P5JA 3GRYA 2DHQA 1DJPA 5CLQA 1B0ZA 4BVEA 1FCJA 3U7RA 3NTOA 2OXEA 4BFVA 5HXAA 1XG5A 4GG1A 3HP7A 5HDBB 4AN4A 2QW1A 3N5KA 3CB4A 4EDHA 4JBYA 1CUJA 1AO0A 1YVPA 5KJ6A 4RV5A 3VDQA 1FU7A 2WOOA 2WYHA 3BVPA 3OF5A 2Q1YA 4NZYA 3S2FA 4A4DA 4MW6A 1IONA 2REQA 4AXXA 3HSSA 2LV8A 4C14A 5K0GA 1J2TA 4NL4H 3MD0A 4IJ6A 3D6MA 1B0PA 1RKXA 1FRVA 3MJFA 1RP1A 4M87A 1J24A 2PMFA 1C1XA 1NWHA 1Z0DA 4TVSA 3MINB 2DLNA 1AB5A 1V1MA 3UQZA 2OGWA 1W0CA 2V6MA 4BMPB 1MIHA 4MAAA 1NN0A 1QUFA 1RI2A 4KB5A 4YP9A 4H35A 3P45A 1QTNA 1PG0A 3VR5D 3RRBA 4D4LA 5TMEA 1PSZA 1USGA 1VLZA 3A2MA 3DPIA 3GZ4A 3S2SA 1SHJA 2X0NA 1R6AA 1GAXA 2BF4A 2B8TA 3X44A 4L74A 2CVZA 5AI4A 2KMLA 4JLUA 4H7EA 1GVHA 4MUAA 1DC6A 3T9FA 5BR1A 2JD0A 4KXFB 4RY0A 3OSUA 2BKEA 2PGLA 3H8WA 2OBLA 5TB5A 3W8FA 1AT1A 2C7RA 2RJNA 4QFDA 1Z47A 4CG1A 3B3FA 1E2FA 3CKKA 3CJTA 4RYDA 3FCYA 4DN6A 2P79A 4EH1A 4E1VA 7MDHA 5CDFE 1RE1A 3NBZC 1R0XA 3W8DA 3U7IA 1QRSA 3NM5A 1NM5A 3LBFA 3MQFA 4MDYA 1T24A 2QN7A 1SKMA 2JKZA 1ULTA 4CETA 3JD4A 4G0YA 3WRXA 1M83A 5B2FA 4JUCA 3EQ2A 3TI7A 4RHXA 2B5WA 1KJQA 5BVHA 3H2IA 1JQBA 4BV8A 2OR3A 2ZETA 3D6VA 4RPIA 1QP7A 2EJWA 4LZJA 4UNIA 3P9QA 3SQDA 1UC9A 4ER0A 2V7GA 1PR5A 4L8GA 2OOKA 1HTTA 5JJCA 1QKIA 3EP6B 3JARA 1YS9A 3T9BA 4KAXA 4F4DA 3AGQA 2VA9A 1E61A 2J67A 1JT2A 4MVWA 4K9OA 4MPDA 1UQUA 2RHGB 3UZUA 2G04A 4EG6A 5K6RA 1NZFA 1TJ5A 4V2UA 1ODFA 4G5HA 1ZKDA 1L1QA 1BCSB 3W04A 2ZJFA 4WTOA 1FDIA 5F5LA 1FFYA 5A3SA 2VXCA 4RHYA 2D0IA 3T3MB 2DQKA 4LY9A 1AQIA 4C5CA 2YFQA 1G6KA 5ALWA 2FZ5A 4M0FA 1U0LA 1W9HA 2WJHA 5F1OA 4XM1A 4PBRA 2YNMC 1CXZA 3L84A 2BFAA 5A5DA 1E1YA 1YJBA 3GLFB 3SJAA 3N8NA 1H65A 3HB4X 2ATCA 3FB4A 3C2QA 2QSZA 4YCBA 5LNK1 1HTBA 3FPAA 4RTJA 2I4TA 3NORA 4XJXA 2VEOA 2I4OA 4DABA 3VJLA 4JJAA 4BFSA 3U37A 2WWFA 2EKBA 4GOJA 4BAZA 4X85A 1O89A 2K5UA 4QDJA 4KQ6A 3I1FA 4L4RA 5LMNB 4R40A 2VXYA 4R98A 1N2CB 3TFWA 4ID9A 2MOKA 1H05A 2E4XA 2MYTA 2B3DA 1VMAA 2XOEA 4ZQIA 2WJYA 4KGXA 5LA6F 2IV2X 1JB9A 3VI4B 1FJGB 4NOKA 1Z7EA 4QT0A 4Y2GA 5CNJA 1NVTA 4E3ZA 3DBRB 4J94A 4IF4A 4PCLA 1YRHA 2J7KA 4PM4A 5LLSA 5HR5A 1KETA 3D8BA 1T3GA 4JKIA 3S44A 1R0SA 2GYUA 1QLHA 2HF9A 1ZGAA 2RGBA 3OQIA 1OLXA 3FE2A 2EXXA 2QVZX 4DC9A 5T6BA 5A4DA 3OLZA 5I45A 4HQ0A 4I1VA 4PF1A 4TYNA 1ZFNA 4K28A 2OZVA 1H1TA 3LF2A 4P98A 2NSHA 1HORA 4YV2A 3AEKA 2EGHA 3PUXA 3DSRA 1JU9A 1Q3TA 2NXJA 3U9SA 2C0CA 4ZO9A 4ZAGA 2QRQA 2C2HA 1GRNA 3F98A 4Q3LA 1QZ3A 1I3CA 3DBOB 5IASA 3GD5A 5JXJA 1N1EA 4JIGA 2JHPA 2EKLA 2IOFA 4Q19A 3F8SA 3UMRA 5JAMA 1NY6A 5EMLA 5AHOA 3FLEA 4QRDA 4AQ7A 1GTRA 1U28C 3Q7EA 3X3HA 4F71A 4Z8XA 2R4QA 1HWYA 3ZCXA 3MSCA 4U2KA 5CGQB 4NQRA 5K4GA 1QE0A 3G2OA 1YH3A 5HRAA 3GJ0A 3HLKA 4KAJA 1A77A 2YH2A 4INPA 5D7NA 1L7EA 3KXKA 4PX2A 4EKYA 4OX9B 4B4UA 2C4KA 3ER8A 1YU6A 4NCKA 3Q0EA 7MHTA 1Q1AA 5A7GA 3DHVA 3ER6A 1B23P 3RHTA 3TIGA 2HFKA 4PQGA 1JIUA 4K6GA 4RDCA 3W9SA 2MWMA 3WQRA 3CUVA 3SFVA 5K0TA 3CCBA 3DXXA 1GPDG 1UP7A 4HYEA 2ZRCA 1E60A 1P75A 5JJKA 4LJ7A 3UUEA 5DCYA 3OIVA 3EB9A 3QKIA 2B7CA 2WSSD 2Z6AA 2PGAA 2ZEJA 3SVLA 3I30X 1HY3A 3PFCA 1E59A 1BXRA 4ROTA 2CLEB 2FPGB 2C3YA 1NG9A 5DIZA 4DJJA 4YRNA 1FFAA 4I4CA 4UEWA 1ZGGA 4I1PA 3IOEA 1WDKA 3YASA 5CX4A 2D0PB 1REQB 4GMXA 3TPZA 1RPJA 3UJDA 3WLFA 4FOTA 4CDMA 4G4SO 5M34A 4Z49A 5IXJA 1I79B 1ODIA 2VP6A 3QJ5A 4WCFA 3BGSA 4RTOA 1CY2A 2W11A 2O19A 2WJPA 2GK3A 3EP7B 3GMTA 2DHEA 3JVEA 1H2XA 4HGNA 1T0IA 4HN4B 2KW5A 3T3IA 5K6TA 3KQUA 4HNTA 3DV0A 1I2CA 3KHKA 4GLLA 5G1PA 4IKEA 3N2LA 2GTHA 5BUZA 2HW8A 1BVHA 1QG2A 2ZIGA 3PUVA 4KPUA 1D5WA 1KQGA 3DEYX 5B3JA 3K9WA 4EI8A 1TRHA 1KY5A 2IDJA 3BHIA 3QBEA 1PX2A 1R8SA 4UHEA 3D81A 3AEQA 1L8XA 2PJRA 5CA1A 2YZKA 4C05A 1IULA 2DG2A 3VU3A 2JASA 3H16A 1SRQA 3N6XA 3L1UA 1Y8ZA 1E2MA 3OQ6A 1QFMA 4B32A 3BXXA 3OQHA 5EOVA 4XJSA 3OEHD 5EMHA 2UYGA 3GLIA 1KEUA 1MJFA 3RS9A 2VJCA 4DMCA 2QAGB 4OB6A 5I7HA 2QYOA 3A32A 3EZXA 2KWIA 4TZTA 5EWJB 3ZXYA 1ZH4A 4CN8A 5JS7A 2EFGA 4AS1A 4JA0A 1W5AA 3BF7A 4I2VA 3VKGA 3LSTA 2E4WA 5G4LA 3PR1A 3PUZA 4RY9A 1I7QB 2TMYA 1GQQA 3RBZA 3P8ZA 3SQOA 3FY4A 3TAXA 3VZSA 2JATA 5JSHA 3M3DA 5EIAA 4IIEA 3VPBA 1BJKA 3J81A 1H8HA 3MUEA 4L6CA 1YJXA 3K5WA 4FFBB 3COWA 2A1UA 3KL2A 2WUDA 1II8B 3I9OA 4FCVA 4C1BA 5JXHA 2AN5A 1A9QA 3U9TA 1PG5A 2VNKA 2PUWA 4RS4A 3B6EA 2Z9DA 3D2LA 4QJ5A 5CFZA 1E1DA 3LDGA 1FMTA 1BS2A 3G8YA 1AQNA 2RGEA 2IZ0A 3KJIA 4PX9A 2IVFA 3ND7A 2QTVA 3EXHC 4G5FA 4YAOA 5KVSA 4CXMA 2YW9A 2VPQA 2F1HA 1QH1A 4JFAA 3UAGA 4CLRA 1F0NA 4H6PA 3LOQA 1GUAA 4RXMA 2OENG 4BUCA 4DEYA 5KO2A 2OLJA 3D6AA 1E89A 3M82A 2FH5B 2ZI4A 2FX2A 3AHIA 4KO3S 4CV1A 5AHKA 3NPMA 3ZZ1A 3U5TA 1L6IA 3B78A 2LRHA 1YNOA 5JDCA 5D86A 3PP8A 1PGJA 3W5DA 4MR7A 4R3NA 3O90A 3W34A 3ZQUA 2A4MA 4K88A 4RGQA 2BGMA 2BWJA 2EZ8A 1RPNA 5L3ZA 5JSUA 1I2ZA 4UBLA 3REQB 2G77B 1PF7E 2I4MA 5F1PA 4HRAA 2PUJA 3THWA 2QRLA 1C14A 2B3TA 2CXTA 2AHRA 1UP4A 5SYNA 2C2ZA 5I7FA 1ZH0A 4U6NA 4DCPA 5HUHA 2UV8A 2OWDA 1VGQA 3GXBA 3JQAA 4F2HA 5CT9A 4JC4A 4C0WA 2OCDA 3B13B 3PRKE 3WRYC 2BFOA 2VDNB 4O2AA 4B40A 4DLYA 4F84A 5JR3A 3LPAA 4L50A 4EQ6B 4GC5A 3GUCA 1KI1A 4GXRA 4GLOA 4H7PA 3WVNA 1Z17A 2QVLA 3LDHA 4XWWA 5AXDA 4R71A 4FEGA 3GB9A 4UOQA 3IWBB 4UTVA 1KO5A 2WJAA 3MMXA 3T0GA 1O6BA 3EPRA 3NBAA 4FS8A 5J2TA 1DDOA 5DXAA 2IEZA 4C7XA 4GSYA 2WUGA 1ZJ5A 1XWFA 5IK2A 3C3EA 3Q7PA 2XV1A 3O74A 2BVNA 4TV8F 1JIVA 4RTPA 4FD3A 2FEAA 3KB8A 2BTQA 1TCCA 1LTKA 2BFFB 5FWXA 1Z34A 1QH8A 3L2OB 3H8JA 4MK4A 1JU4A 4NX2A 1ZW1A 4QU0A 2ZBEA 3LZCA 3PHCA 2D5IA 5JFTA 1P9OA 3KTOA 4DLSA 2CXRA 5EKDA 4GBJA 4R7TA 3HUUA 3N6VA 3ZXSA 3AYZB 4GBGA 3F6EX 1OXXK 1DFGA 1FVOA 2LP4Y 3K1ZA 1PI3A 5TSDA 5T64A 1IY9A 4D43A 5KIAA 1KHHA 3KOZA 2V7VA 4LQLA 1M73E 3NHRA 1KDPA 4PLVA 1Z3CA 1MGPA 1XZQA 2H48A 1YC2A 3F9RA 4QOGA 2ZUBA 4XX0B 1L5HB 2KYRA 4KE8A 4LI0A 4TGLA 2XWJI 3MT8A 3Q6NA 1SVUA 1UBFA 3ZOZA 4F8YA 2OFOA 2PS9A 5D3MA 4DV7B 2X15A 1VYVA 1FDVA 1JSXA 3NHZA 2O05A 2M6RA 1RRGA 2PT6A 4I5GA 2A0WA 5DNAA 2XQIA 4OBWA 5IUKC 3ABOB 1PV4A 1BS9A 3JX9A 1KI4A 5TRTA 3VPXA 1VSVA 1JSLA 1ADFA 4LNAA 3BJZA 5DNCA 1MOQA 2SHKA 4K3UA 1GAQA 5A9SA 1JSZA 1OHHA 2RHMA 3CVUA 1VE9A 2GYYA 1MO5A 1I2BA 2DSTA 4PAMA 1U65A 3WDLA 1FLVA 5TQ0B 2HQRA 3NHPA 2R60A 3TW3A 2QL7A 4EL5A 1KVSA 4YB8A 3N0XA 2WV9A 2IYQA 2O1XA 1R9MA 3BFKA 3EIXA 4LCBA 1GP2A 4V3BA 5AUNB 4DLVA 1SCKA 4FOOA 5IKEA 1LEHA 3UKOA 1W0KD 1LDMA 1GCIA 4B84A 1QLWA 1F0KA 1TI7A 4LX0A 1ZH6A 2CSXA 1ZISA 1DO0A 6REQA 4AIRA 1T5HX 2FRXA 2R48A 3F3MA 2UUCB 4GP6A 2V4MA 3D8HA 4AO8A 2POQX 1DTWA 1I4EB 2ECFA 1Q0LA 2FWAA 2EFHB 4N7RA 4GP9A 4Y6QA 5CLIA 3RRZA 1VZ3A 1SQ0A 3HBMA 5LP6F 4LWPA 1FF9A 2A1TR 3R9WA 1NGSA 2R0QC 3KKEA 4QHYA 4AL4A 5AXCA 1K3UB 5I7SA 1EFHA 3JD3A 5ABPA 2HU2A 1B41A 1EX1A 1T3SA 2XY4A 3EGDA 3WDSA 5CFPA 3RUDA 2WF9A 2NU9B 2WWHA 4HBGA 3NRCA 1DC8A 4ALJA 1VDMA 3NMUF 3PHHA 4ENPA 2RGGA 1C41A 2GN0A 5K0LA 1GGHA 2HO4A 2J5XA 1PUIA 3O31A 2VAPA 3HH8A 4FU0A 3U3RA 4NE2A 3M8KA 1OX4A 1DO2A 4ESVA 1N33B 3K8YA 1B8PA 4AJLA 2XUIA 1LI4A 4GI7A 1IN8A 4EEXA 4KQ9A 3LHKA 3DVLA 5F76A 3G5UA 5ESDA 2GZSA 3O9VA 3EXG2 1HMPA 3H42B 1S2MA 1THTA 4JBHA 3O6VA 5AW4A 2RH5A 1UKEA 2O2XA 5AKJA 4HEA6 3T7DA 5F5XA 5HJ7A 4U7WA 5JJ5A 1MC1A 3QH4A 4YI5A 1EUQA 3DMTA 2ISQA 5ED0A 4ZDJA 9LDTA 2WBLC 4EKGA 3Q3CA 3C14C 4IV5A 3WMXA 2FFAA 2D4AA 4J7UA 1J39A 4TRMA 4CKZA 4Q00A 3OTOB 1B16A 1CR2A 4HS4A 3TNJA 3RBAA 4QM7A 3HXKA 3A8TA 2CXSA 3MWEA 1Z88A 5FUWA 3IUNA 1VE5A 3N58A 3Q5GA 3QKSA 4GAEA 1D2MA 3WOVA 5DRYA 2GAAA 4Q5IA 1JQ3A 2I3ZA 2IV3A 5DWVA 4A27A 4Z1OA 4HWOA 2FFJA 4MPJA 4WN9B 1NBAA 4AUMA 2R2AA 2ZB4A 5A1JA 4DYDA 5B4UA 2NU7B 4AQDA 3ZLVA 3CEPB 1OAKA 4QDOA 2TRSB 1QYWA 3EEBA 4H1VA 1XVUA 4J76A 5IKXA 4K6HA 2H1CA 1DAOA 1FVHA 1V16A 3BSFA 1OA0A 2Q0SA 2W2LA 1MC8A 3BWXA 5DLDA 5FNVF 3BFPA 4M88A 5IM5A 5AP9A 5DNWA 5BWCA 1JJAA 2C95A 2RAPA 3LX6A 4QU5A 4TXLA 3RDPA 2ZU0C 2WUFA 1LA2A 3AZPA 2ZYRA 1XBTA 2V6IA 3IE1A 3T52A 1JKJA 3T1VA 1EXDA 3JZFA 2F67A 1T9DA 3AR6A 2CHGA 3N3AC 5HKAA 3KZOA 2FW7A 4K0RA 4Q6BA 3WHLA 4P0QB 2NMVA 2H4XA 3F97A 2HMYB 4FINA 4BYMA 2JD1A 1JIXA 1GRVA 4JP5A 2QL9A 1U0EA 2CHUA 2YS7A 1UP6A 4KG7A 3CU5A 3ZCSA 1E63A 5JHGB 3HL4A 1NDQA 3D8TA 3ZHTA 3AC0A 3BRQA 1S9DA 4QJBA 4NOLA 2ZOSA 4H1UA 2VH5R 1XZJA 4L4UA 1N2IA 1X3SA 3ZDRA 4BNDA 2IKQA 1SJ9A 2J4DA 1YRWA 5E9AA 3W1VA 4BMVA 4P54A 3HCEA 3DZHA 4JLAA 2IXTA 3DDZX 3DXFA 4D98A 4N76A 5DDIP 3L8HA 4HJXA 4KREA 5KX5F 1AXGA 4N12A 5IC6A 2JGAA 1NE7A 1YMVA 4MIKA 3ZWQA 1Q0TA 4IXTA 3PXUA 4FXOA 2IZ1A 4BLWA 1KSFX 4EY7A 5FPPA 4KPGA 2K2WA 2KE5A 2P2SA 1PZFA 4QXAA 5LJIA 3RE1A 3G6WA 3AG5A 3CZAA 2Z6QA 1F14A 2JA2A 2OPHA 1PLKA 1Q11A 1AKVA 2XZLA 1ES9A 3EGIA 1PR3A 2GHIA 4RPLA 2QHXA 1QVWA 3AY6A 4HX2A 4C06A 4X91A 4TYYA 3GK3A 1TA4A 2Y4NA 1R6XA 3RFXA 5BWNA 3ZDDA 1O95A 1QQAA 1X1CA 3S29A 5KOJB 3OPYI 2OCXA 2FZLA 3O03A 2R8YA 2EFYA 1MD9A 1DOHA 3JPYA 4XYEA 4HN2A 1KK1A 3DKKA 4YMWA 3WFIA 1E4YA 1N3IA 1UT8A 3CB2A 5TS3A 4DLRA 2CSUA 4UCFA 1Q14A 3EP9B 3U7HB 3UW3A 1WXDA 3QE0A 4OP2A 2R6FA 5F33A 3ZU4A 3CH5A 4QBHA 2MSEB 3DZGA 5CW2A 5LQDA 2QSYA 3NCHA 2I33A 3SI7A 3DTTA 4I9FA 3G68A 1QTIA 2OXIA 3GFSA 4AYXA 5IVDA 2P6NA 2AG5A 5AKIA 1X14A 5HNKA 1NKVA 1ZRHA 4JX8A 4LRYA 1OWOA 3HNOA 1SIOA 2I1VB 2HN9A 2R1TA 3NVMB 3GVIA 4J7XA 5IYZF 1WG8A 1G2PA 5SICE 1LBHA 2VYNA 2XOKA 1QH1B 1E6KA 2CCJA 1F06A 4YIHA 1PSDA 2I3DA 1EYZA 3AKEA 4R4JA 4MUFA 4DSOA 3GGDA 4N01A 2XPCA 1ENPA 1VG9B 4D9GA 1QYIA 1WF6A 4S24A 2GHTA 1G2OA 2OSBA 4DUPA 1XPJA 1C9NA 4BX8A 2VBIA 2XLBA 2XYQA 2JI8A 3PNSA 1EDEA 4I66A 4Z9XA 2VQFB 3QPAA 1KZYC 2FFQA 2JGMA 1NURA 3DLIA 4R2IA 3ZHVA 1V8DA 3SOPA 4DSTA 4MLZA 1Z4MA 4C4PA 2DR2A 1HKHA 2JD2A 1CTQA 1RWPA 4DCJA 1JEOA 2HQSA 3K0FB 1Z06A 1P7VA 5K01A 2OGUA 3ZD6A 2X4LA 2Y92A 5ARBA 3R7SA 4TVBA 2G76A 1Z4QA 1G7SA 3SN6A 2Z5FA 4PFJA 2B8WA 2AMJA 1DBQA 3Q3GE 4N8SA 2QX4A 3WJAA 5JE8A 1AH2A 4HEJA 1J20A 3R09A 1G5PA 3GU3A 4FLMA 3LKVA 3Q9SA 1PGOA 2QP9X 5E8RA 3V4VB 4DKXA 4F45A 2PUGA 3ED5A 4M8LA 4E5KA 1EGQA 3HN2A 4GYYA 1LXCA 2JIQA 3M6WA 4D9HA 2VHZA 5HM8A 1HQCA 2UXBB 4UUOA 2KB0A 4Q3CA 2F4VB 1IG3A 1ZD1A 1NWCA 1GJRA 1GSAA 1BRTA 4IRMA 5GVSA 2Q3LA 1JDPA 1L6RA 1QCDA 5ICMA 3PLRA 3AUUA 3ZGLA 1F1JA 3IAFA 2XBUA 5JSQA 1E3DA 3UWOA 2LPMA 3FTNA 1YQXA 5IX8A 5GZ1A 5JCJD 1DTSA 2JEZA 3JQ9A 2A57A 4POAA 3ESYA 3I45A 1GKLA 4IXDA 1H23A 2BCJQ 4YXWA 4BMXA 4TSFD 3USES 1ANKA 2FWMX 5ED4A 4F8EA 1N2GA 4G1FA 1E6LA 3VR0A 4LZOA 5BXQC 4H2DA 4BEWA 1DRJA 4PTLA 3DO5A 4EZEA 2XYPA 1ZUNA 2YHIB 1CCWA 4RQAA 2FPIB 4ASUD 4LNHA 4U4AA 1I32A 1E8MA 5DTIA 3L4SO 4YYEA 1H3FA 1YKSA 2AYZA 4LXHA 3ZCTA 1DIAA 2BKXA 1IQPA 2X9NA 3PVCA 4Q9LA 5SY6A 2YWBA 2UUAB 4M6WA 3UJCA 3PQCA 4O1MA 5G2OA 3RASA 3VO8A 3UB3A 4ZI7A 4TV9A 1QG0A 1T5OA 2OCIA 2ZDQA 4P2BA 3QVOA 4HWRA 2VT3A 2ZM5A 1JJBA 3PGVA 4PLPA 4KSCA 4QULA 1QV9A 2QV0A 3I01A 4OLFA 4OIFA 3WNBA 3IEVA 3S1AB 4TVOA 1G41A 1G3RA 1BE6A 1JTEA 1LV7A 1R4AA 1CS0B 1ZESA 2GK7A 2VI5A 3HFSA 3HJTA 3I0MA 3LHIA 3ZGOA 1PJRA 2ADMA 3M4YA 3OX3A 2P9HA 4R54A 4NE7A 4PHGA 4WRRA 3I73A 4H0FA 4QD3A 1PEYA