3KUZA

Crystal structure of the ubiquitin like domain of plxnc1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QGTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ubiquitin like domain of PLXNC1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Plexin-C1
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kuzA00
2D07B 1Y8RC 4AWJA 2N1WA 2NR2A 3L13A 4KV2A 5CX3A 2CU1A 5LLIA 2GBKA 3MJWA 1RAXA 4KSKC 2LZ6A 1HE8A 2G4SA 3M63B 2MCNB 2BGFA 2C7MB 2KDIA 4IM0A 1E7VA 2L7RA 1GNUA 1TGZB 5AZHA 1WIAA 4G0NB 2M17A 3OJ4B 2LD9A 3ZTCA 5E6OA 2IO0B 1V5TA 1V2YA 3UINB 4DHJD 4MGYE 1AARA 2GBNA 2I1JA 3PRPB 4GN1A 2KWVB 4MGZE 1UELA 4HVBA 3VVWB 3T9LA 4NPNA 4BKTA 2LGDA 1KOTA 5KHOA 4LDTD 5E6NA 1P3QU 4FJYA 2KC1A 1P9DU 2IY0B 4IWPA 1SE9A 1PQSA 2KX0A 2KZRA 2D2QA 3ALBA 3RYTA 4W9DA 2RSUA 2J7QB 3KUCB 4EOYA 1Z5SB 2JZ3B 5C23A 3RCZA 4JGHB 2MBBB 2LASA 1Q5WB 2KTFA 3U30A 3L17A 3ZW3A 3HM3A 4MJSA 3RZFA 4NAWB 2ZVOA 4ICVA 1GUAB 2WWZA 4GDKA 1LQBA 1E7UA 3SD5A 4AP4C 4JIOU 2RPQA 1X1MA 3H1UA 4BOSC 2FNJB 1V5OA 1E5WA 2BWES 4HCPB 4IM3A 4MGKE 2EKEC 4LCDE 3H7SA 4MSMB 3ZNGC 1TZ1A 4ANVA 4ICUA 2CR5A 4WWOA 4KSLC 1E8YA 1V81A 2XK5A 4W9KA 5CHWA 2BYVE 4WWNA 3PZDA 1UZXB 4PYZA 4ZDVA 2GBJA 2KTRA 2L3ZA 3QK0A 1GC7A 5E6PA 3HHMA 4WJOA 4W9FA 4M0WB 2N9PC 4MSQB 1XT9B 4EZLA 4HPLB 1WX9A 2FUHB 2N7EA 1G6JA 1U4AA 1WJ4A 4XC2A 3U8ZA 1WY8A 4G50A 1I35A 3ZVVA 2CHXA 4I6PA 2BKRB 1IYFA 2LRWA 3WA0A 2NBWB 3VXWA 5DPWA 4WWPA 2MP2B 2IBIB 4GB9A 3QCAA 2WYQA 2KWUB 4IG7B 3EC8A 4MH0E 2IZVB 3K9PB 1OEYJ 1WGRA 4AUQC 1WXAA 3ZDMC 4BBNF 1R4MI 1WJUA 3DVNV 4G11A 4DBGA 2LWPA 3AU4A 4HDQA 2NPTA 5JHAA 4W9GA 2ZPNA 2FIFA 2RGFA 2BWFA 1IP9A 2NS5A 3OJ3A 3IVFA 1V49A 1WGHA 4B6WA 3NZUA 5G55A 2MA9B 2BF8B 1F9JA 2BYEA 2C7NB 1KM7A 4GIVA 2MQJA 1WF9A 2QHOA 1TTNA 3TMPB 2EMTA 2MBHA 2KOXA 4MELA 1NI2A 4EUTA 3WAPA 1UBQA 2IYDB 3PTFC 1WI0A 2VRRB 1RFAA 3R66C 4FLHA 4W9JA 1YX6B 4WQOB 3V6EB 3VTWA 3CMMB 2L76A 4IW0A 4IWQA 4GSWA 3GOEA 1UH6A 2ZVNA 4KIKB 1EO6A 2O2VA 2KHWB 4FJVB 3JVZX 4ZRJA 3N32A 3U7DA 5DCNA 4A3PA 3UF8A 2KN5A 2FAZA 2AEHA 2LXAA 4GDLB 1Z2MA 2JWZA 4E3CA 3KUZA 3PV1A 1EUVB 3R7RA 5HKHA 1P1AA 1WGGA 4NNJB 5CHVC 4EZKA 1OEYA 3V62A 3VQIA 2MBQA 4AJYB 2LJ5A 2O6VB 4RM9A 3NOBA 1GG3A 4DDID 5D94A 2KLCA 3BINA 4HDOA 3DVGX 4M8MA 2GBRA 3L08A 3APDA 4PS3A 3ZUNA 3M95A 2KDFB 2XBBC 3A4SC 4J6IA 4PS7A 5BO4B 3WALA 2KDBA 2NPTB 3QQ8B 5D7GA 1WRDB 2HTHA 2ZPYA 1LFDA 2KKCA 3ML9A 2CS4A 1UD7A 2ZCBA 3PHWB 4KIKA 1P0RA 2K39A 2DX5B 2DYBA 2LUEA 3DPDA 2J0MA 2FCSA 3QAQA 2ZCCA 1MG8A 2HD5B 3ZNHB 4K81A 5JHBA 3TJPA 1ZKHA 1SIFA 2IO2B 5CHFA 4W9HA 1T0YA 4NY0A 2JVCA 4DK5A 3C0RB 1RLFA 4DHZB 4ZRKA 3W1SC 5AEKB 4TKNA 5D2MB 3ONSA 2KQSA 3ENEA 4I6NB 3VFKA 4N9F4 5JZEB 4G3XB 4KDIC 1XD3B 4P7IA 3O65B 4ZYNA 4RMAA 4AJWA 2WDTB 4FHKA 2JRHA 2KTRB 2L00B 2DAJA 2JUOA 2K8BA 2FCMA 2Z59B 3NS8A 4HJKA 4TV3A 2EMSA 3N30A 2JXXA 3UIOB 3V60A 3PRZA 2KANA 1FXTB 1YQBA 3PS6A 4DDGD 4I6LB 3RD2A 3DCGA 1BT0A 4TQ1A 1RRBA 2ZJDA 3ZDTA 3PLUA 2LXCA 4WJPA 3JSVB 4BVUC 4KDLB 3HK0A 4CHKA 1L2NA 3L54A 4GDKB 3OAWA 1KJTA 3KW5B 3A9KA 1Q1OA 2O2VB 1EF5A 2KFKA 4CYEA 2R2OA 4FN2A 3A1QB 4MJSB 3B0AA 4IC7B 5AZGA 2KNBA 1YX5B 3W1SA 4FBJB 5L95C 2N9EB 5LXIB 3H7PB 3APFA 3A9JB 4K7WA 2ZNVC 3KUDB 1UGMA 3NZSA 3QJZA 4EFOA 3PHXB 2Y5BB 3SDLC 4M8NA 3R7QA 1IPGA 4K7SA 4W9IA 2FCNA 1D3ZA 2K6QA 2AL6A 3PT2B 3KH0A 4NJ7A 4K1RB 4NJ6A 1E90A 2LRUA 3P2BA 2HJ8A 3K9OB 1YIWA 3DVNU 2V3SA 2C5LC 3QWZB 5DPSA 3S2AA 4MDKE 5L83A 2PPHA 3LDZE 4X57B 2MBOA 2K8CA 1WFYA 2DZMA 4NAWA 5LXHA 1ZW7A 1S3SG 3V6CB 2ZNVB 2NBUA 3M3JA 2BYFA 3PRMB 4W9CA 4OVVA 2A4ZA 2LVQA 2BPSA 2RD0A 1LXDA 2KC2A 2OJRA 1H4RA 1C3TA 5KHQA 2W9NA 5CTRC 2CKHB 1QZEA 2LI5A 4HPMB 4FHJA 1WE6A 5C1ZA 3TCAA 3OLMD 2AYOB 1YJ1A 4FA6A 4GDLA 4ZRIA 2L0FA 4TQ0A 3AU5A 3DBHI 2MBEA 3QA8A 2M8SA 4F7ZA 1NBFC 4FULA 4PYUA 1SGHA 1XQQA 1WXVA 1OTRB 2JF5A 3EFUA 2UWQA 2FCQA 4HCNB 3W1YA 1OGWA 3VHTC 3IG3A 4IM2A 2KFJA 2M1MA 4OVUA 4RM8A 3A9KB 2DYOA 2DZIA 2YVCA 2V4LA 3WANA 3UQBA 2L0TA 2I1KA 4MEMA 1WXSA 2KVRA 4CO7A 2PE6B 1I42A 3AULA 2WX1A 2N4FA 4WJQA 3KYDD 4BBNC 3A9JA 3TIXA 3R3MA 2O6VD 3DVGY 3QC8B 3H9DA 4HWIB 5FR6A 2D3GA 2MX2A 4EEWA 4GU2A 1J0GA 3QIJA 3VAWA 1WYWB 3QX1A 3QARA 3X0WA 2NCNA 2ASQA 1WH3A 2J0KA 3MTNB 3X23A 3ZKJC 3IBEA 4BKSA 2KQ7A 2JT4B 2AWTA 3KYCD 4XX5A 3WAOA 4ANXA 4E71A 4ANWA 1UBIA 2JZZA 3ZRFA 2WX0A 1WM3A 1A5RA 1V80A 2PEAA 2V1YA 2KXJA 2OOBB 3UGBB 2ZZPB 2DAFA 2LVOA 2C60A 3SHQA 3DBRI 1L7YA 4DWFA 3ZNID 4BKSD 3HM6X 3IFWB 1ISNA 3H7PA 2FIDA 2HE7A 3PGEA 3VTUA 3CSFA 2LGXA 2KLGA 3A1QA 1YD8U 1WMHB 5TR5A 5J18A 3D32A 3I3TB 2DYMA 5GMVA 2KWCA 4FJZA 3RT3B 4F1SA 1GC6A 2MSED 3L16A 4A20A 2RR9A 1E8WA 3PSEB 3RZWC 1J19A 1WZ3A 2K8HA 2N1VA 3HIZA 3VH3B 4URKA 4JL9A 2J0JA 2KJHB 1P98A 1VCBA 2G4DB 4LDTB 3RUIB 2DZJA 3CF6E 1Q0WB 3VTVA 4PS8A 3VUWA 3T8MA 1WR1A 3ECIA 1S1QB 1LM8B 3AI5A 2REXA 1TBEA 3TBLD 3VUXA 2BKFA 2K6DB 2CHZA 3JSVA 4B95A 2MWSB 4WJNA 3Q3JA 2O6VA 4LJOB 3JW0X 4DHZE 1WJNA 3RULA 2LVPA 3APCA 5DPRA 2G3QB 1C1YB 4KZ0A 1NDDA 3A33B 3ZO5B 2GOWA 4BOZB 2DENB 1H8CA 2GBMA 2PJHA 2XEWA 3H6NA 4IUMB 3NY5A 1WM2A 1WJ6A 1WX7A 3B1LX 1KLVA 1K8RB 3NHEB 2NVUI 3M62B 2ZEQA 2D11A 5J17A 2AL3A 4MGIE 2IO1B 1WR6E 3PVLA 4E74A 3EECA 2KJ6A 5IAAC 3JYUA 3DBSA 2G45B 1EF1A 4KVGB 4W9LA 4EKUA 4BKGA 3SU8X 1WGYA 2DZKA 2M4NA 2L05A 5IA7A 2XK5B 2DHZA 5G2NA 4DHJB 3BY4B 4KZCA 4IWOA 4NQLB 4YL8A 3L0WB 1WXMA 2M0XA 2R2QA 3V61A 1R4NI 2KK8A 3N3KB 4II3B 3WIMA 3WAMA 1OQYA 3UIPB 2N9XA 2KD0A 3ZIMA 4K7UA 2L8JA 5JH5C 3UQAA 4BFRA 4LJPB 1WZ0A 2C7HA 3Q3FA 2JY6A 4ANUA 4NQKE 2JPHA 4MM3A 2NBVB 3ZTDA 1M94A 3TL5A 2KMAA 4ASWC 2JRIB 1E8XA 2A5UA 3GZNI 3QHTA 3ZRCA 4WAAA 4AOFA 4F8CB 1VD2A 4B9KA 3PREA 1WMHA 4A3OA 2YLMA 4XZ4A 3B08A 4GGQA 4GXBA 1ZGUB 4HK2A 5D6JB 3CSTA 3AXCA 2IO3B 3IHPC 5J2RA 3DDCB 1WX8A 1WGDA 5AZFA 1V86A 2PE9A 3MHSD 2KFKB 2KDEB 1E8ZA 2Z0DB 3VH4B 3PPAA 3L10B 2Z0EB 2C9WB 1JRUA 4DXAB 5DPTA 2B3AA 2KX3A 2K25A 4FADA 4W9EA 1J8CA 4JQWC 1CMXB 5EDSA 2MP2A 2MRPA 2MLBA 4HLEA 2K1FA 2IY1B 4EZJA 2D10A 4JLCA 2MW5A 2UYZB 3LJ3A 1V6EA 2CHWA 3ZLZA 3A4RA 4TUUA 2N7DA 3PLVA 4HXDA 3DBLI 2GMIC 3DQVA 1GJZA 4GMVA 1WE7A 3DOWA 3ZNZB 2KJRA 2KMCA 3EHVA 4II2B 2LGYA 1V9JA 3KVFB 3ML8A 3VDZA 2KO3A 4GOCA 3VUYA
chains in the Genus database with same CATH superfamily
2D07B 1Y8RC 4JX1C 5CX3A 3Q14C 1DYQA 3MJWA 2JYTA 1R4NB 4ZRPA 2G4SA 3HRDD 1SXTA 4LNNA 2KDIA 1JWMD 1TGZB 4WURA 1XCQL 2IO0B 3PO0A 3UINB 2GBNA 3PRPB 1YMHE 1UELA 3VVWB 5MPOA 2BQQA 4BKTA 5KHOA 2K22A 4LDTD 2YEPB 2OHFA 1Q10A 2KZRA 3VRBB 2BTEA 1VRAB 3LYYA 1UWXA 2WXIA 4A55A 3ZXRA 3RCZA 3U30A 2LASA 3AEGB 1J7AA 3L17A 3ZW3A 3RZFA 4NAWB 5IO9A 1JMLA 1LQBA 4JIOU 4BOSC 4GLSC 2FNJB 2WXLA 1E5WA 2BWES 3SEBA 2LHDA 4LCDE 4ANVA 2W3RA 4ICUA 1E8YA 4MT5A 5CHWA 4WWNA 3C8YA 4PYZA 2GBJA 2KTRA 2L3ZA 3I57A 1GC7A 3HHMA 4W9FA 4M0WB 3IT6B 1XT9B 4EZLA 2QIEB 4XC2A 1I35A 4G50A 3GZNB 2CHXA 1C78A 2BKRB 2LRWA 5DPWA 2IBIB 1IUEA 2OJWA 1M4VA 2KYWA 1OEYJ 3ZDMC 4N59A 4DBGA 4HDQA 1XLNA 4W9GA 3GE3C 1IP9A 4B6WA 4N58A 1ZXIA 3NZUA 1F9JA 1N5XA 1TTNA 4MELA 1NI2A 4HRSA 4LNIA 1F77A 1UH6A 2L1AA 3Q8BA 4FJVB 1XLQA 3UF8A 2FAZA 4GDLB 2JWZA 4KKIA 5HI1A 3KUZA 1WGGA 1OEYA 1JWSD 2MBQA 3IAM1 4AJYB 3NOBA 1GG3A 4ZYSA 5D94A 2KLCA 4M8MA 3DVGX 2N9KA 2BB5A 3L08A 5HHDG 4PS3A 4J6IA 2XBBC 3A4SC 4PS7A 5BO4B 4L23A 4S0RA 4HROA 2Y3AA 2ZPYA 2CS4A 3AEBB 1UD7A 3MC9A 3PHWB 3AE2B 1P0RA 2K39A 4J3OD 3DPDA 2FCSA 3FAHA 4K81A 2WXJA 4K3CA 4DHZB 4ZRKA 1JCKB 3ONSA 2WP9B 4KDIC 1XD3B 4P7IA 4ZYNA 1K53A 3RNEC 2JRHA 2KTRB 2VZKB 3NS8A 3S2AA 3PRZA 4XDDA 3CWIA 3PS6A 4DDGD 2JZPA 2ZJDA 1V97A 4AQ7A 4HKZE 4CHKA 3MP9A 2Q5WD 2KFKA 4DXGA 4CYEA 5EE1A 4FN2A 4RF0A 1AW7A 5BYSA 4IC7B 3W1SA 4FBJB 5L95C 3ZGZA 4K7WA 4IKGA 1UGMA 4MH8A 4DXFA 4K7SA 3ZQ4A 2PLPA 4A90A 3PT2B 3KH0A 1BMLC 1E90A 3QWZB 3I5JC 1IGDA 5L83A 4K3BA 3GS2A 1UGJA 1ZW7A 4W9CA 1FNVA 2WXFA 4OVVA 2LVQA 2RD0A 1K52A 2KC2A 3VR8B 2OJRA 3VRAB 4FHJA 1WE6A 3TCAA 3OLMD 4C7YA 2MBEA 1MFWA 1OTRB 2JF5A 1FIQA 2UWQA 3IG3A 5JXVA 3A9KB 2DYOA 2DZIA 2YVCA 3R2IA 2L0TA 4MEMA 1YOVB 2N9LA 3A9JA 3TUOA 5FR6A 3QIJA 4M01A 3VAWA 2ASQA 3MTNB 3AE6B 3IBEA 2AWTA 4ANXA 4ANWA 2JZZA 1WM3A 2KXJA 2ZZPB 2C60A 1N63A 3RFZB 2V4IB 1E6EB 4RNAA 3P42A 3PGEA 3CSFA 1YD8U 3D32A 4US8A 2KWCA 2MSED 3L16A 1SE3A 3HIZA 1T6BX 4URKA 1VCBA 2G4DB 1I7HA 3RUIB 1PGBA 3N9YC 1Q0WB 1WR1A 3NVVA 1LM8B 3EFCA 2W3SA 2MWSB 1TY0A 4LJOB 4ACFA 1ZPSA 4OVZA 4KZ0A 4IUMB 1WM2A 1WX7A 3AEFB 1KLVA 3AECB 3B9JA 3W9CB 2AL3A 1HTQA 1MPEA 4MGIE 3MJ5A 3PZ7A 1KLGD 3DBSA 2ZW0A 3ZXVA 2ON8A 1VJKA 3SU8X 1WSPA 5G5GA 5IA7A 2DHZA 3RNAC 4WIPA 2M0XA 4YTNB 3V61A 1R4NI 2KK8A 4II3B 4OHJA 3WAMA 4ZHPA 1F52A 3UQAA 2PIAA 3AH7A 3Q3FA 4YTMB 3NVYA 3ZTDA 1M94A 4PT5A 2A5UA 2LEKA 2KAJA 4A3OA 2YLMA 4A8XC 1ZGUB 4HK2A 3AXCA 2IO3B 2IGDA 5I4DA 1V86A 3MHSD 1E8ZA 2Z0DB 3PPAA 1FMAD 1JRUA 5DPTA 1OFFA 1C4PA 2JX5A 2B3AA 2K25A 1J8CA 1CMXB 1TKEA 2MRPA 2BS3B 2K1FA 4EZJA 1KTKA 1I4XA 1TS2A 3LJ3A 2CHWA 3I9V1 2AQ3B 1V1PB 2WXNA 4HXDA 3PLVA 1I4QA 2GMIC 3DQVA 1FCLA 1LGRA 1WE7A 3DOWA 3ZNZB 4TMAB 4II2B 3ML8A 3NS1A 3Q6BA 1HTOA 2WU5B 3VUYA 1PUTA 4AWJA 2N1WA 2NR2A 3OG5A 3P63A 2CU1A 1N62A 3M63B 2BVCA 3AE9B 2L7RA 3IAS1 4G0NB 1K51A 1MHXA 4YSXB 3BVZA 5TSSA 4HVBA 2LGDA 2RDBC 4JWSC 4C00A 1KOTA 2WNMA 2WXHA 5E6NA 1JWAD 1P3QU 2JQRB 1I4PA 1SE9A 2UU7A 4B0EA 2D2QA 2WDVB 3ALBA 3RYTA 1XF5L 2J7QB 3BWUD 1L6UA 5FR3A 2WXRA 4RGNA 3RN9C 4MJSA 2GB1A 2YEPF 1GUAB 2KT7A 4USAA 3BVGA 1FM0D 1MVKA 1FEHA 1PGAA 4AP4C 2M19A 1N6ZA 4HCPB 2EKEC 3NG0A 4ZRQA 4KSLC 1V81A 4W9KA 1L0XB 1EM7A 3FKYA 1UZXB 4H2AA 4WWMA 1WX9A 3KQ4A 1G6JA 1U4AA 3U8ZA 2E6XA 1IYFA 3WA0A 3VXWA 2GRIA 3U2SC 4WWPA 4XGAB 4A9AA 3RMKC 3EC8A 5LNK1 1WXAA 1FCCC 4BBNF 1N60A 1XLPA 1F0ZA 5JHAA 2FIFA 4HKQA 3OJ3A 3IVFA 1WGHA 2MA9B 2BF8B 2C7NB 5AUIA 2D5GA 2MQJA 4GIVA 2QCZA 2PVOD 2EMTA 2MBHA 4EUTA 3WAPA 3URYA 1WXQA 3PTFC 1WI0A 2VRRB 3R66C 4W9JA 2L76A 2O2VA 1K50A 1EU4A 3JVZX 1SB3C 2QJLA 1TT5B 2EELA 4NNJB 5CHVC 5D3DA 2DBYA 2LJ5A 4RM9A 4DDID 3BINA 1DOIA 3APDA 1VLBA 3MHZA 3NVWA 3M95A 3LXFA 3WALA 2KDBA 5D7GA 3DWGC 2WLBA 3AEEB 2J4XA 2I38A 2DYBA 2M56B 3QAQA 2ZCCA 1MG8A 3ZNHB 2RDGA 5CHFA 3DHHC 4N6EB 2WHIA 1FRRA 1RLFA 1NVID 2QDFA 1NYQA 5D2MB 1WWTA 2KQSA 3ENEA 5JZEB 4AJWA 2K8BA 2Z59B 2JXXA 3UIOB 5IN7A 1YQBA 3RD2A 3DCGA 2LXCA 3L54A 4KKJA 4GDKB 3OAWA 2LUMA 1Q1OA 1SE2A 4UDUC 4YT0B 3A1QB 5BMHA 3B0AA 4RGOS 2IGGA 3A9JB 1JRPA 3QJZA 4EFOA 3PHXB 1T3QA 2Y5BB 3Q8AA 2L32A 1TYGB 1IPGA 2LFIA 2G9HD 4P1BC 4W9IA 1J7CA 1D3ZA 4K1RB 1TS4A 4NJ6A 3P2BA 3K9OB 3DVNU 2C5LC 5DPSA 1WGKA 2PPHA 3TEWA 1F2RI 2MBOA 2FE8A 2WGSA 2DZMA 4NAWA 2WXMA 1ET6A 2NBUA 3PRMB 2A4ZA 5AUKA 1L6VA 1V8CA 3Q69A 2QSDA 2V3PA 1H4RA 1C3TA 4P6VF 2LI5A 1D4BA 1PGXA 4GDLA 4F7ZA 2M8SA 1EWYC 3EFUA 3VHTC 3U4EG 1C9FA 1YQ3B 2I1KA 1WXSA 1JWBD 2PE6B 1I42A 3AULA 3NJTA 2N4FA 4WJQA 3TIXA 1L5PA 4R3DA 1N61A 4GU2A 3FILA 5T8IA 2J0KA 3X23A 2E3TA 3WAOA 2JT4B 3KYCD 4XX5A 4E71A 2IDYA 2ZW1A 1UNSA 3RI7C 1A5RA 2V1YA 3U7ZA 3UI3A 3UGBB 3VR9B 2DAFA 2LVOA 1L7YA 3MC0B 3IT4B 1LO5D 2KLGA 3A1QA 5TR5A 5GMVA 2DYMA 4RFBA 1D5MC 1GC6A 4F1SA 3HVDA 3KWVA 2K8HA 3VH3B 4ARIA 3J9CA 1P98A 5EE0A 3CF6E 3ECIA 3H8HA 1S1QB 1FXIA 5C2TB 2BKFA 4JPSA 4WJNA 3JW0X 4RGMA 3TSSA 1B9RA 3RNBC 2FUG1 3A33B 2IPKD 3ZO5B 4AS1A 3AE3B 1H8CA 3H6NA 4WAFA 1WJ6A 3L4PA 1OQQA 2NVUI 3M62B 2D11A 5J17A 2IO1B 1WR6E 2Z8LA 4KVGB 2DZKA 2M4NA 1VR9A 3EGRA 3KLSX 3BY4B 4IWOA 4XWWA 3V3XA 3N3KB 2BYTA 3UIPB 2PW9A 3Q3MC 4K7UA 1RWSA 2INPE 4LJPB 1WZ0A 4YXDB 1ACCA 2JU6X 2NBVB 3TL5A 1E8XA 2WDRB 1J7BA 3GZNI 4WAAA 4F8CB 1PFDA 4B9KA 3PREA 1C79A 1WMHA 2MJEA 3DWMA 4XZ4A 3E56A 4GGQA 1TS3A 1YN4A 1WGDA 5AZFA 1SEBD 2PE9A 2KDEB 4WH4A 4C80A 2Z0EB 2C9WB 2WU2B 2HTME 4FADA 4W9EA 5EDSA 2MP2A 2MLBA 4HLEA 4IOIE 2D10A 1SE4A 3AE7B 1TKGA 3ZLZA 1P7EA 4REZA 4C4VA 3RNGC 4GMVA 2KMCA 3KVFB 4RF1A 3VDZA 2SEBD 2KO3A 1QQRA 4LK0M 4KV2A 1T5XD 3L13A 4HPPA 5LLIA 2GBKA 4BAXA 4KSKC 1FD6A 2MCNB 1SJED 2BGFA 2C7MB 5BYQA 4IM0A 5AZHA 1WIAA 1F1HA 5E6OA 2OEDA 1V5TA 2K5PA 4MGYE 1AARA 1VZ8A 4DHJD 4GN1A 2MEKA 2BW2A 3T9LA 4NPNA 2B76B 1E7PB 2Y5CA 2KC1A 1P9DU 1QOGA 2IY0B 4IWPA 4JWUC 1L0VB 1PQSA 2KX0A 4XWTA 3BYTB 4W9DA 2RSUA 4EOYA 3KUCB 5C23A 4JGHB 2MBBB 1Q5WB 2KTFA 2N7JA 2QC8A 4MM3B 4L1BA 2ZVOA 1T0SC 3BK1A 2WWZA 2PKOA 1E7UA 1QOFA 2RPQA 3H1UA 1L4ZB 1V5OA 4MGKE 4M00A 1OQRA 2RDHA 3H7SA 3Q3NC 2XK5A 2BYVE 3PZDA 2Y5PA 4NZLB 1QILA 4WJOA 1EU3A 2N9PC 3FC4A 1SBBB 1NENB 1WJ4A 4OZCA 2V3NA 3WCQA 2MP2B 4GB9A 2WYQA 4IG7B 3MC8A 4M02A 1WJUA 1R4MI 3DVNV 4G11A 3R2TA 2AQ1B 2KACA 1V49A 2BYEA 1KM7A 2V0GA 2ICIA 1E10A 3TMPB 3AE5B 3AE8B 2KOXA 3DBHB 3V6EB 3CMMB 4RH6A 4GSWA 1Y56A 4KIKB 1BXTA 1EO6A 1FNWA 3EUB2 1QLBB 1P7FA 5BYRA 4BZAA 5DCNA 4A3PA 2KN5A 2AEHA 3CIRB 4CQNA 2LXAA 2QILA 1Z2MA 1EUVB 1P1AA 3VQIA 3V62A 3RPFC 4ZOHC 4HJGE 4YTPB 2O6VB 1JQ4A 4HDOA 2GBRA 2PTLA 3AEDB 1IGCA 3SR6A 2J42A 2FBWB 4NJCA 2NPTB 1WRDB 2HTHA 3AE1B 1RYJA 3ML9A 1YN3A 1UF0A 2ZCBA 4KIKA 2DX5B 3BIID 2K3UA 2J0MA 3T3OA 2INNE 3TJPA 1ZKHA 1SIFA 2IO2B 5JHBA 4W9HA 4NY0A 2L83A 3C0RB 5AEKB 4TKNA 1VDVA 1CZPA 4I6NB 3VFKA 4N9F4 4RMAA 4FHKA 4YWGG 3ABVB 4HJKA 1ZDXA 2JUOA 2L00B 4C7ZA 3BK2A 3V60A 1FXTB 4I6LB 1BT0A 2W82A 3ZDTA 3PLUA 2GLSA 3JSVB 3HK0A 1L2NA 4A6QA 2KN4A 1EF5A 2R2OA 1D6EC 1NEKB 5AZGA 2KNBA 3APFA 1JALA 2G1EA 3KUDB 3NZSA 3Q8FA 3SDLC 1HQRD 1YQ4B 2FCNA 2K6QA 1AYFA 1XO3A 2HJ8A 2KQ4X 2V3SA 2M0AA 3LDZE 3IXSA 4X57B 2K8CA 1WFYA 1E9MA 5LXHA 1S3SG 4LTUA 1MJDA 2ZNVB 1R7SA 3M3JA 2VH2A 2BPSA 2W9NA 5CTRC 1YJJA 1QZEA 5C1ZA 1C76A 2AYOB 4FA6A 2R61A 2TSSA 4TQ0A 3DBHI 3QA8A 4FULA 1WXVA 4HCNB 3W1YA 1ESFA 1ENFA 4IM2A 2M1MA 4OVUA 4RM8A 1C77A 2V4LA 1L0YB 2KVRA 4CO7A 1MG4A 3KYDD 1TS5A 3R3MA 2LHEA 3DVGY 3QC8B 3H9DA 1J0GA 3QARA 3X0WA 3ZKJC 4BKSA 3ZRFA 3HVZA 1V80A 2PEAA 1N5WA 3SHQA 2BBCA 1A70A 4DWFA 3ZNID 4BKSD 3HM6X 3NZ3A 3IFWB 2NMQA 1ISNA 2FIDA 2HE7A 1NYRA 3I3TB 1SF0A 1ZXHA 3RT3B 1XEEA 2RR9A 1E8WA 3PSEB 3RZWC 1J19A 2N1VA 1FXAA 4C4VB 3VTVA 1VZ6A 4PS8A 3VUWA 2WXKA 3T8MA 3SFEB 2JSVX 3ZJTA 1QF6A 1TBEA 2K6DB 2CHZA 3JSVA 2O6VA 4DHZE 1C1YB 4EE2A 3FILB 2GOWA 2DENB 2GBMA 2PJHA 2XEWA 3NY5A 3DHIC 1WYGA 2IJ0A 1QOBA 4XYCA 1ZP0B 1RM6C 3NUHB 3PVLA 4E74A 3AN1A 2KJ6A 3JYUA 2G45B 3BZDB 4XE0A 2N0SB 4YSZB 2L05A 2XK5B 2DWQA 4KZCA 3PZ8A 4YL8A 1C4AA 3L0WB 3WIMA 3TEXA 1OQYA 2N9XA 3ZIMA 2L8JA 3P4SB 5JH5C 4BFRA 1ET9A 2J53A 2JPHA 1HZ6A 2EKIA 1EWCA 2JYEA 2KMAA 4ASWC 2JRIB 3NRZA 2PMVA 3QHTA 3ZRCA 3C19A 4KGTA 3CSTA 4P16A 3IHPC 5J2RA 3DDCB 2BB6A 1UUPA 3VH4B 3W5UB 2L52A 3TEYA 2SAKA 4M0WA 2WXQA 4DXAB 2KX3A 2LGSA 3Q8CA 1HXYD 4S17A 4OW0A 1MI0A 3AB5A 2IY1B 1TJEA 4QAYA 4JLCA 2UYZB 1V6EA 5IP4D 1TZOA 4HEA1 1DGJA 2N7DA 1GPXA 1TKYA 2VZKD 1GJZA 1ZDVA 1V9JA 2WXPA 1RAXA 2J52A 1HE8A 2LZ6A 1SSNA 1WRIA 4ZHOA 1E7VA 1GNUA 2BS4B 1KF6B 1I4GA 2M17A 3OJ4B 2LD9A 3ZTCA 1FFUA 3EA6A 1V2YA 3SFDB 3DBLB 2I1JA 1I4RA 2KWVB 4MGZE 4P1CC 1YNTE 1GOZA 2X38A 4FJYA 3Q2AC 5G5HA 1KRHA 1T0QC 1Z5SB 2JZ3B 2D3AA 3HM3A 1FNUA 1JWUD 4ICVA 3ETRA 2CJNA 3N1ZC 4GDKA 2DNFA 3N1XC 3SD5A 1X1MA 4IM3A 4MSMB 3ZNGC 1TZ1A 1UWMA 4O1NA 2CR5A 4WWOA 5BMGA 2ACZB 2VH1A 4ZDVA 3QK0A 1MHHE 5E6PA 1JW9D 3NVZA 4MSQB 4HPLB 2FUHB 2N7EA 4IDIA 1WY8A 3ZVVA 4I6PA 2NBWB 3QCAA 3GP7A 2KWUB 4LNOA 3P1MA 4MH0E 2IZVB 3K9PB 1YN5A 1WGRA 4AUQC 1TIFA 2IGHA 2QEJC 2D3CA 1IBXB 2LWPA 3AU4A 5FKAC 2NPTA 4LLGM 2ZPNA 2RGFA 3AMZA 2BWFA 2NS5A 5G55A 1T0RC 1WF9A 2QHOA 1UBQA 3LB8C 2IYDB 1CK1A 4FLHA 1RFAA 3VTWA 1YX6B 4WQOB 4IW0A 4IWQA 2MJDA 2ZVNA 3GOEA 5EE9A 2KHWB 4ZRJA 3N32A 3U7DA 1AN8A 1ROEA 4D2KA 4E3CA 1XXGA 3PV1A 5HKHA 3R7RA 4EZKA 3R8BA 1QOAA 1DOXA 2XNAC 2CJOA 3ZUNA 3BVMA 3AE4B 2KDFB 4XDCA 3GE8C 2MH7A 3QQ8B 1LFDA 2D3BA 2KKCA 2HJ1A 2K0PA 1GAQB 1RFKA 2LUEA 3E9SA 2HD5B 3Q8EA 1YJIA 1I4HA 1T0YA 2BT6A 2JVCA 4DK5A 3W1SC 1AWDA 4G3XB 3O65B 2WDTB 4LNFA 3B2GA 2DAJA 3ZJUA 2FCMA 4TV3A 2EMSA 3N30A 4RCOA 2MHJA 1DOYA 2KANA 5BMIA 4YSYB 4TQ1A 2W55A 1RRBA 1CQVA 3OWEB 4KGRA 4WJPA 4BVUC 2LGIA 2V9HA 1PYWD 4KDLB 4PK1A 4US9A 1KJTA 3KW5B 3A9KA 2O2VB 5C3JB 4MJSB 3RNFC 1YX5B 5HFYA 5LXIB 2N9EB 3B2FA 2LJIA 3H7PB 1QT9A 2ZNVC 1NI3A 4B0MA 4M8NA 3R7QA 1B1ZA 2WQYB 2AL6A 4C56C 4NJ7A 1D5ZC 2JWUA 4L2YA 3N20C 3O13A 2LRUA 4OZBA 3N1YC 1YIWA 3V05A 4MDKE 3T3NA 2K9XA 3V6CB 2BYFA 5H92C 4Q2JA 1LXDA 5KHQA 2CKHB 1IBXA 4HPMB 1YJ1A 2H88B 4ZRIA 2L0FA 1CJEA 4RGTA 3AU5A 1NBFC 4ITKA 4PYUA 2X8XX 1SGHA 1XQQA 2FCQA 2I2YA 1OGWA 2KFJA 3MFGA 3WANA 3UQBA 2H89B 3ZYYX 1FFVA 1VZ7A 2WX1A 4BBNC 3W2DA 2O6VD 1C4CA 3DBRB 1V1PA 4HWIB 2D3GA 2MX2A 4EEWA 2JXTA 1WYWB 3QX1A 1KFYB 2NCNA 1WH3A 3P4RB 1PDXA 2KQ7A 1HA5A 4FXCA 1UBIA 2DLBA 2WX0A 2HDEA 2OOBB 2KWDA 4MACA 3DHGC 3DBRI 4WQMA 3H7PA 3VTUA 2LGXA 1WMHB 2AQ2B 5J18A 5FK9C 1XLOA 4FJZA 4A20A 1ZUD2 4ARCA 1WZ3A 4JL9A 3BYYB 2J0JA 2RPVA 2KJHB 4LDTB 2DZJA 3KWLA 4DQOC 2PVGC 1KLUD 2NTSA 1E0ZA 2MJ3A 2WDQB 3AI5A 2REXA 3TBLD 3VUXA 1F2RC 4B95A 3Q3JA 1WJNA 3RULA 2LVPA 3APCA 5DPRA 2G3QB 2WS3B 1NDDA 4OZAA 4BOZB 3P4PB 5HG2A 3Q3OC 3AV8A 3B1LX 3TEZA 1FPYA 2AX5A 1K8RB 4LNKA 3NHEB 2ZEQA 1V1OA 2GI9A 1D5XC 3EECA 5IAAC 1EF1A 4W9LA 4EKUA 4BKGA 1WGYA 4JE3B 5G2NA 4DHJB 3HUIA 4NQLB 1JROA 2WXOA 1HZ5A 1WXMA 2R2QA 2KD0A 5D3IB 1GB4A 1R4MB 1HEZE 2C7HA 3AEAB 2JY6A 4ANUA 1XCTL 4NQKE 3AM9A 4MM3A 5E6JA 5IKCM 1KH0A 2KMMA 4AOFA 1SJHD 1VD2A 3B08A 4GXBA 2CU3A 2W54A 5D6JB 5H8YE 1FRDA 3P4QB 1WX8A 2KDMA 1FO4A 2KFKB 4KX6B 5IOIA 3L10B 3RNCC 1SIJA 4NAMA 2ONQA 2RMMA 2QMTA 1BUIC 3W5VB 1ZE3D 1QKZA 2XN9C 1ZOYB 5GXGB 4JQWC 2INCC 3I63C 2NTTA 1L4DB 2LMCA 5EE3A 2BS2B 2MW5A 2INDC 3A4RA 1TY2A 4TUUA 3GB1A 3U52E 1GB1A 1STEA 2WXGA 3DBLI 2KJRA 3ZJVA 3EHVA 4KGSA 2LGYA 4TSSA 4GOCA 2KVZA
chains in the Genus database with same CATH topology
2D07B 1Y8RC 4AWJA 2N1WA 2NR2A 3L13A 4KV2A 5CX3A 2CU1A 5LLIA 2GBKA 3MJWA 1RAXA 4KSKC 2LZ6A 1HE8A 2G4SA 3M63B 2MCNB 2BGFA 2C7MB 2KDIA 4IM0A 1E7VA 2L7RA 1GNUA 1TGZB 5AZHA 1WIAA 4G0NB 2M17A 3OJ4B 2LD9A 3ZTCA 5E6OA 2IO0B 1V5TA 1V2YA 3UINB 4DHJD 4MGYE 1AARA 2GBNA 2I1JA 3PRPB 4GN1A 2KWVB 4MGZE 1UELA 4HVBA 3VVWB 3T9LA 4NPNA 4BKTA 2LGDA 1KOTA 5KHOA 4LDTD 5E6NA 1P3QU 4FJYA 2KC1A 1P9DU 2IY0B 4IWPA 1SE9A 1PQSA 2KX0A 2KZRA 2D2QA 3ALBA 3RYTA 4W9DA 2RSUA 2J7QB 3KUCB 4EOYA 1Z5SB 2JZ3B 5C23A 3RCZA 4JGHB 2MBBB 2LASA 1Q5WB 2KTFA 3U30A 3L17A 3ZW3A 3HM3A 4MJSA 3RZFA 4NAWB 2ZVOA 4ICVA 1GUAB 2WWZA 4GDKA 1LQBA 1E7UA 3SD5A 4AP4C 4JIOU 2RPQA 1X1MA 3H1UA 4BOSC 2FNJB 1V5OA 1E5WA 2BWES 4HCPB 4IM3A 4MGKE 2EKEC 4LCDE 3H7SA 4MSMB 3ZNGC 1TZ1A 4ANVA 4ICUA 2CR5A 4WWOA 4KSLC 1E8YA 1V81A 2XK5A 4W9KA 5CHWA 2BYVE 4WWNA 3PZDA 1UZXB 4PYZA 4ZDVA 2GBJA 2KTRA 2L3ZA 3QK0A 1GC7A 5E6PA 3HHMA 4WJOA 4W9FA 4M0WB 2N9PC 4MSQB 1XT9B 4EZLA 4HPLB 1WX9A 2FUHB 2N7EA 1G6JA 1U4AA 1WJ4A 4XC2A 3U8ZA 1WY8A 4G50A 1I35A 3ZVVA 2CHXA 4I6PA 2BKRB 1IYFA 2LRWA 3WA0A 2NBWB 3VXWA 5DPWA 4WWPA 2MP2B 2IBIB 4GB9A 3QCAA 2WYQA 2KWUB 4IG7B 3EC8A 4MH0E 2IZVB 3K9PB 1OEYJ 1WGRA 4AUQC 1WXAA 3ZDMC 4BBNF 1R4MI 1WJUA 3DVNV 4G11A 4DBGA 2LWPA 3AU4A 4HDQA 2NPTA 5JHAA 4W9GA 2ZPNA 2FIFA 2RGFA 2BWFA 1IP9A 2NS5A 3OJ3A 3IVFA 1V49A 1WGHA 4B6WA 3NZUA 5G55A 2MA9B 2BF8B 1F9JA 2BYEA 2C7NB 1KM7A 4GIVA 2MQJA 1WF9A 2QHOA 1TTNA 3TMPB 2EMTA 2MBHA 2KOXA 4MELA 1NI2A 4EUTA 3WAPA 1UBQA 2IYDB 3PTFC 1WI0A 2VRRB 1RFAA 3R66C 4FLHA 4W9JA 1YX6B 4WQOB 3V6EB 3VTWA 3CMMB 2L76A 4IW0A 4IWQA 4GSWA 3GOEA 1UH6A 2ZVNA 4KIKB 1EO6A 2O2VA 2KHWB 4FJVB 3JVZX 4ZRJA 3N32A 3U7DA 5DCNA 4A3PA 3UF8A 2KN5A 2FAZA 2AEHA 2LXAA 4GDLB 1Z2MA 2JWZA 4E3CA 3KUZA 3PV1A 1EUVB 3R7RA 5HKHA 1P1AA 1WGGA 4NNJB 5CHVC 4EZKA 1OEYA 3V62A 3VQIA 2MBQA 4AJYB 2LJ5A 2O6VB 4RM9A 3NOBA 1GG3A 4DDID 5D94A 2KLCA 3BINA 4HDOA 3DVGX 4M8MA 2GBRA 3L08A 3APDA 4PS3A 3ZUNA 3M95A 2KDFB 2XBBC 3A4SC 4J6IA 4PS7A 5BO4B 3WALA 2KDBA 2NPTB 3QQ8B 5D7GA 1WRDB 2HTHA 2ZPYA 1LFDA 2KKCA 3ML9A 2CS4A 1UD7A 2ZCBA 3PHWB 4KIKA 1P0RA 2K39A 2DX5B 2DYBA 2LUEA 3DPDA 2J0MA 2FCSA 3QAQA 2ZCCA 1MG8A 2HD5B 3ZNHB 4K81A 5JHBA 3TJPA 1ZKHA 1SIFA 2IO2B 5CHFA 4W9HA 1T0YA 4NY0A 2JVCA 4DK5A 3C0RB 1RLFA 4DHZB 4ZRKA 3W1SC 5AEKB 4TKNA 5D2MB 3ONSA 2KQSA 3ENEA 4I6NB 3VFKA 4N9F4 5JZEB 4G3XB 4KDIC 1XD3B 4P7IA 3O65B 4ZYNA 4RMAA 4AJWA 2WDTB 4FHKA 2JRHA 2KTRB 2L00B 2DAJA 2JUOA 2K8BA 2FCMA 2Z59B 3NS8A 4HJKA 4TV3A 2EMSA 3N30A 2JXXA 3UIOB 3V60A 3PRZA 2KANA 1FXTB 1YQBA 3PS6A 4DDGD 4I6LB 3RD2A 3DCGA 1BT0A 4TQ1A 1RRBA 2ZJDA 3ZDTA 3PLUA 2LXCA 4WJPA 3JSVB 4BVUC 4KDLB 3HK0A 4CHKA 1L2NA 3L54A 4GDKB 3OAWA 1KJTA 3KW5B 3A9KA 1Q1OA 2O2VB 1EF5A 2KFKA 4CYEA 2R2OA 4FN2A 3A1QB 4MJSB 3B0AA 4IC7B 5AZGA 2KNBA 1YX5B 3W1SA 4FBJB 5L95C 2N9EB 5LXIB 3H7PB 3APFA 3A9JB 4K7WA 2ZNVC 3KUDB 1UGMA 3NZSA 3QJZA 4EFOA 3PHXB 2Y5BB 3SDLC 4M8NA 3R7QA 1IPGA 4K7SA 4W9IA 2FCNA 1D3ZA 2K6QA 2AL6A 3PT2B 3KH0A 4NJ7A 4K1RB 4NJ6A 1E90A 2LRUA 3P2BA 2HJ8A 3K9OB 1YIWA 3DVNU 2V3SA 2C5LC 3QWZB 5DPSA 3S2AA 4MDKE 5L83A 2PPHA 3LDZE 4X57B 2MBOA 2K8CA 1WFYA 2DZMA 4NAWA 5LXHA 1ZW7A 1S3SG 3V6CB 2ZNVB 2NBUA 3M3JA 2BYFA 3PRMB 4W9CA 4OVVA 2A4ZA 2LVQA 2BPSA 2RD0A 1LXDA 2KC2A 2OJRA 1H4RA 1C3TA 5KHQA 2W9NA 5CTRC 2CKHB 1QZEA 2LI5A 4HPMB 4FHJA 1WE6A 5C1ZA 3TCAA 3OLMD 2AYOB 1YJ1A 4FA6A 4GDLA 4ZRIA 2L0FA 4TQ0A 3AU5A 3DBHI 2MBEA 3QA8A 2M8SA 4F7ZA 1NBFC 4FULA 4PYUA 1SGHA 1XQQA 1WXVA 1OTRB 2JF5A 3EFUA 2UWQA 2FCQA 4HCNB 3W1YA 1OGWA 3VHTC 3IG3A 4IM2A 2KFJA 2M1MA 4OVUA 4RM8A 3A9KB 2DYOA 2DZIA 2YVCA 2V4LA 3WANA 3UQBA 2L0TA 2I1KA 4MEMA 1WXSA 2KVRA 4CO7A 2PE6B 1I42A 3AULA 2WX1A 2N4FA 4WJQA 3KYDD 4BBNC 3A9JA 3TIXA 3R3MA 2O6VD 3DVGY 3QC8B 3H9DA 4HWIB 5FR6A 2D3GA 2MX2A 4EEWA 4GU2A 1J0GA 3QIJA 3VAWA 1WYWB 3QX1A 3QARA 3X0WA 2NCNA 2ASQA 1WH3A 2J0KA 3MTNB 3X23A 3ZKJC 3IBEA 4BKSA 2KQ7A 2JT4B 2AWTA 3KYCD 4XX5A 3WAOA 4ANXA 4E71A 4ANWA 1UBIA 2JZZA 3ZRFA 2WX0A 1WM3A 1A5RA 1V80A 2PEAA 2V1YA 2KXJA 2OOBB 3UGBB 2ZZPB 2DAFA 2LVOA 2C60A 3SHQA 3DBRI 1L7YA 4DWFA 3ZNID 4BKSD 3HM6X 3IFWB 1ISNA 3H7PA 2FIDA 2HE7A 3PGEA 3VTUA 3CSFA 2LGXA 2KLGA 3A1QA 1YD8U 1WMHB 5TR5A 5J18A 3D32A 3I3TB 2DYMA 5GMVA 2KWCA 4FJZA 3RT3B 4F1SA 1GC6A 2MSED 3L16A 4A20A 2RR9A 1E8WA 3PSEB 3RZWC 1J19A 1WZ3A 2K8HA 2N1VA 3HIZA 3VH3B 4URKA 4JL9A 2J0JA 2KJHB 1P98A 1VCBA 2G4DB 4LDTB 3RUIB 2DZJA 3CF6E 1Q0WB 3VTVA 4PS8A 3VUWA 3T8MA 1WR1A 3ECIA 1S1QB 1LM8B 3AI5A 2REXA 1TBEA 3TBLD 3VUXA 2BKFA 2K6DB 2CHZA 3JSVA 4B95A 2MWSB 4WJNA 3Q3JA 2O6VA 4LJOB 3JW0X 4DHZE 1WJNA 3RULA 2LVPA 3APCA 5DPRA 2G3QB 1C1YB 4KZ0A 1NDDA 3A33B 3ZO5B 2GOWA 4BOZB 2DENB 1H8CA 2GBMA 2PJHA 2XEWA 3H6NA 4IUMB 3NY5A 1WM2A 1WJ6A 1WX7A 3B1LX 1KLVA 1K8RB 3NHEB 2NVUI 3M62B 2ZEQA 2D11A 5J17A 2AL3A 4MGIE 2IO1B 1WR6E 3PVLA 4E74A 3EECA 2KJ6A 5IAAC 3JYUA 3DBSA 2G45B 1EF1A 4KVGB 4W9LA 4EKUA 4BKGA 3SU8X 1WGYA 2DZKA 2M4NA 2L05A 5IA7A 2XK5B 2DHZA 5G2NA 4DHJB 3BY4B 4KZCA 4IWOA 4NQLB 4YL8A 3L0WB 1WXMA 2M0XA 2R2QA 3V61A 1R4NI 2KK8A 3N3KB 4II3B 3WIMA 3WAMA 1OQYA 3UIPB 2N9XA 2KD0A 3ZIMA 4K7UA 2L8JA 5JH5C 3UQAA 4BFRA 4LJPB 1WZ0A 2C7HA 3Q3FA 2JY6A 4ANUA 4NQKE 2JPHA 4MM3A 2NBVB 3ZTDA 1M94A 3TL5A 2KMAA 4ASWC 2JRIB 1E8XA 2A5UA 3GZNI 3QHTA 3ZRCA 4WAAA 4AOFA 4F8CB 1VD2A 4B9KA 3PREA 1WMHA 4A3OA 2YLMA 4XZ4A 3B08A 4GGQA 4GXBA 1ZGUB 4HK2A 5D6JB 3CSTA 3AXCA 2IO3B 3IHPC 5J2RA 3DDCB 1WX8A 1WGDA 5AZFA 1V86A 2PE9A 3MHSD 2KFKB 2KDEB 1E8ZA 2Z0DB 3VH4B 3PPAA 3L10B 2Z0EB 2C9WB 1JRUA 4DXAB 5DPTA 2B3AA 2KX3A 2K25A 4FADA 4W9EA 1J8CA 4JQWC 1CMXB 5EDSA 2MP2A 2MRPA 2MLBA 4HLEA 2K1FA 2IY1B 4EZJA 2D10A 4JLCA 2MW5A 2UYZB 3LJ3A 1V6EA 2CHWA 3ZLZA 3A4RA 4TUUA 2N7DA 3PLVA 4HXDA 3DBLI 2GMIC 3DQVA 1GJZA 4GMVA 1WE7A 3DOWA 3ZNZB 2KJRA 2KMCA 3EHVA 4II2B 2LGYA 1V9JA 3KVFB 3ML8A 3VDZA 2KO3A 4GOCA 3VUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D07 B;  1Y8R C;  4AWJ A;  2N1W A;  2NR2 A;  3L13 A;  4KV2 A;  5CX3 A;  2CU1 A;  5LLI A;  2GBK A;  3MJW A;  1RAX A;  4KSK C;  2LZ6 A;  1HE8 A;  2G4S A;  3M63 B;  2MCN B;  2BGF A;  2C7M B;  2KDI A;  4IM0 A;  1E7V A;  2L7R A;  1GNU A;  1TGZ B;  5AZH A;  1WIA A;  4G0N B;  2M17 A;  3OJ4 B;  2LD9 A;  3ZTC A;  5E6O A;  2IO0 B;  1V5T A;  1V2Y A;  3UIN B;  4DHJ D;  4MGY E;  1AAR A;  2GBN A;  2I1J A;  3PRP B;  4GN1 A;  2KWV B;  4MGZ E;  1UEL A;  4HVB A;  3VVW B;  3T9L A;  4NPN A;  4BKT A;  2LGD A;  1KOT A;  5KHO A;  4LDT D;  5E6N A;  1P3Q U;  4FJY A;  2KC1 A;  1P9D U;  2IY0 B;  4IWP A;  1SE9 A;  1PQS A;  2KX0 A;  2KZR A;  2D2Q A;  3ALB A;  3RYT A;  4W9D A;  2RSU A;  2J7Q B;  3KUC B;  4EOY A;  1Z5S B;  2JZ3 B;  5C23 A;  3RCZ A;  4JGH B;  2MBB B;  2LAS A;  1Q5W B;  2KTF A;  3U30 A;  3L17 A;  3ZW3 A;  3HM3 A;  4MJS A;  3RZF A;  4NAW B;  2ZVO A;  4ICV A;  1GUA B;  2WWZ A;  4GDK A;  1LQB A;  1E7U A;  3SD5 A;  4AP4 C;  4JIO U;  2RPQ A;  1X1M A;  3H1U A;  4BOS C;  2FNJ B;  1V5O A;  1E5W A;  2BWE S;  4HCP B;  4IM3 A;  4MGK E;  2EKE C;  4LCD E;  3H7S A;  4MSM B;  3ZNG C;  1TZ1 A;  4ANV A;  4ICU A;  2CR5 A;  4WWO A;  4KSL C;  1E8Y A;  1V81 A;  2XK5 A;  4W9K A;  5CHW A;  2BYV E;  4WWN A;  3PZD A;  1UZX B;  4PYZ A;  4ZDV A;  2GBJ A;  2KTR A;  2L3Z A;  3QK0 A;  1GC7 A;  5E6P A;  3HHM A;  4WJO A;  4W9F A;  4M0W B;  2N9P C;  4MSQ B;  1XT9 B;  4EZL A;  4HPL B;  1WX9 A;  2FUH B;  2N7E A;  1G6J A;  1U4A A;  1WJ4 A;  4XC2 A;  3U8Z A;  1WY8 A;  4G50 A;  1I35 A;  3ZVV A;  2CHX A;  4I6P A;  2BKR B;  1IYF A;  2LRW A;  3WA0 A;  2NBW B;  3VXW A;  5DPW A;  4WWP A;  2MP2 B;  2IBI B;  4GB9 A;  3QCA A;  2WYQ A;  2KWU B;  4IG7 B;  3EC8 A;  4MH0 E;  2IZV B;  3K9P B;  1OEY J;  1WGR A;  4AUQ C;  1WXA A;  3ZDM C;  4BBN F;  1R4M I;  1WJU A;  3DVN V;  4G11 A;  4DBG A;  2LWP A;  3AU4 A;  4HDQ A;  2NPT A;  5JHA A;  4W9G A;  2ZPN A;  2FIF A;  2RGF A;  2BWF A;  1IP9 A;  2NS5 A;  3OJ3 A;  3IVF A;  1V49 A;  1WGH A;  4B6W A;  3NZU A;  5G55 A;  2MA9 B;  2BF8 B;  1F9J A;  2BYE A;  2C7N B;  1KM7 A;  4GIV A;  2MQJ A;  1WF9 A;  2QHO A;  1TTN A;  3TMP B;  2EMT A;  2MBH A;  2KOX A;  4MEL A;  1NI2 A;  4EUT A;  3WAP A;  1UBQ A;  2IYD B;  3PTF C;  1WI0 A;  2VRR B;  1RFA A;  3R66 C;  4FLH A;  4W9J A;  1YX6 B;  4WQO B;  3V6E B;  3VTW A;  3CMM B;  2L76 A;  4IW0 A;  4IWQ A;  4GSW A;  3GOE A;  1UH6 A;  2ZVN A;  4KIK B;  1EO6 A;  2O2V A;  2KHW B;  4FJV B;  3JVZ X;  4ZRJ A;  3N32 A;  3U7D A;  5DCN A;  4A3P A;  3UF8 A;  2KN5 A;  2FAZ A;  2AEH A;  2LXA A;  4GDL B;  1Z2M A;  2JWZ A;  4E3C A;  3KUZ A;  3PV1 A;  1EUV B;  3R7R A;  5HKH A;  1P1A A;  1WGG A;  4NNJ B;  5CHV C;  4EZK A;  1OEY A;  3V62 A;  3VQI A;  2MBQ A;  4AJY B;  2LJ5 A;  2O6V B;  4RM9 A;  3NOB A;  1GG3 A;  4DDI D;  5D94 A;  2KLC A;  3BIN A;  4HDO A;  3DVG X;  4M8M A;  2GBR A;  3L08 A;  3APD A;  4PS3 A;  3ZUN A;  3M95 A;  2KDF B;  2XBB C;  3A4S C;  4J6I A;  4PS7 A;  5BO4 B;  3WAL A;  2KDB A;  2NPT B;  3QQ8 B;  5D7G A;  1WRD B;  2HTH A;  2ZPY A;  1LFD A;  2KKC A;  3ML9 A;  2CS4 A;  1UD7 A;  2ZCB A;  3PHW B;  4KIK A;  1P0R A;  2K39 A;  2DX5 B;  2DYB A;  2LUE A;  3DPD A;  2J0M A;  2FCS A;  3QAQ A;  2ZCC A;  1MG8 A;  2HD5 B;  3ZNH B;  4K81 A;  5JHB A;  3TJP A;  1ZKH A;  1SIF A;  2IO2 B;  5CHF A;  4W9H A;  1T0Y A;  4NY0 A;  2JVC A;  4DK5 A;  3C0R B;  1RLF A;  4DHZ B;  4ZRK A;  3W1S C;  5AEK B;  4TKN A;  5D2M B;  3ONS A;  2KQS A;  3ENE A;  4I6N B;  3VFK A;  4N9F 4;  5JZE B;  4G3X B;  4KDI C;  1XD3 B;  4P7I A;  3O65 B;  4ZYN A;  4RMA A;  4AJW A;  2WDT B;  4FHK A;  2JRH A;  2KTR B;  2L00 B;  2DAJ A;  2JUO A;  2K8B A;  2FCM A;  2Z59 B;  3NS8 A;  4HJK A;  4TV3 A;  2EMS A;  3N30 A;  2JXX A;  3UIO B;  3V60 A;  3PRZ A;  2KAN A;  1FXT B;  1YQB A;  3PS6 A;  4DDG D;  4I6L B;  3RD2 A;  3DCG A;  1BT0 A;  4TQ1 A;  1RRB A;  2ZJD A;  3ZDT A;  3PLU A;  2LXC A;  4WJP A;  3JSV B;  4BVU C;  4KDL B;  3HK0 A;  4CHK A;  1L2N A;  3L54 A;  4GDK B;  3OAW A;  1KJT A;  3KW5 B;  3A9K A;  1Q1O A;  2O2V B;  1EF5 A;  2KFK A;  4CYE A;  2R2O A;  4FN2 A;  3A1Q B;  4MJS B;  3B0A A;  4IC7 B;  5AZG A;  2KNB A;  1YX5 B;  3W1S A;  4FBJ B;  5L95 C;  2N9E B;  5LXI B;  3H7P B;  3APF A;  3A9J B;  4K7W A;  2ZNV C;  3KUD B;  1UGM A;  3NZS A;  3QJZ A;  4EFO A;  3PHX B;  2Y5B B;  3SDL C;  4M8N A;  3R7Q A;  1IPG A;  4K7S A;  4W9I A;  2FCN A;  1D3Z A;  2K6Q A;  2AL6 A;  3PT2 B;  3KH0 A;  4NJ7 A;  4K1R B;  4NJ6 A;  1E90 A;  2LRU A;  3P2B A;  2HJ8 A;  3K9O B;  1YIW A;  3DVN U;  2V3S A;  2C5L C;  3QWZ B;  5DPS A;  3S2A A;  4MDK E;  5L83 A;  2PPH A;  3LDZ E;  4X57 B;  2MBO A;  2K8C A;  1WFY A;  2DZM A;  4NAW A;  5LXH A;  1ZW7 A;  1S3S G;  3V6C B;  2ZNV B;  2NBU A;  3M3J A;  2BYF A;  3PRM B;  4W9C A;  4OVV A;  2A4Z A;  2LVQ A;  2BPS A;  2RD0 A;  1LXD A;  2KC2 A;  2OJR A;  1H4R A;  1C3T A;  5KHQ A;  2W9N A;  5CTR C;  2CKH B;  1QZE A;  2LI5 A;  4HPM B;  4FHJ A;  1WE6 A;  5C1Z A;  3TCA A;  3OLM D;  2AYO B;  1YJ1 A;  4FA6 A;  4GDL A;  4ZRI A;  2L0F A;  4TQ0 A;  3AU5 A;  3DBH I;  2MBE A;  3QA8 A;  2M8S A;  4F7Z A;  1NBF C;  4FUL A;  4PYU A;  1SGH A;  1XQQ A;  1WXV A;  1OTR B;  2JF5 A;  3EFU A;  2UWQ A;  2FCQ A;  4HCN B;  3W1Y A;  1OGW A;  3VHT C;  3IG3 A;  4IM2 A;  2KFJ A;  2M1M A;  4OVU A;  4RM8 A;  3A9K B;  2DYO A;  2DZI A;  2YVC A;  2V4L A;  3WAN A;  3UQB A;  2L0T A;  2I1K A;  4MEM A;  1WXS A;  2KVR A;  4CO7 A;  2PE6 B;  1I42 A;  3AUL A;  2WX1 A;  2N4F A;  4WJQ A;  3KYD D;  4BBN C;  3A9J A;  3TIX A;  3R3M A;  2O6V D;  3DVG Y;  3QC8 B;  3H9D A;  4HWI B;  5FR6 A;  2D3G A;  2MX2 A;  4EEW A;  4GU2 A;  1J0G A;  3QIJ A;  3VAW A;  1WYW B;  3QX1 A;  3QAR A;  3X0W A;  2NCN A;  2ASQ A;  1WH3 A;  2J0K A;  3MTN B;  3X23 A;  3ZKJ C;  3IBE A;  4BKS A;  2KQ7 A;  2JT4 B;  2AWT A;  3KYC D;  4XX5 A;  3WAO A;  4ANX A;  4E71 A;  4ANW A;  1UBI A;  2JZZ A;  3ZRF A;  2WX0 A;  1WM3 A;  1A5R A;  1V80 A;  2PEA A;  2V1Y A;  2KXJ A;  2OOB B;  3UGB B;  2ZZP B;  2DAF A;  2LVO A;  2C60 A;  3SHQ A;  3DBR I;  1L7Y A;  4DWF A;  3ZNI D;  4BKS D;  3HM6 X;  3IFW B;  1ISN A;  3H7P A;  2FID A;  2HE7 A;  3PGE A;  3VTU A;  3CSF A;  2LGX A;  2KLG A;  3A1Q A;  1YD8 U;  1WMH B;  5TR5 A;  5J18 A;  3D32 A;  3I3T B;  2DYM A;  5GMV A;  2KWC A;  4FJZ A;  3RT3 B;  4F1S A;  1GC6 A;  2MSE D;  3L16 A;  4A20 A;  2RR9 A;  1E8W A;  3PSE B;  3RZW C;  1J19 A;  1WZ3 A;  2K8H A;  2N1V A;  3HIZ A;  3VH3 B;  4URK A;  4JL9 A;  2J0J A;  2KJH B;  1P98 A;  1VCB A;  2G4D B;  4LDT B;  3RUI B;  2DZJ A;  3CF6 E;  1Q0W B;  3VTV A;  4PS8 A;  3VUW A;  3T8M A;  1WR1 A;  3ECI A;  1S1Q B;  1LM8 B;  3AI5 A;  2REX A;  1TBE A;  3TBL D;  3VUX A;  2BKF A;  2K6D B;  2CHZ A;  3JSV A;  4B95 A;  2MWS B;  4WJN A;  3Q3J A;  2O6V A;  4LJO B;  3JW0 X;  4DHZ E;  1WJN A;  3RUL A;  2LVP A;  3APC A;  5DPR A;  2G3Q B;  1C1Y B;  4KZ0 A;  1NDD A;  3A33 B;  3ZO5 B;  2GOW A;  4BOZ B;  2DEN B;  1H8C A;  2GBM A;  2PJH A;  2XEW A;  3H6N A;  4IUM B;  3NY5 A;  1WM2 A;  1WJ6 A;  1WX7 A;  3B1L X;  1KLV A;  1K8R B;  3NHE B;  2NVU I;  3M62 B;  2ZEQ A;  2D11 A;  5J17 A;  2AL3 A;  4MGI E;  2IO1 B;  1WR6 E;  3PVL A;  4E74 A;  3EEC A;  2KJ6 A;  5IAA C;  3JYU A;  3DBS A;  2G45 B;  1EF1 A;  4KVG B;  4W9L A;  4EKU A;  4BKG A;  3SU8 X;  1WGY A;  2DZK A;  2M4N A;  2L05 A;  5IA7 A;  2XK5 B;  2DHZ A;  5G2N A;  4DHJ B;  3BY4 B;  4KZC A;  4IWO A;  4NQL B;  4YL8 A;  3L0W B;  1WXM A;  2M0X A;  2R2Q A;  3V61 A;  1R4N I;  2KK8 A;  3N3K B;  4II3 B;  3WIM A;  3WAM A;  1OQY A;  3UIP B;  2N9X A;  2KD0 A;  3ZIM A;  4K7U A;  2L8J A;  5JH5 C;  3UQA A;  4BFR A;  4LJP B;  1WZ0 A;  2C7H A;  3Q3F A;  2JY6 A;  4ANU A;  4NQK E;  2JPH A;  4MM3 A;  2NBV B;  3ZTD A;  1M94 A;  3TL5 A;  2KMA A;  4ASW C;  2JRI B;  1E8X A;  2A5U A;  3GZN I;  3QHT A;  3ZRC A;  4WAA A;  4AOF A;  4F8C B;  1VD2 A;  4B9K A;  3PRE A;  1WMH A;  4A3O A;  2YLM A;  4XZ4 A;  3B08 A;  4GGQ A;  4GXB A;  1ZGU B;  4HK2 A;  5D6J B;  3CST A;  3AXC A;  2IO3 B;  3IHP C;  5J2R A;  3DDC B;  1WX8 A;  1WGD A;  5AZF A;  1V86 A;  2PE9 A;  3MHS D;  2KFK B;  2KDE B;  1E8Z A;  2Z0D B;  3VH4 B;  3PPA A;  3L10 B;  2Z0E B;  2C9W B;  1JRU A;  4DXA B;  5DPT A;  2B3A A;  2KX3 A;  2K25 A;  4FAD A;  4W9E A;  1J8C A;  4JQW C;  1CMX B;  5EDS A;  2MP2 A;  2MRP A;  2MLB A;  4HLE A;  2K1F A;  2IY1 B;  4EZJ A;  2D10 A;  4JLC A;  2MW5 A;  2UYZ B;  3LJ3 A;  1V6E A;  2CHW A;  3ZLZ A;  3A4R A;  4TUU A;  2N7D A;  3PLV A;  4HXD A;  3DBL I;  2GMI C;  3DQV A;  1GJZ A;  4GMV A;  1WE7 A;  3DOW A;  3ZNZ B;  2KJR A;  2KMC A;  3EHV A;  4II2 B;  2LGY A;  1V9J A;  3KVF B;  3ML8 A;  3VDZ A;  2KO3 A;  4GOC A;  3VUY A; 
#chains in the Genus database with same CATH topology
 2D07 B;  1Y8R C;  4JX1 C;  5CX3 A;  3Q14 C;  1DYQ A;  3MJW A;  2JYT A;  1R4N B;  4ZRP A;  2G4S A;  3HRD D;  1SXT A;  4LNN A;  2KDI A;  1JWM D;  1TGZ B;  4WUR A;  1XCQ L;  2IO0 B;  3PO0 A;  3UIN B;  2GBN A;  3PRP B;  1YMH E;  1UEL A;  3VVW B;  5MPO A;  2BQQ A;  4BKT A;  5KHO A;  2K22 A;  4LDT D;  2YEP B;  2OHF A;  1Q10 A;  2KZR A;  3VRB B;  2BTE A;  1VRA B;  3LYY A;  1UWX A;  2WXI A;  4A55 A;  3ZXR A;  3RCZ A;  3U30 A;  2LAS A;  3AEG B;  1J7A A;  3L17 A;  3ZW3 A;  3RZF A;  4NAW B;  5IO9 A;  1JML A;  1LQB A;  4JIO U;  4BOS C;  4GLS C;  2FNJ B;  2WXL A;  1E5W A;  2BWE S;  3SEB A;  2LHD A;  4LCD E;  4ANV A;  2W3R A;  4ICU A;  1E8Y A;  4MT5 A;  5CHW A;  4WWN A;  3C8Y A;  4PYZ A;  2GBJ A;  2KTR A;  2L3Z A;  3I57 A;  1GC7 A;  3HHM A;  4W9F A;  4M0W B;  3IT6 B;  1XT9 B;  4EZL A;  2QIE B;  4XC2 A;  1I35 A;  4G50 A;  3GZN B;  2CHX A;  1C78 A;  2BKR B;  2LRW A;  5DPW A;  2IBI B;  1IUE A;  2OJW A;  1M4V A;  2KYW A;  1OEY J;  3ZDM C;  4N59 A;  4DBG A;  4HDQ A;  1XLN A;  4W9G A;  3GE3 C;  1IP9 A;  4B6W A;  4N58 A;  1ZXI A;  3NZU A;  1F9J A;  1N5X A;  1TTN A;  4MEL A;  1NI2 A;  4HRS A;  4LNI A;  1F77 A;  1UH6 A;  2L1A A;  3Q8B A;  4FJV B;  1XLQ A;  3UF8 A;  2FAZ A;  4GDL B;  2JWZ A;  4KKI A;  5HI1 A;  3KUZ A;  1WGG A;  1OEY A;  1JWS D;  2MBQ A;  3IAM 1;  4AJY B;  3NOB A;  1GG3 A;  4ZYS A;  5D94 A;  2KLC A;  4M8M A;  3DVG X;  2N9K A;  2BB5 A;  3L08 A;  5HHD G;  4PS3 A;  4J6I A;  2XBB C;  3A4S C;  4PS7 A;  5BO4 B;  4L23 A;  4S0R A;  4HRO A;  2Y3A A;  2ZPY A;  2CS4 A;  3AEB B;  1UD7 A;  3MC9 A;  3PHW B;  3AE2 B;  1P0R A;  2K39 A;  4J3O D;  3DPD A;  2FCS A;  3FAH A;  4K81 A;  2WXJ A;  4K3C A;  4DHZ B;  4ZRK A;  1JCK B;  3ONS A;  2WP9 B;  4KDI C;  1XD3 B;  4P7I A;  4ZYN A;  1K53 A;  3RNE C;  2JRH A;  2KTR B;  2VZK B;  3NS8 A;  3S2A A;  3PRZ A;  4XDD A;  3CWI A;  3PS6 A;  4DDG D;  2JZP A;  2ZJD A;  1V97 A;  4AQ7 A;  4HKZ E;  4CHK A;  3MP9 A;  2Q5W D;  2KFK A;  4DXG A;  4CYE A;  5EE1 A;  4FN2 A;  4RF0 A;  1AW7 A;  5BYS A;  4IC7 B;  3W1S A;  4FBJ B;  5L95 C;  3ZGZ A;  4K7W A;  4IKG A;  1UGM A;  4MH8 A;  4DXF A;  4K7S A;  3ZQ4 A;  2PLP A;  4A90 A;  3PT2 B;  3KH0 A;  1BML C;  1E90 A;  3QWZ B;  3I5J C;  1IGD A;  5L83 A;  4K3B A;  3GS2 A;  1UGJ A;  1ZW7 A;  4W9C A;  1FNV A;  2WXF A;  4OVV A;  2LVQ A;  2RD0 A;  1K52 A;  2KC2 A;  3VR8 B;  2OJR A;  3VRA B;  4FHJ A;  1WE6 A;  3TCA A;  3OLM D;  4C7Y A;  2MBE A;  1MFW A;  1OTR B;  2JF5 A;  1FIQ A;  2UWQ A;  3IG3 A;  5JXV A;  3A9K B;  2DYO A;  2DZI A;  2YVC A;  3R2I A;  2L0T A;  4MEM A;  1YOV B;  2N9L A;  3A9J A;  3TUO A;  5FR6 A;  3QIJ A;  4M01 A;  3VAW A;  2ASQ A;  3MTN B;  3AE6 B;  3IBE A;  2AWT A;  4ANX A;  4ANW A;  2JZZ A;  1WM3 A;  2KXJ A;  2ZZP B;  2C60 A;  1N63 A;  3RFZ B;  2V4I B;  1E6E B;  4RNA A;  3P42 A;  3PGE A;  3CSF A;  1YD8 U;  3D32 A;  4US8 A;  2KWC A;  2MSE D;  3L16 A;  1SE3 A;  3HIZ A;  1T6B X;  4URK A;  1VCB A;  2G4D B;  1I7H A;  3RUI B;  1PGB A;  3N9Y C;  1Q0W B;  1WR1 A;  3NVV A;  1LM8 B;  3EFC A;  2W3S A;  2MWS B;  1TY0 A;  4LJO B;  4ACF A;  1ZPS A;  4OVZ A;  4KZ0 A;  4IUM B;  1WM2 A;  1WX7 A;  3AEF B;  1KLV A;  3AEC B;  3B9J A;  3W9C B;  2AL3 A;  1HTQ A;  1MPE A;  4MGI E;  3MJ5 A;  3PZ7 A;  1KLG D;  3DBS A;  2ZW0 A;  3ZXV A;  2ON8 A;  1VJK A;  3SU8 X;  1WSP A;  5G5G A;  5IA7 A;  2DHZ A;  3RNA C;  4WIP A;  2M0X A;  4YTN B;  3V61 A;  1R4N I;  2KK8 A;  4II3 B;  4OHJ A;  3WAM A;  4ZHP A;  1F52 A;  3UQA A;  2PIA A;  3AH7 A;  3Q3F A;  4YTM B;  3NVY A;  3ZTD A;  1M94 A;  4PT5 A;  2A5U A;  2LEK A;  2KAJ A;  4A3O A;  2YLM A;  4A8X C;  1ZGU B;  4HK2 A;  3AXC A;  2IO3 B;  2IGD A;  5I4D A;  1V86 A;  3MHS D;  1E8Z A;  2Z0D B;  3PPA A;  1FMA D;  1JRU A;  5DPT A;  1OFF A;  1C4P A;  2JX5 A;  2B3A A;  2K25 A;  1J8C A;  1CMX B;  1TKE A;  2MRP A;  2BS3 B;  2K1F A;  4EZJ A;  1KTK A;  1I4X A;  1TS2 A;  3LJ3 A;  2CHW A;  3I9V 1;  2AQ3 B;  1V1P B;  2WXN A;  4HXD A;  3PLV A;  1I4Q A;  2GMI C;  3DQV A;  1FCL A;  1LGR A;  1WE7 A;  3DOW A;  3ZNZ B;  4TMA B;  4II2 B;  3ML8 A;  3NS1 A;  3Q6B A;  1HTO A;  2WU5 B;  3VUY A;  1PUT A;  4AWJ A;  2N1W A;  2NR2 A;  3OG5 A;  3P63 A;  2CU1 A;  1N62 A;  3M63 B;  2BVC A;  3AE9 B;  2L7R A;  3IAS 1;  4G0N B;  1K51 A;  1MHX A;  4YSX B;  3BVZ A;  5TSS A;  4HVB A;  2LGD A;  2RDB C;  4JWS C;  4C00 A;  1KOT A;  2WNM A;  2WXH A;  5E6N A;  1JWA D;  1P3Q U;  2JQR B;  1I4P A;  1SE9 A;  2UU7 A;  4B0E A;  2D2Q A;  2WDV B;  3ALB A;  3RYT A;  1XF5 L;  2J7Q B;  3BWU D;  1L6U A;  5FR3 A;  2WXR A;  4RGN A;  3RN9 C;  4MJS A;  2GB1 A;  2YEP F;  1GUA B;  2KT7 A;  4USA A;  3BVG A;  1FM0 D;  1MVK A;  1FEH A;  1PGA A;  4AP4 C;  2M19 A;  1N6Z A;  4HCP B;  2EKE C;  3NG0 A;  4ZRQ A;  4KSL C;  1V81 A;  4W9K A;  1L0X B;  1EM7 A;  3FKY A;  1UZX B;  4H2A A;  4WWM A;  1WX9 A;  3KQ4 A;  1G6J A;  1U4A A;  3U8Z A;  2E6X A;  1IYF A;  3WA0 A;  3VXW A;  2GRI A;  3U2S C;  4WWP A;  4XGA B;  4A9A A;  3RMK C;  3EC8 A;  5LNK 1;  1WXA A;  1FCC C;  4BBN F;  1N60 A;  1XLP A;  1F0Z A;  5JHA A;  2FIF A;  4HKQ A;  3OJ3 A;  3IVF A;  1WGH A;  2MA9 B;  2BF8 B;  2C7N B;  5AUI A;  2D5G A;  2MQJ A;  4GIV A;  2QCZ A;  2PVO D;  2EMT A;  2MBH A;  4EUT A;  3WAP A;  3URY A;  1WXQ A;  3PTF C;  1WI0 A;  2VRR B;  3R66 C;  4W9J A;  2L76 A;  2O2V A;  1K50 A;  1EU4 A;  3JVZ X;  1SB3 C;  2QJL A;  1TT5 B;  2EEL A;  4NNJ B;  5CHV C;  5D3D A;  2DBY A;  2LJ5 A;  4RM9 A;  4DDI D;  3BIN A;  1DOI A;  3APD A;  1VLB A;  3MHZ A;  3NVW A;  3M95 A;  3LXF A;  3WAL A;  2KDB A;  5D7G A;  3DWG C;  2WLB A;  3AEE B;  2J4X A;  2I38 A;  2DYB A;  2M56 B;  3QAQ A;  2ZCC A;  1MG8 A;  3ZNH B;  2RDG A;  5CHF A;  3DHH C;  4N6E B;  2WHI A;  1FRR A;  1RLF A;  1NVI D;  2QDF A;  1NYQ A;  5D2M B;  1WWT A;  2KQS A;  3ENE A;  5JZE B;  4AJW A;  2K8B A;  2Z59 B;  2JXX A;  3UIO B;  5IN7 A;  1YQB A;  3RD2 A;  3DCG A;  2LXC A;  3L54 A;  4KKJ A;  4GDK B;  3OAW A;  2LUM A;  1Q1O A;  1SE2 A;  4UDU C;  4YT0 B;  3A1Q B;  5BMH A;  3B0A A;  4RGO S;  2IGG A;  3A9J B;  1JRP A;  3QJZ A;  4EFO A;  3PHX B;  1T3Q A;  2Y5B B;  3Q8A A;  2L32 A;  1TYG B;  1IPG A;  2LFI A;  2G9H D;  4P1B C;  4W9I A;  1J7C A;  1D3Z A;  4K1R B;  1TS4 A;  4NJ6 A;  3P2B A;  3K9O B;  3DVN U;  2C5L C;  5DPS A;  1WGK A;  2PPH A;  3TEW A;  1F2R I;  2MBO A;  2FE8 A;  2WGS A;  2DZM A;  4NAW A;  2WXM A;  1ET6 A;  2NBU A;  3PRM B;  2A4Z A;  5AUK A;  1L6V A;  1V8C A;  3Q69 A;  2QSD A;  2V3P A;  1H4R A;  1C3T A;  4P6V F;  2LI5 A;  1D4B A;  1PGX A;  4GDL A;  4F7Z A;  2M8S A;  1EWY C;  3EFU A;  3VHT C;  3U4E G;  1C9F A;  1YQ3 B;  2I1K A;  1WXS A;  1JWB D;  2PE6 B;  1I42 A;  3AUL A;  3NJT A;  2N4F A;  4WJQ A;  3TIX A;  1L5P A;  4R3D A;  1N61 A;  4GU2 A;  3FIL A;  5T8I A;  2J0K A;  3X23 A;  2E3T A;  3WAO A;  2JT4 B;  3KYC D;  4XX5 A;  4E71 A;  2IDY A;  2ZW1 A;  1UNS A;  3RI7 C;  1A5R A;  2V1Y A;  3U7Z A;  3UI3 A;  3UGB B;  3VR9 B;  2DAF A;  2LVO A;  1L7Y A;  3MC0 B;  3IT4 B;  1LO5 D;  2KLG A;  3A1Q A;  5TR5 A;  5GMV A;  2DYM A;  4RFB A;  1D5M C;  1GC6 A;  4F1S A;  3HVD A;  3KWV A;  2K8H A;  3VH3 B;  4ARI A;  3J9C A;  1P98 A;  5EE0 A;  3CF6 E;  3ECI A;  3H8H A;  1S1Q B;  1FXI A;  5C2T B;  2BKF A;  4JPS A;  4WJN A;  3JW0 X;  4RGM A;  3TSS A;  1B9R A;  3RNB C;  2FUG 1;  3A33 B;  2IPK D;  3ZO5 B;  4AS1 A;  3AE3 B;  1H8C A;  3H6N A;  4WAF A;  1WJ6 A;  3L4P A;  1OQQ A;  2NVU I;  3M62 B;  2D11 A;  5J17 A;  2IO1 B;  1WR6 E;  2Z8L A;  4KVG B;  2DZK A;  2M4N A;  1VR9 A;  3EGR A;  3KLS X;  3BY4 B;  4IWO A;  4XWW A;  3V3X A;  3N3K B;  2BYT A;  3UIP B;  2PW9 A;  3Q3M C;  4K7U A;  1RWS A;  2INP E;  4LJP B;  1WZ0 A;  4YXD B;  1ACC A;  2JU6 X;  2NBV B;  3TL5 A;  1E8X A;  2WDR B;  1J7B A;  3GZN I;  4WAA A;  4F8C B;  1PFD A;  4B9K A;  3PRE A;  1C79 A;  1WMH A;  2MJE A;  3DWM A;  4XZ4 A;  3E56 A;  4GGQ A;  1TS3 A;  1YN4 A;  1WGD A;  5AZF A;  1SEB D;  2PE9 A;  2KDE B;  4WH4 A;  4C80 A;  2Z0E B;  2C9W B;  2WU2 B;  2HTM E;  4FAD A;  4W9E A;  5EDS A;  2MP2 A;  2MLB A;  4HLE A;  4IOI E;  2D10 A;  1SE4 A;  3AE7 B;  1TKG A;  3ZLZ A;  1P7E A;  4REZ A;  4C4V A;  3RNG C;  4GMV A;  2KMC A;  3KVF B;  4RF1 A;  3VDZ A;  2SEB D;  2KO3 A;  1QQR A;  4LK0 M;  4KV2 A;  1T5X D;  3L13 A;  4HPP A;  5LLI A;  2GBK A;  4BAX A;  4KSK C;  1FD6 A;  2MCN B;  1SJE D;  2BGF A;  2C7M B;  5BYQ A;  4IM0 A;  5AZH A;  1WIA A;  1F1H A;  5E6O A;  2OED A;  1V5T A;  2K5P A;  4MGY E;  1AAR A;  1VZ8 A;  4DHJ D;  4GN1 A;  2MEK A;  2BW2 A;  3T9L A;  4NPN A;  2B76 B;  1E7P B;  2Y5C A;  2KC1 A;  1P9D U;  1QOG A;  2IY0 B;  4IWP A;  4JWU C;  1L0V B;  1PQS A;  2KX0 A;  4XWT A;  3BYT B;  4W9D A;  2RSU A;  4EOY A;  3KUC B;  5C23 A;  4JGH B;  2MBB B;  1Q5W B;  2KTF A;  2N7J A;  2QC8 A;  4MM3 B;  4L1B A;  2ZVO A;  1T0S C;  3BK1 A;  2WWZ A;  2PKO A;  1E7U A;  1QOF A;  2RPQ A;  3H1U A;  1L4Z B;  1V5O A;  4MGK E;  4M00 A;  1OQR A;  2RDH A;  3H7S A;  3Q3N C;  2XK5 A;  2BYV E;  3PZD A;  2Y5P A;  4NZL B;  1QIL A;  4WJO A;  1EU3 A;  2N9P C;  3FC4 A;  1SBB B;  1NEN B;  1WJ4 A;  4OZC A;  2V3N A;  3WCQ A;  2MP2 B;  4GB9 A;  2WYQ A;  4IG7 B;  3MC8 A;  4M02 A;  1WJU A;  1R4M I;  3DVN V;  4G11 A;  3R2T A;  2AQ1 B;  2KAC A;  1V49 A;  2BYE A;  1KM7 A;  2V0G A;  2ICI A;  1E10 A;  3TMP B;  3AE5 B;  3AE8 B;  2KOX A;  3DBH B;  3V6E B;  3CMM B;  4RH6 A;  4GSW A;  1Y56 A;  4KIK B;  1BXT A;  1EO6 A;  1FNW A;  3EUB 2;  1QLB B;  1P7F A;  5BYR A;  4BZA A;  5DCN A;  4A3P A;  2KN5 A;  2AEH A;  3CIR B;  4CQN A;  2LXA A;  2QIL A;  1Z2M A;  1EUV B;  1P1A A;  3VQI A;  3V62 A;  3RPF C;  4ZOH C;  4HJG E;  4YTP B;  2O6V B;  1JQ4 A;  4HDO A;  2GBR A;  2PTL A;  3AED B;  1IGC A;  3SR6 A;  2J42 A;  2FBW B;  4NJC A;  2NPT B;  1WRD B;  2HTH A;  3AE1 B;  1RYJ A;  3ML9 A;  1YN3 A;  1UF0 A;  2ZCB A;  4KIK A;  2DX5 B;  3BII D;  2K3U A;  2J0M A;  3T3O A;  2INN E;  3TJP A;  1ZKH A;  1SIF A;  2IO2 B;  5JHB A;  4W9H A;  4NY0 A;  2L83 A;  3C0R B;  5AEK B;  4TKN A;  1VDV A;  1CZP A;  4I6N B;  3VFK A;  4N9F 4;  4RMA A;  4FHK A;  4YWG G;  3ABV B;  4HJK A;  1ZDX A;  2JUO A;  2L00 B;  4C7Z A;  3BK2 A;  3V60 A;  1FXT B;  4I6L B;  1BT0 A;  2W82 A;  3ZDT A;  3PLU A;  2GLS A;  3JSV B;  3HK0 A;  1L2N A;  4A6Q A;  2KN4 A;  1EF5 A;  2R2O A;  1D6E C;  1NEK B;  5AZG A;  2KNB A;  3APF A;  1JAL A;  2G1E A;  3KUD B;  3NZS A;  3Q8F A;  3SDL C;  1HQR D;  1YQ4 B;  2FCN A;  2K6Q A;  1AYF A;  1XO3 A;  2HJ8 A;  2KQ4 X;  2V3S A;  2M0A A;  3LDZ E;  3IXS A;  4X57 B;  2K8C A;  1WFY A;  1E9M A;  5LXH A;  1S3S G;  4LTU A;  1MJD A;  2ZNV B;  1R7S A;  3M3J A;  2VH2 A;  2BPS A;  2W9N A;  5CTR C;  1YJJ A;  1QZE A;  5C1Z A;  1C76 A;  2AYO B;  4FA6 A;  2R61 A;  2TSS A;  4TQ0 A;  3DBH I;  3QA8 A;  4FUL A;  1WXV A;  4HCN B;  3W1Y A;  1ESF A;  1ENF A;  4IM2 A;  2M1M A;  4OVU A;  4RM8 A;  1C77 A;  2V4L A;  1L0Y B;  2KVR A;  4CO7 A;  1MG4 A;  3KYD D;  1TS5 A;  3R3M A;  2LHE A;  3DVG Y;  3QC8 B;  3H9D A;  1J0G A;  3QAR A;  3X0W A;  3ZKJ C;  4BKS A;  3ZRF A;  3HVZ A;  1V80 A;  2PEA A;  1N5W A;  3SHQ A;  2BBC A;  1A70 A;  4DWF A;  3ZNI D;  4BKS D;  3HM6 X;  3NZ3 A;  3IFW B;  2NMQ A;  1ISN A;  2FID A;  2HE7 A;  1NYR A;  3I3T B;  1SF0 A;  1ZXH A;  3RT3 B;  1XEE A;  2RR9 A;  1E8W A;  3PSE B;  3RZW C;  1J19 A;  2N1V A;  1FXA A;  4C4V B;  3VTV A;  1VZ6 A;  4PS8 A;  3VUW A;  2WXK A;  3T8M A;  3SFE B;  2JSV X;  3ZJT A;  1QF6 A;  1TBE A;  2K6D B;  2CHZ A;  3JSV A;  2O6V A;  4DHZ E;  1C1Y B;  4EE2 A;  3FIL B;  2GOW A;  2DEN B;  2GBM A;  2PJH A;  2XEW A;  3NY5 A;  3DHI C;  1WYG A;  2IJ0 A;  1QOB A;  4XYC A;  1ZP0 B;  1RM6 C;  3NUH B;  3PVL A;  4E74 A;  3AN1 A;  2KJ6 A;  3JYU A;  2G45 B;  3BZD B;  4XE0 A;  2N0S B;  4YSZ B;  2L05 A;  2XK5 B;  2DWQ A;  4KZC A;  3PZ8 A;  4YL8 A;  1C4A A;  3L0W B;  3WIM A;  3TEX A;  1OQY A;  2N9X A;  3ZIM A;  2L8J A;  3P4S B;  5JH5 C;  4BFR A;  1ET9 A;  2J53 A;  2JPH A;  1HZ6 A;  2EKI A;  1EWC A;  2JYE A;  2KMA A;  4ASW C;  2JRI B;  3NRZ A;  2PMV A;  3QHT A;  3ZRC A;  3C19 A;  4KGT A;  3CST A;  4P16 A;  3IHP C;  5J2R A;  3DDC B;  2BB6 A;  1UUP A;  3VH4 B;  3W5U B;  2L52 A;  3TEY A;  2SAK A;  4M0W A;  2WXQ A;  4DXA B;  2KX3 A;  2LGS A;  3Q8C A;  1HXY D;  4S17 A;  4OW0 A;  1MI0 A;  3AB5 A;  2IY1 B;  1TJE A;  4QAY A;  4JLC A;  2UYZ B;  1V6E A;  5IP4 D;  1TZO A;  4HEA 1;  1DGJ A;  2N7D A;  1GPX A;  1TKY A;  2VZK D;  1GJZ A;  1ZDV A;  1V9J A;  2WXP A;  1RAX A;  2J52 A;  1HE8 A;  2LZ6 A;  1SSN A;  1WRI A;  4ZHO A;  1E7V A;  1GNU A;  2BS4 B;  1KF6 B;  1I4G A;  2M17 A;  3OJ4 B;  2LD9 A;  3ZTC A;  1FFU A;  3EA6 A;  1V2Y A;  3SFD B;  3DBL B;  2I1J A;  1I4R A;  2KWV B;  4MGZ E;  4P1C C;  1YNT E;  1GOZ A;  2X38 A;  4FJY A;  3Q2A C;  5G5H A;  1KRH A;  1T0Q C;  1Z5S B;  2JZ3 B;  2D3A A;  3HM3 A;  1FNU A;  1JWU D;  4ICV A;  3ETR A;  2CJN A;  3N1Z C;  4GDK A;  2DNF A;  3N1X C;  3SD5 A;  1X1M A;  4IM3 A;  4MSM B;  3ZNG C;  1TZ1 A;  1UWM A;  4O1N A;  2CR5 A;  4WWO A;  5BMG A;  2ACZ B;  2VH1 A;  4ZDV A;  3QK0 A;  1MHH E;  5E6P A;  1JW9 D;  3NVZ A;  4MSQ B;  4HPL B;  2FUH B;  2N7E A;  4IDI A;  1WY8 A;  3ZVV A;  4I6P A;  2NBW B;  3QCA A;  3GP7 A;  2KWU B;  4LNO A;  3P1M A;  4MH0 E;  2IZV B;  3K9P B;  1YN5 A;  1WGR A;  4AUQ C;  1TIF A;  2IGH A;  2QEJ C;  2D3C A;  1IBX B;  2LWP A;  3AU4 A;  5FKA C;  2NPT A;  4LLG M;  2ZPN A;  2RGF A;  3AMZ A;  2BWF A;  2NS5 A;  5G55 A;  1T0R C;  1WF9 A;  2QHO A;  1UBQ A;  3LB8 C;  2IYD B;  1CK1 A;  4FLH A;  1RFA A;  3VTW A;  1YX6 B;  4WQO B;  4IW0 A;  4IWQ A;  2MJD A;  2ZVN A;  3GOE A;  5EE9 A;  2KHW B;  4ZRJ A;  3N32 A;  3U7D A;  1AN8 A;  1ROE A;  4D2K A;  4E3C A;  1XXG A;  3PV1 A;  5HKH A;  3R7R A;  4EZK A;  3R8B A;  1QOA A;  1DOX A;  2XNA C;  2CJO A;  3ZUN A;  3BVM A;  3AE4 B;  2KDF B;  4XDC A;  3GE8 C;  2MH7 A;  3QQ8 B;  1LFD A;  2D3B A;  2KKC A;  2HJ1 A;  2K0P A;  1GAQ B;  1RFK A;  2LUE A;  3E9S A;  2HD5 B;  3Q8E A;  1YJI A;  1I4H A;  1T0Y A;  2BT6 A;  2JVC A;  4DK5 A;  3W1S C;  1AWD A;  4G3X B;  3O65 B;  2WDT B;  4LNF A;  3B2G A;  2DAJ A;  3ZJU A;  2FCM A;  4TV3 A;  2EMS A;  3N30 A;  4RCO A;  2MHJ A;  1DOY A;  2KAN A;  5BMI A;  4YSY B;  4TQ1 A;  2W55 A;  1RRB A;  1CQV A;  3OWE B;  4KGR A;  4WJP A;  4BVU C;  2LGI A;  2V9H A;  1PYW D;  4KDL B;  4PK1 A;  4US9 A;  1KJT A;  3KW5 B;  3A9K A;  2O2V B;  5C3J B;  4MJS B;  3RNF C;  1YX5 B;  5HFY A;  5LXI B;  2N9E B;  3B2F A;  2LJI A;  3H7P B;  1QT9 A;  2ZNV C;  1NI3 A;  4B0M A;  4M8N A;  3R7Q A;  1B1Z A;  2WQY B;  2AL6 A;  4C56 C;  4NJ7 A;  1D5Z C;  2JWU A;  4L2Y A;  3N20 C;  3O13 A;  2LRU A;  4OZB A;  3N1Y C;  1YIW A;  3V05 A;  4MDK E;  3T3N A;  2K9X A;  3V6C B;  2BYF A;  5H92 C;  4Q2J A;  1LXD A;  5KHQ A;  2CKH B;  1IBX A;  4HPM B;  1YJ1 A;  2H88 B;  4ZRI A;  2L0F A;  1CJE A;  4RGT A;  3AU5 A;  1NBF C;  4ITK A;  4PYU A;  2X8X X;  1SGH A;  1XQQ A;  2FCQ A;  2I2Y A;  1OGW A;  2KFJ A;  3MFG A;  3WAN A;  3UQB A;  2H89 B;  3ZYY X;  1FFV A;  1VZ7 A;  2WX1 A;  4BBN C;  3W2D A;  2O6V D;  1C4C A;  3DBR B;  1V1P A;  4HWI B;  2D3G A;  2MX2 A;  4EEW A;  2JXT A;  1WYW B;  3QX1 A;  1KFY B;  2NCN A;  1WH3 A;  3P4R B;  1PDX A;  2KQ7 A;  1HA5 A;  4FXC A;  1UBI A;  2DLB A;  2WX0 A;  2HDE A;  2OOB B;  2KWD A;  4MAC A;  3DHG C;  3DBR I;  4WQM A;  3H7P A;  3VTU A;  2LGX A;  1WMH B;  2AQ2 B;  5J18 A;  5FK9 C;  1XLO A;  4FJZ A;  4A20 A;  1ZUD 2;  4ARC A;  1WZ3 A;  4JL9 A;  3BYY B;  2J0J A;  2RPV A;  2KJH B;  4LDT B;  2DZJ A;  3KWL A;  4DQO C;  2PVG C;  1KLU D;  2NTS A;  1E0Z A;  2MJ3 A;  2WDQ B;  3AI5 A;  2REX A;  3TBL D;  3VUX A;  1F2R C;  4B95 A;  3Q3J A;  1WJN A;  3RUL A;  2LVP A;  3APC A;  5DPR A;  2G3Q B;  2WS3 B;  1NDD A;  4OZA A;  4BOZ B;  3P4P B;  5HG2 A;  3Q3O C;  3AV8 A;  3B1L X;  3TEZ A;  1FPY A;  2AX5 A;  1K8R B;  4LNK A;  3NHE B;  2ZEQ A;  1V1O A;  2GI9 A;  1D5X C;  3EEC A;  5IAA C;  1EF1 A;  4W9L A;  4EKU A;  4BKG A;  1WGY A;  4JE3 B;  5G2N A;  4DHJ B;  3HUI A;  4NQL B;  1JRO A;  2WXO A;  1HZ5 A;  1WXM A;  2R2Q A;  2KD0 A;  5D3I B;  1GB4 A;  1R4M B;  1HEZ E;  2C7H A;  3AEA B;  2JY6 A;  4ANU A;  1XCT L;  4NQK E;  3AM9 A;  4MM3 A;  5E6J A;  5IKC M;  1KH0 A;  2KMM A;  4AOF A;  1SJH D;  1VD2 A;  3B08 A;  4GXB A;  2CU3 A;  2W54 A;  5D6J B;  5H8Y E;  1FRD A;  3P4Q B;  1WX8 A;  2KDM A;  1FO4 A;  2KFK B;  4KX6 B;  5IOI A;  3L10 B;  3RNC C;  1SIJ A;  4NAM A;  2ONQ A;  2RMM A;  2QMT A;  1BUI C;  3W5V B;  1ZE3 D;  1QKZ A;  2XN9 C;  1ZOY B;  5GXG B;  4JQW C;  2INC C;  3I63 C;  2NTT A;  1L4D B;  2LMC A;  5EE3 A;  2BS2 B;  2MW5 A;  2IND C;  3A4R A;  1TY2 A;  4TUU A;  3GB1 A;  3U52 E;  1GB1 A;  1STE A;  2WXG A;  3DBL I;  2KJR A;  3ZJV A;  3EHV A;  4KGS A;  2LGY A;  4TSS A;  4GOC A;  2KVZ A; 
#chains in the Genus database with same CATH homology
 2D07 B;  1Y8R C;  4AWJ A;  2N1W A;  2NR2 A;  3L13 A;  4KV2 A;  5CX3 A;  2CU1 A;  5LLI A;  2GBK A;  3MJW A;  1RAX A;  4KSK C;  2LZ6 A;  1HE8 A;  2G4S A;  3M63 B;  2MCN B;  2BGF A;  2C7M B;  2KDI A;  4IM0 A;  1E7V A;  2L7R A;  1GNU A;  1TGZ B;  5AZH A;  1WIA A;  4G0N B;  2M17 A;  3OJ4 B;  2LD9 A;  3ZTC A;  5E6O A;  2IO0 B;  1V5T A;  1V2Y A;  3UIN B;  4DHJ D;  4MGY E;  1AAR A;  2GBN A;  2I1J A;  3PRP B;  4GN1 A;  2KWV B;  4MGZ E;  1UEL A;  4HVB A;  3VVW B;  3T9L A;  4NPN A;  4BKT A;  2LGD A;  1KOT A;  5KHO A;  4LDT D;  5E6N A;  1P3Q U;  4FJY A;  2KC1 A;  1P9D U;  2IY0 B;  4IWP A;  1SE9 A;  1PQS A;  2KX0 A;  2KZR A;  2D2Q A;  3ALB A;  3RYT A;  4W9D A;  2RSU A;  2J7Q B;  3KUC B;  4EOY A;  1Z5S B;  2JZ3 B;  5C23 A;  3RCZ A;  4JGH B;  2MBB B;  2LAS A;  1Q5W B;  2KTF A;  3U30 A;  3L17 A;  3ZW3 A;  3HM3 A;  4MJS A;  3RZF A;  4NAW B;  2ZVO A;  4ICV A;  1GUA B;  2WWZ A;  4GDK A;  1LQB A;  1E7U A;  3SD5 A;  4AP4 C;  4JIO U;  2RPQ A;  1X1M A;  3H1U A;  4BOS C;  2FNJ B;  1V5O A;  1E5W A;  2BWE S;  4HCP B;  4IM3 A;  4MGK E;  2EKE C;  4LCD E;  3H7S A;  4MSM B;  3ZNG C;  1TZ1 A;  4ANV A;  4ICU A;  2CR5 A;  4WWO A;  4KSL C;  1E8Y A;  1V81 A;  2XK5 A;  4W9K A;  5CHW A;  2BYV E;  4WWN A;  3PZD A;  1UZX B;  4PYZ A;  4ZDV A;  2GBJ A;  2KTR A;  2L3Z A;  3QK0 A;  1GC7 A;  5E6P A;  3HHM A;  4WJO A;  4W9F A;  4M0W B;  2N9P C;  4MSQ B;  1XT9 B;  4EZL A;  4HPL B;  1WX9 A;  2FUH B;  2N7E A;  1G6J A;  1U4A A;  1WJ4 A;  4XC2 A;  3U8Z A;  1WY8 A;  4G50 A;  1I35 A;  3ZVV A;  2CHX A;  4I6P A;  2BKR B;  1IYF A;  2LRW A;  3WA0 A;  2NBW B;  3VXW A;  5DPW A;  4WWP A;  2MP2 B;  2IBI B;  4GB9 A;  3QCA A;  2WYQ A;  2KWU B;  4IG7 B;  3EC8 A;  4MH0 E;  2IZV B;  3K9P B;  1OEY J;  1WGR A;  4AUQ C;  1WXA A;  3ZDM C;  4BBN F;  1R4M I;  1WJU A;  3DVN V;  4G11 A;  4DBG A;  2LWP A;  3AU4 A;  4HDQ A;  2NPT A;  5JHA A;  4W9G A;  2ZPN A;  2FIF A;  2RGF A;  2BWF A;  1IP9 A;  2NS5 A;  3OJ3 A;  3IVF A;  1V49 A;  1WGH A;  4B6W A;  3NZU A;  5G55 A;  2MA9 B;  2BF8 B;  1F9J A;  2BYE A;  2C7N B;  1KM7 A;  4GIV A;  2MQJ A;  1WF9 A;  2QHO A;  1TTN A;  3TMP B;  2EMT A;  2MBH A;  2KOX A;  4MEL A;  1NI2 A;  4EUT A;  3WAP A;  1UBQ A;  2IYD B;  3PTF C;  1WI0 A;  2VRR B;  1RFA A;  3R66 C;  4FLH A;  4W9J A;  1YX6 B;  4WQO B;  3V6E B;  3VTW A;  3CMM B;  2L76 A;  4IW0 A;  4IWQ A;  4GSW A;  3GOE A;  1UH6 A;  2ZVN A;  4KIK B;  1EO6 A;  2O2V A;  2KHW B;  4FJV B;  3JVZ X;  4ZRJ A;  3N32 A;  3U7D A;  5DCN A;  4A3P A;  3UF8 A;  2KN5 A;  2FAZ A;  2AEH A;  2LXA A;  4GDL B;  1Z2M A;  2JWZ A;  4E3C A;  3KUZ A;  3PV1 A;  1EUV B;  3R7R A;  5HKH A;  1P1A A;  1WGG A;  4NNJ B;  5CHV C;  4EZK A;  1OEY A;  3V62 A;  3VQI A;  2MBQ A;  4AJY B;  2LJ5 A;  2O6V B;  4RM9 A;  3NOB A;  1GG3 A;  4DDI D;  5D94 A;  2KLC A;  3BIN A;  4HDO A;  3DVG X;  4M8M A;  2GBR A;  3L08 A;  3APD A;  4PS3 A;  3ZUN A;  3M95 A;  2KDF B;  2XBB C;  3A4S C;  4J6I A;  4PS7 A;  5BO4 B;  3WAL A;  2KDB A;  2NPT B;  3QQ8 B;  5D7G A;  1WRD B;  2HTH A;  2ZPY A;  1LFD A;  2KKC A;  3ML9 A;  2CS4 A;  1UD7 A;  2ZCB A;  3PHW B;  4KIK A;  1P0R A;  2K39 A;  2DX5 B;  2DYB A;  2LUE A;  3DPD A;  2J0M A;  2FCS A;  3QAQ A;  2ZCC A;  1MG8 A;  2HD5 B;  3ZNH B;  4K81 A;  5JHB A;  3TJP A;  1ZKH A;  1SIF A;  2IO2 B;  5CHF A;  4W9H A;  1T0Y A;  4NY0 A;  2JVC A;  4DK5 A;  3C0R B;  1RLF A;  4DHZ B;  4ZRK A;  3W1S C;  5AEK B;  4TKN A;  5D2M B;  3ONS A;  2KQS A;  3ENE A;  4I6N B;  3VFK A;  4N9F 4;  5JZE B;  4G3X B;  4KDI C;  1XD3 B;  4P7I A;  3O65 B;  4ZYN A;  4RMA A;  4AJW A;  2WDT B;  4FHK A;  2JRH A;  2KTR B;  2L00 B;  2DAJ A;  2JUO A;  2K8B A;  2FCM A;  2Z59 B;  3NS8 A;  4HJK A;  4TV3 A;  2EMS A;  3N30 A;  2JXX A;  3UIO B;  3V60 A;  3PRZ A;  2KAN A;  1FXT B;  1YQB A;  3PS6 A;  4DDG D;  4I6L B;  3RD2 A;  3DCG A;  1BT0 A;  4TQ1 A;  1RRB A;  2ZJD A;  3ZDT A;  3PLU A;  2LXC A;  4WJP A;  3JSV B;  4BVU C;  4KDL B;  3HK0 A;  4CHK A;  1L2N A;  3L54 A;  4GDK B;  3OAW A;  1KJT A;  3KW5 B;  3A9K A;  1Q1O A;  2O2V B;  1EF5 A;  2KFK A;  4CYE A;  2R2O A;  4FN2 A;  3A1Q B;  4MJS B;  3B0A A;  4IC7 B;  5AZG A;  2KNB A;  1YX5 B;  3W1S A;  4FBJ B;  5L95 C;  2N9E B;  5LXI B;  3H7P B;  3APF A;  3A9J B;  4K7W A;  2ZNV C;  3KUD B;  1UGM A;  3NZS A;  3QJZ A;  4EFO A;  3PHX B;  2Y5B B;  3SDL C;  4M8N A;  3R7Q A;  1IPG A;  4K7S A;  4W9I A;  2FCN A;  1D3Z A;  2K6Q A;  2AL6 A;  3PT2 B;  3KH0 A;  4NJ7 A;  4K1R B;  4NJ6 A;  1E90 A;  2LRU A;  3P2B A;  2HJ8 A;  3K9O B;  1YIW A;  3DVN U;  2V3S A;  2C5L C;  3QWZ B;  5DPS A;  3S2A A;  4MDK E;  5L83 A;  2PPH A;  3LDZ E;  4X57 B;  2MBO A;  2K8C A;  1WFY A;  2DZM A;  4NAW A;  5LXH A;  1ZW7 A;  1S3S G;  3V6C B;  2ZNV B;  2NBU A;  3M3J A;  2BYF A;  3PRM B;  4W9C A;  4OVV A;  2A4Z A;  2LVQ A;  2BPS A;  2RD0 A;  1LXD A;  2KC2 A;  2OJR A;  1H4R A;  1C3T A;  5KHQ A;  2W9N A;  5CTR C;  2CKH B;  1QZE A;  2LI5 A;  4HPM B;  4FHJ A;  1WE6 A;  5C1Z A;  3TCA A;  3OLM D;  2AYO B;  1YJ1 A;  4FA6 A;  4GDL A;  4ZRI A;  2L0F A;  4TQ0 A;  3AU5 A;  3DBH I;  2MBE A;  3QA8 A;  2M8S A;  4F7Z A;  1NBF C;  4FUL A;  4PYU A;  1SGH A;  1XQQ A;  1WXV A;  1OTR B;  2JF5 A;  3EFU A;  2UWQ A;  2FCQ A;  4HCN B;  3W1Y A;  1OGW A;  3VHT C;  3IG3 A;  4IM2 A;  2KFJ A;  2M1M A;  4OVU A;  4RM8 A;  3A9K B;  2DYO A;  2DZI A;  2YVC A;  2V4L A;  3WAN A;  3UQB A;  2L0T A;  2I1K A;  4MEM A;  1WXS A;  2KVR A;  4CO7 A;  2PE6 B;  1I42 A;  3AUL A;  2WX1 A;  2N4F A;  4WJQ A;  3KYD D;  4BBN C;  3A9J A;  3TIX A;  3R3M A;  2O6V D;  3DVG Y;  3QC8 B;  3H9D A;  4HWI B;  5FR6 A;  2D3G A;  2MX2 A;  4EEW A;  4GU2 A;  1J0G A;  3QIJ A;  3VAW A;  1WYW B;  3QX1 A;  3QAR A;  3X0W A;  2NCN A;  2ASQ A;  1WH3 A;  2J0K A;  3MTN B;  3X23 A;  3ZKJ C;  3IBE A;  4BKS A;  2KQ7 A;  2JT4 B;  2AWT A;  3KYC D;  4XX5 A;  3WAO A;  4ANX A;  4E71 A;  4ANW A;  1UBI A;  2JZZ A;  3ZRF A;  2WX0 A;  1WM3 A;  1A5R A;  1V80 A;  2PEA A;  2V1Y A;  2KXJ A;  2OOB B;  3UGB B;  2ZZP B;  2DAF A;  2LVO A;  2C60 A;  3SHQ A;  3DBR I;  1L7Y A;  4DWF A;  3ZNI D;  4BKS D;  3HM6 X;  3IFW B;  1ISN A;  3H7P A;  2FID A;  2HE7 A;  3PGE A;  3VTU A;  3CSF A;  2LGX A;  2KLG A;  3A1Q A;  1YD8 U;  1WMH B;  5TR5 A;  5J18 A;  3D32 A;  3I3T B;  2DYM A;  5GMV A;  2KWC A;  4FJZ A;  3RT3 B;  4F1S A;  1GC6 A;  2MSE D;  3L16 A;  4A20 A;  2RR9 A;  1E8W A;  3PSE B;  3RZW C;  1J19 A;  1WZ3 A;  2K8H A;  2N1V A;  3HIZ A;  3VH3 B;  4URK A;  4JL9 A;  2J0J A;  2KJH B;  1P98 A;  1VCB A;  2G4D B;  4LDT B;  3RUI B;  2DZJ A;  3CF6 E;  1Q0W B;  3VTV A;  4PS8 A;  3VUW A;  3T8M A;  1WR1 A;  3ECI A;  1S1Q B;  1LM8 B;  3AI5 A;  2REX A;  1TBE A;  3TBL D;  3VUX A;  2BKF A;  2K6D B;  2CHZ A;  3JSV A;  4B95 A;  2MWS B;  4WJN A;  3Q3J A;  2O6V A;  4LJO B;  3JW0 X;  4DHZ E;  1WJN A;  3RUL A;  2LVP A;  3APC A;  5DPR A;  2G3Q B;  1C1Y B;  4KZ0 A;  1NDD A;  3A33 B;  3ZO5 B;  2GOW A;  4BOZ B;  2DEN B;  1H8C A;  2GBM A;  2PJH A;  2XEW A;  3H6N A;  4IUM B;  3NY5 A;  1WM2 A;  1WJ6 A;  1WX7 A;  3B1L X;  1KLV A;  1K8R B;  3NHE B;  2NVU I;  3M62 B;  2ZEQ A;  2D11 A;  5J17 A;  2AL3 A;  4MGI E;  2IO1 B;  1WR6 E;  3PVL A;  4E74 A;  3EEC A;  2KJ6 A;  5IAA C;  3JYU A;  3DBS A;  2G45 B;  1EF1 A;  4KVG B;  4W9L A;  4EKU A;  4BKG A;  3SU8 X;  1WGY A;  2DZK A;  2M4N A;  2L05 A;  5IA7 A;  2XK5 B;  2DHZ A;  5G2N A;  4DHJ B;  3BY4 B;  4KZC A;  4IWO A;  4NQL B;  4YL8 A;  3L0W B;  1WXM A;  2M0X A;  2R2Q A;  3V61 A;  1R4N I;  2KK8 A;  3N3K B;  4II3 B;  3WIM A;  3WAM A;  1OQY A;  3UIP B;  2N9X A;  2KD0 A;  3ZIM A;  4K7U A;  2L8J A;  5JH5 C;  3UQA A;  4BFR A;  4LJP B;  1WZ0 A;  2C7H A;  3Q3F A;  2JY6 A;  4ANU A;  4NQK E;  2JPH A;  4MM3 A;  2NBV B;  3ZTD A;  1M94 A;  3TL5 A;  2KMA A;  4ASW C;  2JRI B;  1E8X A;  2A5U A;  3GZN I;  3QHT A;  3ZRC A;  4WAA A;  4AOF A;  4F8C B;  1VD2 A;  4B9K A;  3PRE A;  1WMH A;  4A3O A;  2YLM A;  4XZ4 A;  3B08 A;  4GGQ A;  4GXB A;  1ZGU B;  4HK2 A;  5D6J B;  3CST A;  3AXC A;  2IO3 B;  3IHP C;  5J2R A;  3DDC B;  1WX8 A;  1WGD A;  5AZF A;  1V86 A;  2PE9 A;  3MHS D;  2KFK B;  2KDE B;  1E8Z A;  2Z0D B;  3VH4 B;  3PPA A;  3L10 B;  2Z0E B;  2C9W B;  1JRU A;  4DXA B;  5DPT A;  2B3A A;  2KX3 A;  2K25 A;  4FAD A;  4W9E A;  1J8C A;  4JQW C;  1CMX B;  5EDS A;  2MP2 A;  2MRP A;  2MLB A;  4HLE A;  2K1F A;  2IY1 B;  4EZJ A;  2D10 A;  4JLC A;  2MW5 A;  2UYZ B;  3LJ3 A;  1V6E A;  2CHW A;  3ZLZ A;  3A4R A;  4TUU A;  2N7D A;  3PLV A;  4HXD A;  3DBL I;  2GMI C;  3DQV A;  1GJZ A;  4GMV A;  1WE7 A;  3DOW A;  3ZNZ B;  2KJR A;  2KMC A;  3EHV A;  4II2 B;  2LGY A;  1V9J A;  3KVF B;  3ML8 A;  3VDZ A;  2KO3 A;  4GOC A;  3VUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...