3KUZA

Crystal structure of the ubiquitin like domain of plxnc1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
b'QGTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-C1
publication title Crystal structure of the ubiquitin like domain of PLXNC1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kuzA00
2K39A 2Y5BB 4W9LA 4F1SA 1WJ4A 2MBBB 2N9XA 1Q1OA 1FXTB 1WZ0A 2N7EA 4GIVA 3TMPB 4DHZE 1TZ1A 4PYUA 5AEKB 1C3TA 3HM6X 2KJRA 3NY5A 3KUZA 3P2BA 3OJ4B 2KXJA 3H9DA 5L95C 4IWPA 3QHTA 2I1KA 3ZVVA 3VUYA 2BKRB 3UIPB 5KHQA 3PPAA 2R2QA 4HPLB 2ZVNA 1UD7A 2DYBA 4TV3A 4ZRIA 4J6IA 1WGDA 4BBNF 2DHZA 3PZDA 5CHFA 1JRUA 3SD5A 4BVUC 5D6JB 4BOZB 1E8YA 2D3GA 4PS3A 3O65B 3N32A 5E6OA 3R3MA 2MQJA 3KH0A 4M0WB 1WGRA 4AWJA 1L2NA 1WM2A 1V9JA 4BKGA 3M3JA 2DX5B 1K8RB 2JPHA 5D2MB 3T8MA 4ICVA 1E8ZA 4W9IA 4XZ4A 5CTRC 1P1AA 3UQBA 1VCBA 1VD2A 3DBRI 2MCNB 3ZDTA 2PJHA 1E8WA 4GSWA 4W9DA 3D32A 2GBMA 2MBHA 1WXAA 4AP4C 4DHJB 4K1RB 1QZEA 5EDSA 2KWUB 5JZEB 2LVPA 2NR2A 2QHOA 3HHMA 3L16A 3UINB 2M17A 2KHWB 3PRMB 2A5UA 2DAFA 1WGGA 3ZRCA 4GGQA 3R7RA 3AU5A 4JLCA 2KFKB 4K7UA 3TL5A 2L76A 3VTVA 4ANWA 4DBGA 2BYVE 3PLVA 2LD9A 4I6PA 3H6NA 2LRUA 3WAPA 4IC7B 4TUUA 4E3CA 4RMAA 2FIDA 1C1YB 4DK5A 2KFKA 1OTRB 3A1QA 2K8HA 3SHQA 2BYFA 2MLBA 5JHBA 2R2OA 4NJ6A 1WR6E 4GN1A 1H4RA 2KK8A 3KYDD 5C1ZA 2MA9B 3UIOB 4LCDE 3BINA 5E6PA 2Z0EB 4TQ1A 3DPDA 2VRRB 3KW5B 1TGZB 2KDIA 4JIOU 3RD2A 3AU4A 2KX3A 2KTRB 1BT0A 3L17A 2L8JA 4G11A 3U30A 2KC1A 1WM3A 2ZNVC 2FCNA 1KJTA 3AULA 3W1SC 4FN2A 2N4FA 4EZKA 3ZNZB 5BO4B 2BGFA 4G3XB 3DDCB 2KX0A 5G55A 3SDLC 5AZFA 2NVUI 1OQYA 3UF8A 1CMXB 2CS4A 4IUMB 2IBIB 4W9FA 2WWZA 1WRDB 5DPTA 2AYOB 3EHVA 3MTNB 4NQLB 2HE7A 3U8ZA 3DBSA 3QAQA 2BYEA 2KNBA 1E90A 2GBNA 3N3KB 4N9F4 4W9KA 1XD3B 4NAWA 1YX6B 3A9JB 2K8BA 2AL6A 1KLVA 2O6VB 4YL8A 1V81A 1Q0WB 1RRBA 4HJKA 2N9EB 4I6NB 2IO3B 2KLCA 4HDOA 5DCNA 1V86A 3OJ3A 4KZ0A 1WI0A 2KC2A 2LVOA 4HLEA 3IHPC 2C60A 4HPMB 4KIKA 2ZCBA 4TQ0A 3APFA 1LM8B 4NNJB 1V80A 3ALBA 2HJ8A 5IA7A 1T0YA 3QIJA 2J7QB 3QC8B 2M0XA 3RT3B 4F7ZA 4BOSC 1EO6A 3AI5A 3CSTA 3ZDMC 2BWFA 3KYCD 2GOWA 4CO7A 1L7YA 2MX2A 1M94A 4M8NA 2IY0B 3ML9A 4RM8A 1F9JA 3X23A 5LXIB 2RGFA 2XK5B 3L0WB 3RUIB 4FULA 1WE7A 4GMVA 4F8CB 1NI2A 4GB9A 4IM0A 1S3SG 3A4SC 4MM3A 3PRZA 3DQVA 4ZYNA 1I42A 2XK5A 4NJ7A 1V6EA 2LASA 2C5LC 2MP2B 3ML8A 3U7DA 2KOXA 3QARA 1V5OA 4W9JA 4ZDVA 3GZNI 2KJ6A 1WF9A 2K6DB 3RULA 4ANUA 4NPNA 2REXA 3H7SA 4MGIE 2JXXA 4LJOB 1RAXA 2CHXA 3JYUA 3DVGX 3CMMB 3HIZA 2ZZPB 3VH4B 4X57B 2GBKA 3IG3A 1LQBA 3Q3JA 2DZMA 3QWZB 2OOBB 4K7SA 2GMIC 2MSED 1GC7A 2AWTA 2C7MB 2JT4B 2MBQA 2W9NA 3NHEB 3RYTA 5JHAA 4FADA 3LJ3A 3PSEB 3PV1A 4BKTA 3ZW3A 2ZPNA 2IY1B 3IBEA 1G6JA 2JZ3B 2ZPYA 4MDKE 5DPWA 2O6VD 4DWFA 4FLHA 2DENB 3C0RB 4BFRA 4GDLB 1V49A 4GU2A 1ZGUB 3NS8A 4FA6A 3HK0A 3K9PB 2KQSA 3Q3FA 3A4RA 2A4ZA 4BKSD 4WJOA 4GDLA 4A3PA 4P7IA 1GJZA 2FIFA 1LFDA 4GDKB 1GC6A 3M62B 2GBRA 3BY4B 2ZJDA 2L05A 1WXSA 2EMSA 2PPHA 4KVGB 4JGHB 4OVVA 1UZXB 3VFKA 1E8XA 1V5TA 4HXDA 3DVNV 1WGYA 2BKFA 4MSMB 4LDTD 4E74A 1Q5WB 2IZVB 3PHWB 2FCMA 1YIWA 3DOWA 4HCNB 1WFYA 3ZIMA 3V62A 1V2YA 4CYEA 2LJ5A 3M63B 4K81A 2D10A 1A5RA 3ZO5B 2WYQA 3KUCB 4HCPB 2V4LA 2RD0A 3SU8X 2ZVOA 2XEWA 4KDIC 4NQKE 3ZLZA 2B3AA 2CHWA 1P3QU 3N30A 2KTRA 2L0FA 3ZNID 4EZLA 2V1YA 2LZ6A 1J8CA 4DDGD 2KWCA 1WJNA 2HD5B 4ASWC 2O2VB 4FHJA 2DZJA 1EF5A 2BF8B 2NS5A 4E71A 2LGXA 4W9EA 4EFOA 5JH5C 3PLUA 5LLIA 3WA0A 2LXAA 4NY0A 2KANA 2LWPA 4ZRKA 1WJUA 4ZRJA 3VUWA 2L00B 5E6NA 4G0NB 3KUDB 4HDQA 1Z2MA 4WWPA 4AJWA 3JVZX 4B9KA 4II3B 1WZ3A 3PRPB 1D3ZA 3V6CB 3A9JA 4KSKC 4KSLC 4DDID 5J17A 3IVFA 2O6VA 4AOFA 3QK0A 2CHZA 4ANVA 1SE9A 2C7HA 3B1LX 2M8SA 1R4NI 3ZKJC 2JY6A 4ICUA 5J2RA 1I35A 3RZFA 3VVWB 5D94A 4BKSA 4K7WA 1J0GA 3ZNGC 1WX9A 1SIFA 4EEWA 2LGDA 2K6QA 1YJ1A 2NPTB 1EUVB 1YD8U 2FNJB 1WJ6A 4IWOA 3VH3B 2Z59B 3GOEA 1WIAA 4LDTB 2KO3A 1WY8A 5CHWA 1UH6A 2M4NA 1E7UA 2BPSA 3UGBB 2KFJA 3PHXB 3M95A 2NPTA 4WQOB 2G45B 4A3OA 1YQBA 3TIXA 2J0JA 2L7RA 1UELA 2NCNA 3LDZE 3DCGA 3VUXA 3QQ8B 3X0WA 4EOYA 3DBHI 5GMVA 3WIMA 1EF1A 1LXDA 4EZJA 2MRPA 3W1YA 2K1FA 5L83A 2NBVB 3PTFC 2DYMA 1WYWB 3WAMA 2AL3A 3NOBA 3QX1A 3ONSA 2JRIB 1PQSA 2N1VA 2MP2A 3K9OB 2J0KA 3ZTCA 2IO1B 2V3SA 3L54A 3V6EB 2WX0A 1P0RA 3DBLI 4FJYA 3ZTDA 3A33B 2D2QA 2N1WA 2G4DB 1XQQA 4IG7B 1ZW7A 2JUOA 3VTUA 1XT9B 5CHVC 2D11A 4JQWC 3V60A 2FAZA 3PVLA 1ISNA 1IYFA 3L10B 5J18A 2RR9A 2JRHA 3R7QA 3TJPA 2NBUA 4GXBA 2YLMA 2LUEA 2KDFB 2OJRA 1WH3A 2G3QB 2KJHB 2RSUA 2KMAA 1RLFA 2KVRA 1YX5B 2N9PC 3PT2B 1AARA 2MBEA 2UWQA 3VQIA 4XC2A 3DVGY 2WX1A 4OVUA 2MBOA 2CKHB 5AZHA 1OEYJ 5FR6A 3UQAA 2KLGA 4XX5A 4GOCA 4WWNA 2K25A 2LGYA 3S2AA 2YVCA 3WANA 4FBJB 2KMCA 1WXVA 2CR5A 1IP9A 2G4SA 1J19A 2KD0A 1WE6A 1ZKHA 1WMHB 2JF5A 4I6LB 1GUAB 4M8MA 4G50A 2K8CA 3H7PB 2KTFA 4MGZE 1IPGA 3WAOA 2GBJA 4WWOA 1UBQA 5DPSA 3T9LA 2L3ZA 1NDDA 1TBEA 3EFUA 3MJWA 1P98A 1WMHA 2KWVB 3APCA 3QCAA 3PS6A 4WJPA 4AUQC 4LJPB 1MG8A 2C9WB 2I1JA 2RPQA 3ENEA 4GDKA 3H7PA 4KV2A 4URKA 1KM7A 2BWES 3R66C 4MELA 4RM9A 4B6WA 3MHSD 2EKEC 2KDBA 3CF6E 3KVFB 3PREA 2PE9A 2EMTA 5IAAC 3PGEA 3ZRFA 3VHTC 2C7NB 3JW0X 5G2NA 3TBLD 1P9DU 2FCQA 2IYDB 3B08A 2LRWA 4MH0E 3A1QB 1E5WA 2JWZA 4HWIB 2IO0B 4PYZA 4DHZB 2AEHA 2N7DA 2DZIA 1E7VA 3I3TB 3VDZA 3WALA 3VAWA 3VXWA 4HK2A 4FJVB 4DXAB 2D07B 2DAJA 2M1MA 4IWQA 4AJYB 3QJZA 5LXHA 4ANXA 1WGHA 2L0TA 2MW5A 2WDTB 4KDLB 2DZKA 4HVBA 3EC8A 4PS7A 3VTWA 2ASQA 2MWSB 2XBBC 2PEAA 3HM3A 5HKHA 2O2VA 3ECIA 3L08A 2LI5A 4MSQB 3TCAA 1NBFC 4MGKE 2JVCA 4W9GA 1KOTA 4A20A 1TTNA 2KZRA 1GNUA 3RCZA 1H8CA 1Y8RC 1S1QB 1Z5SB 4FJZA 2UYZB 4TKNA 4W9HA 1U4AA 4W9CA 4BBNC 1SGHA 3DVNU 5CX3A 2LXCA 1WR1A 4FHKA 2KDEB 2FCSA 4II2B 2CU1A 1WXMA 1UBIA 3OAWA 5D7GA 4NAWB 4EUTA 4B95A 1HE8A 3V61A 2KQ7A 5KHOA 3NZUA 2LVQA 2Z0DB 3A9KB 4JL9A 3NZSA 2HTHA 2KN5A 3CSFA 4KZCA 4WAAA 3ZUNA 2ZEQA 2IO2B 2ZNVB 3APDA 3ZNHB 4KIKB 5AZGA 4CHKA 3A9KA 4IM2A 4MJSB 4WJQA 3OLMD 3W1SA 4MGYE 3AXCA 2NBWB 4MEMA 3JSVB 4EKUA 1RFAA 4WJNA 3L13A 2DYOA 1WX8A 2J0MA 2PE6B 3B0AA 4MJSA 1R4MI 1UGMA 2FUHB 4DHJD 1OEYA 5DPRA 3JSVA 3QA8A 1WX7A 4IM3A 4IW0A 3RZWC 1X1MA 3IFWB 1GG3A 2ZCCA 2KKCA 5TR5A 1OGWA 2JZZA 4PS8A 5C23A 3EECA 3H1UA
chains in the Genus database with same CATH superfamily
4Q2JA 2Y5BB 4W9LA 4F1SA 3AE1B 1FXTB 3TMPB 2N7EA 5IKCM 1N5XA 1TZ1A 1F77A 1KH0A 3HM6X 2ICIA 2WU2B 3P2BA 2KXJA 2CJNA 1RFKA 2BKRB 3AEBB 4HPLB 2ZVNA 1GPXA 1UD7A 4J6IA 1MVKA 1QOAA 1JRUA 3SD5A 4BVUC 5IO9A 3N32A 2MQJA 4AWJA 1C79A 1FM0D 5CTRC 1VCBA 3DBRI 2PJHA 1E8WA 4W9DA 2KWUB 1SEBD 3PRMB 3AEDB 2A5UA 1WGGA 4WH4A 4ANWA 3AEAB 3VTVA 4I6PA 1UUPA 2LRUA 3WAPA 4E3CA 1QOGA 4HJGE 1C1YB 2KFKA 2BYFA 2EELA 2R2OA 2YEPB 2MA9B 2IDYA 3UIOB 4PK1A 4LCDE 3BINA 1XLOA 2VZKB 1CZPA 2Z0EB 5E6PA 1MHHE 1TGZB 1FNVA 3W5UB 1WM3A 2ZNVC 3W9CB 2N4FA 1K51A 5BO4B 4G3XB 4NJCA 3DDCB 5G55A 1N5WA 1OQYA 3UF8A 4HRSA 4W9FA 1OQQA 4C7ZA 2K22A 4N9F4 2H88B 1UWXA 2K8BA 2AL6A 2O6VB 2Y5PA 2KLCA 1V86A 1WI0A 2WXPA 3RNBC 4HPMB 4YTMB 4KIKA 3TEWA 1IBXB 1KFYB 3ALBA 1T0YA 4RF1A 3RT3B 4F7ZA 2K0PA 3AE2B 2UU7A 2IY0B 5LXIB 2D3CA 1NI2A 3E56A 4GB9A 1I42A 3AECB 1V6EA 2MP2B 3U7DA 1WXQA 3QARA 3TEXA 4W9JA 4ZDVA 3N1ZC 3GZNI 1WF9A 3H7SA 2JXXA 4LJOB 1RAXA 2CHXA 2M56B 3HIZA 5C3JB 2WXJA 2MSED 2JT4B 3RYTA 2MBQA 4OZAA 2IJ0A 1MJDA 3ZW3A 2IY1B 3IBEA 1JWUD 1TY0A 3T3OA 1KTKA 4L23A 2V3NA 4FA6A 2J4XA 2KQSA 3Q3FA 3A4RA 2A4ZA 4BKSD 2INDC 3VRBB 4P7IA 1YN4A 2FIFA 2OHFA 2GBRA 5EE1A 2EMSA 1TKEA 1E8XA 1PGAA 4E74A 2IZVB 1YIWA 4WIPA 3ZIMA 3V62A 1YJIA 3M63B 1K50A 1NYRA 1RM6C 2D10A 4XYCA 3KUCB 4HCPB 2RD0A 1D4BA 2ZVOA 4ARIA 4KDIC 1TS3A 2CHWA 2LZ6A 1J8CA 2KWCA 3DBLB 1SE3A 2HD5B 4L2YA 3J9CA 2BF8B 1N63A 2NS5A 1I4PA 1XLPA 4E71A 5BMIA 2G9HD 4ZRKA 3R2IA 4AJWA 3V6CB 4DDID 4KSKC 2PVOD 5J17A 2O6VA 2G1EA 2V3PA 1I35A 3O13A 2FBWB 3RZFA 5D94A 3ZNGC 4PT5A 1YD8U 4S17A 1WJ6A 3NVWA 1D5MC 1TYGB 2RDGA 1WY8A 3AMZA 1E7UA 3PHXB 4WQOB 2G45B 1TS5A 2NCNA 1UELA 1N61A 2J42A 3X0WA 3WIMA 1EF1A 4EZJA 2MRPA 3ZJUA 1F2RI 3ABVB 1N60A 3GP7A 2DYMA 3WAMA 3NOBA 2MP2A 1FXIA 2BB5A 2V3SA 2Z8LA 3ZTDA 3AE5B 2N1WA 4IG7B 3TUOA 3VTUA 1TS2A 1MHXA 3V60A 2AQ3B 2I2YA 3TJPA 2JRHA 3HVDA 1ET9A 4WURA 2INNE 2G3QB 1XCQL 1RLFA 2UWQA 1L4DB 2K25A 3WANA 1IP9A 1WXVA 1FCLA 1VJKA 1BMLC 4WAFA 1BUIC 1ZKHA 2KTFA 1GOZA 2L3ZA 1XEEA 4MH8A 3MJWA 1P98A 1WMHA 1MG8A 2RPQA 4KV2A 2K3UA 3H7PA 4MACA 4MELA 2NMQA 3T3NA 3AE6B 2EKEC 2EMTA 1QF6A 1QOBA 1EU4A 3B08A 3A1QB 5EE9A 4PYZA 3MC9A 4RGOS 2LJIA 4FJVB 4KDLB 2MWSB 2XBBC 3P4PB 3ECIA 1A70A 3Q3OC 4NAMA 2JX5A 3RCZA 1Y8RC 4TKNA 2UYZB 1U4AA 4KGSA 1CK1A 4N59A 4ZHOA 2LXCA 3LB8C 4II2B 2WDRB 1UBIA 5D7GA 3SR6A 1HE8A 2Z0DB 4JL9A 4KZCA 2ZEQA 3TEZA 4LK0M 2N7JA 4M02A 3DHIC 4WJQA 3DBRB 3W1SA 2JZPA 2NBWB 3NG0A 3TEYA 2KWDA 4NZLB 2W54A 1M4VA 4MJSA 1R4MI 3NJTA 2FUHB 1WX7A 2ONQA 1YN3A 4IW0A 2CU3A 5BYQA 5TR5A 3NVVA 4YT0B 1Q1OA 2PKOA 1K52A 3BYTB 1C3TA 4RCOA 2I1KA 3ZJVA 4LNNA 1V1PA 2DHZA 5BMGA 3PZDA 4XGAB 4P16A 2WXLA 1YQ3B 1E8YA 1E6EB 4HEA1 2X38A 1L2NA 4JE3B 1V9JA 2WXKA 3T8MA 4ICVA 1E8ZA 4W9IA 4XZ4A 1P1AA 1VD2A 3ETRA 3D32A 2GBMA 1WXAA 5HG2A 4AP4C 1QZEA 2SEBD 4LNKA 2NR2A 1TS4A 2WXHA 4JLCA 2KFKB 2L76A 1UGJA 1VR9A 1FFUA 2FIDA 2KVZA 3A1QA 2MLBA 2GI9A 1E7PB 2KK8A 5C1ZA 2LUMA 1JWAD 2JXTA 1E9MA 4MT5A 1JWBD 2KAJA 2KN4A 4J3OD 3AU4A 2KX3A 3GS2A 3RD2A 3W5VB 2L8JA 3U30A 2KC1A 3AULA 4A9AA 1RWSA 3ZNZB 1YN5A 2BGFA 1EWYC 1QQRA 3RFZB 2NVUI 1HA5A 2CS4A 4IUMB 2IBIB 1E10A 3BK2A 4BAXA 2AYOB 2XN9C 3EHVA 3MTNB 4DXGA 3U8ZA 2HE7A 2X8XX 3P63A 2KNBA 1E90A 2GBNA 3N3KB 1XD3B 3Q2AC 1KLVA 2VH1A 3KLSX 4YL8A 1RRBA 2N9EB 3OJ3A 4HLEA 1JMLA 1IUEA 3BVGA 2N9LA 1SBBB 5G5GA 5IA7A 3QC8B 2M0XA 2GLSA 1YNTE 4ZHPA 3ZDMC 3KYCD 1L0XB 1L7YA 2QMTA 4CO7A 3ML9A 4YSZB 1I4HA 1WGKA 4L1BA 1XCTL 3Q8EA 4A90A 3PRZA 1XLNA 1VRAB 3ML8A 2RDHA 3FC4A 3GE8C 4YSXB 2DNFA 2OEDA 1QKZA 1JALA 4MGIE 3BK1A 1FFVA 2CJOA 2WXQA 3Q3JA 1C4CA 3QWZB 2OOBB 2GMIC 1GC7A 2C7MB 1B9RA 3PV1A 3HUIA 3AV8A 1G6JA 1FMAD 2HJ1A 2H89B 4FLHA 2DENB 3C0RB 1R7SA 4BFRA 4GU2A 1ZGUB 4HKQA 3NS8A 3RPFC 3K9PB 4A3PA 1GJZA 4GDKB 3FILA 4YTNB 2BBCA 2L05A 2PTLA 2JU6X 4OVVA 1V5TA 3U7ZA 4HXDA 1E0ZA 1KLGD 3BIID 1WFYA 2L32A 4CYEA 2BS3B 4C80A 1T3QA 4ITKA 1L6VA 1WYGA 1A5RA 3ZO5B 1FEHA 1CJEA 4JWUC 1PGBA 1NENB 4NQKE 2JQRB 3MHZA 4XDCA 4O1NA 2PIAA 4ASWC 2O2VB 3E9SA 4FHJA 2DZJA 1D5XC 1EF5A 4XE0A 2MJDA 4EFOA 1ZXIA 1L4ZB 4GLSC 3MFGA 5LLIA 3RNCC 4NY0A 3WA0A 2KANA 1WJUA 1ENFA 1VDVA 4ZRJA 3VUWA 5MPOA 4G0NB 4HDQA 1Z2MA 3N9YC 4WWPA 4II3B 1D3ZA 2OJWA 4KSLC 2AX5A 5HHDG 3U2SC 3IVFA 2J52A 4ANVA 1DOYA 4IDIA 2JY6A 4ICUA 3C19A 1RYJA 1J0GA 4EEWA 2LGDA 3VH3B 1EUVB 2FNJB 2Z59B 3GOEA 5CHWA 3ZJTA 2TSSA 1UH6A 2M4NA 2BPSA 2KFJA 1DOIA 4YTPB 2NPTA 5D3IB 3W2DA 2J0JA 4R3DA 1XXGA 3VUXA 4AQ7A 4EOYA 3DBHI 5GMVA 3P1MA 3R8BA 2D3BA 2K1FA 2NBVB 2AL3A 1SE2A 3ONSA 2JRIB 2WXMA 2N1VA 4JX1C 1SXTA 2J0KA 4OVZA 2IO1B 3A33B 4RF0A 4D2KA 2G4DB 1XQQA 4XDDA 1XT9B 5CHVC 1XO3A 4JQWC 3PVLA 3B2GA 1MG4A 2NBUA 1NEKB 2YLMA 3BZDB 2NTSA 2OJRA 3DHGC 2LHEA 3PT2B 2KVRA 2MJEA 1OFFA 3DVGY 2WX1A 2MBOA 1P7FA 2CKHB 5AZHA 5FR6A 2KLGA 2LEKA 4GOCA 4FBJB 1SIJA 2G4SA 2M0AA 1WMHB 2JF5A 3H7PB 4MGZE 3WAOA 3T9LA 1DGJA 3L4PA 3QCAA 4LJPB 4URKA 4GDKA 2XNAC 3AN1A 1KM7A 3R66C 4RM9A 4QAYA 3CF6E 1TIFA 1JWSD 2Y3AA 4WQMA 3PGEA 2C7NB 1QT9A 1P9DU 3SEBA 2Q5WD 2AEHA 2BVCA 2DZIA 3I3TB 4TMAB 4JPSA 2D07B 2M1MA 2D3AA 2WXFA 1WGHA 2L0TA 2MW5A 5TSSA 2INPE 4HVBA 4PS7A 2ASQA 2QIEB 5HKHA 2O2VA 3L08A 4MSQB 4HKZE 1NBFC 2QJLA 1KOTA 2KZRA 3Q8BA 1Z5SB 1S1QB 4FJZA 4W9CA 4KX6B 2WS3B 2W55A 2JSVX 1HZ6A 3NVZA 2KDEB 4NAWB 3NZUA 4BZAA 3I9V1 3DWGC 3ZUNA 4UDUC 5AZGA 3A9KA 4RGTA 3B9JA 4B0EA 3Q8CA 4MJSB 4MEMA 4EKUA 1B1ZA 1RFAA 4WJNA 2K5PA 4P6VF 2DYOA 2PE6B 3B0AA 1OEYA 5DPRA 1ZP0B 3RZWC 3H8HA 2ZCCA 4MM3B 3VR8B 2ON8A 1C76A 2K39A 2MBBB 1WZ0A 4DHZE 2W3SA 3PO0A 5AEKB 4EE2A 3NY5A 3KUZA 3OJ4B 1T0QC 4IWPA 2BT6A 1V1PB 3PZ8A 2R2QA 4TV3A 2MHJA 2LHDA 4ZRIA 2RPVA 3EGRA 1ZDVA 5CHFA 5D6JB 4BOZB 4PS3A 3R3MA 2DBYA 3KH0A 1WGRA 1PDXA 1WM2A 2QDFA 4BKGA 2JPHA 1FPYA 3UQBA 3MJ5A 2MCNB 4M0WA 3ZDTA 1FXAA 4K1RB 1KF6B 5JZEB 2LVPA 4RNAA 1ROEA 2M17A 2DAFA 3ZRCA 4GGQA 4A55A 4K7UA 3TL5A 2RDBC 2BYVE 3PLVA 4YWGG 1DOXA 1ZE3D 4IC7B 4TUUA 3MP9A 4RMAA 1L0YB 4DK5A 2K8HA 3SHQA 2GRIA 4NJ6A 4GN1A 3KYDD 1Y56A 5HI1A 5AUIA 1FO4A 4C4VA 1Q10A 4JIOU 3KW5B 2KDIA 2KTRB 4G11A 2FCNA 3W1SC 3AE7B 4FN2A 4EZKA 1FIQA 2KX0A 1CMXB 3P4RB 5BMHA 2WDQB 1GB1A 3QAQA 2BYEA 4W9KA 4NAWA 1C77A 4AS1A 5EE0A 1V81A 1Q0WB 2E6XA 4HJKA 5DCNA 3CWIA 3AB5A 2KC2A 3SFDB 1ZDXA 3DHHC 2AQ2B 1ESFA 1I4XA 1T6BX 1KRHA 1V80A 2HJ8A 2J7QB 2BB6A 2WXGA 4M01A 3AI5A 3IT4B 2BWFA 3IAM1 2GOWA 2JWUA 1WSPA 4M8NA 4RGNA 1MFWA 4RGMA 3X23A 2RGFA 3RUIB 2BS2B 4OZBA 1S3SG 4MM3A 1L5PA 1PYWD 4ZYNA 2EKIA 2XK5A 1J7AA 2K9XA 2C5LC 1SJED 1F52A 1V5OA 3ZYYX 2VZKD 2K6DB 4ANUA 5FR3A 1ZUD2 3OG5A 2AQ1B 2WDVB 3VH4B 4X57B 2KMMA 3IG3A 1HQRD 2WXRA 2AWTA 3BWUD 4FADA 3PSEB 3IAS1 1P7EA 2ZPNA 1GAQB 2JZ3B 4MDKE 5DPWA 2O6VD 1V49A 3HVZA 3FILB 3AE3B 2IGDA 4WJOA 4GDLA 4KKIA 5BYSA 3VR9B 3M62B 2ZJDA 1WXSA 4KVGB 2J53A 4JGHB 1VZ7A 1WGYA 1Q5WB 1YJJA 2FCMA 2QC8A 2PMVA 3V05A 1HZ5A 2LJ5A 1D5ZC 4S0RA 1I7HA 2WXOA 2V4LA 1K53A 3GZNB 3SU8X 1XF5L 2XEWA 2B3AA 3Q3NC 4M00A 2KTRA 3ZNID 2V1YA 2KDMA 1WJNA 3AEEB 1FNWA 2LGXA 4W9EA 5JH5C 3PLUA 3ZQ4A 3KWLA 1T5XD 4US8A 5EE3A 2L00B 3KUDB 1L6UA 3JVZX 4B9KA 3GB1A 1HEZE 5HFYA 3QK0A 2CHZA 2C7HA 3B1LX 2M8SA 1R4NI 4A8XC 2D5GA 5J2RA 3VVWB 1EWCA 4BKSA 1JWMD 2LMCA 4IWOA 2K6QA 2NPTB 1I4RA 4LDTB 2KO3A 3UGBB 3M95A 1TT5B 4A3OA 3WCQA 3QQ8B 1V1OA 5BYRA 3BVZA 3Q3MC 4IKGA 4JWSC 3PTFC 4K3CA 3QX1A 1FD6A 1PQSA 1XLQA 3K9OB 5E6JA 1J7CA 3ZGZA 1TKGA 3V6EB 1P0RA 2D2QA 3HRDD 3MC0B 1AYFA 2ACZB 5J18A 2RR9A 3N1XC 4GXBA 2KDFB 1WH3A 2KJHB 2KMAA 2N9PC 1TKYA 1YX5B 1AARA 2MBEA 3VQIA 4XC2A 4ZRQA 4OVUA 1OEYJ 3UQAA 1I4QA 3S2AA 2YVCA 4RH6A 1WE6A 4I6LB 3CIRB 3C8YA 4C56C 4G50A 2K8CA 2MH7A 3FKYA 3I57A 1IPGA 2GBJA 5DPSA 2WXIA 1STEA 1BXTA 1JCKB 3EFUA 4AUQC 3APCA 4WJPA 2C9WB 2I1JA 3ENEA 4RFBA 5H8YE 1VLBA 3MHSD 4LNFA 2R61A 3PREA 2BTEA 1J7BA 1JROA 4XWWA 3B2FA 2ZW0A 3JW0X 5G2NA 1T0SC 2IYDB 3AE4B 3AE9B 2MJ3A 5I4DA 4MH0E 1E5WA 4HWIB 3EFCA 2N7DA 3VAWA 3VXWA 2DAJA 4IWQA 3QJZA 1PUTA 4ANXA 1JW9D 1SB3C 2WDTB 3RN9C 3EC8A 1TZOA 1NI3A 3VTWA 2N9KA 3AE8B 2PW9A 3TCAA 4W9GA 2JVCA 4A20A 1GNUA 1JRPA 4C00A 2WNMA 3DVNU 1AWDA 1L0VB 4OW0A 1WXMA 1V97A 2MEKA 5KHOA 1IGDA 4LNIA 2LVQA 3A9KB 4WAAA 3AM9A 3ZXVA 3AEGB 3APDA 3ZNHB 4XWTA 1VZ8A 3RMKC 3TSSA 5GXGB 4A6QA 2L83A 4H2AA 2LFIA 3L13A 3SFEB 3V3XA 3JSVA 3DWMA 4IM3A 3NUHB 3IFWB 1GG3A 1KLUD 2W82A 4KGTA 5AUKA 3OWEB 4PS8A 1SJHD 3H1UA 1WJ4A 2N9XA 4DXFA 4GIVA 4PYUA 1TJEA 1C4AA 2SAKA 2KJRA 5H92C 5C2TB 4B0MA 3H9DA 5L95C 4OZCA 2JYEA 3QHTA 3ZVVA 3VUYA 3UIPB 5KHQA 2GB1A 3PPAA 3NRZA 3VRAB 3NS1A 2DYBA 5LNK1 1WGDA 4BBNF 1C9FA 1CQVA 3UI3A 4USAA 1TY2A 2D3GA 3O65B 5D3DA 1F2RC 5E6OA 4M0WB 2QEJC 2RMMA 3M3JA 2DX5B 1K8RB 5D2MB 4CHKA 1MPEA 4GSWA 2MBHA 1GB4A 4DHJB 5EDSA 3FAHA 2QHOA 3HHMA 3GE3C 3L16A 3IT6B 3UINB 2KHWB 3R7RA 3AU5A 1R4MB 3AH7A 4YSYB 4DBGA 4LTUA 2LD9A 3H6NA 1UF0A 5FKAC 1OTRB 2INCC 4C4VB 5JHBA 1WR6E 1MI0A 1H4RA 3NVYA 4P1CC 3NZ3A 2Y5CA 4TQ1A 3DPDA 1IGCA 2VRRB 2L52A 1V8CA 1BT0A 3L17A 2WU5B 1ZXHA 1F0ZA 2IGGA 1FCCC 1KJTA 4N58A 3P4SB 3SDLC 5AZFA 4TSSA 2QILA 2WWZA 1WRDB 5DPTA 3RNEC 4HPPA 4NQLB 3DBSA 5IN7A 1C4PA 1LO5D 1YX6B 3A9JB 1ACCA 4I6NB 2IO3B 1N62A 4HDOA 1SSNA 4KZ0A 2LVOA 1DYQA 3IHPC 2JYTA 2C60A 2ZCBA 3ZXRA 4TQ0A 3APFA 1LM8B 2WP9B 4NNJB 3QIJA 1OQRA 4BOSC 1EO6A 3CSTA 1IBXA 2IPKD 2MX2A 1M94A 3Q6BA 4RM8A 1F9JA 1I4GA 2XK5B 3L0WB 4FULA 1WE7A 4GMVA 4F8CB 4IM0A 3A4SC 4KKJA 3DQVA 2IGHA 4NJ7A 2LASA 2KOXA 3R2TA 2KJ6A 2BS4B 3RULA 3EUB2 4NPNA 4US9A 2REXA 3JYUA 1HTQA 3BVMA 3DVGX 3CMMB 2DWQA 2ZZPB 3PZ7A 1WWTA 2GBKA 1LQBA 2DLBA 2DZMA 4K7SA 4KGRA 1T0RC 2W9NA 3NHEB 5JHAA 3LJ3A 4BKTA 1EM7A 1YQ4B 2ZPYA 4DWFA 4GDLB 1FRRA 1ZPSA 2KT7A 2M19A 1R4NB 3HK0A 1AW7A 2LGIA 3RNFC 1NVID 1LFDA 1ZOYB 1GC6A 2B76B 3BY4B 1N6ZA 1VZ6A 2HDEA 2PPHA 3VFKA 1UZXB 3DVNV 2BKFA 4MSMB 4P1BC 4LDTD 3KQ4A 3PHWB 4HCNB 3DOWA 3N1YC 2KACA 2WGSA 5IOIA 1V2YA 2QSDA 1PGXA 4K81A 2WYQA 2PVGC 2KQ4X 2V9HA 1D6EC 3Q8FA 3ZLZA 3N30A 1P3QU 2L0FA 4LNOA 4EZLA 4ARCA 4DDGD 1FNUA 2KYWA 4N6EB 2N0SB 1JQ4A 3AEFB 2NTTA 2LXAA 2LWPA 3LYYA 5E6NA 1WZ3A 3PRPB 3A9JA 2PLPA 3Q14C 3BYYB 2L1AA 4AOFA 1ET6A 2HTME 4ZYSA 1SE9A 3ZKJC 2FUG1 2WHIA 1NYQA 3IXSA 2WLBA 4K7WA 1WX9A 1SIFA 1QOFA 1C78A 1YJ1A 2YEPF 5G5HA 1WIAA 3RNAC 4WWMA 1UWMA 1YQBA 3TIXA 5IP4D 2L7RA 3LDZE 3DCGA 1LXDA 4YXDB 3W1YA 5L83A 1F1HA 1WYWB 2VH2A 5T8IA 3ZTCA 3L54A 2WX0A 3DBLI 4FJYA 5FK9C 1ZW7A 2JUOA 2D11A 1WRIA 2FAZA 1ISNA 1YMHE 3L10B 1IYFA 3R7QA 2LUEA 3I5JC 2RSUA 1LGRA 4XX5A 1YOVB 4WWNA 2LGYA 2KMCA 2CR5A 1J19A 2KD0A 2BQQA 1GUAB 4M8MA 4DQOC 4IOIE 4WWOA 1UBQA 1NDDA 1TBEA 2KWVB 3PS6A 1EU3A 2BWES 4B6WA 2KDBA 3KVFB 2PE9A 5IAAC 3N20C 3DBHB 3VHTC 1QILA 3ZRFA 3TBLD 2FCQA 2LRWA 2JWZA 1FRDA 2IO0B 4DHZB 3Q69A 3U52E 1E7VA 1QLBB 3VDZA 2WXNA 3WALA 4HK2A 4DXAB 5LXHA 3P4QB 4AJYB 4ACFA 3I63C 2FE8A 2DZKA 4REZA 5JXVA 2WQYB 4K3BA 3HM3A 2PEAA 2LI5A 4C7YA 4MGKE 1TTNA 4ZRPA 2LGSA 1H8CA 4W9HA 1AN8A 3URYA 4BBNC 1SGHA 5CX3A 4FHKA 1WR1A 2ZW1A 3MC8A 4HROA 2FCSA 2CU1A 3OAWA 2V0GA 1SE4A 3EA6A 4EUTA 4B95A 1SF0A 3V61A 2KQ7A 2BYTA 3RNGC 3NZSA 2QCZA 2HTHA 2KN5A 3CSFA 2E3TA 2W3RA 2IO2B 2ZNVB 4KIKB 4FXCA 4IM2A 4ZOHC 1PFDA 3U4EG 3P42A 3RI7C 1HXYD 3OLMD 4MGYE 3AXCA 1HTOA 3JSVB 4CQNA 3Q8AA 4OHJA 2I38A 1WX8A 2J0MA 3KWVA 1UGMA 4DHJD 3LXFA 3QA8A 1X1MA 2V4IB 2KKCA 1UNSA 1OGWA 2JZZA 5C23A 2BW2A 3EECA 4LLGM
chains in the Genus database with same CATH topology
2K39A 2Y5BB 4W9LA 4F1SA 1WJ4A 2MBBB 2N9XA 1Q1OA 1FXTB 1WZ0A 2N7EA 4GIVA 3TMPB 4DHZE 1TZ1A 4PYUA 5AEKB 1C3TA 3HM6X 2KJRA 3NY5A 3KUZA 3P2BA 3OJ4B 2KXJA 3H9DA 5L95C 4IWPA 3QHTA 2I1KA 3ZVVA 3VUYA 2BKRB 3UIPB 5KHQA 3PPAA 2R2QA 4HPLB 2ZVNA 1UD7A 2DYBA 4TV3A 4ZRIA 4J6IA 1WGDA 4BBNF 2DHZA 3PZDA 5CHFA 1JRUA 3SD5A 4BVUC 5D6JB 4BOZB 1E8YA 2D3GA 4PS3A 3O65B 3N32A 5E6OA 3R3MA 2MQJA 3KH0A 4M0WB 1WGRA 4AWJA 1L2NA 1WM2A 1V9JA 4BKGA 3M3JA 2DX5B 1K8RB 2JPHA 5D2MB 3T8MA 4ICVA 1E8ZA 4W9IA 4XZ4A 5CTRC 1P1AA 3UQBA 1VCBA 1VD2A 3DBRI 2MCNB 3ZDTA 2PJHA 1E8WA 4GSWA 4W9DA 3D32A 2GBMA 2MBHA 1WXAA 4AP4C 4DHJB 4K1RB 1QZEA 5EDSA 2KWUB 5JZEB 2LVPA 2NR2A 2QHOA 3HHMA 3L16A 3UINB 2M17A 2KHWB 3PRMB 2A5UA 2DAFA 1WGGA 3ZRCA 4GGQA 3R7RA 3AU5A 4JLCA 2KFKB 4K7UA 3TL5A 2L76A 3VTVA 4ANWA 4DBGA 2BYVE 3PLVA 2LD9A 4I6PA 3H6NA 2LRUA 3WAPA 4IC7B 4TUUA 4E3CA 4RMAA 2FIDA 1C1YB 4DK5A 2KFKA 1OTRB 3A1QA 2K8HA 3SHQA 2BYFA 2MLBA 5JHBA 2R2OA 4NJ6A 1WR6E 4GN1A 1H4RA 2KK8A 3KYDD 5C1ZA 2MA9B 3UIOB 4LCDE 3BINA 5E6PA 2Z0EB 4TQ1A 3DPDA 2VRRB 3KW5B 1TGZB 2KDIA 4JIOU 3RD2A 3AU4A 2KX3A 2KTRB 1BT0A 3L17A 2L8JA 4G11A 3U30A 2KC1A 1WM3A 2ZNVC 2FCNA 1KJTA 3AULA 3W1SC 4FN2A 2N4FA 4EZKA 3ZNZB 5BO4B 2BGFA 4G3XB 3DDCB 2KX0A 5G55A 3SDLC 5AZFA 2NVUI 1OQYA 3UF8A 1CMXB 2CS4A 4IUMB 2IBIB 4W9FA 2WWZA 1WRDB 5DPTA 2AYOB 3EHVA 3MTNB 4NQLB 2HE7A 3U8ZA 3DBSA 3QAQA 2BYEA 2KNBA 1E90A 2GBNA 3N3KB 4N9F4 4W9KA 1XD3B 4NAWA 1YX6B 3A9JB 2K8BA 2AL6A 1KLVA 2O6VB 4YL8A 1V81A 1Q0WB 1RRBA 4HJKA 2N9EB 4I6NB 2IO3B 2KLCA 4HDOA 5DCNA 1V86A 3OJ3A 4KZ0A 1WI0A 2KC2A 2LVOA 4HLEA 3IHPC 2C60A 4HPMB 4KIKA 2ZCBA 4TQ0A 3APFA 1LM8B 4NNJB 1V80A 3ALBA 2HJ8A 5IA7A 1T0YA 3QIJA 2J7QB 3QC8B 2M0XA 3RT3B 4F7ZA 4BOSC 1EO6A 3AI5A 3CSTA 3ZDMC 2BWFA 3KYCD 2GOWA 4CO7A 1L7YA 2MX2A 1M94A 4M8NA 2IY0B 3ML9A 4RM8A 1F9JA 3X23A 5LXIB 2RGFA 2XK5B 3L0WB 3RUIB 4FULA 1WE7A 4GMVA 4F8CB 1NI2A 4GB9A 4IM0A 1S3SG 3A4SC 4MM3A 3PRZA 3DQVA 4ZYNA 1I42A 2XK5A 4NJ7A 1V6EA 2LASA 2C5LC 2MP2B 3ML8A 3U7DA 2KOXA 3QARA 1V5OA 4W9JA 4ZDVA 3GZNI 2KJ6A 1WF9A 2K6DB 3RULA 4ANUA 4NPNA 2REXA 3H7SA 4MGIE 2JXXA 4LJOB 1RAXA 2CHXA 3JYUA 3DVGX 3CMMB 3HIZA 2ZZPB 3VH4B 4X57B 2GBKA 3IG3A 1LQBA 3Q3JA 2DZMA 3QWZB 2OOBB 4K7SA 2GMIC 2MSED 1GC7A 2AWTA 2C7MB 2JT4B 2MBQA 2W9NA 3NHEB 3RYTA 5JHAA 4FADA 3LJ3A 3PSEB 3PV1A 4BKTA 3ZW3A 2ZPNA 2IY1B 3IBEA 1G6JA 2JZ3B 2ZPYA 4MDKE 5DPWA 2O6VD 4DWFA 4FLHA 2DENB 3C0RB 4BFRA 4GDLB 1V49A 4GU2A 1ZGUB 3NS8A 4FA6A 3HK0A 3K9PB 2KQSA 3Q3FA 3A4RA 2A4ZA 4BKSD 4WJOA 4GDLA 4A3PA 4P7IA 1GJZA 2FIFA 1LFDA 4GDKB 1GC6A 3M62B 2GBRA 3BY4B 2ZJDA 2L05A 1WXSA 2EMSA 2PPHA 4KVGB 4JGHB 4OVVA 1UZXB 3VFKA 1E8XA 1V5TA 4HXDA 3DVNV 1WGYA 2BKFA 4MSMB 4LDTD 4E74A 1Q5WB 2IZVB 3PHWB 2FCMA 1YIWA 3DOWA 4HCNB 1WFYA 3ZIMA 3V62A 1V2YA 4CYEA 2LJ5A 3M63B 4K81A 2D10A 1A5RA 3ZO5B 2WYQA 3KUCB 4HCPB 2V4LA 2RD0A 3SU8X 2ZVOA 2XEWA 4KDIC 4NQKE 3ZLZA 2B3AA 2CHWA 1P3QU 3N30A 2KTRA 2L0FA 3ZNID 4EZLA 2V1YA 2LZ6A 1J8CA 4DDGD 2KWCA 1WJNA 2HD5B 4ASWC 2O2VB 4FHJA 2DZJA 1EF5A 2BF8B 2NS5A 4E71A 2LGXA 4W9EA 4EFOA 5JH5C 3PLUA 5LLIA 3WA0A 2LXAA 4NY0A 2KANA 2LWPA 4ZRKA 1WJUA 4ZRJA 3VUWA 2L00B 5E6NA 4G0NB 3KUDB 4HDQA 1Z2MA 4WWPA 4AJWA 3JVZX 4B9KA 4II3B 1WZ3A 3PRPB 1D3ZA 3V6CB 3A9JA 4KSKC 4KSLC 4DDID 5J17A 3IVFA 2O6VA 4AOFA 3QK0A 2CHZA 4ANVA 1SE9A 2C7HA 3B1LX 2M8SA 1R4NI 3ZKJC 2JY6A 4ICUA 5J2RA 1I35A 3RZFA 3VVWB 5D94A 4BKSA 4K7WA 1J0GA 3ZNGC 1WX9A 1SIFA 4EEWA 2LGDA 2K6QA 1YJ1A 2NPTB 1EUVB 1YD8U 2FNJB 1WJ6A 4IWOA 3VH3B 2Z59B 3GOEA 1WIAA 4LDTB 2KO3A 1WY8A 5CHWA 1UH6A 2M4NA 1E7UA 2BPSA 3UGBB 2KFJA 3PHXB 3M95A 2NPTA 4WQOB 2G45B 4A3OA 1YQBA 3TIXA 2J0JA 2L7RA 1UELA 2NCNA 3LDZE 3DCGA 3VUXA 3QQ8B 3X0WA 4EOYA 3DBHI 5GMVA 3WIMA 1EF1A 1LXDA 4EZJA 2MRPA 3W1YA 2K1FA 5L83A 2NBVB 3PTFC 2DYMA 1WYWB 3WAMA 2AL3A 3NOBA 3QX1A 3ONSA 2JRIB 1PQSA 2N1VA 2MP2A 3K9OB 2J0KA 3ZTCA 2IO1B 2V3SA 3L54A 3V6EB 2WX0A 1P0RA 3DBLI 4FJYA 3ZTDA 3A33B 2D2QA 2N1WA 2G4DB 1XQQA 4IG7B 1ZW7A 2JUOA 3VTUA 1XT9B 5CHVC 2D11A 4JQWC 3V60A 2FAZA 3PVLA 1ISNA 1IYFA 3L10B 5J18A 2RR9A 2JRHA 3R7QA 3TJPA 2NBUA 4GXBA 2YLMA 2LUEA 2KDFB 2OJRA 1WH3A 2G3QB 2KJHB 2RSUA 2KMAA 1RLFA 2KVRA 1YX5B 2N9PC 3PT2B 1AARA 2MBEA 2UWQA 3VQIA 4XC2A 3DVGY 2WX1A 4OVUA 2MBOA 2CKHB 5AZHA 1OEYJ 5FR6A 3UQAA 2KLGA 4XX5A 4GOCA 4WWNA 2K25A 2LGYA 3S2AA 2YVCA 3WANA 4FBJB 2KMCA 1WXVA 2CR5A 1IP9A 2G4SA 1J19A 2KD0A 1WE6A 1ZKHA 1WMHB 2JF5A 4I6LB 1GUAB 4M8MA 4G50A 2K8CA 3H7PB 2KTFA 4MGZE 1IPGA 3WAOA 2GBJA 4WWOA 1UBQA 5DPSA 3T9LA 2L3ZA 1NDDA 1TBEA 3EFUA 3MJWA 1P98A 1WMHA 2KWVB 3APCA 3QCAA 3PS6A 4WJPA 4AUQC 4LJPB 1MG8A 2C9WB 2I1JA 2RPQA 3ENEA 4GDKA 3H7PA 4KV2A 4URKA 1KM7A 2BWES 3R66C 4MELA 4RM9A 4B6WA 3MHSD 2EKEC 2KDBA 3CF6E 3KVFB 3PREA 2PE9A 2EMTA 5IAAC 3PGEA 3ZRFA 3VHTC 2C7NB 3JW0X 5G2NA 3TBLD 1P9DU 2FCQA 2IYDB 3B08A 2LRWA 4MH0E 3A1QB 1E5WA 2JWZA 4HWIB 2IO0B 4PYZA 4DHZB 2AEHA 2N7DA 2DZIA 1E7VA 3I3TB 3VDZA 3WALA 3VAWA 3VXWA 4HK2A 4FJVB 4DXAB 2D07B 2DAJA 2M1MA 4IWQA 4AJYB 3QJZA 5LXHA 4ANXA 1WGHA 2L0TA 2MW5A 2WDTB 4KDLB 2DZKA 4HVBA 3EC8A 4PS7A 3VTWA 2ASQA 2MWSB 2XBBC 2PEAA 3HM3A 5HKHA 2O2VA 3ECIA 3L08A 2LI5A 4MSQB 3TCAA 1NBFC 4MGKE 2JVCA 4W9GA 1KOTA 4A20A 1TTNA 2KZRA 1GNUA 3RCZA 1H8CA 1Y8RC 1S1QB 1Z5SB 4FJZA 2UYZB 4TKNA 4W9HA 1U4AA 4W9CA 4BBNC 1SGHA 3DVNU 5CX3A 2LXCA 1WR1A 4FHKA 2KDEB 2FCSA 4II2B 2CU1A 1WXMA 1UBIA 3OAWA 5D7GA 4NAWB 4EUTA 4B95A 1HE8A 3V61A 2KQ7A 5KHOA 3NZUA 2LVQA 2Z0DB 3A9KB 4JL9A 3NZSA 2HTHA 2KN5A 3CSFA 4KZCA 4WAAA 3ZUNA 2ZEQA 2IO2B 2ZNVB 3APDA 3ZNHB 4KIKB 5AZGA 4CHKA 3A9KA 4IM2A 4MJSB 4WJQA 3OLMD 3W1SA 4MGYE 3AXCA 2NBWB 4MEMA 3JSVB 4EKUA 1RFAA 4WJNA 3L13A 2DYOA 1WX8A 2J0MA 2PE6B 3B0AA 4MJSA 1R4MI 1UGMA 2FUHB 4DHJD 1OEYA 5DPRA 3JSVA 3QA8A 1WX7A 4IM3A 4IW0A 3RZWC 1X1MA 3IFWB 1GG3A 2ZCCA 2KKCA 5TR5A 1OGWA 2JZZA 4PS8A 5C23A 3EECA 3H1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K39 A;  2Y5B B;  4W9L A;  4F1S A;  1WJ4 A;  2MBB B;  2N9X A;  1Q1O A;  1FXT B;  1WZ0 A;  2N7E A;  4GIV A;  3TMP B;  4DHZ E;  1TZ1 A;  4PYU A;  5AEK B;  1C3T A;  3HM6 X;  2KJR A;  3NY5 A;  3KUZ A;  3P2B A;  3OJ4 B;  2KXJ A;  3H9D A;  5L95 C;  4IWP A;  3QHT A;  2I1K A;  3ZVV A;  3VUY A;  2BKR B;  3UIP B;  5KHQ A;  3PPA A;  2R2Q A;  4HPL B;  2ZVN A;  1UD7 A;  2DYB A;  4TV3 A;  4ZRI A;  4J6I A;  1WGD A;  4BBN F;  2DHZ A;  3PZD A;  5CHF A;  1JRU A;  3SD5 A;  4BVU C;  5D6J B;  4BOZ B;  1E8Y A;  2D3G A;  4PS3 A;  3O65 B;  3N32 A;  5E6O A;  3R3M A;  2MQJ A;  3KH0 A;  4M0W B;  1WGR A;  4AWJ A;  1L2N A;  1WM2 A;  1V9J A;  4BKG A;  3M3J A;  2DX5 B;  1K8R B;  2JPH A;  5D2M B;  3T8M A;  4ICV A;  1E8Z A;  4W9I A;  4XZ4 A;  5CTR C;  1P1A A;  3UQB A;  1VCB A;  1VD2 A;  3DBR I;  2MCN B;  3ZDT A;  2PJH A;  1E8W A;  4GSW A;  4W9D A;  3D32 A;  2GBM A;  2MBH A;  1WXA A;  4AP4 C;  4DHJ B;  4K1R B;  1QZE A;  5EDS A;  2KWU B;  5JZE B;  2LVP A;  2NR2 A;  2QHO A;  3HHM A;  3L16 A;  3UIN B;  2M17 A;  2KHW B;  3PRM B;  2A5U A;  2DAF A;  1WGG A;  3ZRC A;  4GGQ A;  3R7R A;  3AU5 A;  4JLC A;  2KFK B;  4K7U A;  3TL5 A;  2L76 A;  3VTV A;  4ANW A;  4DBG A;  2BYV E;  3PLV A;  2LD9 A;  4I6P A;  3H6N A;  2LRU A;  3WAP A;  4IC7 B;  4TUU A;  4E3C A;  4RMA A;  2FID A;  1C1Y B;  4DK5 A;  2KFK A;  1OTR B;  3A1Q A;  2K8H A;  3SHQ A;  2BYF A;  2MLB A;  5JHB A;  2R2O A;  4NJ6 A;  1WR6 E;  4GN1 A;  1H4R A;  2KK8 A;  3KYD D;  5C1Z A;  2MA9 B;  3UIO B;  4LCD E;  3BIN A;  5E6P A;  2Z0E B;  4TQ1 A;  3DPD A;  2VRR B;  3KW5 B;  1TGZ B;  2KDI A;  4JIO U;  3RD2 A;  3AU4 A;  2KX3 A;  2KTR B;  1BT0 A;  3L17 A;  2L8J A;  4G11 A;  3U30 A;  2KC1 A;  1WM3 A;  2ZNV C;  2FCN A;  1KJT A;  3AUL A;  3W1S C;  4FN2 A;  2N4F A;  4EZK A;  3ZNZ B;  5BO4 B;  2BGF A;  4G3X B;  3DDC B;  2KX0 A;  5G55 A;  3SDL C;  5AZF A;  2NVU I;  1OQY A;  3UF8 A;  1CMX B;  2CS4 A;  4IUM B;  2IBI B;  4W9F A;  2WWZ A;  1WRD B;  5DPT A;  2AYO B;  3EHV A;  3MTN B;  4NQL B;  2HE7 A;  3U8Z A;  3DBS A;  3QAQ A;  2BYE A;  2KNB A;  1E90 A;  2GBN A;  3N3K B;  4N9F 4;  4W9K A;  1XD3 B;  4NAW A;  1YX6 B;  3A9J B;  2K8B A;  2AL6 A;  1KLV A;  2O6V B;  4YL8 A;  1V81 A;  1Q0W B;  1RRB A;  4HJK A;  2N9E B;  4I6N B;  2IO3 B;  2KLC A;  4HDO A;  5DCN A;  1V86 A;  3OJ3 A;  4KZ0 A;  1WI0 A;  2KC2 A;  2LVO A;  4HLE A;  3IHP C;  2C60 A;  4HPM B;  4KIK A;  2ZCB A;  4TQ0 A;  3APF A;  1LM8 B;  4NNJ B;  1V80 A;  3ALB A;  2HJ8 A;  5IA7 A;  1T0Y A;  3QIJ A;  2J7Q B;  3QC8 B;  2M0X A;  3RT3 B;  4F7Z A;  4BOS C;  1EO6 A;  3AI5 A;  3CST A;  3ZDM C;  2BWF A;  3KYC D;  2GOW A;  4CO7 A;  1L7Y A;  2MX2 A;  1M94 A;  4M8N A;  2IY0 B;  3ML9 A;  4RM8 A;  1F9J A;  3X23 A;  5LXI B;  2RGF A;  2XK5 B;  3L0W B;  3RUI B;  4FUL A;  1WE7 A;  4GMV A;  4F8C B;  1NI2 A;  4GB9 A;  4IM0 A;  1S3S G;  3A4S C;  4MM3 A;  3PRZ A;  3DQV A;  4ZYN A;  1I42 A;  2XK5 A;  4NJ7 A;  1V6E A;  2LAS A;  2C5L C;  2MP2 B;  3ML8 A;  3U7D A;  2KOX A;  3QAR A;  1V5O A;  4W9J A;  4ZDV A;  3GZN I;  2KJ6 A;  1WF9 A;  2K6D B;  3RUL A;  4ANU A;  4NPN A;  2REX A;  3H7S A;  4MGI E;  2JXX A;  4LJO B;  1RAX A;  2CHX A;  3JYU A;  3DVG X;  3CMM B;  3HIZ A;  2ZZP B;  3VH4 B;  4X57 B;  2GBK A;  3IG3 A;  1LQB A;  3Q3J A;  2DZM A;  3QWZ B;  2OOB B;  4K7S A;  2GMI C;  2MSE D;  1GC7 A;  2AWT A;  2C7M B;  2JT4 B;  2MBQ A;  2W9N A;  3NHE B;  3RYT A;  5JHA A;  4FAD A;  3LJ3 A;  3PSE B;  3PV1 A;  4BKT A;  3ZW3 A;  2ZPN A;  2IY1 B;  3IBE A;  1G6J A;  2JZ3 B;  2ZPY A;  4MDK E;  5DPW A;  2O6V D;  4DWF A;  4FLH A;  2DEN B;  3C0R B;  4BFR A;  4GDL B;  1V49 A;  4GU2 A;  1ZGU B;  3NS8 A;  4FA6 A;  3HK0 A;  3K9P B;  2KQS A;  3Q3F A;  3A4R A;  2A4Z A;  4BKS D;  4WJO A;  4GDL A;  4A3P A;  4P7I A;  1GJZ A;  2FIF A;  1LFD A;  4GDK B;  1GC6 A;  3M62 B;  2GBR A;  3BY4 B;  2ZJD A;  2L05 A;  1WXS A;  2EMS A;  2PPH A;  4KVG B;  4JGH B;  4OVV A;  1UZX B;  3VFK A;  1E8X A;  1V5T A;  4HXD A;  3DVN V;  1WGY A;  2BKF A;  4MSM B;  4LDT D;  4E74 A;  1Q5W B;  2IZV B;  3PHW B;  2FCM A;  1YIW A;  3DOW A;  4HCN B;  1WFY A;  3ZIM A;  3V62 A;  1V2Y A;  4CYE A;  2LJ5 A;  3M63 B;  4K81 A;  2D10 A;  1A5R A;  3ZO5 B;  2WYQ A;  3KUC B;  4HCP B;  2V4L A;  2RD0 A;  3SU8 X;  2ZVO A;  2XEW A;  4KDI C;  4NQK E;  3ZLZ A;  2B3A A;  2CHW A;  1P3Q U;  3N30 A;  2KTR A;  2L0F A;  3ZNI D;  4EZL A;  2V1Y A;  2LZ6 A;  1J8C A;  4DDG D;  2KWC A;  1WJN A;  2HD5 B;  4ASW C;  2O2V B;  4FHJ A;  2DZJ A;  1EF5 A;  2BF8 B;  2NS5 A;  4E71 A;  2LGX A;  4W9E A;  4EFO A;  5JH5 C;  3PLU A;  5LLI A;  3WA0 A;  2LXA A;  4NY0 A;  2KAN A;  2LWP A;  4ZRK A;  1WJU A;  4ZRJ A;  3VUW A;  2L00 B;  5E6N A;  4G0N B;  3KUD B;  4HDQ A;  1Z2M A;  4WWP A;  4AJW A;  3JVZ X;  4B9K A;  4II3 B;  1WZ3 A;  3PRP B;  1D3Z A;  3V6C B;  3A9J A;  4KSK C;  4KSL C;  4DDI D;  5J17 A;  3IVF A;  2O6V A;  4AOF A;  3QK0 A;  2CHZ A;  4ANV A;  1SE9 A;  2C7H A;  3B1L X;  2M8S A;  1R4N I;  3ZKJ C;  2JY6 A;  4ICU A;  5J2R A;  1I35 A;  3RZF A;  3VVW B;  5D94 A;  4BKS A;  4K7W A;  1J0G A;  3ZNG C;  1WX9 A;  1SIF A;  4EEW A;  2LGD A;  2K6Q A;  1YJ1 A;  2NPT B;  1EUV B;  1YD8 U;  2FNJ B;  1WJ6 A;  4IWO A;  3VH3 B;  2Z59 B;  3GOE A;  1WIA A;  4LDT B;  2KO3 A;  1WY8 A;  5CHW A;  1UH6 A;  2M4N A;  1E7U A;  2BPS A;  3UGB B;  2KFJ A;  3PHX B;  3M95 A;  2NPT A;  4WQO B;  2G45 B;  4A3O A;  1YQB A;  3TIX A;  2J0J A;  2L7R A;  1UEL A;  2NCN A;  3LDZ E;  3DCG A;  3VUX A;  3QQ8 B;  3X0W A;  4EOY A;  3DBH I;  5GMV A;  3WIM A;  1EF1 A;  1LXD A;  4EZJ A;  2MRP A;  3W1Y A;  2K1F A;  5L83 A;  2NBV B;  3PTF C;  2DYM A;  1WYW B;  3WAM A;  2AL3 A;  3NOB A;  3QX1 A;  3ONS A;  2JRI B;  1PQS A;  2N1V A;  2MP2 A;  3K9O B;  2J0K A;  3ZTC A;  2IO1 B;  2V3S A;  3L54 A;  3V6E B;  2WX0 A;  1P0R A;  3DBL I;  4FJY A;  3ZTD A;  3A33 B;  2D2Q A;  2N1W A;  2G4D B;  1XQQ A;  4IG7 B;  1ZW7 A;  2JUO A;  3VTU A;  1XT9 B;  5CHV C;  2D11 A;  4JQW C;  3V60 A;  2FAZ A;  3PVL A;  1ISN A;  1IYF A;  3L10 B;  5J18 A;  2RR9 A;  2JRH A;  3R7Q A;  3TJP A;  2NBU A;  4GXB A;  2YLM A;  2LUE A;  2KDF B;  2OJR A;  1WH3 A;  2G3Q B;  2KJH B;  2RSU A;  2KMA A;  1RLF A;  2KVR A;  1YX5 B;  2N9P C;  3PT2 B;  1AAR A;  2MBE A;  2UWQ A;  3VQI A;  4XC2 A;  3DVG Y;  2WX1 A;  4OVU A;  2MBO A;  2CKH B;  5AZH A;  1OEY J;  5FR6 A;  3UQA A;  2KLG A;  4XX5 A;  4GOC A;  4WWN A;  2K25 A;  2LGY A;  3S2A A;  2YVC A;  3WAN A;  4FBJ B;  2KMC A;  1WXV A;  2CR5 A;  1IP9 A;  2G4S A;  1J19 A;  2KD0 A;  1WE6 A;  1ZKH A;  1WMH B;  2JF5 A;  4I6L B;  1GUA B;  4M8M A;  4G50 A;  2K8C A;  3H7P B;  2KTF A;  4MGZ E;  1IPG A;  3WAO A;  2GBJ A;  4WWO A;  1UBQ A;  5DPS A;  3T9L A;  2L3Z A;  1NDD A;  1TBE A;  3EFU A;  3MJW A;  1P98 A;  1WMH A;  2KWV B;  3APC A;  3QCA A;  3PS6 A;  4WJP A;  4AUQ C;  4LJP B;  1MG8 A;  2C9W B;  2I1J A;  2RPQ A;  3ENE A;  4GDK A;  3H7P A;  4KV2 A;  4URK A;  1KM7 A;  2BWE S;  3R66 C;  4MEL A;  4RM9 A;  4B6W A;  3MHS D;  2EKE C;  2KDB A;  3CF6 E;  3KVF B;  3PRE A;  2PE9 A;  2EMT A;  5IAA C;  3PGE A;  3ZRF A;  3VHT C;  2C7N B;  3JW0 X;  5G2N A;  3TBL D;  1P9D U;  2FCQ A;  2IYD B;  3B08 A;  2LRW A;  4MH0 E;  3A1Q B;  1E5W A;  2JWZ A;  4HWI B;  2IO0 B;  4PYZ A;  4DHZ B;  2AEH A;  2N7D A;  2DZI A;  1E7V A;  3I3T B;  3VDZ A;  3WAL A;  3VAW A;  3VXW A;  4HK2 A;  4FJV B;  4DXA B;  2D07 B;  2DAJ A;  2M1M A;  4IWQ A;  4AJY B;  3QJZ A;  5LXH A;  4ANX A;  1WGH A;  2L0T A;  2MW5 A;  2WDT B;  4KDL B;  2DZK A;  4HVB A;  3EC8 A;  4PS7 A;  3VTW A;  2ASQ A;  2MWS B;  2XBB C;  2PEA A;  3HM3 A;  5HKH A;  2O2V A;  3ECI A;  3L08 A;  2LI5 A;  4MSQ B;  3TCA A;  1NBF C;  4MGK E;  2JVC A;  4W9G A;  1KOT A;  4A20 A;  1TTN A;  2KZR A;  1GNU A;  3RCZ A;  1H8C A;  1Y8R C;  1S1Q B;  1Z5S B;  4FJZ A;  2UYZ B;  4TKN A;  4W9H A;  1U4A A;  4W9C A;  4BBN C;  1SGH A;  3DVN U;  5CX3 A;  2LXC A;  1WR1 A;  4FHK A;  2KDE B;  2FCS A;  4II2 B;  2CU1 A;  1WXM A;  1UBI A;  3OAW A;  5D7G A;  4NAW B;  4EUT A;  4B95 A;  1HE8 A;  3V61 A;  2KQ7 A;  5KHO A;  3NZU A;  2LVQ A;  2Z0D B;  3A9K B;  4JL9 A;  3NZS A;  2HTH A;  2KN5 A;  3CSF A;  4KZC A;  4WAA A;  3ZUN A;  2ZEQ A;  2IO2 B;  2ZNV B;  3APD A;  3ZNH B;  4KIK B;  5AZG A;  4CHK A;  3A9K A;  4IM2 A;  4MJS B;  4WJQ A;  3OLM D;  3W1S A;  4MGY E;  3AXC A;  2NBW B;  4MEM A;  3JSV B;  4EKU A;  1RFA A;  4WJN A;  3L13 A;  2DYO A;  1WX8 A;  2J0M A;  2PE6 B;  3B0A A;  4MJS A;  1R4M I;  1UGM A;  2FUH B;  4DHJ D;  1OEY A;  5DPR A;  3JSV A;  3QA8 A;  1WX7 A;  4IM3 A;  4IW0 A;  3RZW C;  1X1M A;  3IFW B;  1GG3 A;  2ZCC A;  2KKC A;  5TR5 A;  1OGW A;  2JZZ A;  4PS8 A;  5C23 A;  3EEC A;  3H1U A; 
#chains in the Genus database with same CATH topology
 4Q2J A;  2Y5B B;  4W9L A;  4F1S A;  3AE1 B;  1FXT B;  3TMP B;  2N7E A;  5IKC M;  1N5X A;  1TZ1 A;  1F77 A;  1KH0 A;  3HM6 X;  2ICI A;  2WU2 B;  3P2B A;  2KXJ A;  2CJN A;  1RFK A;  2BKR B;  3AEB B;  4HPL B;  2ZVN A;  1GPX A;  1UD7 A;  4J6I A;  1MVK A;  1QOA A;  1JRU A;  3SD5 A;  4BVU C;  5IO9 A;  3N32 A;  2MQJ A;  4AWJ A;  1C79 A;  1FM0 D;  5CTR C;  1VCB A;  3DBR I;  2PJH A;  1E8W A;  4W9D A;  2KWU B;  1SEB D;  3PRM B;  3AED B;  2A5U A;  1WGG A;  4WH4 A;  4ANW A;  3AEA B;  3VTV A;  4I6P A;  1UUP A;  2LRU A;  3WAP A;  4E3C A;  1QOG A;  4HJG E;  1C1Y B;  2KFK A;  2BYF A;  2EEL A;  2R2O A;  2YEP B;  2MA9 B;  2IDY A;  3UIO B;  4PK1 A;  4LCD E;  3BIN A;  1XLO A;  2VZK B;  1CZP A;  2Z0E B;  5E6P A;  1MHH E;  1TGZ B;  1FNV A;  3W5U B;  1WM3 A;  2ZNV C;  3W9C B;  2N4F A;  1K51 A;  5BO4 B;  4G3X B;  4NJC A;  3DDC B;  5G55 A;  1N5W A;  1OQY A;  3UF8 A;  4HRS A;  4W9F A;  1OQQ A;  4C7Z A;  2K22 A;  4N9F 4;  2H88 B;  1UWX A;  2K8B A;  2AL6 A;  2O6V B;  2Y5P A;  2KLC A;  1V86 A;  1WI0 A;  2WXP A;  3RNB C;  4HPM B;  4YTM B;  4KIK A;  3TEW A;  1IBX B;  1KFY B;  3ALB A;  1T0Y A;  4RF1 A;  3RT3 B;  4F7Z A;  2K0P A;  3AE2 B;  2UU7 A;  2IY0 B;  5LXI B;  2D3C A;  1NI2 A;  3E56 A;  4GB9 A;  1I42 A;  3AEC B;  1V6E A;  2MP2 B;  3U7D A;  1WXQ A;  3QAR A;  3TEX A;  4W9J A;  4ZDV A;  3N1Z C;  3GZN I;  1WF9 A;  3H7S A;  2JXX A;  4LJO B;  1RAX A;  2CHX A;  2M56 B;  3HIZ A;  5C3J B;  2WXJ A;  2MSE D;  2JT4 B;  3RYT A;  2MBQ A;  4OZA A;  2IJ0 A;  1MJD A;  3ZW3 A;  2IY1 B;  3IBE A;  1JWU D;  1TY0 A;  3T3O A;  1KTK A;  4L23 A;  2V3N A;  4FA6 A;  2J4X A;  2KQS A;  3Q3F A;  3A4R A;  2A4Z A;  4BKS D;  2IND C;  3VRB B;  4P7I A;  1YN4 A;  2FIF A;  2OHF A;  2GBR A;  5EE1 A;  2EMS A;  1TKE A;  1E8X A;  1PGA A;  4E74 A;  2IZV B;  1YIW A;  4WIP A;  3ZIM A;  3V62 A;  1YJI A;  3M63 B;  1K50 A;  1NYR A;  1RM6 C;  2D10 A;  4XYC A;  3KUC B;  4HCP B;  2RD0 A;  1D4B A;  2ZVO A;  4ARI A;  4KDI C;  1TS3 A;  2CHW A;  2LZ6 A;  1J8C A;  2KWC A;  3DBL B;  1SE3 A;  2HD5 B;  4L2Y A;  3J9C A;  2BF8 B;  1N63 A;  2NS5 A;  1I4P A;  1XLP A;  4E71 A;  5BMI A;  2G9H D;  4ZRK A;  3R2I A;  4AJW A;  3V6C B;  4DDI D;  4KSK C;  2PVO D;  5J17 A;  2O6V A;  2G1E A;  2V3P A;  1I35 A;  3O13 A;  2FBW B;  3RZF A;  5D94 A;  3ZNG C;  4PT5 A;  1YD8 U;  4S17 A;  1WJ6 A;  3NVW A;  1D5M C;  1TYG B;  2RDG A;  1WY8 A;  3AMZ A;  1E7U A;  3PHX B;  4WQO B;  2G45 B;  1TS5 A;  2NCN A;  1UEL A;  1N61 A;  2J42 A;  3X0W A;  3WIM A;  1EF1 A;  4EZJ A;  2MRP A;  3ZJU A;  1F2R I;  3ABV B;  1N60 A;  3GP7 A;  2DYM A;  3WAM A;  3NOB A;  2MP2 A;  1FXI A;  2BB5 A;  2V3S A;  2Z8L A;  3ZTD A;  3AE5 B;  2N1W A;  4IG7 B;  3TUO A;  3VTU A;  1TS2 A;  1MHX A;  3V60 A;  2AQ3 B;  2I2Y A;  3TJP A;  2JRH A;  3HVD A;  1ET9 A;  4WUR A;  2INN E;  2G3Q B;  1XCQ L;  1RLF A;  2UWQ A;  1L4D B;  2K25 A;  3WAN A;  1IP9 A;  1WXV A;  1FCL A;  1VJK A;  1BML C;  4WAF A;  1BUI C;  1ZKH A;  2KTF A;  1GOZ A;  2L3Z A;  1XEE A;  4MH8 A;  3MJW A;  1P98 A;  1WMH A;  1MG8 A;  2RPQ A;  4KV2 A;  2K3U A;  3H7P A;  4MAC A;  4MEL A;  2NMQ A;  3T3N A;  3AE6 B;  2EKE C;  2EMT A;  1QF6 A;  1QOB A;  1EU4 A;  3B08 A;  3A1Q B;  5EE9 A;  4PYZ A;  3MC9 A;  4RGO S;  2LJI A;  4FJV B;  4KDL B;  2MWS B;  2XBB C;  3P4P B;  3ECI A;  1A70 A;  3Q3O C;  4NAM A;  2JX5 A;  3RCZ A;  1Y8R C;  4TKN A;  2UYZ B;  1U4A A;  4KGS A;  1CK1 A;  4N59 A;  4ZHO A;  2LXC A;  3LB8 C;  4II2 B;  2WDR B;  1UBI A;  5D7G A;  3SR6 A;  1HE8 A;  2Z0D B;  4JL9 A;  4KZC A;  2ZEQ A;  3TEZ A;  4LK0 M;  2N7J A;  4M02 A;  3DHI C;  4WJQ A;  3DBR B;  3W1S A;  2JZP A;  2NBW B;  3NG0 A;  3TEY A;  2KWD A;  4NZL B;  2W54 A;  1M4V A;  4MJS A;  1R4M I;  3NJT A;  2FUH B;  1WX7 A;  2ONQ A;  1YN3 A;  4IW0 A;  2CU3 A;  5BYQ A;  5TR5 A;  3NVV A;  4YT0 B;  1Q1O A;  2PKO A;  1K52 A;  3BYT B;  1C3T A;  4RCO A;  2I1K A;  3ZJV A;  4LNN A;  1V1P A;  2DHZ A;  5BMG A;  3PZD A;  4XGA B;  4P16 A;  2WXL A;  1YQ3 B;  1E8Y A;  1E6E B;  4HEA 1;  2X38 A;  1L2N A;  4JE3 B;  1V9J A;  2WXK A;  3T8M A;  4ICV A;  1E8Z A;  4W9I A;  4XZ4 A;  1P1A A;  1VD2 A;  3ETR A;  3D32 A;  2GBM A;  1WXA A;  5HG2 A;  4AP4 C;  1QZE A;  2SEB D;  4LNK A;  2NR2 A;  1TS4 A;  2WXH A;  4JLC A;  2KFK B;  2L76 A;  1UGJ A;  1VR9 A;  1FFU A;  2FID A;  2KVZ A;  3A1Q A;  2MLB A;  2GI9 A;  1E7P B;  2KK8 A;  5C1Z A;  2LUM A;  1JWA D;  2JXT A;  1E9M A;  4MT5 A;  1JWB D;  2KAJ A;  2KN4 A;  4J3O D;  3AU4 A;  2KX3 A;  3GS2 A;  3RD2 A;  3W5V B;  2L8J A;  3U30 A;  2KC1 A;  3AUL A;  4A9A A;  1RWS A;  3ZNZ B;  1YN5 A;  2BGF A;  1EWY C;  1QQR A;  3RFZ B;  2NVU I;  1HA5 A;  2CS4 A;  4IUM B;  2IBI B;  1E10 A;  3BK2 A;  4BAX A;  2AYO B;  2XN9 C;  3EHV A;  3MTN B;  4DXG A;  3U8Z A;  2HE7 A;  2X8X X;  3P63 A;  2KNB A;  1E90 A;  2GBN A;  3N3K B;  1XD3 B;  3Q2A C;  1KLV A;  2VH1 A;  3KLS X;  4YL8 A;  1RRB A;  2N9E B;  3OJ3 A;  4HLE A;  1JML A;  1IUE A;  3BVG A;  2N9L A;  1SBB B;  5G5G A;  5IA7 A;  3QC8 B;  2M0X A;  2GLS A;  1YNT E;  4ZHP A;  3ZDM C;  3KYC D;  1L0X B;  1L7Y A;  2QMT A;  4CO7 A;  3ML9 A;  4YSZ B;  1I4H A;  1WGK A;  4L1B A;  1XCT L;  3Q8E A;  4A90 A;  3PRZ A;  1XLN A;  1VRA B;  3ML8 A;  2RDH A;  3FC4 A;  3GE8 C;  4YSX B;  2DNF A;  2OED A;  1QKZ A;  1JAL A;  4MGI E;  3BK1 A;  1FFV A;  2CJO A;  2WXQ A;  3Q3J A;  1C4C A;  3QWZ B;  2OOB B;  2GMI C;  1GC7 A;  2C7M B;  1B9R A;  3PV1 A;  3HUI A;  3AV8 A;  1G6J A;  1FMA D;  2HJ1 A;  2H89 B;  4FLH A;  2DEN B;  3C0R B;  1R7S A;  4BFR A;  4GU2 A;  1ZGU B;  4HKQ A;  3NS8 A;  3RPF C;  3K9P B;  4A3P A;  1GJZ A;  4GDK B;  3FIL A;  4YTN B;  2BBC A;  2L05 A;  2PTL A;  2JU6 X;  4OVV A;  1V5T A;  3U7Z A;  4HXD A;  1E0Z A;  1KLG D;  3BII D;  1WFY A;  2L32 A;  4CYE A;  2BS3 B;  4C80 A;  1T3Q A;  4ITK A;  1L6V A;  1WYG A;  1A5R A;  3ZO5 B;  1FEH A;  1CJE A;  4JWU C;  1PGB A;  1NEN B;  4NQK E;  2JQR B;  3MHZ A;  4XDC A;  4O1N A;  2PIA A;  4ASW C;  2O2V B;  3E9S A;  4FHJ A;  2DZJ A;  1D5X C;  1EF5 A;  4XE0 A;  2MJD A;  4EFO A;  1ZXI A;  1L4Z B;  4GLS C;  3MFG A;  5LLI A;  3RNC C;  4NY0 A;  3WA0 A;  2KAN A;  1WJU A;  1ENF A;  1VDV A;  4ZRJ A;  3VUW A;  5MPO A;  4G0N B;  4HDQ A;  1Z2M A;  3N9Y C;  4WWP A;  4II3 B;  1D3Z A;  2OJW A;  4KSL C;  2AX5 A;  5HHD G;  3U2S C;  3IVF A;  2J52 A;  4ANV A;  1DOY A;  4IDI A;  2JY6 A;  4ICU A;  3C19 A;  1RYJ A;  1J0G A;  4EEW A;  2LGD A;  3VH3 B;  1EUV B;  2FNJ B;  2Z59 B;  3GOE A;  5CHW A;  3ZJT A;  2TSS A;  1UH6 A;  2M4N A;  2BPS A;  2KFJ A;  1DOI A;  4YTP B;  2NPT A;  5D3I B;  3W2D A;  2J0J A;  4R3D A;  1XXG A;  3VUX A;  4AQ7 A;  4EOY A;  3DBH I;  5GMV A;  3P1M A;  3R8B A;  2D3B A;  2K1F A;  2NBV B;  2AL3 A;  1SE2 A;  3ONS A;  2JRI B;  2WXM A;  2N1V A;  4JX1 C;  1SXT A;  2J0K A;  4OVZ A;  2IO1 B;  3A33 B;  4RF0 A;  4D2K A;  2G4D B;  1XQQ A;  4XDD A;  1XT9 B;  5CHV C;  1XO3 A;  4JQW C;  3PVL A;  3B2G A;  1MG4 A;  2NBU A;  1NEK B;  2YLM A;  3BZD B;  2NTS A;  2OJR A;  3DHG C;  2LHE A;  3PT2 B;  2KVR A;  2MJE A;  1OFF A;  3DVG Y;  2WX1 A;  2MBO A;  1P7F A;  2CKH B;  5AZH A;  5FR6 A;  2KLG A;  2LEK A;  4GOC A;  4FBJ B;  1SIJ A;  2G4S A;  2M0A A;  1WMH B;  2JF5 A;  3H7P B;  4MGZ E;  3WAO A;  3T9L A;  1DGJ A;  3L4P A;  3QCA A;  4LJP B;  4URK A;  4GDK A;  2XNA C;  3AN1 A;  1KM7 A;  3R66 C;  4RM9 A;  4QAY A;  3CF6 E;  1TIF A;  1JWS D;  2Y3A A;  4WQM A;  3PGE A;  2C7N B;  1QT9 A;  1P9D U;  3SEB A;  2Q5W D;  2AEH A;  2BVC A;  2DZI A;  3I3T B;  4TMA B;  4JPS A;  2D07 B;  2M1M A;  2D3A A;  2WXF A;  1WGH A;  2L0T A;  2MW5 A;  5TSS A;  2INP E;  4HVB A;  4PS7 A;  2ASQ A;  2QIE B;  5HKH A;  2O2V A;  3L08 A;  4MSQ B;  4HKZ E;  1NBF C;  2QJL A;  1KOT A;  2KZR A;  3Q8B A;  1Z5S B;  1S1Q B;  4FJZ A;  4W9C A;  4KX6 B;  2WS3 B;  2W55 A;  2JSV X;  1HZ6 A;  3NVZ A;  2KDE B;  4NAW B;  3NZU A;  4BZA A;  3I9V 1;  3DWG C;  3ZUN A;  4UDU C;  5AZG A;  3A9K A;  4RGT A;  3B9J A;  4B0E A;  3Q8C A;  4MJS B;  4MEM A;  4EKU A;  1B1Z A;  1RFA A;  4WJN A;  2K5P A;  4P6V F;  2DYO A;  2PE6 B;  3B0A A;  1OEY A;  5DPR A;  1ZP0 B;  3RZW C;  3H8H A;  2ZCC A;  4MM3 B;  3VR8 B;  2ON8 A;  1C76 A;  2K39 A;  2MBB B;  1WZ0 A;  4DHZ E;  2W3S A;  3PO0 A;  5AEK B;  4EE2 A;  3NY5 A;  3KUZ A;  3OJ4 B;  1T0Q C;  4IWP A;  2BT6 A;  1V1P B;  3PZ8 A;  2R2Q A;  4TV3 A;  2MHJ A;  2LHD A;  4ZRI A;  2RPV A;  3EGR A;  1ZDV A;  5CHF A;  5D6J B;  4BOZ B;  4PS3 A;  3R3M A;  2DBY A;  3KH0 A;  1WGR A;  1PDX A;  1WM2 A;  2QDF A;  4BKG A;  2JPH A;  1FPY A;  3UQB A;  3MJ5 A;  2MCN B;  4M0W A;  3ZDT A;  1FXA A;  4K1R B;  1KF6 B;  5JZE B;  2LVP A;  4RNA A;  1ROE A;  2M17 A;  2DAF A;  3ZRC A;  4GGQ A;  4A55 A;  4K7U A;  3TL5 A;  2RDB C;  2BYV E;  3PLV A;  4YWG G;  1DOX A;  1ZE3 D;  4IC7 B;  4TUU A;  3MP9 A;  4RMA A;  1L0Y B;  4DK5 A;  2K8H A;  3SHQ A;  2GRI A;  4NJ6 A;  4GN1 A;  3KYD D;  1Y56 A;  5HI1 A;  5AUI A;  1FO4 A;  4C4V A;  1Q10 A;  4JIO U;  3KW5 B;  2KDI A;  2KTR B;  4G11 A;  2FCN A;  3W1S C;  3AE7 B;  4FN2 A;  4EZK A;  1FIQ A;  2KX0 A;  1CMX B;  3P4R B;  5BMH A;  2WDQ B;  1GB1 A;  3QAQ A;  2BYE A;  4W9K A;  4NAW A;  1C77 A;  4AS1 A;  5EE0 A;  1V81 A;  1Q0W B;  2E6X A;  4HJK A;  5DCN A;  3CWI A;  3AB5 A;  2KC2 A;  3SFD B;  1ZDX A;  3DHH C;  2AQ2 B;  1ESF A;  1I4X A;  1T6B X;  1KRH A;  1V80 A;  2HJ8 A;  2J7Q B;  2BB6 A;  2WXG A;  4M01 A;  3AI5 A;  3IT4 B;  2BWF A;  3IAM 1;  2GOW A;  2JWU A;  1WSP A;  4M8N A;  4RGN A;  1MFW A;  4RGM A;  3X23 A;  2RGF A;  3RUI B;  2BS2 B;  4OZB A;  1S3S G;  4MM3 A;  1L5P A;  1PYW D;  4ZYN A;  2EKI A;  2XK5 A;  1J7A A;  2K9X A;  2C5L C;  1SJE D;  1F52 A;  1V5O A;  3ZYY X;  2VZK D;  2K6D B;  4ANU A;  5FR3 A;  1ZUD 2;  3OG5 A;  2AQ1 B;  2WDV B;  3VH4 B;  4X57 B;  2KMM A;  3IG3 A;  1HQR D;  2WXR A;  2AWT A;  3BWU D;  4FAD A;  3PSE B;  3IAS 1;  1P7E A;  2ZPN A;  1GAQ B;  2JZ3 B;  4MDK E;  5DPW A;  2O6V D;  1V49 A;  3HVZ A;  3FIL B;  3AE3 B;  2IGD A;  4WJO A;  4GDL A;  4KKI A;  5BYS A;  3VR9 B;  3M62 B;  2ZJD A;  1WXS A;  4KVG B;  2J53 A;  4JGH B;  1VZ7 A;  1WGY A;  1Q5W B;  1YJJ A;  2FCM A;  2QC8 A;  2PMV A;  3V05 A;  1HZ5 A;  2LJ5 A;  1D5Z C;  4S0R A;  1I7H A;  2WXO A;  2V4L A;  1K53 A;  3GZN B;  3SU8 X;  1XF5 L;  2XEW A;  2B3A A;  3Q3N C;  4M00 A;  2KTR A;  3ZNI D;  2V1Y A;  2KDM A;  1WJN A;  3AEE B;  1FNW A;  2LGX A;  4W9E A;  5JH5 C;  3PLU A;  3ZQ4 A;  3KWL A;  1T5X D;  4US8 A;  5EE3 A;  2L00 B;  3KUD B;  1L6U A;  3JVZ X;  4B9K A;  3GB1 A;  1HEZ E;  5HFY A;  3QK0 A;  2CHZ A;  2C7H A;  3B1L X;  2M8S A;  1R4N I;  4A8X C;  2D5G A;  5J2R A;  3VVW B;  1EWC A;  4BKS A;  1JWM D;  2LMC A;  4IWO A;  2K6Q A;  2NPT B;  1I4R A;  4LDT B;  2KO3 A;  3UGB B;  3M95 A;  1TT5 B;  4A3O A;  3WCQ A;  3QQ8 B;  1V1O A;  5BYR A;  3BVZ A;  3Q3M C;  4IKG A;  4JWS C;  3PTF C;  4K3C A;  3QX1 A;  1FD6 A;  1PQS A;  1XLQ A;  3K9O B;  5E6J A;  1J7C A;  3ZGZ A;  1TKG A;  3V6E B;  1P0R A;  2D2Q A;  3HRD D;  3MC0 B;  1AYF A;  2ACZ B;  5J18 A;  2RR9 A;  3N1X C;  4GXB A;  2KDF B;  1WH3 A;  2KJH B;  2KMA A;  2N9P C;  1TKY A;  1YX5 B;  1AAR A;  2MBE A;  3VQI A;  4XC2 A;  4ZRQ A;  4OVU A;  1OEY J;  3UQA A;  1I4Q A;  3S2A A;  2YVC A;  4RH6 A;  1WE6 A;  4I6L B;  3CIR B;  3C8Y A;  4C56 C;  4G50 A;  2K8C A;  2MH7 A;  3FKY A;  3I57 A;  1IPG A;  2GBJ A;  5DPS A;  2WXI A;  1STE A;  1BXT A;  1JCK B;  3EFU A;  4AUQ C;  3APC A;  4WJP A;  2C9W B;  2I1J A;  3ENE A;  4RFB A;  5H8Y E;  1VLB A;  3MHS D;  4LNF A;  2R61 A;  3PRE A;  2BTE A;  1J7B A;  1JRO A;  4XWW A;  3B2F A;  2ZW0 A;  3JW0 X;  5G2N A;  1T0S C;  2IYD B;  3AE4 B;  3AE9 B;  2MJ3 A;  5I4D A;  4MH0 E;  1E5W A;  4HWI B;  3EFC A;  2N7D A;  3VAW A;  3VXW A;  2DAJ A;  4IWQ A;  3QJZ A;  1PUT A;  4ANX A;  1JW9 D;  1SB3 C;  2WDT B;  3RN9 C;  3EC8 A;  1TZO A;  1NI3 A;  3VTW A;  2N9K A;  3AE8 B;  2PW9 A;  3TCA A;  4W9G A;  2JVC A;  4A20 A;  1GNU A;  1JRP A;  4C00 A;  2WNM A;  3DVN U;  1AWD A;  1L0V B;  4OW0 A;  1WXM A;  1V97 A;  2MEK A;  5KHO A;  1IGD A;  4LNI A;  2LVQ A;  3A9K B;  4WAA A;  3AM9 A;  3ZXV A;  3AEG B;  3APD A;  3ZNH B;  4XWT A;  1VZ8 A;  3RMK C;  3TSS A;  5GXG B;  4A6Q A;  2L83 A;  4H2A A;  2LFI A;  3L13 A;  3SFE B;  3V3X A;  3JSV A;  3DWM A;  4IM3 A;  3NUH B;  3IFW B;  1GG3 A;  1KLU D;  2W82 A;  4KGT A;  5AUK A;  3OWE B;  4PS8 A;  1SJH D;  3H1U A;  1WJ4 A;  2N9X A;  4DXF A;  4GIV A;  4PYU A;  1TJE A;  1C4A A;  2SAK A;  2KJR A;  5H92 C;  5C2T B;  4B0M A;  3H9D A;  5L95 C;  4OZC A;  2JYE A;  3QHT A;  3ZVV A;  3VUY A;  3UIP B;  5KHQ A;  2GB1 A;  3PPA A;  3NRZ A;  3VRA B;  3NS1 A;  2DYB A;  5LNK 1;  1WGD A;  4BBN F;  1C9F A;  1CQV A;  3UI3 A;  4USA A;  1TY2 A;  2D3G A;  3O65 B;  5D3D A;  1F2R C;  5E6O A;  4M0W B;  2QEJ C;  2RMM A;  3M3J A;  2DX5 B;  1K8R B;  5D2M B;  4CHK A;  1MPE A;  4GSW A;  2MBH A;  1GB4 A;  4DHJ B;  5EDS A;  3FAH A;  2QHO A;  3HHM A;  3GE3 C;  3L16 A;  3IT6 B;  3UIN B;  2KHW B;  3R7R A;  3AU5 A;  1R4M B;  3AH7 A;  4YSY B;  4DBG A;  4LTU A;  2LD9 A;  3H6N A;  1UF0 A;  5FKA C;  1OTR B;  2INC C;  4C4V B;  5JHB A;  1WR6 E;  1MI0 A;  1H4R A;  3NVY A;  4P1C C;  3NZ3 A;  2Y5C A;  4TQ1 A;  3DPD A;  1IGC A;  2VRR B;  2L52 A;  1V8C A;  1BT0 A;  3L17 A;  2WU5 B;  1ZXH A;  1F0Z A;  2IGG A;  1FCC C;  1KJT A;  4N58 A;  3P4S B;  3SDL C;  5AZF A;  4TSS A;  2QIL A;  2WWZ A;  1WRD B;  5DPT A;  3RNE C;  4HPP A;  4NQL B;  3DBS A;  5IN7 A;  1C4P A;  1LO5 D;  1YX6 B;  3A9J B;  1ACC A;  4I6N B;  2IO3 B;  1N62 A;  4HDO A;  1SSN A;  4KZ0 A;  2LVO A;  1DYQ A;  3IHP C;  2JYT A;  2C60 A;  2ZCB A;  3ZXR A;  4TQ0 A;  3APF A;  1LM8 B;  2WP9 B;  4NNJ B;  3QIJ A;  1OQR A;  4BOS C;  1EO6 A;  3CST A;  1IBX A;  2IPK D;  2MX2 A;  1M94 A;  3Q6B A;  4RM8 A;  1F9J A;  1I4G A;  2XK5 B;  3L0W B;  4FUL A;  1WE7 A;  4GMV A;  4F8C B;  4IM0 A;  3A4S C;  4KKJ A;  3DQV A;  2IGH A;  4NJ7 A;  2LAS A;  2KOX A;  3R2T A;  2KJ6 A;  2BS4 B;  3RUL A;  3EUB 2;  4NPN A;  4US9 A;  2REX A;  3JYU A;  1HTQ A;  3BVM A;  3DVG X;  3CMM B;  2DWQ A;  2ZZP B;  3PZ7 A;  1WWT A;  2GBK A;  1LQB A;  2DLB A;  2DZM A;  4K7S A;  4KGR A;  1T0R C;  2W9N A;  3NHE B;  5JHA A;  3LJ3 A;  4BKT A;  1EM7 A;  1YQ4 B;  2ZPY A;  4DWF A;  4GDL B;  1FRR A;  1ZPS A;  2KT7 A;  2M19 A;  1R4N B;  3HK0 A;  1AW7 A;  2LGI A;  3RNF C;  1NVI D;  1LFD A;  1ZOY B;  1GC6 A;  2B76 B;  3BY4 B;  1N6Z A;  1VZ6 A;  2HDE A;  2PPH A;  3VFK A;  1UZX B;  3DVN V;  2BKF A;  4MSM B;  4P1B C;  4LDT D;  3KQ4 A;  3PHW B;  4HCN B;  3DOW A;  3N1Y C;  2KAC A;  2WGS A;  5IOI A;  1V2Y A;  2QSD A;  1PGX A;  4K81 A;  2WYQ A;  2PVG C;  2KQ4 X;  2V9H A;  1D6E C;  3Q8F A;  3ZLZ A;  3N30 A;  1P3Q U;  2L0F A;  4LNO A;  4EZL A;  4ARC A;  4DDG D;  1FNU A;  2KYW A;  4N6E B;  2N0S B;  1JQ4 A;  3AEF B;  2NTT A;  2LXA A;  2LWP A;  3LYY A;  5E6N A;  1WZ3 A;  3PRP B;  3A9J A;  2PLP A;  3Q14 C;  3BYY B;  2L1A A;  4AOF A;  1ET6 A;  2HTM E;  4ZYS A;  1SE9 A;  3ZKJ C;  2FUG 1;  2WHI A;  1NYQ A;  3IXS A;  2WLB A;  4K7W A;  1WX9 A;  1SIF A;  1QOF A;  1C78 A;  1YJ1 A;  2YEP F;  5G5H A;  1WIA A;  3RNA C;  4WWM A;  1UWM A;  1YQB A;  3TIX A;  5IP4 D;  2L7R A;  3LDZ E;  3DCG A;  1LXD A;  4YXD B;  3W1Y A;  5L83 A;  1F1H A;  1WYW B;  2VH2 A;  5T8I A;  3ZTC A;  3L54 A;  2WX0 A;  3DBL I;  4FJY A;  5FK9 C;  1ZW7 A;  2JUO A;  2D11 A;  1WRI A;  2FAZ A;  1ISN A;  1YMH E;  3L10 B;  1IYF A;  3R7Q A;  2LUE A;  3I5J C;  2RSU A;  1LGR A;  4XX5 A;  1YOV B;  4WWN A;  2LGY A;  2KMC A;  2CR5 A;  1J19 A;  2KD0 A;  2BQQ A;  1GUA B;  4M8M A;  4DQO C;  4IOI E;  4WWO A;  1UBQ A;  1NDD A;  1TBE A;  2KWV B;  3PS6 A;  1EU3 A;  2BWE S;  4B6W A;  2KDB A;  3KVF B;  2PE9 A;  5IAA C;  3N20 C;  3DBH B;  3VHT C;  1QIL A;  3ZRF A;  3TBL D;  2FCQ A;  2LRW A;  2JWZ A;  1FRD A;  2IO0 B;  4DHZ B;  3Q69 A;  3U52 E;  1E7V A;  1QLB B;  3VDZ A;  2WXN A;  3WAL A;  4HK2 A;  4DXA B;  5LXH A;  3P4Q B;  4AJY B;  4ACF A;  3I63 C;  2FE8 A;  2DZK A;  4REZ A;  5JXV A;  2WQY B;  4K3B A;  3HM3 A;  2PEA A;  2LI5 A;  4C7Y A;  4MGK E;  1TTN A;  4ZRP A;  2LGS A;  1H8C A;  4W9H A;  1AN8 A;  3URY A;  4BBN C;  1SGH A;  5CX3 A;  4FHK A;  1WR1 A;  2ZW1 A;  3MC8 A;  4HRO A;  2FCS A;  2CU1 A;  3OAW A;  2V0G A;  1SE4 A;  3EA6 A;  4EUT A;  4B95 A;  1SF0 A;  3V61 A;  2KQ7 A;  2BYT A;  3RNG C;  3NZS A;  2QCZ A;  2HTH A;  2KN5 A;  3CSF A;  2E3T A;  2W3R A;  2IO2 B;  2ZNV B;  4KIK B;  4FXC A;  4IM2 A;  4ZOH C;  1PFD A;  3U4E G;  3P42 A;  3RI7 C;  1HXY D;  3OLM D;  4MGY E;  3AXC A;  1HTO A;  3JSV B;  4CQN A;  3Q8A A;  4OHJ A;  2I38 A;  1WX8 A;  2J0M A;  3KWV A;  1UGM A;  4DHJ D;  3LXF A;  3QA8 A;  1X1M A;  2V4I B;  2KKC A;  1UNS A;  1OGW A;  2JZZ A;  5C23 A;  2BW2 A;  3EEC A;  4LLG M; 
#chains in the Genus database with same CATH homology
 2K39 A;  2Y5B B;  4W9L A;  4F1S A;  1WJ4 A;  2MBB B;  2N9X A;  1Q1O A;  1FXT B;  1WZ0 A;  2N7E A;  4GIV A;  3TMP B;  4DHZ E;  1TZ1 A;  4PYU A;  5AEK B;  1C3T A;  3HM6 X;  2KJR A;  3NY5 A;  3KUZ A;  3P2B A;  3OJ4 B;  2KXJ A;  3H9D A;  5L95 C;  4IWP A;  3QHT A;  2I1K A;  3ZVV A;  3VUY A;  2BKR B;  3UIP B;  5KHQ A;  3PPA A;  2R2Q A;  4HPL B;  2ZVN A;  1UD7 A;  2DYB A;  4TV3 A;  4ZRI A;  4J6I A;  1WGD A;  4BBN F;  2DHZ A;  3PZD A;  5CHF A;  1JRU A;  3SD5 A;  4BVU C;  5D6J B;  4BOZ B;  1E8Y A;  2D3G A;  4PS3 A;  3O65 B;  3N32 A;  5E6O A;  3R3M A;  2MQJ A;  3KH0 A;  4M0W B;  1WGR A;  4AWJ A;  1L2N A;  1WM2 A;  1V9J A;  4BKG A;  3M3J A;  2DX5 B;  1K8R B;  2JPH A;  5D2M B;  3T8M A;  4ICV A;  1E8Z A;  4W9I A;  4XZ4 A;  5CTR C;  1P1A A;  3UQB A;  1VCB A;  1VD2 A;  3DBR I;  2MCN B;  3ZDT A;  2PJH A;  1E8W A;  4GSW A;  4W9D A;  3D32 A;  2GBM A;  2MBH A;  1WXA A;  4AP4 C;  4DHJ B;  4K1R B;  1QZE A;  5EDS A;  2KWU B;  5JZE B;  2LVP A;  2NR2 A;  2QHO A;  3HHM A;  3L16 A;  3UIN B;  2M17 A;  2KHW B;  3PRM B;  2A5U A;  2DAF A;  1WGG A;  3ZRC A;  4GGQ A;  3R7R A;  3AU5 A;  4JLC A;  2KFK B;  4K7U A;  3TL5 A;  2L76 A;  3VTV A;  4ANW A;  4DBG A;  2BYV E;  3PLV A;  2LD9 A;  4I6P A;  3H6N A;  2LRU A;  3WAP A;  4IC7 B;  4TUU A;  4E3C A;  4RMA A;  2FID A;  1C1Y B;  4DK5 A;  2KFK A;  1OTR B;  3A1Q A;  2K8H A;  3SHQ A;  2BYF A;  2MLB A;  5JHB A;  2R2O A;  4NJ6 A;  1WR6 E;  4GN1 A;  1H4R A;  2KK8 A;  3KYD D;  5C1Z A;  2MA9 B;  3UIO B;  4LCD E;  3BIN A;  5E6P A;  2Z0E B;  4TQ1 A;  3DPD A;  2VRR B;  3KW5 B;  1TGZ B;  2KDI A;  4JIO U;  3RD2 A;  3AU4 A;  2KX3 A;  2KTR B;  1BT0 A;  3L17 A;  2L8J A;  4G11 A;  3U30 A;  2KC1 A;  1WM3 A;  2ZNV C;  2FCN A;  1KJT A;  3AUL A;  3W1S C;  4FN2 A;  2N4F A;  4EZK A;  3ZNZ B;  5BO4 B;  2BGF A;  4G3X B;  3DDC B;  2KX0 A;  5G55 A;  3SDL C;  5AZF A;  2NVU I;  1OQY A;  3UF8 A;  1CMX B;  2CS4 A;  4IUM B;  2IBI B;  4W9F A;  2WWZ A;  1WRD B;  5DPT A;  2AYO B;  3EHV A;  3MTN B;  4NQL B;  2HE7 A;  3U8Z A;  3DBS A;  3QAQ A;  2BYE A;  2KNB A;  1E90 A;  2GBN A;  3N3K B;  4N9F 4;  4W9K A;  1XD3 B;  4NAW A;  1YX6 B;  3A9J B;  2K8B A;  2AL6 A;  1KLV A;  2O6V B;  4YL8 A;  1V81 A;  1Q0W B;  1RRB A;  4HJK A;  2N9E B;  4I6N B;  2IO3 B;  2KLC A;  4HDO A;  5DCN A;  1V86 A;  3OJ3 A;  4KZ0 A;  1WI0 A;  2KC2 A;  2LVO A;  4HLE A;  3IHP C;  2C60 A;  4HPM B;  4KIK A;  2ZCB A;  4TQ0 A;  3APF A;  1LM8 B;  4NNJ B;  1V80 A;  3ALB A;  2HJ8 A;  5IA7 A;  1T0Y A;  3QIJ A;  2J7Q B;  3QC8 B;  2M0X A;  3RT3 B;  4F7Z A;  4BOS C;  1EO6 A;  3AI5 A;  3CST A;  3ZDM C;  2BWF A;  3KYC D;  2GOW A;  4CO7 A;  1L7Y A;  2MX2 A;  1M94 A;  4M8N A;  2IY0 B;  3ML9 A;  4RM8 A;  1F9J A;  3X23 A;  5LXI B;  2RGF A;  2XK5 B;  3L0W B;  3RUI B;  4FUL A;  1WE7 A;  4GMV A;  4F8C B;  1NI2 A;  4GB9 A;  4IM0 A;  1S3S G;  3A4S C;  4MM3 A;  3PRZ A;  3DQV A;  4ZYN A;  1I42 A;  2XK5 A;  4NJ7 A;  1V6E A;  2LAS A;  2C5L C;  2MP2 B;  3ML8 A;  3U7D A;  2KOX A;  3QAR A;  1V5O A;  4W9J A;  4ZDV A;  3GZN I;  2KJ6 A;  1WF9 A;  2K6D B;  3RUL A;  4ANU A;  4NPN A;  2REX A;  3H7S A;  4MGI E;  2JXX A;  4LJO B;  1RAX A;  2CHX A;  3JYU A;  3DVG X;  3CMM B;  3HIZ A;  2ZZP B;  3VH4 B;  4X57 B;  2GBK A;  3IG3 A;  1LQB A;  3Q3J A;  2DZM A;  3QWZ B;  2OOB B;  4K7S A;  2GMI C;  2MSE D;  1GC7 A;  2AWT A;  2C7M B;  2JT4 B;  2MBQ A;  2W9N A;  3NHE B;  3RYT A;  5JHA A;  4FAD A;  3LJ3 A;  3PSE B;  3PV1 A;  4BKT A;  3ZW3 A;  2ZPN A;  2IY1 B;  3IBE A;  1G6J A;  2JZ3 B;  2ZPY A;  4MDK E;  5DPW A;  2O6V D;  4DWF A;  4FLH A;  2DEN B;  3C0R B;  4BFR A;  4GDL B;  1V49 A;  4GU2 A;  1ZGU B;  3NS8 A;  4FA6 A;  3HK0 A;  3K9P B;  2KQS A;  3Q3F A;  3A4R A;  2A4Z A;  4BKS D;  4WJO A;  4GDL A;  4A3P A;  4P7I A;  1GJZ A;  2FIF A;  1LFD A;  4GDK B;  1GC6 A;  3M62 B;  2GBR A;  3BY4 B;  2ZJD A;  2L05 A;  1WXS A;  2EMS A;  2PPH A;  4KVG B;  4JGH B;  4OVV A;  1UZX B;  3VFK A;  1E8X A;  1V5T A;  4HXD A;  3DVN V;  1WGY A;  2BKF A;  4MSM B;  4LDT D;  4E74 A;  1Q5W B;  2IZV B;  3PHW B;  2FCM A;  1YIW A;  3DOW A;  4HCN B;  1WFY A;  3ZIM A;  3V62 A;  1V2Y A;  4CYE A;  2LJ5 A;  3M63 B;  4K81 A;  2D10 A;  1A5R A;  3ZO5 B;  2WYQ A;  3KUC B;  4HCP B;  2V4L A;  2RD0 A;  3SU8 X;  2ZVO A;  2XEW A;  4KDI C;  4NQK E;  3ZLZ A;  2B3A A;  2CHW A;  1P3Q U;  3N30 A;  2KTR A;  2L0F A;  3ZNI D;  4EZL A;  2V1Y A;  2LZ6 A;  1J8C A;  4DDG D;  2KWC A;  1WJN A;  2HD5 B;  4ASW C;  2O2V B;  4FHJ A;  2DZJ A;  1EF5 A;  2BF8 B;  2NS5 A;  4E71 A;  2LGX A;  4W9E A;  4EFO A;  5JH5 C;  3PLU A;  5LLI A;  3WA0 A;  2LXA A;  4NY0 A;  2KAN A;  2LWP A;  4ZRK A;  1WJU A;  4ZRJ A;  3VUW A;  2L00 B;  5E6N A;  4G0N B;  3KUD B;  4HDQ A;  1Z2M A;  4WWP A;  4AJW A;  3JVZ X;  4B9K A;  4II3 B;  1WZ3 A;  3PRP B;  1D3Z A;  3V6C B;  3A9J A;  4KSK C;  4KSL C;  4DDI D;  5J17 A;  3IVF A;  2O6V A;  4AOF A;  3QK0 A;  2CHZ A;  4ANV A;  1SE9 A;  2C7H A;  3B1L X;  2M8S A;  1R4N I;  3ZKJ C;  2JY6 A;  4ICU A;  5J2R A;  1I35 A;  3RZF A;  3VVW B;  5D94 A;  4BKS A;  4K7W A;  1J0G A;  3ZNG C;  1WX9 A;  1SIF A;  4EEW A;  2LGD A;  2K6Q A;  1YJ1 A;  2NPT B;  1EUV B;  1YD8 U;  2FNJ B;  1WJ6 A;  4IWO A;  3VH3 B;  2Z59 B;  3GOE A;  1WIA A;  4LDT B;  2KO3 A;  1WY8 A;  5CHW A;  1UH6 A;  2M4N A;  1E7U A;  2BPS A;  3UGB B;  2KFJ A;  3PHX B;  3M95 A;  2NPT A;  4WQO B;  2G45 B;  4A3O A;  1YQB A;  3TIX A;  2J0J A;  2L7R A;  1UEL A;  2NCN A;  3LDZ E;  3DCG A;  3VUX A;  3QQ8 B;  3X0W A;  4EOY A;  3DBH I;  5GMV A;  3WIM A;  1EF1 A;  1LXD A;  4EZJ A;  2MRP A;  3W1Y A;  2K1F A;  5L83 A;  2NBV B;  3PTF C;  2DYM A;  1WYW B;  3WAM A;  2AL3 A;  3NOB A;  3QX1 A;  3ONS A;  2JRI B;  1PQS A;  2N1V A;  2MP2 A;  3K9O B;  2J0K A;  3ZTC A;  2IO1 B;  2V3S A;  3L54 A;  3V6E B;  2WX0 A;  1P0R A;  3DBL I;  4FJY A;  3ZTD A;  3A33 B;  2D2Q A;  2N1W A;  2G4D B;  1XQQ A;  4IG7 B;  1ZW7 A;  2JUO A;  3VTU A;  1XT9 B;  5CHV C;  2D11 A;  4JQW C;  3V60 A;  2FAZ A;  3PVL A;  1ISN A;  1IYF A;  3L10 B;  5J18 A;  2RR9 A;  2JRH A;  3R7Q A;  3TJP A;  2NBU A;  4GXB A;  2YLM A;  2LUE A;  2KDF B;  2OJR A;  1WH3 A;  2G3Q B;  2KJH B;  2RSU A;  2KMA A;  1RLF A;  2KVR A;  1YX5 B;  2N9P C;  3PT2 B;  1AAR A;  2MBE A;  2UWQ A;  3VQI A;  4XC2 A;  3DVG Y;  2WX1 A;  4OVU A;  2MBO A;  2CKH B;  5AZH A;  1OEY J;  5FR6 A;  3UQA A;  2KLG A;  4XX5 A;  4GOC A;  4WWN A;  2K25 A;  2LGY A;  3S2A A;  2YVC A;  3WAN A;  4FBJ B;  2KMC A;  1WXV A;  2CR5 A;  1IP9 A;  2G4S A;  1J19 A;  2KD0 A;  1WE6 A;  1ZKH A;  1WMH B;  2JF5 A;  4I6L B;  1GUA B;  4M8M A;  4G50 A;  2K8C A;  3H7P B;  2KTF A;  4MGZ E;  1IPG A;  3WAO A;  2GBJ A;  4WWO A;  1UBQ A;  5DPS A;  3T9L A;  2L3Z A;  1NDD A;  1TBE A;  3EFU A;  3MJW A;  1P98 A;  1WMH A;  2KWV B;  3APC A;  3QCA A;  3PS6 A;  4WJP A;  4AUQ C;  4LJP B;  1MG8 A;  2C9W B;  2I1J A;  2RPQ A;  3ENE A;  4GDK A;  3H7P A;  4KV2 A;  4URK A;  1KM7 A;  2BWE S;  3R66 C;  4MEL A;  4RM9 A;  4B6W A;  3MHS D;  2EKE C;  2KDB A;  3CF6 E;  3KVF B;  3PRE A;  2PE9 A;  2EMT A;  5IAA C;  3PGE A;  3ZRF A;  3VHT C;  2C7N B;  3JW0 X;  5G2N A;  3TBL D;  1P9D U;  2FCQ A;  2IYD B;  3B08 A;  2LRW A;  4MH0 E;  3A1Q B;  1E5W A;  2JWZ A;  4HWI B;  2IO0 B;  4PYZ A;  4DHZ B;  2AEH A;  2N7D A;  2DZI A;  1E7V A;  3I3T B;  3VDZ A;  3WAL A;  3VAW A;  3VXW A;  4HK2 A;  4FJV B;  4DXA B;  2D07 B;  2DAJ A;  2M1M A;  4IWQ A;  4AJY B;  3QJZ A;  5LXH A;  4ANX A;  1WGH A;  2L0T A;  2MW5 A;  2WDT B;  4KDL B;  2DZK A;  4HVB A;  3EC8 A;  4PS7 A;  3VTW A;  2ASQ A;  2MWS B;  2XBB C;  2PEA A;  3HM3 A;  5HKH A;  2O2V A;  3ECI A;  3L08 A;  2LI5 A;  4MSQ B;  3TCA A;  1NBF C;  4MGK E;  2JVC A;  4W9G A;  1KOT A;  4A20 A;  1TTN A;  2KZR A;  1GNU A;  3RCZ A;  1H8C A;  1Y8R C;  1S1Q B;  1Z5S B;  4FJZ A;  2UYZ B;  4TKN A;  4W9H A;  1U4A A;  4W9C A;  4BBN C;  1SGH A;  3DVN U;  5CX3 A;  2LXC A;  1WR1 A;  4FHK A;  2KDE B;  2FCS A;  4II2 B;  2CU1 A;  1WXM A;  1UBI A;  3OAW A;  5D7G A;  4NAW B;  4EUT A;  4B95 A;  1HE8 A;  3V61 A;  2KQ7 A;  5KHO A;  3NZU A;  2LVQ A;  2Z0D B;  3A9K B;  4JL9 A;  3NZS A;  2HTH A;  2KN5 A;  3CSF A;  4KZC A;  4WAA A;  3ZUN A;  2ZEQ A;  2IO2 B;  2ZNV B;  3APD A;  3ZNH B;  4KIK B;  5AZG A;  4CHK A;  3A9K A;  4IM2 A;  4MJS B;  4WJQ A;  3OLM D;  3W1S A;  4MGY E;  3AXC A;  2NBW B;  4MEM A;  3JSV B;  4EKU A;  1RFA A;  4WJN A;  3L13 A;  2DYO A;  1WX8 A;  2J0M A;  2PE6 B;  3B0A A;  4MJS A;  1R4M I;  1UGM A;  2FUH B;  4DHJ D;  1OEY A;  5DPR A;  3JSV A;  3QA8 A;  1WX7 A;  4IM3 A;  4IW0 A;  3RZW C;  1X1M A;  3IFW B;  1GG3 A;  2ZCC A;  2KKC A;  5TR5 A;  1OGW A;  2JZZ A;  4PS8 A;  5C23 A;  3EEC A;  3H1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...