3KUZA

Crystal structure of the ubiquitin like domain of plxnc1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QGTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the ubiquitin like domain of PLXNC1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Plexin-C1
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kuzA00
1RLFA 5KHOA 5AZGA 4TV3A 3EC8A 3KVFB 2RSUA 4PS3A 3X0WA 3NZUA 4DDID 3TJPA 2CHZA 4CHKA 1KOTA 2KQSA 3VTVA 4JGHB 3V6CB 2I1KA 1UBQA 1Z5SB 2YLMA 3HHMA 3PVLA 4G50A 4K81A 2CR5A 2MSED 3CMMB 3PS6A 3WALA 4IG7B 1YX6B 4HJKA 4HPMB 5JZEB 1GNUA 2KXJA 4G11A 2B3AA 4DK5A 2IO2B 1J8CA 2PE6B 2LRUA 4E71A 2CHXA 2BYFA 4PS8A 3V62A 4KIKA 2FAZA 4IWPA 4WJPA 3A1QA 2KZRA 2NPTA 2N1VA 3CF6E 3VTUA 4JLCA 1WR1A 1WXSA 2LASA 3RZFA 3SU8X 5HKHA 3L10B 5E6PA 2CKHB 4RM9A 2K6DB 4GN1A 2K8BA 5IAAC 5DPTA 4MM3A 2C60A 2IBIB 3WAOA 4EKUA 1RRBA 1WI0A 2O6VB 2AL6A 2M4NA 2L8JA 4M8NA 2FCNA 2MBHA 2KN5A 2D07B 4IW0A 4W9KA 4N9F4 1J19A 3WAPA 2C9WB 2KTFA 2GBNA 3WANA 4EEWA 4EZLA 1I42A 4W9CA 4XZ4A 3T8MA 4TQ0A 4GU2A 4IM2A 4X57B 4GDLB 4WJNA 3O65B 2LJ5A 3PTFC 3A33B 4JL9A 3IG3A 1ZKHA 2JRHA 3RZWC 1P1AA 4BOZB 3PGEA 3PT2B 2MP2A 2JT4B 3QC8B 4MDKE 3DVNU 4AWJA 2MLBA 3R7QA 2AWTA 2KX0A 2Z59B 2DYOA 2IZVB 4IUMB 1NI2A 2AYOB 2KWVB 5KHQA 1ZGUB 2WDTB 3VFKA 2OOBB 2KTRB 2Z0DB 2KDEB 2ZCCA 1TTNA 2LVOA 3RCZA 4G0NB 4J6IA 2KMCA 4ANXA 1WYWB 3LJ3A 4KDLB 1OGWA 2DAJA 2RPQA 3N30A 4BKSA 1D3ZA 2MBOA 4AP4C 3JVZX 3VH3B 4GDKA 3QHTA 1OEYJ 2A5UA 2FIDA 4EUTA 4DHZB 5D2MB 1OTRB 3H7SA 2BYEA 4EOYA 1S1QB 3A1QB 3H1UA 4KSKC 1UELA 4B6WA 4EZJA 3U8ZA 5JHAA 2KLCA 2IYDB 4ANWA 4LDTD 1GG3A 1E8XA 2V1YA 3L13A 2WX0A 3KUCB 4YL8A 3ZUNA 4BBNF 3VXWA 1A5RA 5AZFA 2L00B 2V3SA 3QWZB 2EKEC 2N9XA 3A4RA 3UQAA 2JVCA 3RD2A 2I1JA 2L05A 2KTRA 2DX5B 2D10A 4MELA 3RYTA 2KJ6A 3BINA 2MWSB 3ML9A 1YD8U 4BBNC 2C5LC 1VCBA 2GOWA 1TGZB 4DHJB 1OQYA 2N9EB 4BFRA 4WWOA 3R66C 3HK0A 3PLUA 1KM7A 1E5WA 3WIMA 3CSTA 1SE9A 2J0MA 3ZW3A 1H8CA 2LVPA 3UIPB 4BKSD 3LDZE 4BKGA 2KX3A 3M95A 4HK2A 2XBBC 2LXAA 3HIZA 3C0RB 3TIXA 2GBKA 1OEYA 2BKFA 3N3KB 4GMVA 4ZDVA 2M8SA 4GDLA 2WYQA 2ZPYA 2JPHA 4HLEA 1SGHA 4HDOA 4I6PA 1U4AA 2L76A 1WGGA 3JW0X 5J17A 1IPGA 5DCNA 2R2OA 1Q1OA 5D7GA 3EFUA 4FULA 4JQWC 2K8HA 4W9FA 2ZVNA 1Z2MA 2GMIC 3A9KA 2ASQA 4FN2A 4URKA 4NAWA 1F9JA 3QJZA 3QIJA 3OLMD 2O6VD 5DPWA 2JRIB 4FBJB 4MGYE 1WM3A 4TQ1A 2V4LA 3DBRI 2MCNB 4MJSB 2RGFA 4XC2A 2LD9A 3A4SC 2K8CA 2WX1A 4AUQC 4GSWA 2ZNVB 3RUIB 2D11A 1G6JA 4GIVA 2JZZA 4AJWA 4NQLB 2M1MA 3WAMA 1J0GA 1BT0A 2NPTB 4KZCA 5DPRA 5LXHA 1UZXB 1XT9B 2OJRA 4DHZE 1E8YA 2BWES 2ZJDA 1LQBA 4MSMB 3AXCA 2LVQA 4KSLC 1TBEA 3D32A 2JUOA 5CHVC 1SIFA 4MH0E 4W9DA 1P98A 2MW5A 4NAWB 3PRPB 1WX7A 3JSVA 2LUEA 1R4NI 4HPLB 1E7VA 4W9EA 4E3CA 1KLVA 2CU1A 5EDSA 2N1WA 1IP9A 1L2NA 2HD5B 1C3TA 1UGMA 3ZRFA 4LJPB 3VQIA 1WJUA 1WX9A 3AU5A 2NCNA 3DVGX 1WGDA 2L3ZA 3PV1A 4ZRIA 2KC2A 4GDKB 2XK5A 3A9JB 3MTNB 3VAWA 2KJRA 4A20A 2N7DA 2LRWA 4CO7A 3DVNV 3UGBB 4LDTB 4MGIE 2QHOA 3QX1A 4BVUC 2PEAA 1GC7A 1UH6A 4G3XB 2MP2B 1WGRA 2Y5BB 3DCGA 3QQ8B 4HWIB 4ICUA 3H7PA 2MBQA 4W9JA 4CYEA 2ZEQA 1E8WA 3ZTDA 3VDZA 1V5TA 4LCDE 2KKCA 1WE7A 3OJ3A 2KFKB 2KWUB 4MJSA 4WJOA 2HTHA 2L0FA 5J2RA 4DHJD 1WM2A 2KK8A 3KUZA 3TL5A 3PREA 2O6VA 1I35A 3DPDA 1GJZA 1ISNA 1GC6A 4HCPB 3B08A 3M63B 3A9JA 4PYZA 1R4MI 5CTRC 2KNBA 2C7NB 1V80A 4BOSC 1Q0WB 3DQVA 3VHTC 1WXVA 2YVCA 3U30A 4DBGA 4BKTA 3L16A 3TCAA 4F7ZA 3PHWB 3T9LA 4IC7B 2KDIA 3QAQA 2LZ6A 1WMHA 1V86A 2NVUI 2FNJB 3ZO5B 2EMTA 2MX2A 4KVGB 4DXAB 3VUXA 2K25A 5DPSA 3ZNGC 5LLIA 2FUHB 4E74A 2DYMA 5JHBA 1RFAA 3RT3B 3ENEA 3NS8A 3IHPC 2G4SA 3VUYA 4IWQA 4NJ6A 2J7QB 3ZLZA 2C7MB 5LXIB 1TZ1A 4HCNB 2LGYA 1L7YA 2LGXA 3PZDA 3U7DA 1V49A 4A3PA 5AZHA 4NQKE 1Q5WB 3ZNID 4GXBA 4MGZE 2N4FA 4RM8A 3M3JA 4XX5A 3APDA 2D2QA 3IVFA 2DAFA 3NY5A 3HM6X 5D6JB 4K1RB 3PLVA 4ANUA 3AU4A 5C1ZA 3APFA 1EF1A 2HJ8A 4M8MA 4FHJA 3WA0A 2DZMA 1WE6A 1WZ3A 1KJTA 2XK5B 2DHZA 4TKNA 5FR6A 1E90A 2ZZPB 3RULA 1NBFC 2MBEA 4LJOB 3I3TB 2MA9B 4K7SA 4FJYA 3IFWB 3DBLI 2ZCBA 3NHEB 3Q3FA 3ZNZB 1XD3B 3QARA 4EZKA 1WF9A 2PE9A 2IO1B 1CMXB 2NS5A 2KD0A 2BKRB 3NZSA 3OAWA 4HDQA 2JXXA 1WR6E 4DWFA 1AARA 3W1YA 3KH0A 4II2B 4IM3A 1WX8A 4NNJB 1YQBA 4FADA 3K9OB 3Q3JA 4GOCA 1K8RB 4KZ0A 3ZKJC 2KLGA 3GOEA 3KYCD 2L0TA 2O2VA 2G3QB 4PS7A 2UYZB 1LXDA 4FLHA 1WJNA 3K9PB 1WY8A 3DVGY 4NY0A 4OVVA 2NBVB 5CHWA 1WZ0A 4I6NB 3PHXB 2REXA 3BY4B 1YJ1A 2J0JA 2EMSA 1M94A 4I6LB 1LFDA 4FA6A 2ZPNA 5L95C 1YIWA 1WGHA 4B9KA 3ZVVA 3B1LX 2FCSA 2M17A 3DBHI 4FHKA 5G2NA 4TUUA 3JSVB 2AL3A 4AOFA 3A9KB 1VD2A 2BGFA 2DYBA 2KJHB 4KV2A 2CHWA 4EFOA 2DZJA 3V60A 4A3OA 3DOWA 2XEWA 1MG8A 1EUVB 3S2AA 3X23A 1JRUA 2JZ3B 2O2VB 1WJ4A 5CX3A 3CSFA 4K7WA 4PYUA 2PPHA 1XQQA 3ML8A 3SHQA 1HE8A 2NBUA 2MBBB 4HXDA 3N32A 3PRZA 2NBWB 2CS4A 2KDBA 2MQJA 4GB9A 2KDFB 2KFJA 2VRRB 1V9JA 1WH3A 2IO0B 3AULA 2NR2A 1WGYA 1Y8RC 2ZVOA 4HVBA 2BPSA 1LM8B 2J0KA 5D94A 1V6EA 3L17A 3ZNHB 3HM3A 3VTWA 5AEKB 2UWQA 1C1YB 3EHVA 1WFYA 1V5OA 3JYUA 4W9HA 4FJZA 4ZRKA 2K1FA 2C7HA 2G45B 4WWNA 1S3SG 2IO3B 5JH5C 4NJ7A 1WXAA 4WJQA 3ZTCA 3V6EB 2DZIA 4GGQA 4FJVB 1T0YA 2PJHA 1YX5B 2FCMA 2IY0B 2KANA 3L54A 5G55A 3H7PB 4B95A 3ZDMC 2HE7A 4F1SA 2IY1B 3QA8A 2KO3A 4ZRJA 3AI5A 4MGKE 2RR9A 4K7UA 3ZDTA 2MRPA 3UF8A 3DBSA 1V2YA 1NDDA 3H9DA 1H4RA 3VH4B 2N9PC 3VUWA 4II3B 4OVUA 2W9NA 1E8ZA 5J18A 3TBLD 1RAXA 5GMVA 5E6NA 2JWZA 5BO4B 2DZKA 3KYDD 4WAAA 2FCQA 2BF8B 1WRDB 4KDIC 4IM0A 2GBRA 3KW5B 3MJWA 3PSEB 4RMAA 4ANVA 3TMPB 4DDGD 2KOXA 1FXTB 2RD0A 3OJ4B 3QCAA 3ZIMA 2AEHA 2L7RA 2FIFA 3H6NA 3L0WB 2KQ7A 3EECA 4KIKB 5TR5A 1E7UA 4WQOB 4IWOA 3W1SA 4W9IA 4W9LA 2GBJA 2KVRA 4WWPA 1WJ6A 4JIOU 3B0AA 5L83A 3PRMB 2DENB 2GBMA 3ONSA 5C23A 1PQSA 3SD5A 1WMHB 3ZRCA 2WWZA 3L08A 2KWCA 3V61A 3UQBA 2G4DB 3IBEA 4W9GA 3M62B 1UD7A 3P2BA 4AJYB 5IA7A 3DDCB 2D3GA 1V81A 2Z0EB 3SDLC 3QK0A 4MSQB 2BWFA 3MHSD 1P3QU 4ICVA 3W1SC 1GUAB 1X1MA 4ZYNA 2N7EA 3PPAA 1UBIA 3GZNI 2KHWB 3VVWB 4ASWC 1P0RA 2BYVE 1WXMA 4P7IA 2K39A 2KFKA 2ZNVC 2LWPA 3UIOB 2LXCA 5CHFA 2JY6A 2K6QA 3APCA 2A4ZA 2LGDA 4M0WB 1ZW7A 4MEMA 1IYFA 3KUDB 3NOBA 4NPNA 5E6OA 3ALBA 2R2QA 4F8CB 1P9DU 1EO6A 3UINB 2KMAA 2KC1A 2LI5A 2M0XA 3ECIA 3R7RA 2JF5A 1QZEA 3R3MA 1WIAA 1EF5A
chains in the Genus database with same CATH superfamily
1UUPA 5AZGA 4TV3A 3EC8A 3Q3MC 4DDID 3I5JC 1KOTA 2KQSA 2KVZA 1DGJA 3VTVA 2I1KA 1UBQA 4US9A 3AMZA 1Z5SB 3PVLA 3HHMA 2WU5B 3AE6B 3WALA 1YX6B 1XLOA 4LNIA 2LRUA 3FILA 2BYFA 3DBLB 4PS8A 2PVGC 1DYQA 5H92C 2YEPF 3A1QA 2NPTA 2RPVA 4HRSA 3L10B 1JWAD 1V97A 2K8BA 5IAAC 2K22A 3AV8A 2L8JA 3T3OA 2FCNA 5IO9A 1MHHE 3AE8B 1VRAB 2GRIA 2LJ5A 4JL9A 3IG3A 3PT2B 2MP2A 3RNAC 3HVZA 1FCLA 1FM0D 2DYOA 2L32A 4XDCA 1NI2A 1I4QA 1QILA 1LO5D 1ZGUB 2WXKA 3VFKA 3OWEB 2CJOA 1R4MB 2QC8A 2AQ3B 2V3NA 4G0NB 4J6IA 1M4VA 1OGWA 1GAQB 1WYGA 2A5UA 5D2MB 4EZJA 5JHAA 3H1UA 1I4GA 1FFVA 1STEA 1GG3A 3L13A 2WX0A 4YL8A 2MJDA 4BBNF 3N20C 5D3DA 2V3SA 3RD2A 2DX5B 2D10A 2KN4A 2QJLA 3ML9A 2L1AA 2GOWA 1VLBA 1XLQA 1E6EB 4RNAA 3BYYB 1KM7A 2TSSA 1H8CA 2YEPB 3M95A 3TIXA 2GBKA 2BKFA 4ZDVA 2M8SA 1SGHA 4I6PA 4DXGA 5J17A 1IPGA 1WRIA 1SE4A 3BYTB 1L0VB 1XCQL 2K8HA 2XNAC 2GMIC 3A9KA 4FN2A 1MFWA 1F9JA 3QJZA 1QOGA 5DPWA 3RFZB 2V4LA 3DBRI 4JPSA 3DWMA 3ZJUA 4C80A 2D11A 1QLBB 2M1MA 3AEEB 1BT0A 5LXHA 3TEWA 1E8YA 1JWMD 2LVQA 2JUOA 1SIFA 1VZ7A 4A55A 3MJ5A 3JSVA 1R4NI 2N1WA 1D5XC 2AQ1B 3FKYA 1L2NA 4YSXB 2HD5B 1C3TA 1UGMA 5BYRA 1Y56A 1FCCC 3Q3OC 2NCNA 2SAKA 2WGSA 2Q5WD 3N1YC 3SFEB 2KC2A 2XK5A 3VAWA 2KJRA 3RNEC 3B2GA 4A20A 5BMHA 3W5UB 3QX1A 2PEAA 1GC7A 3DWGC 3N9YC 4HWIB 1KTKA 3H7PA 4WQMA 3SR6A 4W9JA 2ZEQA 1D5ZC 1E8WA 5HI1A 4XWWA 1V5TA 3TUOA 3KQ4A 2KWUB 2HTHA 5J2RA 2KK8A 1KH0A 4C4VB 3B08A 3TEYA 1R4MI 3ZQ4A 3BVMA 3U30A 2PLPA 4BKTA 3TCAA 1WGKA 2LZ6A 1V86A 2BTEA 2ACZB 3P42A 4RGOS 3ZNGC 1TYGB 3NS8A 3VUYA 4IWQA 4NJ6A 2C7MB 5LXIB 1UF0A 4OZCA 4HCNB 2WXPA 3U7DA 2K9XA 4C7YA 3RNFC 1WWTA 2N4FA 1WXQA 2LHEA 2WHIA 2WXQA 3PLVA 5C1ZA 2HJ8A 4M8MA 4PK1A 4FHJA 3WA0A 1T5XD 1E90A 2ZZPB 4LJOB 3I3TB 2ZCBA 1V8CA 2NS5A 1HQRD 3OAWA 4WH4A 4HDQA 3P1MA 2CJNA 2AQ2B 3I57A 1WX8A 1YQBA 1HXYD 4HPPA 3K9OB 3Q3JA 3ZKJC 1A70A 2KLGA 3KYCD 2L0TA 2MJEA 2XN9C 2Y5PA 2BB5A 1E7PB 4NY0A 4OVVA 4RFBA 1PGXA 1WZ0A 3GE8C 3AEFB 4I6LB 4FA6A 3ZVVA 3C8YA 3AEBB 1EM7A 1C4CA 2AL3A 2BQQA 3A9KB 2WS3B 4N6EB 2DZJA 3V60A 1KLGD 3DOWA 2FUG1 1IBXB 1EUVB 1N5WA 1JRUA 5CX3A 3AH7A 4USAA 3NJTA 3PRZA 2NBWB 2CS4A 5EE3A 1B1ZA 1RWSA 1F2RI 2PW9A 1L4ZB 1LM8B 2RDBC 1V6EA 5AEKB 3N1XC 1C1YB 3EHVA 4WWNA 3UI3A 1HA5A 4WJQA 2D5GA 2DZIA 2V4IB 4NAMA 3SFDB 2KANA 2IY0B 1CZPA 4B95A 3ZDMC 4OW0A 2HE7A 3NVWA 2IY1B 1C4AA 2BB6A 3AI5A 2BBCA 1RM6C 2MRPA 1H4RA 3VH4B 1JQ4A 4II3B 1DOYA 4OVUA 5BO4B 1SE3A 1SB3C 2FCQA 4DDGD 4ANVA 3AE1B 2INPE 2L7RA 4FXCA 4KIKB 1PUTA 2Y5CA 1Q10A 3P4RB 3B0AA 3RNGC 3PRMB 1N6ZA 3E56A 2DENB 3ONSA 3ZRCA 4S0RA 3L08A 3GP7A 1TY2A 2HJ1A 3P2BA 5IA7A 2D3GA 2Z0EB 3SDLC 3IT4B 1GUAB 1I4PA 1FIQA 3PPAA 1JWSD 3RMKC 3J9CA 4C00A 3Q3NC 2QCZA 2K39A 5LNK1 5CHFA 2LGDA 1ZW7A 2INCC 3NOBA 4F8CB 1EO6A 1FXAA 2DNFA 2LI5A 4HROA 2WDRB 3PLUA 1SBBB 2INNE 2JSVX 4HK2A 1RLFA 2EKIA 1HZ5A 1JCKB 3Q8CA 1L6UA 5HHDG 4G50A 4K81A 1SF0A 2GB1A 3C19A 1FRRA 3V3XA 3GE3C 3AE5B 2IO2B 1J8CA 4L2YA 4E71A 4YSZB 2FAZA 4C7ZA 1ACCA 3VTUA 3CF6E 4JLCA 1WR1A 3SU8X 3RPFC 2CKHB 1FD6A 5DPTA 4MM3A 1R4NB 2IBIB 1RRBA 1XEEA 2O6VB 2Z8LA 3L4PA 4IW0A 1J19A 3WAPA 2GBNA 3WANA 3KWVA 4XZ4A 2WXGA 2Y3AA 1ZKHA 2JRHA 4MDKE 2ON8A 3WCQA 2AWTA 2ZW1A 2KX0A 2L83A 2Z59B 2IZVB 4IUMB 2KWVB 4AQ7A 2OOBB 2KTRB 2Z0DB 2KDEB 2LVOA 2IPKD 4ANXA 3LJ3A 4KDLB 2RPQA 3NVYA 2WQYB 1D3ZA 4K3BA 4AP4C 3JVZX 5E6JA 3VH3B 1OEYJ 4HKZE 4EUTA 1ZDXA 1VZ8A 4B6WA 3U8ZA 2KLCA 2IYDB 3KUCB 3VXWA 1A5RA 1TS3A 2EKEC 4RGNA 4ZHOA 2JVCA 5G5GA 4WAFA 3ZXRA 1YD8U 1VCBA 1TGZB 1OQYA 3R2TA 4WWOA 3R66C 3MHZA 2WU2B 3HK0A 1E5WA 1XCTL 1L5PA 4HJGE 1DOXA 2LXAA 2WYQA 3AN1A 3O13A 4HDOA 1U4AA 3JW0X 3TEZA 1J7CA 5DCNA 4D2KA 4FULA 4W9FA 2ZVNA 1ZUD2 2GLSA 2I38A 3BWUD 2O6VD 3N1ZC 1FMAD 4FBJB 4HEA1 4TQ1A 2MCNB 4XC2A 1ET9A 3A4SC 2PVOD 4AUQC 1C4PA 1G6JA 1IGDA 1J0GA 3EA6A 5C3JB 1XT9B 2ZJDA 3AXCA 1F52A 2WLBA 4KSLC 1TBEA 3D32A 4MH0E 4W9DA 1ZP0B 4NAWB 3ZJTA 4HPLB 5IP4D 1KLVA 1CK1A 3U7ZA 5EDSA 2J4XA 4AS1A 4JWSC 4LJPB 3BZDB 1WJUA 1WX9A 1BUIC 3DVGX 1WGDA 1T6BX 3PV1A 4H2AA 4M01A 3A9JB 5D3IB 4XDDA 4YT0B 3UGBB 1YNTE 3P63A 1UH6A 4G3XB 3DCGA 4ICUA 1YJJA 1JALA 2JX5A 4P16A 3VDZA 4LCDE 2G9HD 2KKCA 3AE9B 3DBHB 1WM2A 3KUZA 4PT5A 3PREA 1I35A 3DPDA 1GJZA 2D3CA 2MEKA 1GC6A 1J7BA 3M63B 2KNBA 1Q0WB 3DQVA 1WXVA 3HUIA 3PHWB 3T9LA 2PKOA 3OG5A 1WMHA 2FNJB 3AEDB 4L1BA 4IDIA 4NJCA 1MHXA 1EU3A 3ZLZA 3ZJVA 4IKGA 5HG2A 1F2RC 3NS1A 1D4BA 2LGXA 4ITKA 3ZNID 3CIRB 1KF6B 3IVFA 4P1BC 4KGRA 3NY5A 3HM6X 5D6JB 4K1RB 3AU4A 1EF1A 2XK5B 1L4DB 1NBFC 3TEXA 1ZXIA 3QARA 2PE9A 2IO1B 5G5HA 2KD0A 2BKRB 3NZSA 1TS2A 2JXXA 1WR6E 3NZ3A 2MH7A 3W1YA 2DBYA 3KH0A 4FADA 2BVCA 1FNUA 1XO3A 1FRDA 1LXDA 1YN3A 4FLHA 1WY8A 1KLUD 2NBVB 1FEHA 1YMHE 3PHXB 3Q14C 2FBWB 1YJ1A 3FAHA 1OQQA 2PMVA 3U4EG 2KYWA 4B0EA 2LGIA 2M17A 5G2NA 3BK1A 3URYA 2PIAA 4KKIA 4AOFA 2E3TA 1PDXA 4KV2A 3PZ7A 2V9HA 4WURA 2XEWA 3B9JA 2JXTA 1QF6A 2O2VB 1VR9A 4PYUA 1XQQA 3ML8A 1HE8A 2DWQA 4HXDA 4RGMA 3N32A 1PGAA 1GB4A 1QOAA 3AULA 2NR2A 1JMLA 1Y8RC 2ZVOA 3DBRB 1TT5B 3HM3A 1SSNA 4W9HA 2DLBA 2IGHA 4ZRKA 3RN9C 2K1FA 1T0RC 2C7HA 2G45B 1P7EA 3V6EB 1L6VA 1ESFA 3NVZA 3B2FA 1QQRA 2ICIA 5G55A 1CQVA 5IOIA 4F1SA 3CWIA 3ZDTA 2FE8A 3VUWA 1B9RA 3LXFA 1SXTA 5GMVA 5E6NA 2JWZA 2N9KA 1SJED 2JQRB 4IM0A 4LNOA 3OJ4B 3QCAA 2LGSA 3ZIMA 2FIFA 3AE2B 4BAXA 2KQ7A 3Q6BA 1F1HA 4IWOA 2QMTA 4S17A 4KGSA 3SD5A 2KWCA 3M62B 2J42A 1V81A 2BWFA 4ICVA 1MVKA 4C4VA 4P7IA 2LWPA 2K6QA 3IAS1 2WXFA 2R2QA 1C76A 1FO4A 2KMAA 2RMMA 1SEBD 1PFDA 1NEKB 4A8XC 3R7RA 3R3MA 2IGDA 1EF5A 5KHOA 2KDMA 3KVFB 3X0WA 2IDYA 2OJWA 2G1EA 3V6CB 2CR5A 4CQNA 3CMMB 3PS6A 4IG7B 4G11A 2B3AA 4DK5A 2CHXA 4KIKA 4IWPA 2WNMA 1OFFA 2KZRA 3AB5A 2LASA 4RM9A 4GN1A 2LEKA 5TSSA 2C60A 3WAOA 2D3AA 4EKUA 2RDHA 2AL6A 3V05A 2M4NA 4M8NA 1MG4A 2MBHA 3HRDD 1UWXA 2KN5A 2D07B 4N9F4 2C9WB 3MFGA 4EEWA 1I42A 1FPYA 4W9CA 4TQ0A 5FK9C 4IM2A 4X57B 4GDLB 2M19A 2KT7A 2VZKD 4YWGG 3A33B 2K5PA 1P1AA 2CU3A 2JT4B 5GXGB 3RNBC 2QEJC 2MLBA 3R7QA 4MT5A 1YOVB 1CJEA 2WDTB 2ZCCA 1TTNA 2W82A 3DHIC 2KMCA 1YQ3B 2KWDA 2BS4B 3N30A 3VRAB 4BKSA 4M00A 2MBOA 4GDKA 3QHTA 1EU4A 2FIDA 2BYEA 1IBXA 1UELA 1I4RA 1KRHA 2V1YA 2BT6A 2K0PA 3ZUNA 5BMIA 2MHJA 5AZFA 2L00B 3QWZB 3UQAA 3A4RA 2I1JA 4MELA 2KJ6A 3IXSA 2MWSB 4BBNC 2C5LC 1NYRA 2N9EB 1FXIA 3Q8FA 3E9SA 1FNVA 1MPEA 3SEBA 3LDZE 3UIPB 3HIZA 3C0RB 1OEYA 3N3KB 2ZPYA 3AM9A 4C56C 4LK0M 2R2OA 1Q1OA 5D7GA 3EFUA 2WDVB 1Z2MA 2ASQA 2N0SB 3QIJA 1N62A 4KGTA 2JRIB 4LNNA 1WM3A 3RNCC 1JROA 4MJSB 1TKEA 2J53A 2K8CA 4GSWA 3FC4A 5BMGA 2ZNVB 4AJWA 4NQLB 3WAMA 1UWMA 3MC0B 3RI7C 4K3CA 2EELA 2KAJA 3PRPB 4ZRQA 2LUEA 2AX5A 4RGTA 4W9EA 1E7VA 5T8IA 1FNWA 3ZXVA 4M02A 1TS5A 1HTQA 1BXTA 1EWCA 4A6QA 2LUMA 4EE2A 3R2IA 4ZRIA 4GDKB 3MTNB 1PGBA 2LRWA 3DVNV 4MGIE 2QHOA 2NTSA 1WGRA 2Y5BB 3QQ8B 4RF0A 2LFIA 3IAM1 4CYEA 2BW2A 4JWUC 3OJ3A 5IKCM 3TL5A 1ISNA 2GI9A 3NUHB 3GB1A 2C7NB 5BYSA 2L52A 4BOSC 3BVZA 1I4XA 2B76B 2W54A 3NRZA 4DBGA 2WXLA 4IC7B 2KDIA 3QAQA 3PZ8A 3ZO5B 3Q8BA 2EMTA 2MX2A 4KVGB 4DXAB 1SJHD 2K25A 5DPSA 5LLIA 4E74A 2DYMA 5JHBA 2J7QB 3W2DA 2HTME 1ET6A 3PZDA 1LGRA 3P4PB 1Q5WB 1SE2A 4RM8A 4XX5A 3M3JA 1ROEA 3VRBB 3APFA 3Q8AA 2DZMA 1WE6A 5FR6A 1KJTA 1NI3A 4OVZA 4BZAA 2MBEA 5AUKA 2MA9B 4FJYA 4Q2JA 3NHEB 3Q3FA 1XD3B 4KX6B 1KFYB 1TKGA 1K8RB 1V1OA 4KZ0A 1N63A 3GOEA 3T3NA 2G3QB 2UYZB 4LTUA 3DVGY 5HFYA 4LNKA 1K53A 2REXA 4R3DA 1M94A 1VZ6A 5L95C 1WGHA 3B1LX 4FHKA 4OZBA 4ZRPA 4OHJA 1TKYA 1NVID 1VD2A 2BGFA 4RCOA 2DYBA 3IT6B 2CHWA 1HZ6A 4EFOA 1QT9A 3LYYA 2I2YA 3X23A 2LJIA 2QDFA 4J3OD 4REZA 1WJ4A 1NYQA 3CSFA 2PPHA 2NBUA 2KDBA 2KDFB 2VRRB 1SIJA 1WH3A 1JRPA 1WGYA 4HVBA 2BPSA 2LHDA 4P6VF 3ZNHB 3VTWA 2UWQA 3DHHC 1WFYA 3I9V1 3JYUA 1S3SG 3KLSX 2IO3B 5JH5C 3ZTCA 2NMQA 2VZKB 2W55A 2WXJA 4P1CC 4FJVB 1T0YA 2PJHA 1YX5B 4RH6A 3H7PB 1E0ZA 3QA8A 2KO3A 3MP9A 1F0ZA 4MGKE 3DBSA 4KKJA 3H9DA 2N9PC 3P4QB 3U2SC 3ETRA 4A90A 1E8ZA 2ZW0A 2DZKA 3KYDD 3LB8C 1JW9D 2BF8B 1WSPA 2GBRA 3MJWA 3KWLA 2M0AA 3TMPB 2KOXA 1FXTB 2R61A 3EECA 3W5VB 5TR5A 4WQOB 4W9LA 3FILB 3Q8EA 4JIOU 4L23A 5L83A 2WWZA 4AJYB 2LMCA 1GPXA 1XLPA 3QK0A 3W1SC 1X1MA 2J52A 1UBIA 3VVWB 4ASWC 2BYVE 1HEZE 1WXMA 4ZYSA 1TIFA 1AYFA 2KFKA 3APCA 4M0WB 4N58A 4ARCA 5EE9A 1J7AA 3ALBA 3EUB2 1OQRA 1P9DU 3UINB 2KC1A 2M0XA 3ECIA 2JF5A 4TKNA 1WIAA 2KMMA 2ONQA 3H8HA 2RSUA 4PS3A 3NZUA 3U52E 3TJPA 2CHZA 1T0SC 4CHKA 1D5MC 1GOZA 4JGHB 4DQOC 1TY0A 2YLMA 2MSED 4YTPB 3AEGB 4UDUC 4HJKA 4HPMB 5JZEB 1GNUA 2KXJA 4M0WA 1UGJA 2WXOA 2PE6B 3MC8A 3V62A 4WJPA 2N1VA 2HDEA 3Q69A 1WXSA 3P4SB 3RZFA 5HKHA 5E6PA 2K6DB 1WI0A 1C77A 2BYTA 2JWUA 3ZGZA 1NENB 4W9KA 2KTFA 4EZLA 3T8MA 4GU2A 2WXIA 4WJNA 3O65B 3PTFC 1F77A 3RZWC 4BOZB 3PGEA 3NVVA 3QC8B 2X38A 3DVNU 4AWJA 2BS2B 1AN8A 2AYOB 5KHQA 1TJEA 1ZOYB 4MH8A 3RCZA 1UNSA 1WYWB 2DAJA 4IOIE 2KQ4X 4NZLB 2QILA 1DOIA 4DHZB 1OTRB 3H7SA 4EOYA 1S1QB 3A1QB 4KSKC 2IJ0A 4ANWA 4LDTD 2VH1A 1E8XA 1JWBD 2N9XA 1VJKA 1MI0A 2V3PA 2L05A 2KTRA 2WP9B 1YJIA 3RYTA 1TS4A 3BINA 4DHJB 4BFRA 3WIMA 3CSTA 1SE9A 2J0MA 5BYQA 3ZW3A 2LVPA 4BKGA 4BKSD 2KX3A 2XBBC 1ZE3D 1VDVA 4GMVA 4GDLA 4WWMA 5JXVA 2D3BA 2JPHA 4HLEA 2L76A 1WGGA 1C78A 1V1PB 2INDC 3NG0A 1XLNA 4JQWC 4URKA 1EWYC 1IGCA 4ARIA 4NAWA 3OLMD 2M56B 4MGYE 1HTOA 2V0GA 3PO0A 2RGFA 1RYJA 2LD9A 1QOBA 2WX1A 2RDGA 3RUIB 4GIVA 2JZZA 3AE7B 5DPRA 2NPTB 4KZCA 1UZXB 2KACA 2OJRA 4DHZE 4B0MA 2BWES 1LQBA 4MSMB 1ZDVA 3ZYYX 5CHVC 1P98A 2MW5A 1WX7A 4XE0A 2WDQB 1ZPSA 1YN4A 4E3CA 1PYWD 2CU1A 1IP9A 4GLSC 3ZRFA 3VQIA 1TZOA 3AU5A 2L3ZA 2UU7A 1D6EC 2N7DA 2QSDA 2X8XX 4XGAB 4CO7A 4LDTB 2PTLA 3Q2AC 4BVUC 5FR3A 3VR9B 2MP2B 1IUEA 3BVGA 5IN7A 2MBQA 1BMLC 3ZTDA 1YN5A 2JYEA 2W3RA 3GS2A 1WE7A 2JU6X 2KFKB 4WJOA 4MJSA 2L0FA 4DHJD 2O6VA 3GZNB 4HCPB 1T0QC 3AE4B 4MM3B 3A9JA 4PYZA 5CTRC 3BK2A 1V80A 2JYTA 3VHTC 2YVCA 1QOFA 3L16A 4F7ZA 1MJDA 1AWDA 2NVUI 3VUXA 2W3SA 2FUHB 1RFAA 3RT3B 3ENEA 3IHPC 4N59A 2G4SA 4ZOHC 1N61A 1TZ1A 3I63C 1L7YA 2LGYA 4A3PA 1V49A 5AZHA 4ACFA 2QIEB 4NQKE 4YSYB 4OZAA 4GXBA 4MGZE 3APDA 2D2QA 3ABVB 4XWTA 2DAFA 2WXRA 4YXDB 2WXNA 4ANUA 4YTMB 3AEAB 1WZ3A 2DHZA 3R8BA 3AECB 3RULA 4K7SA 1K51A 1I7HA 3DBLI 3IFWB 4EZKA 1WF9A 1CMXB 1K50A 5EE0A 4DWFA 3MC9A 5FKAC 4QAYA 1ZXHA 1AARA 4LLGM 4II2B 4YTNB 4IM3A 4NNJB 4GOCA 5C2TB 2O2VA 3EGRA 4PS7A 2H89B 4O1NA 1WJNA 3K9PB 5CHWA 1V1PA 2N9LA 4I6NB 4JE3B 1QKZA 3BY4B 2J0JA 2EMSA 4ZHPA 1LFDA 1N60A 2ZPNA 1L0YB 4MACA 1YIWA 4B9KA 3TSSA 2FCSA 2MJ3A 3DBHI 4TUUA 2E6XA 3JSVB 1XF5L 2KJHB 4TSSA 4A3OA 2OEDA 1MG8A 4HKQA 3S2AA 2OHFA 4TMAB 3BIID 2JZ3B 3W9CB 4K7WA 3SHQA 4LNFA 2MBBB 1C79A 2K3UA 1JWUD 2MQJA 4GB9A 3AE3B 2KFJA 1V9JA 2IO0B 2J0KA 5D94A 3L17A 1RFKA 3HVDA 1FFUA 1K52A 5EE1A 1V5OA 2WXHA 4FJZA 4NJ7A 1WXAA 4GGQA 2FCMA 3L54A 5AUIA 5I4DA 2IGGA 1I4HA 4ZRJA 2RR9A 4K7UA 1ENFA 2BS3B 3UF8A 1V2YA 1NDDA 2SEBD 5J18A 2W9NA 3TBLD 1RAXA 3DHGC 4US8A 4JX1C 4WAAA 4RF1A 1WRDB 4KDIC 3PSEB 3KW5B 4RMAA 4DXFA 1T3QA 2RD0A 2H88B 2AEHA 3H6NA 1XXGA 3L0WB 2WXMA 1C9FA 2JZPA 1E7UA 3W1SA 4W9IA 4WWPA 2GBJA 1P7FA 2KVRA 1WJ6A 1R7SA 2GBMA 5H8YE 5C23A 1PQSA 1N5XA 4XYCA 1WMHB 3V61A 1YQ4B 2G4DB 3IBEA 4W9GA 3UQBA 1UD7A 3DDCB 4A9AA 4MSQB 3MHSD 1P3QU 3VR8B 4ZYNA 2N7EA 2NTTA 2VH2A 3GZNI 2KHWB 3EFCA 1P0RA 1AW7A 2ZNVC 3UIOB 1E9MA 2LXCA 2JY6A 2A4ZA 4WIPA 4MEMA 1IYFA 1L0XB 3KUDB 5E6OA 4NPNA 2N7JA 1GB1A 1E10A 5MPOA 1QZEA 3ZNZB
chains in the Genus database with same CATH topology
1RLFA 5KHOA 5AZGA 4TV3A 3EC8A 3KVFB 2RSUA 4PS3A 3X0WA 3NZUA 4DDID 3TJPA 2CHZA 4CHKA 1KOTA 2KQSA 3VTVA 4JGHB 3V6CB 2I1KA 1UBQA 1Z5SB 2YLMA 3HHMA 3PVLA 4G50A 4K81A 2CR5A 2MSED 3CMMB 3PS6A 3WALA 4IG7B 1YX6B 4HJKA 4HPMB 5JZEB 1GNUA 2KXJA 4G11A 2B3AA 4DK5A 2IO2B 1J8CA 2PE6B 2LRUA 4E71A 2CHXA 2BYFA 4PS8A 3V62A 4KIKA 2FAZA 4IWPA 4WJPA 3A1QA 2KZRA 2NPTA 2N1VA 3CF6E 3VTUA 4JLCA 1WR1A 1WXSA 2LASA 3RZFA 3SU8X 5HKHA 3L10B 5E6PA 2CKHB 4RM9A 2K6DB 4GN1A 2K8BA 5IAAC 5DPTA 4MM3A 2C60A 2IBIB 3WAOA 4EKUA 1RRBA 1WI0A 2O6VB 2AL6A 2M4NA 2L8JA 4M8NA 2FCNA 2MBHA 2KN5A 2D07B 4IW0A 4W9KA 4N9F4 1J19A 3WAPA 2C9WB 2KTFA 2GBNA 3WANA 4EEWA 4EZLA 1I42A 4W9CA 4XZ4A 3T8MA 4TQ0A 4GU2A 4IM2A 4X57B 4GDLB 4WJNA 3O65B 2LJ5A 3PTFC 3A33B 4JL9A 3IG3A 1ZKHA 2JRHA 3RZWC 1P1AA 4BOZB 3PGEA 3PT2B 2MP2A 2JT4B 3QC8B 4MDKE 3DVNU 4AWJA 2MLBA 3R7QA 2AWTA 2KX0A 2Z59B 2DYOA 2IZVB 4IUMB 1NI2A 2AYOB 2KWVB 5KHQA 1ZGUB 2WDTB 3VFKA 2OOBB 2KTRB 2Z0DB 2KDEB 2ZCCA 1TTNA 2LVOA 3RCZA 4G0NB 4J6IA 2KMCA 4ANXA 1WYWB 3LJ3A 4KDLB 1OGWA 2DAJA 2RPQA 3N30A 4BKSA 1D3ZA 2MBOA 4AP4C 3JVZX 3VH3B 4GDKA 3QHTA 1OEYJ 2A5UA 2FIDA 4EUTA 4DHZB 5D2MB 1OTRB 3H7SA 2BYEA 4EOYA 1S1QB 3A1QB 3H1UA 4KSKC 1UELA 4B6WA 4EZJA 3U8ZA 5JHAA 2KLCA 2IYDB 4ANWA 4LDTD 1GG3A 1E8XA 2V1YA 3L13A 2WX0A 3KUCB 4YL8A 3ZUNA 4BBNF 3VXWA 1A5RA 5AZFA 2L00B 2V3SA 3QWZB 2EKEC 2N9XA 3A4RA 3UQAA 2JVCA 3RD2A 2I1JA 2L05A 2KTRA 2DX5B 2D10A 4MELA 3RYTA 2KJ6A 3BINA 2MWSB 3ML9A 1YD8U 4BBNC 2C5LC 1VCBA 2GOWA 1TGZB 4DHJB 1OQYA 2N9EB 4BFRA 4WWOA 3R66C 3HK0A 3PLUA 1KM7A 1E5WA 3WIMA 3CSTA 1SE9A 2J0MA 3ZW3A 1H8CA 2LVPA 3UIPB 4BKSD 3LDZE 4BKGA 2KX3A 3M95A 4HK2A 2XBBC 2LXAA 3HIZA 3C0RB 3TIXA 2GBKA 1OEYA 2BKFA 3N3KB 4GMVA 4ZDVA 2M8SA 4GDLA 2WYQA 2ZPYA 2JPHA 4HLEA 1SGHA 4HDOA 4I6PA 1U4AA 2L76A 1WGGA 3JW0X 5J17A 1IPGA 5DCNA 2R2OA 1Q1OA 5D7GA 3EFUA 4FULA 4JQWC 2K8HA 4W9FA 2ZVNA 1Z2MA 2GMIC 3A9KA 2ASQA 4FN2A 4URKA 4NAWA 1F9JA 3QJZA 3QIJA 3OLMD 2O6VD 5DPWA 2JRIB 4FBJB 4MGYE 1WM3A 4TQ1A 2V4LA 3DBRI 2MCNB 4MJSB 2RGFA 4XC2A 2LD9A 3A4SC 2K8CA 2WX1A 4AUQC 4GSWA 2ZNVB 3RUIB 2D11A 1G6JA 4GIVA 2JZZA 4AJWA 4NQLB 2M1MA 3WAMA 1J0GA 1BT0A 2NPTB 4KZCA 5DPRA 5LXHA 1UZXB 1XT9B 2OJRA 4DHZE 1E8YA 2BWES 2ZJDA 1LQBA 4MSMB 3AXCA 2LVQA 4KSLC 1TBEA 3D32A 2JUOA 5CHVC 1SIFA 4MH0E 4W9DA 1P98A 2MW5A 4NAWB 3PRPB 1WX7A 3JSVA 2LUEA 1R4NI 4HPLB 1E7VA 4W9EA 4E3CA 1KLVA 2CU1A 5EDSA 2N1WA 1IP9A 1L2NA 2HD5B 1C3TA 1UGMA 3ZRFA 4LJPB 3VQIA 1WJUA 1WX9A 3AU5A 2NCNA 3DVGX 1WGDA 2L3ZA 3PV1A 4ZRIA 2KC2A 4GDKB 2XK5A 3A9JB 3MTNB 3VAWA 2KJRA 4A20A 2N7DA 2LRWA 4CO7A 3DVNV 3UGBB 4LDTB 4MGIE 2QHOA 3QX1A 4BVUC 2PEAA 1GC7A 1UH6A 4G3XB 2MP2B 1WGRA 2Y5BB 3DCGA 3QQ8B 4HWIB 4ICUA 3H7PA 2MBQA 4W9JA 4CYEA 2ZEQA 1E8WA 3ZTDA 3VDZA 1V5TA 4LCDE 2KKCA 1WE7A 3OJ3A 2KFKB 2KWUB 4MJSA 4WJOA 2HTHA 2L0FA 5J2RA 4DHJD 1WM2A 2KK8A 3KUZA 3TL5A 3PREA 2O6VA 1I35A 3DPDA 1GJZA 1ISNA 1GC6A 4HCPB 3B08A 3M63B 3A9JA 4PYZA 1R4MI 5CTRC 2KNBA 2C7NB 1V80A 4BOSC 1Q0WB 3DQVA 3VHTC 1WXVA 2YVCA 3U30A 4DBGA 4BKTA 3L16A 3TCAA 4F7ZA 3PHWB 3T9LA 4IC7B 2KDIA 3QAQA 2LZ6A 1WMHA 1V86A 2NVUI 2FNJB 3ZO5B 2EMTA 2MX2A 4KVGB 4DXAB 3VUXA 2K25A 5DPSA 3ZNGC 5LLIA 2FUHB 4E74A 2DYMA 5JHBA 1RFAA 3RT3B 3ENEA 3NS8A 3IHPC 2G4SA 3VUYA 4IWQA 4NJ6A 2J7QB 3ZLZA 2C7MB 5LXIB 1TZ1A 4HCNB 2LGYA 1L7YA 2LGXA 3PZDA 3U7DA 1V49A 4A3PA 5AZHA 4NQKE 1Q5WB 3ZNID 4GXBA 4MGZE 2N4FA 4RM8A 3M3JA 4XX5A 3APDA 2D2QA 3IVFA 2DAFA 3NY5A 3HM6X 5D6JB 4K1RB 3PLVA 4ANUA 3AU4A 5C1ZA 3APFA 1EF1A 2HJ8A 4M8MA 4FHJA 3WA0A 2DZMA 1WE6A 1WZ3A 1KJTA 2XK5B 2DHZA 4TKNA 5FR6A 1E90A 2ZZPB 3RULA 1NBFC 2MBEA 4LJOB 3I3TB 2MA9B 4K7SA 4FJYA 3IFWB 3DBLI 2ZCBA 3NHEB 3Q3FA 3ZNZB 1XD3B 3QARA 4EZKA 1WF9A 2PE9A 2IO1B 1CMXB 2NS5A 2KD0A 2BKRB 3NZSA 3OAWA 4HDQA 2JXXA 1WR6E 4DWFA 1AARA 3W1YA 3KH0A 4II2B 4IM3A 1WX8A 4NNJB 1YQBA 4FADA 3K9OB 3Q3JA 4GOCA 1K8RB 4KZ0A 3ZKJC 2KLGA 3GOEA 3KYCD 2L0TA 2O2VA 2G3QB 4PS7A 2UYZB 1LXDA 4FLHA 1WJNA 3K9PB 1WY8A 3DVGY 4NY0A 4OVVA 2NBVB 5CHWA 1WZ0A 4I6NB 3PHXB 2REXA 3BY4B 1YJ1A 2J0JA 2EMSA 1M94A 4I6LB 1LFDA 4FA6A 2ZPNA 5L95C 1YIWA 1WGHA 4B9KA 3ZVVA 3B1LX 2FCSA 2M17A 3DBHI 4FHKA 5G2NA 4TUUA 3JSVB 2AL3A 4AOFA 3A9KB 1VD2A 2BGFA 2DYBA 2KJHB 4KV2A 2CHWA 4EFOA 2DZJA 3V60A 4A3OA 3DOWA 2XEWA 1MG8A 1EUVB 3S2AA 3X23A 1JRUA 2JZ3B 2O2VB 1WJ4A 5CX3A 3CSFA 4K7WA 4PYUA 2PPHA 1XQQA 3ML8A 3SHQA 1HE8A 2NBUA 2MBBB 4HXDA 3N32A 3PRZA 2NBWB 2CS4A 2KDBA 2MQJA 4GB9A 2KDFB 2KFJA 2VRRB 1V9JA 1WH3A 2IO0B 3AULA 2NR2A 1WGYA 1Y8RC 2ZVOA 4HVBA 2BPSA 1LM8B 2J0KA 5D94A 1V6EA 3L17A 3ZNHB 3HM3A 3VTWA 5AEKB 2UWQA 1C1YB 3EHVA 1WFYA 1V5OA 3JYUA 4W9HA 4FJZA 4ZRKA 2K1FA 2C7HA 2G45B 4WWNA 1S3SG 2IO3B 5JH5C 4NJ7A 1WXAA 4WJQA 3ZTCA 3V6EB 2DZIA 4GGQA 4FJVB 1T0YA 2PJHA 1YX5B 2FCMA 2IY0B 2KANA 3L54A 5G55A 3H7PB 4B95A 3ZDMC 2HE7A 4F1SA 2IY1B 3QA8A 2KO3A 4ZRJA 3AI5A 4MGKE 2RR9A 4K7UA 3ZDTA 2MRPA 3UF8A 3DBSA 1V2YA 1NDDA 3H9DA 1H4RA 3VH4B 2N9PC 3VUWA 4II3B 4OVUA 2W9NA 1E8ZA 5J18A 3TBLD 1RAXA 5GMVA 5E6NA 2JWZA 5BO4B 2DZKA 3KYDD 4WAAA 2FCQA 2BF8B 1WRDB 4KDIC 4IM0A 2GBRA 3KW5B 3MJWA 3PSEB 4RMAA 4ANVA 3TMPB 4DDGD 2KOXA 1FXTB 2RD0A 3OJ4B 3QCAA 3ZIMA 2AEHA 2L7RA 2FIFA 3H6NA 3L0WB 2KQ7A 3EECA 4KIKB 5TR5A 1E7UA 4WQOB 4IWOA 3W1SA 4W9IA 4W9LA 2GBJA 2KVRA 4WWPA 1WJ6A 4JIOU 3B0AA 5L83A 3PRMB 2DENB 2GBMA 3ONSA 5C23A 1PQSA 3SD5A 1WMHB 3ZRCA 2WWZA 3L08A 2KWCA 3V61A 3UQBA 2G4DB 3IBEA 4W9GA 3M62B 1UD7A 3P2BA 4AJYB 5IA7A 3DDCB 2D3GA 1V81A 2Z0EB 3SDLC 3QK0A 4MSQB 2BWFA 3MHSD 1P3QU 4ICVA 3W1SC 1GUAB 1X1MA 4ZYNA 2N7EA 3PPAA 1UBIA 3GZNI 2KHWB 3VVWB 4ASWC 1P0RA 2BYVE 1WXMA 4P7IA 2K39A 2KFKA 2ZNVC 2LWPA 3UIOB 2LXCA 5CHFA 2JY6A 2K6QA 3APCA 2A4ZA 2LGDA 4M0WB 1ZW7A 4MEMA 1IYFA 3KUDB 3NOBA 4NPNA 5E6OA 3ALBA 2R2QA 4F8CB 1P9DU 1EO6A 3UINB 2KMAA 2KC1A 2LI5A 2M0XA 3ECIA 3R7RA 2JF5A 1QZEA 3R3MA 1WIAA 1EF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLF A;  5KHO A;  5AZG A;  4TV3 A;  3EC8 A;  3KVF B;  2RSU A;  4PS3 A;  3X0W A;  3NZU A;  4DDI D;  3TJP A;  2CHZ A;  4CHK A;  1KOT A;  2KQS A;  3VTV A;  4JGH B;  3V6C B;  2I1K A;  1UBQ A;  1Z5S B;  2YLM A;  3HHM A;  3PVL A;  4G50 A;  4K81 A;  2CR5 A;  2MSE D;  3CMM B;  3PS6 A;  3WAL A;  4IG7 B;  1YX6 B;  4HJK A;  4HPM B;  5JZE B;  1GNU A;  2KXJ A;  4G11 A;  2B3A A;  4DK5 A;  2IO2 B;  1J8C A;  2PE6 B;  2LRU A;  4E71 A;  2CHX A;  2BYF A;  4PS8 A;  3V62 A;  4KIK A;  2FAZ A;  4IWP A;  4WJP A;  3A1Q A;  2KZR A;  2NPT A;  2N1V A;  3CF6 E;  3VTU A;  4JLC A;  1WR1 A;  1WXS A;  2LAS A;  3RZF A;  3SU8 X;  5HKH A;  3L10 B;  5E6P A;  2CKH B;  4RM9 A;  2K6D B;  4GN1 A;  2K8B A;  5IAA C;  5DPT A;  4MM3 A;  2C60 A;  2IBI B;  3WAO A;  4EKU A;  1RRB A;  1WI0 A;  2O6V B;  2AL6 A;  2M4N A;  2L8J A;  4M8N A;  2FCN A;  2MBH A;  2KN5 A;  2D07 B;  4IW0 A;  4W9K A;  4N9F 4;  1J19 A;  3WAP A;  2C9W B;  2KTF A;  2GBN A;  3WAN A;  4EEW A;  4EZL A;  1I42 A;  4W9C A;  4XZ4 A;  3T8M A;  4TQ0 A;  4GU2 A;  4IM2 A;  4X57 B;  4GDL B;  4WJN A;  3O65 B;  2LJ5 A;  3PTF C;  3A33 B;  4JL9 A;  3IG3 A;  1ZKH A;  2JRH A;  3RZW C;  1P1A A;  4BOZ B;  3PGE A;  3PT2 B;  2MP2 A;  2JT4 B;  3QC8 B;  4MDK E;  3DVN U;  4AWJ A;  2MLB A;  3R7Q A;  2AWT A;  2KX0 A;  2Z59 B;  2DYO A;  2IZV B;  4IUM B;  1NI2 A;  2AYO B;  2KWV B;  5KHQ A;  1ZGU B;  2WDT B;  3VFK A;  2OOB B;  2KTR B;  2Z0D B;  2KDE B;  2ZCC A;  1TTN A;  2LVO A;  3RCZ A;  4G0N B;  4J6I A;  2KMC A;  4ANX A;  1WYW B;  3LJ3 A;  4KDL B;  1OGW A;  2DAJ A;  2RPQ A;  3N30 A;  4BKS A;  1D3Z A;  2MBO A;  4AP4 C;  3JVZ X;  3VH3 B;  4GDK A;  3QHT A;  1OEY J;  2A5U A;  2FID A;  4EUT A;  4DHZ B;  5D2M B;  1OTR B;  3H7S A;  2BYE A;  4EOY A;  1S1Q B;  3A1Q B;  3H1U A;  4KSK C;  1UEL A;  4B6W A;  4EZJ A;  3U8Z A;  5JHA A;  2KLC A;  2IYD B;  4ANW A;  4LDT D;  1GG3 A;  1E8X A;  2V1Y A;  3L13 A;  2WX0 A;  3KUC B;  4YL8 A;  3ZUN A;  4BBN F;  3VXW A;  1A5R A;  5AZF A;  2L00 B;  2V3S A;  3QWZ B;  2EKE C;  2N9X A;  3A4R A;  3UQA A;  2JVC A;  3RD2 A;  2I1J A;  2L05 A;  2KTR A;  2DX5 B;  2D10 A;  4MEL A;  3RYT A;  2KJ6 A;  3BIN A;  2MWS B;  3ML9 A;  1YD8 U;  4BBN C;  2C5L C;  1VCB A;  2GOW A;  1TGZ B;  4DHJ B;  1OQY A;  2N9E B;  4BFR A;  4WWO A;  3R66 C;  3HK0 A;  3PLU A;  1KM7 A;  1E5W A;  3WIM A;  3CST A;  1SE9 A;  2J0M A;  3ZW3 A;  1H8C A;  2LVP A;  3UIP B;  4BKS D;  3LDZ E;  4BKG A;  2KX3 A;  3M95 A;  4HK2 A;  2XBB C;  2LXA A;  3HIZ A;  3C0R B;  3TIX A;  2GBK A;  1OEY A;  2BKF A;  3N3K B;  4GMV A;  4ZDV A;  2M8S A;  4GDL A;  2WYQ A;  2ZPY A;  2JPH A;  4HLE A;  1SGH A;  4HDO A;  4I6P A;  1U4A A;  2L76 A;  1WGG A;  3JW0 X;  5J17 A;  1IPG A;  5DCN A;  2R2O A;  1Q1O A;  5D7G A;  3EFU A;  4FUL A;  4JQW C;  2K8H A;  4W9F A;  2ZVN A;  1Z2M A;  2GMI C;  3A9K A;  2ASQ A;  4FN2 A;  4URK A;  4NAW A;  1F9J A;  3QJZ A;  3QIJ A;  3OLM D;  2O6V D;  5DPW A;  2JRI B;  4FBJ B;  4MGY E;  1WM3 A;  4TQ1 A;  2V4L A;  3DBR I;  2MCN B;  4MJS B;  2RGF A;  4XC2 A;  2LD9 A;  3A4S C;  2K8C A;  2WX1 A;  4AUQ C;  4GSW A;  2ZNV B;  3RUI B;  2D11 A;  1G6J A;  4GIV A;  2JZZ A;  4AJW A;  4NQL B;  2M1M A;  3WAM A;  1J0G A;  1BT0 A;  2NPT B;  4KZC A;  5DPR A;  5LXH A;  1UZX B;  1XT9 B;  2OJR A;  4DHZ E;  1E8Y A;  2BWE S;  2ZJD A;  1LQB A;  4MSM B;  3AXC A;  2LVQ A;  4KSL C;  1TBE A;  3D32 A;  2JUO A;  5CHV C;  1SIF A;  4MH0 E;  4W9D A;  1P98 A;  2MW5 A;  4NAW B;  3PRP B;  1WX7 A;  3JSV A;  2LUE A;  1R4N I;  4HPL B;  1E7V A;  4W9E A;  4E3C A;  1KLV A;  2CU1 A;  5EDS A;  2N1W A;  1IP9 A;  1L2N A;  2HD5 B;  1C3T A;  1UGM A;  3ZRF A;  4LJP B;  3VQI A;  1WJU A;  1WX9 A;  3AU5 A;  2NCN A;  3DVG X;  1WGD A;  2L3Z A;  3PV1 A;  4ZRI A;  2KC2 A;  4GDK B;  2XK5 A;  3A9J B;  3MTN B;  3VAW A;  2KJR A;  4A20 A;  2N7D A;  2LRW A;  4CO7 A;  3DVN V;  3UGB B;  4LDT B;  4MGI E;  2QHO A;  3QX1 A;  4BVU C;  2PEA A;  1GC7 A;  1UH6 A;  4G3X B;  2MP2 B;  1WGR A;  2Y5B B;  3DCG A;  3QQ8 B;  4HWI B;  4ICU A;  3H7P A;  2MBQ A;  4W9J A;  4CYE A;  2ZEQ A;  1E8W A;  3ZTD A;  3VDZ A;  1V5T A;  4LCD E;  2KKC A;  1WE7 A;  3OJ3 A;  2KFK B;  2KWU B;  4MJS A;  4WJO A;  2HTH A;  2L0F A;  5J2R A;  4DHJ D;  1WM2 A;  2KK8 A;  3KUZ A;  3TL5 A;  3PRE A;  2O6V A;  1I35 A;  3DPD A;  1GJZ A;  1ISN A;  1GC6 A;  4HCP B;  3B08 A;  3M63 B;  3A9J A;  4PYZ A;  1R4M I;  5CTR C;  2KNB A;  2C7N B;  1V80 A;  4BOS C;  1Q0W B;  3DQV A;  3VHT C;  1WXV A;  2YVC A;  3U30 A;  4DBG A;  4BKT A;  3L16 A;  3TCA A;  4F7Z A;  3PHW B;  3T9L A;  4IC7 B;  2KDI A;  3QAQ A;  2LZ6 A;  1WMH A;  1V86 A;  2NVU I;  2FNJ B;  3ZO5 B;  2EMT A;  2MX2 A;  4KVG B;  4DXA B;  3VUX A;  2K25 A;  5DPS A;  3ZNG C;  5LLI A;  2FUH B;  4E74 A;  2DYM A;  5JHB A;  1RFA A;  3RT3 B;  3ENE A;  3NS8 A;  3IHP C;  2G4S A;  3VUY A;  4IWQ A;  4NJ6 A;  2J7Q B;  3ZLZ A;  2C7M B;  5LXI B;  1TZ1 A;  4HCN B;  2LGY A;  1L7Y A;  2LGX A;  3PZD A;  3U7D A;  1V49 A;  4A3P A;  5AZH A;  4NQK E;  1Q5W B;  3ZNI D;  4GXB A;  4MGZ E;  2N4F A;  4RM8 A;  3M3J A;  4XX5 A;  3APD A;  2D2Q A;  3IVF A;  2DAF A;  3NY5 A;  3HM6 X;  5D6J B;  4K1R B;  3PLV A;  4ANU A;  3AU4 A;  5C1Z A;  3APF A;  1EF1 A;  2HJ8 A;  4M8M A;  4FHJ A;  3WA0 A;  2DZM A;  1WE6 A;  1WZ3 A;  1KJT A;  2XK5 B;  2DHZ A;  4TKN A;  5FR6 A;  1E90 A;  2ZZP B;  3RUL A;  1NBF C;  2MBE A;  4LJO B;  3I3T B;  2MA9 B;  4K7S A;  4FJY A;  3IFW B;  3DBL I;  2ZCB A;  3NHE B;  3Q3F A;  3ZNZ B;  1XD3 B;  3QAR A;  4EZK A;  1WF9 A;  2PE9 A;  2IO1 B;  1CMX B;  2NS5 A;  2KD0 A;  2BKR B;  3NZS A;  3OAW A;  4HDQ A;  2JXX A;  1WR6 E;  4DWF A;  1AAR A;  3W1Y A;  3KH0 A;  4II2 B;  4IM3 A;  1WX8 A;  4NNJ B;  1YQB A;  4FAD A;  3K9O B;  3Q3J A;  4GOC A;  1K8R B;  4KZ0 A;  3ZKJ C;  2KLG A;  3GOE A;  3KYC D;  2L0T A;  2O2V A;  2G3Q B;  4PS7 A;  2UYZ B;  1LXD A;  4FLH A;  1WJN A;  3K9P B;  1WY8 A;  3DVG Y;  4NY0 A;  4OVV A;  2NBV B;  5CHW A;  1WZ0 A;  4I6N B;  3PHX B;  2REX A;  3BY4 B;  1YJ1 A;  2J0J A;  2EMS A;  1M94 A;  4I6L B;  1LFD A;  4FA6 A;  2ZPN A;  5L95 C;  1YIW A;  1WGH A;  4B9K A;  3ZVV A;  3B1L X;  2FCS A;  2M17 A;  3DBH I;  4FHK A;  5G2N A;  4TUU A;  3JSV B;  2AL3 A;  4AOF A;  3A9K B;  1VD2 A;  2BGF A;  2DYB A;  2KJH B;  4KV2 A;  2CHW A;  4EFO A;  2DZJ A;  3V60 A;  4A3O A;  3DOW A;  2XEW A;  1MG8 A;  1EUV B;  3S2A A;  3X23 A;  1JRU A;  2JZ3 B;  2O2V B;  1WJ4 A;  5CX3 A;  3CSF A;  4K7W A;  4PYU A;  2PPH A;  1XQQ A;  3ML8 A;  3SHQ A;  1HE8 A;  2NBU A;  2MBB B;  4HXD A;  3N32 A;  3PRZ A;  2NBW B;  2CS4 A;  2KDB A;  2MQJ A;  4GB9 A;  2KDF B;  2KFJ A;  2VRR B;  1V9J A;  1WH3 A;  2IO0 B;  3AUL A;  2NR2 A;  1WGY A;  1Y8R C;  2ZVO A;  4HVB A;  2BPS A;  1LM8 B;  2J0K A;  5D94 A;  1V6E A;  3L17 A;  3ZNH B;  3HM3 A;  3VTW A;  5AEK B;  2UWQ A;  1C1Y B;  3EHV A;  1WFY A;  1V5O A;  3JYU A;  4W9H A;  4FJZ A;  4ZRK A;  2K1F A;  2C7H A;  2G45 B;  4WWN A;  1S3S G;  2IO3 B;  5JH5 C;  4NJ7 A;  1WXA A;  4WJQ A;  3ZTC A;  3V6E B;  2DZI A;  4GGQ A;  4FJV B;  1T0Y A;  2PJH A;  1YX5 B;  2FCM A;  2IY0 B;  2KAN A;  3L54 A;  5G55 A;  3H7P B;  4B95 A;  3ZDM C;  2HE7 A;  4F1S A;  2IY1 B;  3QA8 A;  2KO3 A;  4ZRJ A;  3AI5 A;  4MGK E;  2RR9 A;  4K7U A;  3ZDT A;  2MRP A;  3UF8 A;  3DBS A;  1V2Y A;  1NDD A;  3H9D A;  1H4R A;  3VH4 B;  2N9P C;  3VUW A;  4II3 B;  4OVU A;  2W9N A;  1E8Z A;  5J18 A;  3TBL D;  1RAX A;  5GMV A;  5E6N A;  2JWZ A;  5BO4 B;  2DZK A;  3KYD D;  4WAA A;  2FCQ A;  2BF8 B;  1WRD B;  4KDI C;  4IM0 A;  2GBR A;  3KW5 B;  3MJW A;  3PSE B;  4RMA A;  4ANV A;  3TMP B;  4DDG D;  2KOX A;  1FXT B;  2RD0 A;  3OJ4 B;  3QCA A;  3ZIM A;  2AEH A;  2L7R A;  2FIF A;  3H6N A;  3L0W B;  2KQ7 A;  3EEC A;  4KIK B;  5TR5 A;  1E7U A;  4WQO B;  4IWO A;  3W1S A;  4W9I A;  4W9L A;  2GBJ A;  2KVR A;  4WWP A;  1WJ6 A;  4JIO U;  3B0A A;  5L83 A;  3PRM B;  2DEN B;  2GBM A;  3ONS A;  5C23 A;  1PQS A;  3SD5 A;  1WMH B;  3ZRC A;  2WWZ A;  3L08 A;  2KWC A;  3V61 A;  3UQB A;  2G4D B;  3IBE A;  4W9G A;  3M62 B;  1UD7 A;  3P2B A;  4AJY B;  5IA7 A;  3DDC B;  2D3G A;  1V81 A;  2Z0E B;  3SDL C;  3QK0 A;  4MSQ B;  2BWF A;  3MHS D;  1P3Q U;  4ICV A;  3W1S C;  1GUA B;  1X1M A;  4ZYN A;  2N7E A;  3PPA A;  1UBI A;  3GZN I;  2KHW B;  3VVW B;  4ASW C;  1P0R A;  2BYV E;  1WXM A;  4P7I A;  2K39 A;  2KFK A;  2ZNV C;  2LWP A;  3UIO B;  2LXC A;  5CHF A;  2JY6 A;  2K6Q A;  3APC A;  2A4Z A;  2LGD A;  4M0W B;  1ZW7 A;  4MEM A;  1IYF A;  3KUD B;  3NOB A;  4NPN A;  5E6O A;  3ALB A;  2R2Q A;  4F8C B;  1P9D U;  1EO6 A;  3UIN B;  2KMA A;  2KC1 A;  2LI5 A;  2M0X A;  3ECI A;  3R7R A;  2JF5 A;  1QZE A;  3R3M A;  1WIA A;  1EF5 A; 
#chains in the Genus database with same CATH topology
 1UUP A;  5AZG A;  4TV3 A;  3EC8 A;  3Q3M C;  4DDI D;  3I5J C;  1KOT A;  2KQS A;  2KVZ A;  1DGJ A;  3VTV A;  2I1K A;  1UBQ A;  4US9 A;  3AMZ A;  1Z5S B;  3PVL A;  3HHM A;  2WU5 B;  3AE6 B;  3WAL A;  1YX6 B;  1XLO A;  4LNI A;  2LRU A;  3FIL A;  2BYF A;  3DBL B;  4PS8 A;  2PVG C;  1DYQ A;  5H92 C;  2YEP F;  3A1Q A;  2NPT A;  2RPV A;  4HRS A;  3L10 B;  1JWA D;  1V97 A;  2K8B A;  5IAA C;  2K22 A;  3AV8 A;  2L8J A;  3T3O A;  2FCN A;  5IO9 A;  1MHH E;  3AE8 B;  1VRA B;  2GRI A;  2LJ5 A;  4JL9 A;  3IG3 A;  3PT2 B;  2MP2 A;  3RNA C;  3HVZ A;  1FCL A;  1FM0 D;  2DYO A;  2L32 A;  4XDC A;  1NI2 A;  1I4Q A;  1QIL A;  1LO5 D;  1ZGU B;  2WXK A;  3VFK A;  3OWE B;  2CJO A;  1R4M B;  2QC8 A;  2AQ3 B;  2V3N A;  4G0N B;  4J6I A;  1M4V A;  1OGW A;  1GAQ B;  1WYG A;  2A5U A;  5D2M B;  4EZJ A;  5JHA A;  3H1U A;  1I4G A;  1FFV A;  1STE A;  1GG3 A;  3L13 A;  2WX0 A;  4YL8 A;  2MJD A;  4BBN F;  3N20 C;  5D3D A;  2V3S A;  3RD2 A;  2DX5 B;  2D10 A;  2KN4 A;  2QJL A;  3ML9 A;  2L1A A;  2GOW A;  1VLB A;  1XLQ A;  1E6E B;  4RNA A;  3BYY B;  1KM7 A;  2TSS A;  1H8C A;  2YEP B;  3M95 A;  3TIX A;  2GBK A;  2BKF A;  4ZDV A;  2M8S A;  1SGH A;  4I6P A;  4DXG A;  5J17 A;  1IPG A;  1WRI A;  1SE4 A;  3BYT B;  1L0V B;  1XCQ L;  2K8H A;  2XNA C;  2GMI C;  3A9K A;  4FN2 A;  1MFW A;  1F9J A;  3QJZ A;  1QOG A;  5DPW A;  3RFZ B;  2V4L A;  3DBR I;  4JPS A;  3DWM A;  3ZJU A;  4C80 A;  2D11 A;  1QLB B;  2M1M A;  3AEE B;  1BT0 A;  5LXH A;  3TEW A;  1E8Y A;  1JWM D;  2LVQ A;  2JUO A;  1SIF A;  1VZ7 A;  4A55 A;  3MJ5 A;  3JSV A;  1R4N I;  2N1W A;  1D5X C;  2AQ1 B;  3FKY A;  1L2N A;  4YSX B;  2HD5 B;  1C3T A;  1UGM A;  5BYR A;  1Y56 A;  1FCC C;  3Q3O C;  2NCN A;  2SAK A;  2WGS A;  2Q5W D;  3N1Y C;  3SFE B;  2KC2 A;  2XK5 A;  3VAW A;  2KJR A;  3RNE C;  3B2G A;  4A20 A;  5BMH A;  3W5U B;  3QX1 A;  2PEA A;  1GC7 A;  3DWG C;  3N9Y C;  4HWI B;  1KTK A;  3H7P A;  4WQM A;  3SR6 A;  4W9J A;  2ZEQ A;  1D5Z C;  1E8W A;  5HI1 A;  4XWW A;  1V5T A;  3TUO A;  3KQ4 A;  2KWU B;  2HTH A;  5J2R A;  2KK8 A;  1KH0 A;  4C4V B;  3B08 A;  3TEY A;  1R4M I;  3ZQ4 A;  3BVM A;  3U30 A;  2PLP A;  4BKT A;  3TCA A;  1WGK A;  2LZ6 A;  1V86 A;  2BTE A;  2ACZ B;  3P42 A;  4RGO S;  3ZNG C;  1TYG B;  3NS8 A;  3VUY A;  4IWQ A;  4NJ6 A;  2C7M B;  5LXI B;  1UF0 A;  4OZC A;  4HCN B;  2WXP A;  3U7D A;  2K9X A;  4C7Y A;  3RNF C;  1WWT A;  2N4F A;  1WXQ A;  2LHE A;  2WHI A;  2WXQ A;  3PLV A;  5C1Z A;  2HJ8 A;  4M8M A;  4PK1 A;  4FHJ A;  3WA0 A;  1T5X D;  1E90 A;  2ZZP B;  4LJO B;  3I3T B;  2ZCB A;  1V8C A;  2NS5 A;  1HQR D;  3OAW A;  4WH4 A;  4HDQ A;  3P1M A;  2CJN A;  2AQ2 B;  3I57 A;  1WX8 A;  1YQB A;  1HXY D;  4HPP A;  3K9O B;  3Q3J A;  3ZKJ C;  1A70 A;  2KLG A;  3KYC D;  2L0T A;  2MJE A;  2XN9 C;  2Y5P A;  2BB5 A;  1E7P B;  4NY0 A;  4OVV A;  4RFB A;  1PGX A;  1WZ0 A;  3GE8 C;  3AEF B;  4I6L B;  4FA6 A;  3ZVV A;  3C8Y A;  3AEB B;  1EM7 A;  1C4C A;  2AL3 A;  2BQQ A;  3A9K B;  2WS3 B;  4N6E B;  2DZJ A;  3V60 A;  1KLG D;  3DOW A;  2FUG 1;  1IBX B;  1EUV B;  1N5W A;  1JRU A;  5CX3 A;  3AH7 A;  4USA A;  3NJT A;  3PRZ A;  2NBW B;  2CS4 A;  5EE3 A;  1B1Z A;  1RWS A;  1F2R I;  2PW9 A;  1L4Z B;  1LM8 B;  2RDB C;  1V6E A;  5AEK B;  3N1X C;  1C1Y B;  3EHV A;  4WWN A;  3UI3 A;  1HA5 A;  4WJQ A;  2D5G A;  2DZI A;  2V4I B;  4NAM A;  3SFD B;  2KAN A;  2IY0 B;  1CZP A;  4B95 A;  3ZDM C;  4OW0 A;  2HE7 A;  3NVW A;  2IY1 B;  1C4A A;  2BB6 A;  3AI5 A;  2BBC A;  1RM6 C;  2MRP A;  1H4R A;  3VH4 B;  1JQ4 A;  4II3 B;  1DOY A;  4OVU A;  5BO4 B;  1SE3 A;  1SB3 C;  2FCQ A;  4DDG D;  4ANV A;  3AE1 B;  2INP E;  2L7R A;  4FXC A;  4KIK B;  1PUT A;  2Y5C A;  1Q10 A;  3P4R B;  3B0A A;  3RNG C;  3PRM B;  1N6Z A;  3E56 A;  2DEN B;  3ONS A;  3ZRC A;  4S0R A;  3L08 A;  3GP7 A;  1TY2 A;  2HJ1 A;  3P2B A;  5IA7 A;  2D3G A;  2Z0E B;  3SDL C;  3IT4 B;  1GUA B;  1I4P A;  1FIQ A;  3PPA A;  1JWS D;  3RMK C;  3J9C A;  4C00 A;  3Q3N C;  2QCZ A;  2K39 A;  5LNK 1;  5CHF A;  2LGD A;  1ZW7 A;  2INC C;  3NOB A;  4F8C B;  1EO6 A;  1FXA A;  2DNF A;  2LI5 A;  4HRO A;  2WDR B;  3PLU A;  1SBB B;  2INN E;  2JSV X;  4HK2 A;  1RLF A;  2EKI A;  1HZ5 A;  1JCK B;  3Q8C A;  1L6U A;  5HHD G;  4G50 A;  4K81 A;  1SF0 A;  2GB1 A;  3C19 A;  1FRR A;  3V3X A;  3GE3 C;  3AE5 B;  2IO2 B;  1J8C A;  4L2Y A;  4E71 A;  4YSZ B;  2FAZ A;  4C7Z A;  1ACC A;  3VTU A;  3CF6 E;  4JLC A;  1WR1 A;  3SU8 X;  3RPF C;  2CKH B;  1FD6 A;  5DPT A;  4MM3 A;  1R4N B;  2IBI B;  1RRB A;  1XEE A;  2O6V B;  2Z8L A;  3L4P A;  4IW0 A;  1J19 A;  3WAP A;  2GBN A;  3WAN A;  3KWV A;  4XZ4 A;  2WXG A;  2Y3A A;  1ZKH A;  2JRH A;  4MDK E;  2ON8 A;  3WCQ A;  2AWT A;  2ZW1 A;  2KX0 A;  2L83 A;  2Z59 B;  2IZV B;  4IUM B;  2KWV B;  4AQ7 A;  2OOB B;  2KTR B;  2Z0D B;  2KDE B;  2LVO A;  2IPK D;  4ANX A;  3LJ3 A;  4KDL B;  2RPQ A;  3NVY A;  2WQY B;  1D3Z A;  4K3B A;  4AP4 C;  3JVZ X;  5E6J A;  3VH3 B;  1OEY J;  4HKZ E;  4EUT A;  1ZDX A;  1VZ8 A;  4B6W A;  3U8Z A;  2KLC A;  2IYD B;  3KUC B;  3VXW A;  1A5R A;  1TS3 A;  2EKE C;  4RGN A;  4ZHO A;  2JVC A;  5G5G A;  4WAF A;  3ZXR A;  1YD8 U;  1VCB A;  1TGZ B;  1OQY A;  3R2T A;  4WWO A;  3R66 C;  3MHZ A;  2WU2 B;  3HK0 A;  1E5W A;  1XCT L;  1L5P A;  4HJG E;  1DOX A;  2LXA A;  2WYQ A;  3AN1 A;  3O13 A;  4HDO A;  1U4A A;  3JW0 X;  3TEZ A;  1J7C A;  5DCN A;  4D2K A;  4FUL A;  4W9F A;  2ZVN A;  1ZUD 2;  2GLS A;  2I38 A;  3BWU D;  2O6V D;  3N1Z C;  1FMA D;  4FBJ B;  4HEA 1;  4TQ1 A;  2MCN B;  4XC2 A;  1ET9 A;  3A4S C;  2PVO D;  4AUQ C;  1C4P A;  1G6J A;  1IGD A;  1J0G A;  3EA6 A;  5C3J B;  1XT9 B;  2ZJD A;  3AXC A;  1F52 A;  2WLB A;  4KSL C;  1TBE A;  3D32 A;  4MH0 E;  4W9D A;  1ZP0 B;  4NAW B;  3ZJT A;  4HPL B;  5IP4 D;  1KLV A;  1CK1 A;  3U7Z A;  5EDS A;  2J4X A;  4AS1 A;  4JWS C;  4LJP B;  3BZD B;  1WJU A;  1WX9 A;  1BUI C;  3DVG X;  1WGD A;  1T6B X;  3PV1 A;  4H2A A;  4M01 A;  3A9J B;  5D3I B;  4XDD A;  4YT0 B;  3UGB B;  1YNT E;  3P63 A;  1UH6 A;  4G3X B;  3DCG A;  4ICU A;  1YJJ A;  1JAL A;  2JX5 A;  4P16 A;  3VDZ A;  4LCD E;  2G9H D;  2KKC A;  3AE9 B;  3DBH B;  1WM2 A;  3KUZ A;  4PT5 A;  3PRE A;  1I35 A;  3DPD A;  1GJZ A;  2D3C A;  2MEK A;  1GC6 A;  1J7B A;  3M63 B;  2KNB A;  1Q0W B;  3DQV A;  1WXV A;  3HUI A;  3PHW B;  3T9L A;  2PKO A;  3OG5 A;  1WMH A;  2FNJ B;  3AED B;  4L1B A;  4IDI A;  4NJC A;  1MHX A;  1EU3 A;  3ZLZ A;  3ZJV A;  4IKG A;  5HG2 A;  1F2R C;  3NS1 A;  1D4B A;  2LGX A;  4ITK A;  3ZNI D;  3CIR B;  1KF6 B;  3IVF A;  4P1B C;  4KGR A;  3NY5 A;  3HM6 X;  5D6J B;  4K1R B;  3AU4 A;  1EF1 A;  2XK5 B;  1L4D B;  1NBF C;  3TEX A;  1ZXI A;  3QAR A;  2PE9 A;  2IO1 B;  5G5H A;  2KD0 A;  2BKR B;  3NZS A;  1TS2 A;  2JXX A;  1WR6 E;  3NZ3 A;  2MH7 A;  3W1Y A;  2DBY A;  3KH0 A;  4FAD A;  2BVC A;  1FNU A;  1XO3 A;  1FRD A;  1LXD A;  1YN3 A;  4FLH A;  1WY8 A;  1KLU D;  2NBV B;  1FEH A;  1YMH E;  3PHX B;  3Q14 C;  2FBW B;  1YJ1 A;  3FAH A;  1OQQ A;  2PMV A;  3U4E G;  2KYW A;  4B0E A;  2LGI A;  2M17 A;  5G2N A;  3BK1 A;  3URY A;  2PIA A;  4KKI A;  4AOF A;  2E3T A;  1PDX A;  4KV2 A;  3PZ7 A;  2V9H A;  4WUR A;  2XEW A;  3B9J A;  2JXT A;  1QF6 A;  2O2V B;  1VR9 A;  4PYU A;  1XQQ A;  3ML8 A;  1HE8 A;  2DWQ A;  4HXD A;  4RGM A;  3N32 A;  1PGA A;  1GB4 A;  1QOA A;  3AUL A;  2NR2 A;  1JML A;  1Y8R C;  2ZVO A;  3DBR B;  1TT5 B;  3HM3 A;  1SSN A;  4W9H A;  2DLB A;  2IGH A;  4ZRK A;  3RN9 C;  2K1F A;  1T0R C;  2C7H A;  2G45 B;  1P7E A;  3V6E B;  1L6V A;  1ESF A;  3NVZ A;  3B2F A;  1QQR A;  2ICI A;  5G55 A;  1CQV A;  5IOI A;  4F1S A;  3CWI A;  3ZDT A;  2FE8 A;  3VUW A;  1B9R A;  3LXF A;  1SXT A;  5GMV A;  5E6N A;  2JWZ A;  2N9K A;  1SJE D;  2JQR B;  4IM0 A;  4LNO A;  3OJ4 B;  3QCA A;  2LGS A;  3ZIM A;  2FIF A;  3AE2 B;  4BAX A;  2KQ7 A;  3Q6B A;  1F1H A;  4IWO A;  2QMT A;  4S17 A;  4KGS A;  3SD5 A;  2KWC A;  3M62 B;  2J42 A;  1V81 A;  2BWF A;  4ICV A;  1MVK A;  4C4V A;  4P7I A;  2LWP A;  2K6Q A;  3IAS 1;  2WXF A;  2R2Q A;  1C76 A;  1FO4 A;  2KMA A;  2RMM A;  1SEB D;  1PFD A;  1NEK B;  4A8X C;  3R7R A;  3R3M A;  2IGD A;  1EF5 A;  5KHO A;  2KDM A;  3KVF B;  3X0W A;  2IDY A;  2OJW A;  2G1E A;  3V6C B;  2CR5 A;  4CQN A;  3CMM B;  3PS6 A;  4IG7 B;  4G11 A;  2B3A A;  4DK5 A;  2CHX A;  4KIK A;  4IWP A;  2WNM A;  1OFF A;  2KZR A;  3AB5 A;  2LAS A;  4RM9 A;  4GN1 A;  2LEK A;  5TSS A;  2C60 A;  3WAO A;  2D3A A;  4EKU A;  2RDH A;  2AL6 A;  3V05 A;  2M4N A;  4M8N A;  1MG4 A;  2MBH A;  3HRD D;  1UWX A;  2KN5 A;  2D07 B;  4N9F 4;  2C9W B;  3MFG A;  4EEW A;  1I42 A;  1FPY A;  4W9C A;  4TQ0 A;  5FK9 C;  4IM2 A;  4X57 B;  4GDL B;  2M19 A;  2KT7 A;  2VZK D;  4YWG G;  3A33 B;  2K5P A;  1P1A A;  2CU3 A;  2JT4 B;  5GXG B;  3RNB C;  2QEJ C;  2MLB A;  3R7Q A;  4MT5 A;  1YOV B;  1CJE A;  2WDT B;  2ZCC A;  1TTN A;  2W82 A;  3DHI C;  2KMC A;  1YQ3 B;  2KWD A;  2BS4 B;  3N30 A;  3VRA B;  4BKS A;  4M00 A;  2MBO A;  4GDK A;  3QHT A;  1EU4 A;  2FID A;  2BYE A;  1IBX A;  1UEL A;  1I4R A;  1KRH A;  2V1Y A;  2BT6 A;  2K0P A;  3ZUN A;  5BMI A;  2MHJ A;  5AZF A;  2L00 B;  3QWZ B;  3UQA A;  3A4R A;  2I1J A;  4MEL A;  2KJ6 A;  3IXS A;  2MWS B;  4BBN C;  2C5L C;  1NYR A;  2N9E B;  1FXI A;  3Q8F A;  3E9S A;  1FNV A;  1MPE A;  3SEB A;  3LDZ E;  3UIP B;  3HIZ A;  3C0R B;  1OEY A;  3N3K B;  2ZPY A;  3AM9 A;  4C56 C;  4LK0 M;  2R2O A;  1Q1O A;  5D7G A;  3EFU A;  2WDV B;  1Z2M A;  2ASQ A;  2N0S B;  3QIJ A;  1N62 A;  4KGT A;  2JRI B;  4LNN A;  1WM3 A;  3RNC C;  1JRO A;  4MJS B;  1TKE A;  2J53 A;  2K8C A;  4GSW A;  3FC4 A;  5BMG A;  2ZNV B;  4AJW A;  4NQL B;  3WAM A;  1UWM A;  3MC0 B;  3RI7 C;  4K3C A;  2EEL A;  2KAJ A;  3PRP B;  4ZRQ A;  2LUE A;  2AX5 A;  4RGT A;  4W9E A;  1E7V A;  5T8I A;  1FNW A;  3ZXV A;  4M02 A;  1TS5 A;  1HTQ A;  1BXT A;  1EWC A;  4A6Q A;  2LUM A;  4EE2 A;  3R2I A;  4ZRI A;  4GDK B;  3MTN B;  1PGB A;  2LRW A;  3DVN V;  4MGI E;  2QHO A;  2NTS A;  1WGR A;  2Y5B B;  3QQ8 B;  4RF0 A;  2LFI A;  3IAM 1;  4CYE A;  2BW2 A;  4JWU C;  3OJ3 A;  5IKC M;  3TL5 A;  1ISN A;  2GI9 A;  3NUH B;  3GB1 A;  2C7N B;  5BYS A;  2L52 A;  4BOS C;  3BVZ A;  1I4X A;  2B76 B;  2W54 A;  3NRZ A;  4DBG A;  2WXL A;  4IC7 B;  2KDI A;  3QAQ A;  3PZ8 A;  3ZO5 B;  3Q8B A;  2EMT A;  2MX2 A;  4KVG B;  4DXA B;  1SJH D;  2K25 A;  5DPS A;  5LLI A;  4E74 A;  2DYM A;  5JHB A;  2J7Q B;  3W2D A;  2HTM E;  1ET6 A;  3PZD A;  1LGR A;  3P4P B;  1Q5W B;  1SE2 A;  4RM8 A;  4XX5 A;  3M3J A;  1ROE A;  3VRB B;  3APF A;  3Q8A A;  2DZM A;  1WE6 A;  5FR6 A;  1KJT A;  1NI3 A;  4OVZ A;  4BZA A;  2MBE A;  5AUK A;  2MA9 B;  4FJY A;  4Q2J A;  3NHE B;  3Q3F A;  1XD3 B;  4KX6 B;  1KFY B;  1TKG A;  1K8R B;  1V1O A;  4KZ0 A;  1N63 A;  3GOE A;  3T3N A;  2G3Q B;  2UYZ B;  4LTU A;  3DVG Y;  5HFY A;  4LNK A;  1K53 A;  2REX A;  4R3D A;  1M94 A;  1VZ6 A;  5L95 C;  1WGH A;  3B1L X;  4FHK A;  4OZB A;  4ZRP A;  4OHJ A;  1TKY A;  1NVI D;  1VD2 A;  2BGF A;  4RCO A;  2DYB A;  3IT6 B;  2CHW A;  1HZ6 A;  4EFO A;  1QT9 A;  3LYY A;  2I2Y A;  3X23 A;  2LJI A;  2QDF A;  4J3O D;  4REZ A;  1WJ4 A;  1NYQ A;  3CSF A;  2PPH A;  2NBU A;  2KDB A;  2KDF B;  2VRR B;  1SIJ A;  1WH3 A;  1JRP A;  1WGY A;  4HVB A;  2BPS A;  2LHD A;  4P6V F;  3ZNH B;  3VTW A;  2UWQ A;  3DHH C;  1WFY A;  3I9V 1;  3JYU A;  1S3S G;  3KLS X;  2IO3 B;  5JH5 C;  3ZTC A;  2NMQ A;  2VZK B;  2W55 A;  2WXJ A;  4P1C C;  4FJV B;  1T0Y A;  2PJH A;  1YX5 B;  4RH6 A;  3H7P B;  1E0Z A;  3QA8 A;  2KO3 A;  3MP9 A;  1F0Z A;  4MGK E;  3DBS A;  4KKJ A;  3H9D A;  2N9P C;  3P4Q B;  3U2S C;  3ETR A;  4A90 A;  1E8Z A;  2ZW0 A;  2DZK A;  3KYD D;  3LB8 C;  1JW9 D;  2BF8 B;  1WSP A;  2GBR A;  3MJW A;  3KWL A;  2M0A A;  3TMP B;  2KOX A;  1FXT B;  2R61 A;  3EEC A;  3W5V B;  5TR5 A;  4WQO B;  4W9L A;  3FIL B;  3Q8E A;  4JIO U;  4L23 A;  5L83 A;  2WWZ A;  4AJY B;  2LMC A;  1GPX A;  1XLP A;  3QK0 A;  3W1S C;  1X1M A;  2J52 A;  1UBI A;  3VVW B;  4ASW C;  2BYV E;  1HEZ E;  1WXM A;  4ZYS A;  1TIF A;  1AYF A;  2KFK A;  3APC A;  4M0W B;  4N58 A;  4ARC A;  5EE9 A;  1J7A A;  3ALB A;  3EUB 2;  1OQR A;  1P9D U;  3UIN B;  2KC1 A;  2M0X A;  3ECI A;  2JF5 A;  4TKN A;  1WIA A;  2KMM A;  2ONQ A;  3H8H A;  2RSU A;  4PS3 A;  3NZU A;  3U52 E;  3TJP A;  2CHZ A;  1T0S C;  4CHK A;  1D5M C;  1GOZ A;  4JGH B;  4DQO C;  1TY0 A;  2YLM A;  2MSE D;  4YTP B;  3AEG B;  4UDU C;  4HJK A;  4HPM B;  5JZE B;  1GNU A;  2KXJ A;  4M0W A;  1UGJ A;  2WXO A;  2PE6 B;  3MC8 A;  3V62 A;  4WJP A;  2N1V A;  2HDE A;  3Q69 A;  1WXS A;  3P4S B;  3RZF A;  5HKH A;  5E6P A;  2K6D B;  1WI0 A;  1C77 A;  2BYT A;  2JWU A;  3ZGZ A;  1NEN B;  4W9K A;  2KTF A;  4EZL A;  3T8M A;  4GU2 A;  2WXI A;  4WJN A;  3O65 B;  3PTF C;  1F77 A;  3RZW C;  4BOZ B;  3PGE A;  3NVV A;  3QC8 B;  2X38 A;  3DVN U;  4AWJ A;  2BS2 B;  1AN8 A;  2AYO B;  5KHQ A;  1TJE A;  1ZOY B;  4MH8 A;  3RCZ A;  1UNS A;  1WYW B;  2DAJ A;  4IOI E;  2KQ4 X;  4NZL B;  2QIL A;  1DOI A;  4DHZ B;  1OTR B;  3H7S A;  4EOY A;  1S1Q B;  3A1Q B;  4KSK C;  2IJ0 A;  4ANW A;  4LDT D;  2VH1 A;  1E8X A;  1JWB D;  2N9X A;  1VJK A;  1MI0 A;  2V3P A;  2L05 A;  2KTR A;  2WP9 B;  1YJI A;  3RYT A;  1TS4 A;  3BIN A;  4DHJ B;  4BFR A;  3WIM A;  3CST A;  1SE9 A;  2J0M A;  5BYQ A;  3ZW3 A;  2LVP A;  4BKG A;  4BKS D;  2KX3 A;  2XBB C;  1ZE3 D;  1VDV A;  4GMV A;  4GDL A;  4WWM A;  5JXV A;  2D3B A;  2JPH A;  4HLE A;  2L76 A;  1WGG A;  1C78 A;  1V1P B;  2IND C;  3NG0 A;  1XLN A;  4JQW C;  4URK A;  1EWY C;  1IGC A;  4ARI A;  4NAW A;  3OLM D;  2M56 B;  4MGY E;  1HTO A;  2V0G A;  3PO0 A;  2RGF A;  1RYJ A;  2LD9 A;  1QOB A;  2WX1 A;  2RDG A;  3RUI B;  4GIV A;  2JZZ A;  3AE7 B;  5DPR A;  2NPT B;  4KZC A;  1UZX B;  2KAC A;  2OJR A;  4DHZ E;  4B0M A;  2BWE S;  1LQB A;  4MSM B;  1ZDV A;  3ZYY X;  5CHV C;  1P98 A;  2MW5 A;  1WX7 A;  4XE0 A;  2WDQ B;  1ZPS A;  1YN4 A;  4E3C A;  1PYW D;  2CU1 A;  1IP9 A;  4GLS C;  3ZRF A;  3VQI A;  1TZO A;  3AU5 A;  2L3Z A;  2UU7 A;  1D6E C;  2N7D A;  2QSD A;  2X8X X;  4XGA B;  4CO7 A;  4LDT B;  2PTL A;  3Q2A C;  4BVU C;  5FR3 A;  3VR9 B;  2MP2 B;  1IUE A;  3BVG A;  5IN7 A;  2MBQ A;  1BML C;  3ZTD A;  1YN5 A;  2JYE A;  2W3R A;  3GS2 A;  1WE7 A;  2JU6 X;  2KFK B;  4WJO A;  4MJS A;  2L0F A;  4DHJ D;  2O6V A;  3GZN B;  4HCP B;  1T0Q C;  3AE4 B;  4MM3 B;  3A9J A;  4PYZ A;  5CTR C;  3BK2 A;  1V80 A;  2JYT A;  3VHT C;  2YVC A;  1QOF A;  3L16 A;  4F7Z A;  1MJD A;  1AWD A;  2NVU I;  3VUX A;  2W3S A;  2FUH B;  1RFA A;  3RT3 B;  3ENE A;  3IHP C;  4N59 A;  2G4S A;  4ZOH C;  1N61 A;  1TZ1 A;  3I63 C;  1L7Y A;  2LGY A;  4A3P A;  1V49 A;  5AZH A;  4ACF A;  2QIE B;  4NQK E;  4YSY B;  4OZA A;  4GXB A;  4MGZ E;  3APD A;  2D2Q A;  3ABV B;  4XWT A;  2DAF A;  2WXR A;  4YXD B;  2WXN A;  4ANU A;  4YTM B;  3AEA B;  1WZ3 A;  2DHZ A;  3R8B A;  3AEC B;  3RUL A;  4K7S A;  1K51 A;  1I7H A;  3DBL I;  3IFW B;  4EZK A;  1WF9 A;  1CMX B;  1K50 A;  5EE0 A;  4DWF A;  3MC9 A;  5FKA C;  4QAY A;  1ZXH A;  1AAR A;  4LLG M;  4II2 B;  4YTN B;  4IM3 A;  4NNJ B;  4GOC A;  5C2T B;  2O2V A;  3EGR A;  4PS7 A;  2H89 B;  4O1N A;  1WJN A;  3K9P B;  5CHW A;  1V1P A;  2N9L A;  4I6N B;  4JE3 B;  1QKZ A;  3BY4 B;  2J0J A;  2EMS A;  4ZHP A;  1LFD A;  1N60 A;  2ZPN A;  1L0Y B;  4MAC A;  1YIW A;  4B9K A;  3TSS A;  2FCS A;  2MJ3 A;  3DBH I;  4TUU A;  2E6X A;  3JSV B;  1XF5 L;  2KJH B;  4TSS A;  4A3O A;  2OED A;  1MG8 A;  4HKQ A;  3S2A A;  2OHF A;  4TMA B;  3BII D;  2JZ3 B;  3W9C B;  4K7W A;  3SHQ A;  4LNF A;  2MBB B;  1C79 A;  2K3U A;  1JWU D;  2MQJ A;  4GB9 A;  3AE3 B;  2KFJ A;  1V9J A;  2IO0 B;  2J0K A;  5D94 A;  3L17 A;  1RFK A;  3HVD A;  1FFU A;  1K52 A;  5EE1 A;  1V5O A;  2WXH A;  4FJZ A;  4NJ7 A;  1WXA A;  4GGQ A;  2FCM A;  3L54 A;  5AUI A;  5I4D A;  2IGG A;  1I4H A;  4ZRJ A;  2RR9 A;  4K7U A;  1ENF A;  2BS3 B;  3UF8 A;  1V2Y A;  1NDD A;  2SEB D;  5J18 A;  2W9N A;  3TBL D;  1RAX A;  3DHG C;  4US8 A;  4JX1 C;  4WAA A;  4RF1 A;  1WRD B;  4KDI C;  3PSE B;  3KW5 B;  4RMA A;  4DXF A;  1T3Q A;  2RD0 A;  2H88 B;  2AEH A;  3H6N A;  1XXG A;  3L0W B;  2WXM A;  1C9F A;  2JZP A;  1E7U A;  3W1S A;  4W9I A;  4WWP A;  2GBJ A;  1P7F A;  2KVR A;  1WJ6 A;  1R7S A;  2GBM A;  5H8Y E;  5C23 A;  1PQS A;  1N5X A;  4XYC A;  1WMH B;  3V61 A;  1YQ4 B;  2G4D B;  3IBE A;  4W9G A;  3UQB A;  1UD7 A;  3DDC B;  4A9A A;  4MSQ B;  3MHS D;  1P3Q U;  3VR8 B;  4ZYN A;  2N7E A;  2NTT A;  2VH2 A;  3GZN I;  2KHW B;  3EFC A;  1P0R A;  1AW7 A;  2ZNV C;  3UIO B;  1E9M A;  2LXC A;  2JY6 A;  2A4Z A;  4WIP A;  4MEM A;  1IYF A;  1L0X B;  3KUD B;  5E6O A;  4NPN A;  2N7J A;  1GB1 A;  1E10 A;  5MPO A;  1QZE A;  3ZNZ B; 
#chains in the Genus database with same CATH homology
 1RLF A;  5KHO A;  5AZG A;  4TV3 A;  3EC8 A;  3KVF B;  2RSU A;  4PS3 A;  3X0W A;  3NZU A;  4DDI D;  3TJP A;  2CHZ A;  4CHK A;  1KOT A;  2KQS A;  3VTV A;  4JGH B;  3V6C B;  2I1K A;  1UBQ A;  1Z5S B;  2YLM A;  3HHM A;  3PVL A;  4G50 A;  4K81 A;  2CR5 A;  2MSE D;  3CMM B;  3PS6 A;  3WAL A;  4IG7 B;  1YX6 B;  4HJK A;  4HPM B;  5JZE B;  1GNU A;  2KXJ A;  4G11 A;  2B3A A;  4DK5 A;  2IO2 B;  1J8C A;  2PE6 B;  2LRU A;  4E71 A;  2CHX A;  2BYF A;  4PS8 A;  3V62 A;  4KIK A;  2FAZ A;  4IWP A;  4WJP A;  3A1Q A;  2KZR A;  2NPT A;  2N1V A;  3CF6 E;  3VTU A;  4JLC A;  1WR1 A;  1WXS A;  2LAS A;  3RZF A;  3SU8 X;  5HKH A;  3L10 B;  5E6P A;  2CKH B;  4RM9 A;  2K6D B;  4GN1 A;  2K8B A;  5IAA C;  5DPT A;  4MM3 A;  2C60 A;  2IBI B;  3WAO A;  4EKU A;  1RRB A;  1WI0 A;  2O6V B;  2AL6 A;  2M4N A;  2L8J A;  4M8N A;  2FCN A;  2MBH A;  2KN5 A;  2D07 B;  4IW0 A;  4W9K A;  4N9F 4;  1J19 A;  3WAP A;  2C9W B;  2KTF A;  2GBN A;  3WAN A;  4EEW A;  4EZL A;  1I42 A;  4W9C A;  4XZ4 A;  3T8M A;  4TQ0 A;  4GU2 A;  4IM2 A;  4X57 B;  4GDL B;  4WJN A;  3O65 B;  2LJ5 A;  3PTF C;  3A33 B;  4JL9 A;  3IG3 A;  1ZKH A;  2JRH A;  3RZW C;  1P1A A;  4BOZ B;  3PGE A;  3PT2 B;  2MP2 A;  2JT4 B;  3QC8 B;  4MDK E;  3DVN U;  4AWJ A;  2MLB A;  3R7Q A;  2AWT A;  2KX0 A;  2Z59 B;  2DYO A;  2IZV B;  4IUM B;  1NI2 A;  2AYO B;  2KWV B;  5KHQ A;  1ZGU B;  2WDT B;  3VFK A;  2OOB B;  2KTR B;  2Z0D B;  2KDE B;  2ZCC A;  1TTN A;  2LVO A;  3RCZ A;  4G0N B;  4J6I A;  2KMC A;  4ANX A;  1WYW B;  3LJ3 A;  4KDL B;  1OGW A;  2DAJ A;  2RPQ A;  3N30 A;  4BKS A;  1D3Z A;  2MBO A;  4AP4 C;  3JVZ X;  3VH3 B;  4GDK A;  3QHT A;  1OEY J;  2A5U A;  2FID A;  4EUT A;  4DHZ B;  5D2M B;  1OTR B;  3H7S A;  2BYE A;  4EOY A;  1S1Q B;  3A1Q B;  3H1U A;  4KSK C;  1UEL A;  4B6W A;  4EZJ A;  3U8Z A;  5JHA A;  2KLC A;  2IYD B;  4ANW A;  4LDT D;  1GG3 A;  1E8X A;  2V1Y A;  3L13 A;  2WX0 A;  3KUC B;  4YL8 A;  3ZUN A;  4BBN F;  3VXW A;  1A5R A;  5AZF A;  2L00 B;  2V3S A;  3QWZ B;  2EKE C;  2N9X A;  3A4R A;  3UQA A;  2JVC A;  3RD2 A;  2I1J A;  2L05 A;  2KTR A;  2DX5 B;  2D10 A;  4MEL A;  3RYT A;  2KJ6 A;  3BIN A;  2MWS B;  3ML9 A;  1YD8 U;  4BBN C;  2C5L C;  1VCB A;  2GOW A;  1TGZ B;  4DHJ B;  1OQY A;  2N9E B;  4BFR A;  4WWO A;  3R66 C;  3HK0 A;  3PLU A;  1KM7 A;  1E5W A;  3WIM A;  3CST A;  1SE9 A;  2J0M A;  3ZW3 A;  1H8C A;  2LVP A;  3UIP B;  4BKS D;  3LDZ E;  4BKG A;  2KX3 A;  3M95 A;  4HK2 A;  2XBB C;  2LXA A;  3HIZ A;  3C0R B;  3TIX A;  2GBK A;  1OEY A;  2BKF A;  3N3K B;  4GMV A;  4ZDV A;  2M8S A;  4GDL A;  2WYQ A;  2ZPY A;  2JPH A;  4HLE A;  1SGH A;  4HDO A;  4I6P A;  1U4A A;  2L76 A;  1WGG A;  3JW0 X;  5J17 A;  1IPG A;  5DCN A;  2R2O A;  1Q1O A;  5D7G A;  3EFU A;  4FUL A;  4JQW C;  2K8H A;  4W9F A;  2ZVN A;  1Z2M A;  2GMI C;  3A9K A;  2ASQ A;  4FN2 A;  4URK A;  4NAW A;  1F9J A;  3QJZ A;  3QIJ A;  3OLM D;  2O6V D;  5DPW A;  2JRI B;  4FBJ B;  4MGY E;  1WM3 A;  4TQ1 A;  2V4L A;  3DBR I;  2MCN B;  4MJS B;  2RGF A;  4XC2 A;  2LD9 A;  3A4S C;  2K8C A;  2WX1 A;  4AUQ C;  4GSW A;  2ZNV B;  3RUI B;  2D11 A;  1G6J A;  4GIV A;  2JZZ A;  4AJW A;  4NQL B;  2M1M A;  3WAM A;  1J0G A;  1BT0 A;  2NPT B;  4KZC A;  5DPR A;  5LXH A;  1UZX B;  1XT9 B;  2OJR A;  4DHZ E;  1E8Y A;  2BWE S;  2ZJD A;  1LQB A;  4MSM B;  3AXC A;  2LVQ A;  4KSL C;  1TBE A;  3D32 A;  2JUO A;  5CHV C;  1SIF A;  4MH0 E;  4W9D A;  1P98 A;  2MW5 A;  4NAW B;  3PRP B;  1WX7 A;  3JSV A;  2LUE A;  1R4N I;  4HPL B;  1E7V A;  4W9E A;  4E3C A;  1KLV A;  2CU1 A;  5EDS A;  2N1W A;  1IP9 A;  1L2N A;  2HD5 B;  1C3T A;  1UGM A;  3ZRF A;  4LJP B;  3VQI A;  1WJU A;  1WX9 A;  3AU5 A;  2NCN A;  3DVG X;  1WGD A;  2L3Z A;  3PV1 A;  4ZRI A;  2KC2 A;  4GDK B;  2XK5 A;  3A9J B;  3MTN B;  3VAW A;  2KJR A;  4A20 A;  2N7D A;  2LRW A;  4CO7 A;  3DVN V;  3UGB B;  4LDT B;  4MGI E;  2QHO A;  3QX1 A;  4BVU C;  2PEA A;  1GC7 A;  1UH6 A;  4G3X B;  2MP2 B;  1WGR A;  2Y5B B;  3DCG A;  3QQ8 B;  4HWI B;  4ICU A;  3H7P A;  2MBQ A;  4W9J A;  4CYE A;  2ZEQ A;  1E8W A;  3ZTD A;  3VDZ A;  1V5T A;  4LCD E;  2KKC A;  1WE7 A;  3OJ3 A;  2KFK B;  2KWU B;  4MJS A;  4WJO A;  2HTH A;  2L0F A;  5J2R A;  4DHJ D;  1WM2 A;  2KK8 A;  3KUZ A;  3TL5 A;  3PRE A;  2O6V A;  1I35 A;  3DPD A;  1GJZ A;  1ISN A;  1GC6 A;  4HCP B;  3B08 A;  3M63 B;  3A9J A;  4PYZ A;  1R4M I;  5CTR C;  2KNB A;  2C7N B;  1V80 A;  4BOS C;  1Q0W B;  3DQV A;  3VHT C;  1WXV A;  2YVC A;  3U30 A;  4DBG A;  4BKT A;  3L16 A;  3TCA A;  4F7Z A;  3PHW B;  3T9L A;  4IC7 B;  2KDI A;  3QAQ A;  2LZ6 A;  1WMH A;  1V86 A;  2NVU I;  2FNJ B;  3ZO5 B;  2EMT A;  2MX2 A;  4KVG B;  4DXA B;  3VUX A;  2K25 A;  5DPS A;  3ZNG C;  5LLI A;  2FUH B;  4E74 A;  2DYM A;  5JHB A;  1RFA A;  3RT3 B;  3ENE A;  3NS8 A;  3IHP C;  2G4S A;  3VUY A;  4IWQ A;  4NJ6 A;  2J7Q B;  3ZLZ A;  2C7M B;  5LXI B;  1TZ1 A;  4HCN B;  2LGY A;  1L7Y A;  2LGX A;  3PZD A;  3U7D A;  1V49 A;  4A3P A;  5AZH A;  4NQK E;  1Q5W B;  3ZNI D;  4GXB A;  4MGZ E;  2N4F A;  4RM8 A;  3M3J A;  4XX5 A;  3APD A;  2D2Q A;  3IVF A;  2DAF A;  3NY5 A;  3HM6 X;  5D6J B;  4K1R B;  3PLV A;  4ANU A;  3AU4 A;  5C1Z A;  3APF A;  1EF1 A;  2HJ8 A;  4M8M A;  4FHJ A;  3WA0 A;  2DZM A;  1WE6 A;  1WZ3 A;  1KJT A;  2XK5 B;  2DHZ A;  4TKN A;  5FR6 A;  1E90 A;  2ZZP B;  3RUL A;  1NBF C;  2MBE A;  4LJO B;  3I3T B;  2MA9 B;  4K7S A;  4FJY A;  3IFW B;  3DBL I;  2ZCB A;  3NHE B;  3Q3F A;  3ZNZ B;  1XD3 B;  3QAR A;  4EZK A;  1WF9 A;  2PE9 A;  2IO1 B;  1CMX B;  2NS5 A;  2KD0 A;  2BKR B;  3NZS A;  3OAW A;  4HDQ A;  2JXX A;  1WR6 E;  4DWF A;  1AAR A;  3W1Y A;  3KH0 A;  4II2 B;  4IM3 A;  1WX8 A;  4NNJ B;  1YQB A;  4FAD A;  3K9O B;  3Q3J A;  4GOC A;  1K8R B;  4KZ0 A;  3ZKJ C;  2KLG A;  3GOE A;  3KYC D;  2L0T A;  2O2V A;  2G3Q B;  4PS7 A;  2UYZ B;  1LXD A;  4FLH A;  1WJN A;  3K9P B;  1WY8 A;  3DVG Y;  4NY0 A;  4OVV A;  2NBV B;  5CHW A;  1WZ0 A;  4I6N B;  3PHX B;  2REX A;  3BY4 B;  1YJ1 A;  2J0J A;  2EMS A;  1M94 A;  4I6L B;  1LFD A;  4FA6 A;  2ZPN A;  5L95 C;  1YIW A;  1WGH A;  4B9K A;  3ZVV A;  3B1L X;  2FCS A;  2M17 A;  3DBH I;  4FHK A;  5G2N A;  4TUU A;  3JSV B;  2AL3 A;  4AOF A;  3A9K B;  1VD2 A;  2BGF A;  2DYB A;  2KJH B;  4KV2 A;  2CHW A;  4EFO A;  2DZJ A;  3V60 A;  4A3O A;  3DOW A;  2XEW A;  1MG8 A;  1EUV B;  3S2A A;  3X23 A;  1JRU A;  2JZ3 B;  2O2V B;  1WJ4 A;  5CX3 A;  3CSF A;  4K7W A;  4PYU A;  2PPH A;  1XQQ A;  3ML8 A;  3SHQ A;  1HE8 A;  2NBU A;  2MBB B;  4HXD A;  3N32 A;  3PRZ A;  2NBW B;  2CS4 A;  2KDB A;  2MQJ A;  4GB9 A;  2KDF B;  2KFJ A;  2VRR B;  1V9J A;  1WH3 A;  2IO0 B;  3AUL A;  2NR2 A;  1WGY A;  1Y8R C;  2ZVO A;  4HVB A;  2BPS A;  1LM8 B;  2J0K A;  5D94 A;  1V6E A;  3L17 A;  3ZNH B;  3HM3 A;  3VTW A;  5AEK B;  2UWQ A;  1C1Y B;  3EHV A;  1WFY A;  1V5O A;  3JYU A;  4W9H A;  4FJZ A;  4ZRK A;  2K1F A;  2C7H A;  2G45 B;  4WWN A;  1S3S G;  2IO3 B;  5JH5 C;  4NJ7 A;  1WXA A;  4WJQ A;  3ZTC A;  3V6E B;  2DZI A;  4GGQ A;  4FJV B;  1T0Y A;  2PJH A;  1YX5 B;  2FCM A;  2IY0 B;  2KAN A;  3L54 A;  5G55 A;  3H7P B;  4B95 A;  3ZDM C;  2HE7 A;  4F1S A;  2IY1 B;  3QA8 A;  2KO3 A;  4ZRJ A;  3AI5 A;  4MGK E;  2RR9 A;  4K7U A;  3ZDT A;  2MRP A;  3UF8 A;  3DBS A;  1V2Y A;  1NDD A;  3H9D A;  1H4R A;  3VH4 B;  2N9P C;  3VUW A;  4II3 B;  4OVU A;  2W9N A;  1E8Z A;  5J18 A;  3TBL D;  1RAX A;  5GMV A;  5E6N A;  2JWZ A;  5BO4 B;  2DZK A;  3KYD D;  4WAA A;  2FCQ A;  2BF8 B;  1WRD B;  4KDI C;  4IM0 A;  2GBR A;  3KW5 B;  3MJW A;  3PSE B;  4RMA A;  4ANV A;  3TMP B;  4DDG D;  2KOX A;  1FXT B;  2RD0 A;  3OJ4 B;  3QCA A;  3ZIM A;  2AEH A;  2L7R A;  2FIF A;  3H6N A;  3L0W B;  2KQ7 A;  3EEC A;  4KIK B;  5TR5 A;  1E7U A;  4WQO B;  4IWO A;  3W1S A;  4W9I A;  4W9L A;  2GBJ A;  2KVR A;  4WWP A;  1WJ6 A;  4JIO U;  3B0A A;  5L83 A;  3PRM B;  2DEN B;  2GBM A;  3ONS A;  5C23 A;  1PQS A;  3SD5 A;  1WMH B;  3ZRC A;  2WWZ A;  3L08 A;  2KWC A;  3V61 A;  3UQB A;  2G4D B;  3IBE A;  4W9G A;  3M62 B;  1UD7 A;  3P2B A;  4AJY B;  5IA7 A;  3DDC B;  2D3G A;  1V81 A;  2Z0E B;  3SDL C;  3QK0 A;  4MSQ B;  2BWF A;  3MHS D;  1P3Q U;  4ICV A;  3W1S C;  1GUA B;  1X1M A;  4ZYN A;  2N7E A;  3PPA A;  1UBI A;  3GZN I;  2KHW B;  3VVW B;  4ASW C;  1P0R A;  2BYV E;  1WXM A;  4P7I A;  2K39 A;  2KFK A;  2ZNV C;  2LWP A;  3UIO B;  2LXC A;  5CHF A;  2JY6 A;  2K6Q A;  3APC A;  2A4Z A;  2LGD A;  4M0W B;  1ZW7 A;  4MEM A;  1IYF A;  3KUD B;  3NOB A;  4NPN A;  5E6O A;  3ALB A;  2R2Q A;  4F8C B;  1P9D U;  1EO6 A;  3UIN B;  2KMA A;  2KC1 A;  2LI5 A;  2M0X A;  3ECI A;  3R7R A;  2JF5 A;  1QZE A;  3R3M A;  1WIA A;  1EF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...