3KUZA

Crystal structure of the ubiquitin like domain of plxnc1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
110
structure length
110
Chain Sequence
QGTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYGLQLNEIGLELQMGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plexin-C1
publication title Crystal structure of the ubiquitin like domain of PLXNC1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 28
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3kuzA00
3IVFA 3KH0A 4MGKE 4M8MA 4NAWA 3ZDMC 4MH0E 3GOEA 1NDDA 1WXAA 4B95A 3DBSA 2IY1B 2KVRA 3LJ3A 1CMXB 1J19A 1MG8A 3UQAA 5LLIA 1V5OA 4DDID 4W9EA 2CU1A 2DZJA 1WM2A 4K81A 2DZMA 3OLMD 5JH5C 4ICVA 5AZHA 2G3QB 5DCNA 3PRPB 3PVLA 2LVPA 2K39A 4YL8A 1Q5WB 3JW0X 1EO6A 4WJPA 2WYQA 4IWPA 4ZRJA 2C7HA 4DWFA 1WIAA 4K7SA 3QQ8B 4K7WA 1WYWB 4HXDA 3KYCD 4HDOA 4HVBA 3EHVA 1WJ6A 1UGMA 2LGDA 3QCAA 2N1WA 3NS8A 4TUUA 4B9KA 3A1QA 2KTRB 2KXJA 4BVUC 1NI2A 2Z0DB 4BBNC 2BGFA 2RSUA 2MBBB 1PQSA 4BKTA 4DHJD 1QZEA 1RLFA 3N32A 2G45B 1V9JA 2KDEB 2Z0EB 4M8NA 5CHFA 5D94A 3W1SC 1U4AA 4EUTA 3QWZB 3VH3B 2KK8A 3H7PA 1H4RA 2K8HA 3A9KB 2FIDA 2ZVNA 2JRHA 3N30A 4DDGD 5LXHA 3L54A 2J0MA 2KWCA 3TIXA 2PPHA 4MGIE 1V5TA 1OTRB 1P9DU 5BO4B 1WM3A 4DHJB 1Z5SB 3VQIA 3X0WA 2BYEA 3WALA 2LASA 3PRZA 3OAWA 3DBLI 2NBUA 4F8CB 4GDKB 2O6VA 5DPSA 2DYBA 3ZNHB 2KC1A 1Q0WB 2DHZA 1V80A 4BOSC 3HM6X 2B3AA 5E6OA 2R2QA 1P0RA 2V4LA 3ZDTA 3ZO5B 4ZDVA 1L7YA 5IAAC 1WMHB 3QAQA 5G2NA 4BBNF 2KHWB 2L7RA 4IM3A 1ZW7A 2AYOB 3TBLD 4ANVA 4X57B 2VRRB 3WAOA 2MQJA 4GDKA 3IG3A 1TBEA 3RZFA 3EECA 1LXDA 1V81A 4M0WB 3RD2A 2BPSA 2L76A 3DOWA 3UGBB 4EKUA 4IC7B 3VUWA 1D3ZA 2M1MA 2BYFA 2AWTA 3ONSA 1Y8RC 2IBIB 2JWZA 2KDFB 4WJQA 2JPHA 2LRWA 1OGWA 3M63B 2J7QB 3OJ3A 4FJVB 1WMHA 4MM3A 4GOCA 2UWQA 3RUIB 2RR9A 2MP2B 1R4NI 4JGHB 1E8ZA 5CTRC 3D32A 1T0YA 3A9JA 2BF8B 2NBVB 1WZ3A 3QC8B 2EMSA 2FNJB 3ZRFA 3ALBA 2LD9A 4W9JA 3ZTDA 2EKEC 4GMVA 3L13A 3U8ZA 1WXVA 2ASQA 3U30A 4FHJA 3VDZA 2DZIA 4B6WA 4EFOA 1IYFA 2CS4A 2IZVB 3B1LX 3PV1A 5CHWA 2KO3A 2JY6A 4KVGB 4NY0A 3VH4B 1KLVA 1WXMA 3W1SA 2NPTA 2GMIC 2N1VA 4NQKE 1OQYA 2LRUA 2MP2A 2KOXA 2L8JA 2KLCA 3S2AA 2JZ3B 5KHQA 2XK5B 2K25A 1BT0A 1S1QB 2IYDB 3TCAA 2O2VB 4GU2A 2KWVB 5AEKB 5CHVC 3A4RA 2WX0A 4LDTB 4KZ0A 3UF8A 5J18A 1WJ4A 3GZNI 1EF5A 2FCSA 4G0NB 5HKHA 1EUVB 2R2OA 3UQBA 4J6IA 2FCNA 2MLBA 4IWOA 3SD5A 4G11A 4RMAA 2LZ6A 2I1JA 1WGHA 4MJSA 4A20A 3KUDB 4MEMA 1V49A 4DK5A 1UELA 4WQOB 4IM2A 3ZIMA 4PS3A 3M3JA 4NQLB 3V6CB 3TMPB 4W9DA 4XX5A 3Q3JA 3JYUA 4AJYB 2ZVOA 5E6NA 2KNBA 4AP4C 2CR5A 2MBOA 3A33B 4II3B 3WAMA 1H8CA 1WRDB 3PPAA 4TKNA 1VD2A 3UINB 2MX2A 3DVNU 3KUCB 5DPWA 3PT2B 3H7SA 3QHTA 2K8BA 1SIFA 3ZRCA 3ECIA 2DYMA 2GBJA 4F7ZA 4WAAA 2D10A 2IO2B 2RGFA 4FADA 5C23A 4BKSA 4AUQC 2J0KA 2GBRA 3NHEB 2KTFA 3A4SC 3ZKJC 1TGZB 3QIJA 1P98A 1WXSA 4HPMB 3VUYA 1HE8A 1NBFC 1SE9A 1UH6A 1WH3A 2NS5A 1E8WA 3ZNID 3OJ4B 1WX8A 3APDA 4ICUA 4LCDE 2MRPA 1WJUA 1LQBA 2JF5A 2W9NA 3KYDD 3QARA 1RAXA 4GIVA 2KJ6A 2O6VD 2V1YA 5D7GA 4W9CA 4HPLB 2LJ5A 3M95A 1AARA 3DCGA 5JHAA 1KJTA 2KTRA 1L2NA 4IG7B 2RD0A 4DBGA 3V6EB 3DPDA 2JXXA 3HK0A 1IPGA 4WJNA 3K9PB 3BINA 4EZJA 1OEYA 1EF1A 1GNUA 3VTWA 4KSKC 4HK2A 5C1ZA 1UBQA 3A9KA 2MA9B 3UIPB 4A3OA 2QHOA 4FBJB 2NBWB 1WY8A 4MSMB 3RZWC 1I42A 4JIOU 1KOTA 3H1UA 3APCA 1WFYA 3P2BA 4HDQA 4MELA 3HHMA 2LWPA 4DHZB 1WX9A 4PS8A 4F1SA 3IFWB 3QX1A 2BKFA 2L0FA 2C9WB 2LXCA 2ZNVC 3H6NA 4GDLB 3PGEA 4KV2A 3VTUA 1GJZA 2ZEQA 2NCNA 4G3XB 5EDSA 2N7EA 4KIKB 1YD8U 5FR6A 1TTNA 3B08A 3N3KB 2FIFA 4KSLC 4BKGA 3VFKA 2N7DA 4RM9A 3VHTC 2DAFA 4PS7A 4W9FA 3EFUA 4W9HA 3Q3FA 2JVCA 1FXTB 2KJHB 1J0GA 1SGHA 1Q1OA 1P3QU 3BY4B 3MHSD 4K1RB 3V60A 3SU8X 3WIMA 4CHKA 3TL5A 3KUZA 3DVNV 2KD0A 5DPTA 2ZCCA 2UYZB 4EOYA 3HM3A 3SHQA 3VVWB 2LGXA 2NR2A 1LFDA 2DX5B 3PS6A 2N9PC 2FCMA 1WR1A 2JT4B 2K8CA 3ML8A 4AOFA 3KVFB 4TQ1A 2WDTB 1YIWA 2KX0A 1WF9A 4NPNA 2A5UA 2KMCA 2M4NA 3RCZA 4KDIC 5J2RA 2FCQA 3NOBA 4WWPA 1JRUA 2J0JA 1E5WA 2HJ8A 1E8YA 3ZW3A 4I6LB 5JHBA 3JVZX 2L0TA 2KFKB 5CX3A 2D2QA 4CYEA 1WR6E 2PE9A 2N9EB 2KZRA 4HWIB 4W9KA 2KC2A 1ISNA 4A3PA 4WWNA 3O65B 5KHOA 2XK5A 2N9XA 2O2VA 4GSWA 3APFA 4GXBA 2CHWA 4CO7A 1GC7A 1XD3B 4EZKA 2YLMA 2G4SA 3ZUNA 4FA6A 4WJOA 3MJWA 1X1MA 2D11A 4IWQA 4NJ7A 4N9F4 2GBNA 4E74A 1WGYA 2K6DB 2ZCBA 2ZPYA 2XEWA 4IUMB 2GBKA 4W9LA 3PSEB 5L95C 3CSTA 1GC6A 1RRBA 4FN2A 3EC8A 1S3SG 2C60A 2IO1B 1Z2MA 2PEAA 3RT3B 2K6QA 5TR5A 5DPRA 3VXWA 2EMTA 2IO0B 2OJRA 2KQ7A 1LM8B 4IW0A 4MGYE 2HTHA 2DAJA 3AU5A 3PHXB 1A5RA 2KMAA 2L00B 2D3GA 1GG3A 3A1QB 3NZSA 2N4FA 3K9OB 4GB9A 2KLGA 2LGYA 2GBMA 3DDCB 1YQBA 4K7UA 4EZLA 4FLHA 4ANXA 2HD5B 3QJZA 3IBEA 5LXIB 2OOBB 2ZPNA 3L10B 3PLVA 2CKHB 2BYVE 2CHZA 4KDLB 4BOZB 4JQWC 4HCNB 2XBBC 5E6PA 3H7PB 2A4ZA 4ANWA 2KJRA 2IY0B 1M94A 5G55A 1ZGUB 2IO3B 4GN1A 1V2YA 5J17A 3L0WB 4G50A 4FULA 4ZRKA 3DVGY 2KX3A 4ASWC 3PHWB 2PE6B 4MDKE 2M8SA 4EEWA 1E7VA 4PYUA 1WX7A 3WA0A 5IA7A 4PYZA 1UBIA 3TJPA 3ZTCA 4AWJA 2YVCA 3AI5A 3IHPC 3RULA 3UIOB 3WAPA 1I35A 3H9DA 2D07B 1R4MI 2JUOA 2LI5A 3LDZE 4KZCA 5L83A 2GOWA 2O6VB 1C3TA 3U7DA 4HCPB 4XC2A 3V61A 1XQQA 2AL3A 3B0AA 2MBHA 2BWES 2KKCA 1WZ0A 2LVOA 2ZZPB 1GUAB 3NY5A 4LJPB 4FJYA 2C7NB 2JZZA 1UD7A 3CF6E 2REXA 1C1YB 4LJOB 2KANA 3JSVB 3X23A 2LUEA 3VAWA 4FHKA 3ZVVA 3L16A 4NNJB 2L3ZA 1XT9B 3PRMB 2PJHA 2MSED 4W9IA 3R7RA 4TQ0A 3L17A 3T9LA 3ZNGC 4ANUA 1WGGA 1TZ1A 3C0RB 2KWUB 5AZFA 1WE7A 2KDIA 2AEHA 4GDLA 1KM7A 4JL9A 4DHZE 2I1KA 3JSVA 2K1FA 1F9JA 4MSQB 3ZLZA 4NJ6A 1J8CA 2KDBA 3T8MA 4OVVA 1WGDA 4KIKA 4HLEA 1WI0A 3A9JB 3DBRI 3AU4A 2DZKA 4JLCA 3HIZA 1ZKHA 3ZNZB 3PREA 2MBEA 3V62A 4BFRA 4E3CA 1YJ1A 2C7MB 1UZXB 2KN5A 4ZRIA 4ZYNA 3AXCA 4FJZA 3DVGX 3DBHI 4AJWA 4WWOA 2JRIB 3W1YA 3SDLC 4I6NB 3R66C 2NPTB 4P7IA 4RM8A 1IP9A 2DYOA 4MGZE 3AULA 3R3MA 2G4DB 3VUXA 4II2B 4E71A 3NZUA 1V86A 2FUHB 4W9GA 2WWZA 2MCNB 2MW5A 2ZJDA 2Y5BB 1VCBA 1G6JA 2V3SA 2KQSA 2KFJA 3PZDA 2BWFA 2DENB 5D2MB 4DXAB 3ML9A 4XZ4A 2RPQA 3RYTA 2NVUI 3PTFC 3L08A 1E7UA 5JZEB 4LDTD 2LXAA 2ZNVB 5D6JB 2M0XA 2HE7A 1RFAA 4IM0A 3ENEA 4URKA 2Z59B 3MTNB 3WANA 1P1AA 2C5LC 4I6PA 1WJNA 2FAZA 2LVQA 1E8XA 5GMVA 1YX5B 3KW5B 3M62B 3QK0A 1YX6B 4NAWB 3I3TB 3R7QA 1OEYJ 4HJKA 4MJSB 2L05A 2MBQA 3CMMB 3QA8A 1K8RB 2MWSB 3DQVA 1WE6A 1V6EA 2WX1A 1E90A 2KFKA 5AZGA 3CSFA 4TV3A 4GGQA 2AL6A 2BKRB 3VTVA 2M17A 1WGRA 4BKSD 4OVUA 3PLUA 2CHXA
chains in the Genus database with same CATH superfamily
3KH0A 1B9RA 2ICIA 4NAMA 1WXAA 4YSXB 2Z8LA 4OZAA 4W9EA 4K81A 1GPXA 5HG2A 3PVLA 2K39A 3JW0X 4WJPA 4ZRJA 1L0YB 4DWFA 5I4DA 4K7SA 4MACA 3KYCD 1WJ6A 4HROA 2N1WA 2N9KA 2RSUA 2MBBB 4ITKA 4KGRA 1PQSA 1RLFA 5CHFA 2KDEB 4EUTA 3QWZB 2WXKA 3H7PA 2K8HA 2FIDA 3AE8B 2JRHA 1BXTA 5LXHA 2PPHA 1P9DU 1R4MB 3VQIA 2BYEA 2LASA 3PRZA 1KRHA 2B3AA 3RMKC 4US9A 1F0ZA 4AQ7A 1RM6C 1TKYA 2BT6A 1XLQA 2AQ3B 4BBNF 1FNWA 4ANVA 1ZUD2 3WAOA 2MQJA 3O13A 2Q5WD 4MT5A 2QIEB 3EECA 1LXDA 1V81A 4M0WB 3RD2A 3UGBB 1N63A 2BYFA 4N58A 1N61A 1F2RI 2JPHA 3OJ3A 2J7QB 4MM3A 2UWQA 3RUIB 4JGHB 1T0YA 5H8YE 3A9JA 2QSDA 1K53A 2BF8B 1WZ3A 1N6ZA 2EMSA 4A9AA 3TEYA 3AEFB 2NTSA 1IYFA 3VDZA 4EFOA 2CS4A 5CHWA 4KVGB 2NPTA 4NQKE 3MC0B 5KHQA 1WWTA 1QKZA 2YEPB 2N7JA 5CHVC 4LDTB 5J18A 1EF5A 1EUVB 4IDIA 3UQBA 4IKGA 4MEMA 1UELA 4YTPB 4IM2A 3GB1A 2EELA 3TMPB 4W9DA 4XX5A 2JQRB 1T3QA 2KNBA 3WAMA 1XLNA 1WRDB 3PPAA 2MX2A 1CK1A 2GI9A 2LGSA 1GB4A 2J53A 4WAAA 2IO2B 4AUQC 3A4SC 3QIJA 4RGTA 1WXSA 3AE9B 2NS5A 1E8WA 3ZNID 3KYDD 4GIVA 2O6VD 3GP7A 4HPLB 3M95A 1AARA 3DPDA 2D5GA 3HK0A 3N1YC 4K3CA 3PO0A 4EZJA 1GNUA 3VTWA 1CQVA 3UIPB 4FBJB 2PKOA 2RMMA 1KOTA 1WGKA 4HDQA 4MELA 4PS8A 4F1SA 3IFWB 3VTUA 3H6NA 4KV2A 2LXCA 2ZNVC 4G3XB 2E6XA 5EE3A 3Q2AC 3SFEB 2FIFA 1ESFA 4LK0M 2N7DA 4RM9A 1XLOA 3BK2A 1SJHD 3V60A 3TL5A 3KUZA 3ZJUA 1LO5D 5D3DA 3BVZA 3BYYB 4EOYA 2LGXA 2DX5B 3PS6A 1J7CA 2N9PC 1WR1A 3ML8A 2K8CA 5AUKA 3KVFB 3ZGZA 3I57A 3RCZA 4KDIC 1ENFA 2QMTA 2FCQA 2N0SB 3NG0A 2PMVA 1E8YA 3ZW3A 4I6LB 5CX3A 4CYEA 2WXJA 1K50A 1ISNA 4JE3B 4A3PA 3HRDD 3O65B 5KHOA 2XK5A 4PK1A 3Q8BA 2CHWA 2QC8A 1XD3B 1C77A 1OQQA 1X1MA 2GBNA 2K3UA 1JALA 3PSEB 4MH8A 1RRBA 1SF0A 2EMTA 1ZDXA 2KQ7A 3PHXB 3GS2A 4RH6A 2L00B 2D3GA 1PYWD 2N4FA 4GB9A 3K9OB 4WWMA 1DOIA 1T0RC 1FNUA 3QJZA 3SFDB 4HPPA 1TS4A 1D5MC 4BOZB 4HCNB 5HHDG 2KJRA 1M94A 3MHZA 1V2YA 4G50A 3DVGY 3RNGC 1FIQA 5BMGA 3UI3A 4ASWC 4MDKE 2M8SA 1NYQA 3TJPA 4AWJA 2L32A 2YVCA 3RULA 1OFFA 2D07B 1HTQA 3AV8A 2O6VB 4LNIA 3OWEB 2AL3A 1YQ3B 1SE3A 3W5VB 4WAFA 4LJPB 2WDVB 2JZZA 1UD7A 2LMCA 3VAWA 1ZPSA 2L3ZA 5C2TB 1XT9B 3DWMA 2M56B 5EE0A 4C4VA 2BW2A 3C0RB 1WE7A 2AEHA 4GDLA 1KM7A 3GE3C 2I1KA 2K1FA 4FXCA 1J8CA 5C3JB 4HLEA 2XNAC 4HEA1 2CJNA 2DZKA 1MFWA 3DWGC 1ZKHA 3ZNZB 3PREA 4ZRIA 2KN5A 3V3XA 3AXCA 3WCQA 3DVGX 4AJWA 2JRIB 4LNKA 4I6NB 2GLSA 3R3MA 4E71A 2L1AA 2Y5BB 4P6VF 2BWFA 1VRAB 3ML9A 2RPQA 2WXOA 1M4VA 1FMAD 3ENEA 4URKA 3MTNB 2ONQA 2C5LC 2LVQA 3AMZA 3M62B 4DXGA 4NAWB 4MJSB 1K8RB 3DQVA 1V6EA 1E90A 3AN1A 3P4QB 3CSFA 4GGQA 2BKRB 1R7SA 2M17A 4OVUA 3CIRB 4M8MA 4NAWA 4JWSC 1NYRA 5IP4D 2WXHA 1PGBA 1VLBA 2KVRA 4OZBA 1TKEA 4QAYA 1WYGA 1WSPA 1ZOYB 5LLIA 3P42A 1V5OA 4DDID 2CU1A 1WM2A 4P16A 3OLMD 3EFCA 5DCNA 3PRPB 4YL8A 2MHJA 4RGOS 1WIAA 1WYWB 3NS8A 4B9KA 3A1QA 2KXJA 2WDRB 1QZEA 3N32A 1V9JA 4M8NA 3W1SC 1U4AA 3V05A 1KH0A 2KK8A 3VH3B 3C19A 1KLGD 2ZVNA 1JW9D 3N30A 4BZAA 2H89B 2BYTA 1WM3A 3WALA 3OAWA 2NBUA 4F8CB 5DPSA 3VRAB 1Q10A 1KTKA 3MJ5A 2HDEA 2R2QA 4ZDVA 1JCKB 1L7YA 3VR9B 2Y3AA 5G2NA 2KHWB 1JWAD 2AYOB 2KQ4X 2EKIA 1TBEA 1UWXA 4LNNA 1IGCA 4TMAB 2L76A 4EKUA 3VUWA 1D3ZA 2M1MA 2AWTA 3ONSA 2IBIB 2JWZA 4WJQA 2LRWA 3EGRA 4XE0A 4GOCA 5H92C 1F77A 1D6EC 2RR9A 1R4NI 3D32A 3KWVA 2NBVB 3ZRFA 1V1PB 3ZTDA 2EKEC 3VRBB 4S0RA 2ASQA 4FHJA 4KGTA 3OG5A 1YN4A 3PV1A 1L4ZB 1EM7A 2N1VA 3RNEC 1OQYA 1DYQA 4XGAB 1SB3C 4WH4A 3TCAA 4NJCA 1N60A 2WX0A 2W54A 3R2TA 3HUIA 2FCSA 1F52A 2R2OA 3SR6A 2FCNA 3SD5A 2LZ6A 2SEBD 4AS1A 3M3JA 4NQLB 3V6CB 3Q3JA 1C9FA 5E6NA 3ZJVA 2MBOA 4II3B 4XDCA 2RDGA 1FCLA 4TKNA 3DVNU 3KUCB 5DPWA 4YTMB 3H7SA 3QHTA 2BQQA 5D3IB 1SIFA 2DYMA 1L6UA 2LUMA 2RPVA 4FADA 2J0KA 3ZKJC 1T5XD 1P98A 3TEWA 1QOGA 1HE8A 3EA6A 2ZW1A 4A90A 1UH6A 3P4PB 3OJ4B 3APDA 4ICUA 1LQBA 5D7GA 2WU2B 2WXRA 3AH7A 3KQ4A 3K9PB 3LYYA 2WHIA 4KSKC 4KKIA 4RGNA 1I42A 1WY8A 4MSMB 3W9CB 2AX5A 4HKZE 3H1UA 3P2BA 1J7BA 3AM9A 1WX9A 2C9WB 4CQNA 2ZEQA 1L4DB 2NCNA 5EDSA 2N7EA 1K52A 4KIKB 5FK9C 1EWCA 1NEKB 2W82A 4BKGA 3IAS1 3EFUA 4W9HA 3Q3FA 2JVCA 3DBRB 3BZDB 1J0GA 2KWDA 1BUIC 2GB1A 1P3QU 3BY4B 3MHSD 4K1RB 4M0WA 4RCOA 4H2AA 4CHKA 2WNMA 3DVNV 4M02A 2D3AA 2ZCCA 3SHQA 2JU6X 3VVWB 2NR2A 1R4NB 2JX5A 3B2FA 4NZLB 2PTLA 2KX0A 1WF9A 2KMCA 2M4NA 5J2RA 3NOBA 4WQMA 3Q3OC 1JRUA 2LEKA 2Y5CA 5JHBA 3W5UB 3JVZX 2L0TA 1QOBA 1WR6E 2N9EB 5IO9A 3DHIC 2JXTA 4HWIB 3N1ZC 1MG4A 4LLGM 3ZQ4A 4GSWA 4A6QA 2HJ1A 1JWUD 2YLMA 2G4SA 2LHDA 2NTTA 3W2DA 1NI3A 3E9SA 4NJ7A 1WGYA 4IUMB 2E3TA 2GBKA 5L95C 2PVOD 1MHXA 2BTEA 1XCQL 2IO0B 1TIFA 2M0AA 1GB1A 4IW0A 2HTHA 2L52A 1SE4A 4ZRQA 2KLGA 2GBMA 3DDCB 1L0VB 1IUEA 3AE5B 3IBEA 3VR8B 2BBCA 4KDLB 2IPKD 4ANWA 1YJIA 4L2YA 1T0QC 1ZGUB 2IO3B 4GN1A 1FD6A 5J17A 4FULA 1JQ4A 3ETRA 3PHWB 2PE6B 4PYUA 3WA0A 1WX7A 2RDBC 4PYZA 3ZTCA 3AI5A 3IHPC 3UIOB 1YMHE 3WAPA 3MFGA 1I35A 4KZCA 3KLSX 2IJ0A 3U7DA 3RI7C 4LNFA 4HCPB 4XC2A 1XQQA 2MBHA 2BWES 4LTUA 4RF0A 2V3NA 1GUAB 5TSSA 4FJYA 2C7NB 3URYA 1E9MA 2REXA 4LJOB 4BAXA 2VH2A 3BK1A 1A70A 3PRMB 3FKYA 4TQ0A 1I4RA 3L17A 3T9LA 2SAKA 3ZNGC 3Q8AA 1TZ1A 3L4PA 2KDIA 3ZLZA 1TT5B 3T8MA 5EE1A 2TSSA 1WI0A 3MC8A 3AU4A 3T3OA 3AEBB 1XXGA 3HIZA 4BFRA 4E3CA 1YJ1A 2XN9C 2WXQA 3DBHI 4WWOA 4REZA 3SDLC 3R66C 4P7IA 4RM8A 1PUTA 4MGZE 3R2IA 2JZPA 5HFYA 4II2B 1UWMA 3NZUA 2MW5A 1FCCC 1VCBA 2KQSA 1D4BA 2IDYA 4XZ4A 3L08A 3B9JA 1YNTE 1RFAA 2HE7A 4IM0A 2Z59B 3WANA 1P1AA 5BYQA 3KW5B 3QK0A 1L5PA 3I3TB 3R7QA 1OEYJ 2L05A 2MBQA 4PT5A 2WX1A 1ZE3D 2ACZB 2WDQB 4TV3A 1CJEA 1I4XA 3NVVA 3VTVA 1XO3A 3PLUA 1SBBB 2CHXA 3IVFA 4MGKE 3N20C 3GOEA 3P4RB 4B95A 2IY1B 2QEJC 1J19A 3UQAA 4GLSC 2DZJA 4N6EB 4ICVA 5AZHA 2G3QB 1B1ZA 1L0XB 1SE2A 4IWPA 2C7HA 4K7WA 1IGDA 3EHVA 2LGDA 1ACCA 3QCAA 1EU3A 2KTRB 4BVUC 4BBNC 2BGFA 3RNCC 1NVID 5JXVA 2G45B 3AE6B 2Z0EB 3NZ3A 5D94A 4B0MA 2QDFA 3U7ZA 2OHFA 3A9KB 2BS3B 2N9LA 4DDGD 2KWCA 4MGIE 3RNAC 1V5TA 5BO4B 4DHJB 1FM0D 1Z5SB 1N62A 3DBLI 2DBYA 2O6VA 2DYBA 4J3OD 3ZNHB 1Q0WB 2DHZA 1TY0A 3PZ7A 5BYSA 2H88B 1VR9A 5E6OA 5T8IA 2V4LA 4IOIE 4D2KA 1D5ZC 1WMHB 2L7RA 4IM3A 1ZW7A 3TBLD 4X57B 2V3PA 2VRRB 2J42A 4WIPA 3AE2B 3RZFA 2PW9A 2BPSA 2WLBA 3DOWA 2WP9B 4IC7B 3Q3MC 2WXGA 1Y8RC 2INPE 3KWLA 3M63B 1OGWA 1WMHA 1J7AA 5CTRC 1PGAA 1XCTL 1TS2A 2FNJB 2LD9A 4W9JA 4GMVA 3L13A 3U8ZA 1SSNA 2MJ3A 4K3BA 3DBHB 3U30A 4B6WA 2DZIA 4KGSA 2IZVB 1JROA 3P4SB 4NY0A 2JY6A 4XWWA 2GMIC 2KOXA 2KLCA 3S2AA 2JZ3B 1BT0A 2O2VB 4ZHOA 4GU2A 1K51A 1I4QA 2KWVB 5AEKB 1SEBD 3A4RA 2LJIA 4KZ0A 2WXMA 2WXNA 1WJ4A 2GRIA 2IGDA 3GZNI 2W3RA 5HKHA 3IT6B 2MLBA 4IWOA 1D5XC 5MPOA 2BB5A 2KDMA 1WGHA 4MJSA 4A20A 2X8XX 3KUDB 1WRIA 4DK5A 4WQOB 2BS4B 2UU7A 4PS3A 3ZIMA 3NUHB 1QILA 3JYUA 1I4GA 4AP4C 5LNK1 3A33B 3UINB 3BVMA 4P1BC 5FR3A 2K22A 2K0PA 1TY2A 2VH1A 2CU3A 1E10A 4F7ZA 2RGFA 5C23A 1T6BX 3NHEB 1SIJA 2KTFA 1TGZB 3NRZA 2INDC 3P63A 2DNFA 1C79A 3SEBA 1WX8A 1WJUA 1KFYB 2JF5A 2MEKA 2W9NA 4C56C 1RAXA 2KJ6A 2LJ5A 1L2NA 1KJTA 4IG7B 1IPGA 4WJNA 4RF1A 1EF1A 2WXPA 1TJEA 1UBQA 2MA9B 4RGMA 2QHOA 3RZWC 4JIOU 2WS3B 5IKCM 4C00A 3APCA 5AUIA 1HZ5A 3RNBC 3HHMA 4OW0A 2MJEA 2D3CA 2BKFA 3PGEA 1GJZA 1IBXB 3MP9A 5FR6A 1TTNA 3B08A 4KSLC 3I63C 4YSYB 3U4EG 2DAFA 4PS7A 1GAQB 2WXFA 3Q69A 2KJHB 1JMLA 4ZYSA 1Q1OA 3SU8X 3WIMA 2WXLA 4A55A 3HM3A 1FFUA 1LFDA 3BYTB 2KMMA 4YTNB 2FCMA 3FC4A 1YIWA 4KKJA 2A5UA 1V1PA 4L23A 3BIID 3FAHA 2J0JA 1WXQA 1E5WA 2HJ8A 4C80A 1HA5A 2KFKB 1VZ8A 2PE9A 4W9KA 2KC2A 1F1HA 4WWNA 4GXBA 4CO7A 1GC7A 1RFKA 2BVCA 2HTME 2WU5B 3GZNB 3ZUNA 4FA6A 2MJDA 4IWQA 4E74A 2K6DB 2ZCBA 1I7HA 1XF5L 1XEEA 4W9LA 2QCZA 4US8A 4FN2A 1LGRA 1S3SG 2PEAA 3RT3B 2K9XA 3H8HA 5EE9A 2K6QA 5TR5A 5IN7A 2KN4A 5DPRA 3VXWA 4ARIA 1A5RA 1AN8A 1VZ6A 1TS5A 1ZXIA 1C78A 2LFIA 1YQBA 4EZLA 4FLHA 4XWTA 4ANXA 1ET9A 1SXTA 5LXIB 2OOBB 2ZPNA 3L10B 3PLVA 2CKHB 2J52A 4JQWC 5E6PA 2XBBC 3H7PB 2A4ZA 2IY0B 2ZW0A 5G55A 3L0WB 1PFDA 2KX3A 1QOFA 1UGJA 1EWYC 4EEWA 5IA7A 1FRRA 1ZDVA 5HI1A 4ZOHC 2K5PA 2JUOA 5L83A 2DLBA 3V61A 1TZOA 2AQ1B 2KKCA 1WZ0A 2LVOA 2ZZPB 3NY5A 4RNAA 1VJKA 1C1YB 2KANA 3X23A 3ZVVA 4ARCA 1L6VA 3L16A 4NNJB 2PJHA 4W9IA 1WGGA 3U52E 4ZHPA 1KF6B 1HQRD 2KWUB 5AZFA 5BMIA 1FRDA 1N5WA 4MM3B 4JX1C 1F9JA 4OVVA 4KIKA 3A9JB 2G9HD 3T3NA 2PVGC 1HTOA 2OEDA 2MBEA 3V62A 1UF0A 1UZXB 3IT4B 3W1YA 2NPTB 2PIAA 1RWSA 3VUXA 2G4DB 1V86A 2FUHB 4OVZA 2MCNB 4O1NA 2ZJDA 1MI0A 2KFJA 4YXDB 3PTFC 2WGSA 5JZEB 1AW7A 2LXAA 5D6JB 2M0XA 3EUB2 1QOAA 2YEPF 4I6PA 1WJNA 3I9V1 3DHGC 4HJKA 2KACA 3QA8A 3AECB 3CMMB 3J9CA 2MWSB 2R61A 5AZGA 4YSZB 2AL6A 1UNSA 2VZKD 1WGRA 4BKSD 1AYFA 1V8CA 2JYEA 3ZDMC 1E7PB 4MH0E 3Q8EA 1NDDA 3AEDB 3DBSA 3LJ3A 1CMXB 1ROEA 1MG8A 4EE2A 3BVGA 2DZMA 5JH5C 1QQRA 2LVPA 1Q5WB 2WXIA 1EO6A 3AE4B 4DXFA 2WYQA 3Q8CA 1FEHA 3QQ8B 4HXDA 4YWGG 1I4HA 4HDOA 4HVBA 1UGMA 1FPYA 4TUUA 1NI2A 2Z0DB 1AWDA 2CJOA 1JRPA 2INCC 5BYRA 3U2SC 1E6EB 1ZXHA 1DOXA 4BKTA 4DHJD 4N59A 1H4RA 4OZCA 5G5GA 3L54A 2J0MA 3TIXA 1OTRB 2LGIA 3LXFA 1P7EA 1FO4A 3X0WA 3LB8C 4GDKB 1UUPA 2KC1A 1V80A 5GXGB 3RNFC 4BOSC 3HM6X 1P0RA 1DOYA 3ZDTA 3ZO5B 4B0EA 4XYCA 5IAAC 3QAQA 4GDKA 3IG3A 3TUOA 2KDFB 3HVZA 3I5JC 4FJVB 3MC9A 2MP2B 1E8ZA 1E0ZA 2V0GA 1HXYD 3QC8B 2OJWA 4P1CC 1HZ6A 1GOZA 1V1OA 3ALBA 1WXVA 1C4PA 3VH4B 3B1LX 2KO3A 1KLVA 1WXMA 3W1SA 2JWUA 4XDDA 2LRUA 2MP2A 2L8JA 2NMQA 3Q14C 4R3DA 2INNE 2XK5B 2DWQA 2K25A 1S1QB 2IYDB 3CWIA 2V4IB 2FBWB 3UF8A 2W3SA 3B2GA 4G0NB 2WQYB 4LNOA 1P7FA 1JWSD 1C4AA 4J6IA 3IAM1 4G11A 4RMAA 2I1JA 2Y5PA 1V49A 1TYGB 3NVYA 5FKAC 2VZKB 4AJYB 2ZVOA 1OQRA 1QLBB 2CR5A 1QT9A 4M00A 1VZ7A 1H8CA 1VD2A 4JWUC 1YN5A 2J4XA 4L1BA 3PT2B 2K8BA 3ZRCA 3ECIA 2GBJA 2D10A 4BKSA 4JPSA 3FILB 2GBRA 3VUYA 4HPMB 1NBFC 1ET6A 1SE9A 1WH3A 1MJDA 4LCDE 2MRPA 3QARA 3TEXA 1FNVA 2MH7A 2V1YA 4W9CA 3ABVB 2JYTA 3DCGA 5JHAA 1T0SC 2KTRA 2RD0A 3FILA 4DBGA 3V6EB 2JXXA 2L83A 3BINA 1OEYA 4Q2JA 2QILA 1BMLC 2FE8A 4HK2A 5C1ZA 3A9KA 1KLUD 4A3OA 2AQ2B 2NBWB 3NJTA 2B76B 4HRSA 1WFYA 3AB5A 4C4VB 1JWBD 2LWPA 4DHZB 3QX1A 2L0FA 4GDLB 2IGHA 1STEA 1YOVB 1YD8U 2BB6A 2BS2B 3N3KB 3VFKA 4C7ZA 3AE3B 3VHTC 4W9FA 1MHHE 3ZXRA 4WURA 1VDVA 1FXIA 2V9HA 2I38A 1FXTB 2ON8A 2QJLA 4DQOC 1SGHA 1FFVA 1RYJA 2KD0A 1YN3A 5DPTA 2UYZB 4HJGE 2JT4B 5E6JA 4AOFA 4TQ1A 2WDTB 1HEZE 4NPNA 1PGXA 4WWPA 1EU4A 3RN9C 5G5HA 2IGGA 2D2QA 2KVZA 5IOIA 2KZRA 3Q6BA 3NVWA 2KT7A 3R8BA 3TEZA 2N9XA 2O2VA 4S17A 3APFA 4EZKA 3HVDA 4ZRPA 4A8XC 1PDXA 4WJOA 5BMHA 3MJWA 2D11A 1C76A 4N9F4 2ZPYA 2XEWA 2KYWA 3C8YA 2PLPA 3CSTA 1GC6A 3EC8A 3N9YC 2C60A 2IO1B 1Z2MA 2W55A 3ZXVA 1ZP0B 1XLPA 1YQ4B 3AE1B 2OJRA 1LM8B 4MGYE 3ZYYX 2DAJA 3AU5A 3N1XC 2KMAA 1DGJA 1GG3A 3NZSA 3A1QB 1V97A 4TSSA 2LGYA 3AEGB 4K7UA 3RFZB 2HD5B 4M01A 4OHJA 2BYVE 2CHZA 3AEAB 2X38A 1NENB 1F2RC 4ZRKA 2RDHA 2KAJA 3P1MA 1E7VA 2M19A 1N5XA 1UBIA 2D3BA 3H9DA 1R4MI 3LDZE 2LI5A 3Q8FA 3AEEB 2GOWA 3DHHC 1C3TA 1I4PA 2LHEA 3B0AA 1QF6A 3DBLB 3E56A 3NS1A 3CF6E 1MVKA 3JSVB 2LUEA 4FHKA 4HKQA 4KX6B 3GE8C 2MSED 3R7RA 1C4CA 3IXSA 4ANUA 3ZJTA 4JL9A 4DHZE 3JSVA 4USAA 4MSQB 4NJ6A 2KDBA 1WGDA 1IBXA 3DBRI 3TSSA 4ACFA 4JLCA 1CZPA 1SJED 3AE7B 2C7MB 4ZYNA 4FJZA 1IP9A 1YJJA 3NVZA 2DYOA 3AULA 3BWUD 1Y56A 4W9GA 2WWZA 4C7YA 2G1EA 1G6JA 2V3SA 1TS3A 3PZDA 2DENB 5D2MB 4DXAB 3RYTA 2NVUI 1E7UA 4LDTD 2ZNVB 3RPFC 1MPEA 2FAZA 1E8XA 5GMVA 1YX5B 2JSVX 2FUG1 1YX6B 1JWMD 3Q3NC 1WE6A 4RFBA 2KFKA 2I2YA 1FXAA 1TKGA 3PZ8A 4UDUC 4YT0B
chains in the Genus database with same CATH topology
3IVFA 3KH0A 4MGKE 4M8MA 4NAWA 3ZDMC 4MH0E 3GOEA 1NDDA 1WXAA 4B95A 3DBSA 2IY1B 2KVRA 3LJ3A 1CMXB 1J19A 1MG8A 3UQAA 5LLIA 1V5OA 4DDID 4W9EA 2CU1A 2DZJA 1WM2A 4K81A 2DZMA 3OLMD 5JH5C 4ICVA 5AZHA 2G3QB 5DCNA 3PRPB 3PVLA 2LVPA 2K39A 4YL8A 1Q5WB 3JW0X 1EO6A 4WJPA 2WYQA 4IWPA 4ZRJA 2C7HA 4DWFA 1WIAA 4K7SA 3QQ8B 4K7WA 1WYWB 4HXDA 3KYCD 4HDOA 4HVBA 3EHVA 1WJ6A 1UGMA 2LGDA 3QCAA 2N1WA 3NS8A 4TUUA 4B9KA 3A1QA 2KTRB 2KXJA 4BVUC 1NI2A 2Z0DB 4BBNC 2BGFA 2RSUA 2MBBB 1PQSA 4BKTA 4DHJD 1QZEA 1RLFA 3N32A 2G45B 1V9JA 2KDEB 2Z0EB 4M8NA 5CHFA 5D94A 3W1SC 1U4AA 4EUTA 3QWZB 3VH3B 2KK8A 3H7PA 1H4RA 2K8HA 3A9KB 2FIDA 2ZVNA 2JRHA 3N30A 4DDGD 5LXHA 3L54A 2J0MA 2KWCA 3TIXA 2PPHA 4MGIE 1V5TA 1OTRB 1P9DU 5BO4B 1WM3A 4DHJB 1Z5SB 3VQIA 3X0WA 2BYEA 3WALA 2LASA 3PRZA 3OAWA 3DBLI 2NBUA 4F8CB 4GDKB 2O6VA 5DPSA 2DYBA 3ZNHB 2KC1A 1Q0WB 2DHZA 1V80A 4BOSC 3HM6X 2B3AA 5E6OA 2R2QA 1P0RA 2V4LA 3ZDTA 3ZO5B 4ZDVA 1L7YA 5IAAC 1WMHB 3QAQA 5G2NA 4BBNF 2KHWB 2L7RA 4IM3A 1ZW7A 2AYOB 3TBLD 4ANVA 4X57B 2VRRB 3WAOA 2MQJA 4GDKA 3IG3A 1TBEA 3RZFA 3EECA 1LXDA 1V81A 4M0WB 3RD2A 2BPSA 2L76A 3DOWA 3UGBB 4EKUA 4IC7B 3VUWA 1D3ZA 2M1MA 2BYFA 2AWTA 3ONSA 1Y8RC 2IBIB 2JWZA 2KDFB 4WJQA 2JPHA 2LRWA 1OGWA 3M63B 2J7QB 3OJ3A 4FJVB 1WMHA 4MM3A 4GOCA 2UWQA 3RUIB 2RR9A 2MP2B 1R4NI 4JGHB 1E8ZA 5CTRC 3D32A 1T0YA 3A9JA 2BF8B 2NBVB 1WZ3A 3QC8B 2EMSA 2FNJB 3ZRFA 3ALBA 2LD9A 4W9JA 3ZTDA 2EKEC 4GMVA 3L13A 3U8ZA 1WXVA 2ASQA 3U30A 4FHJA 3VDZA 2DZIA 4B6WA 4EFOA 1IYFA 2CS4A 2IZVB 3B1LX 3PV1A 5CHWA 2KO3A 2JY6A 4KVGB 4NY0A 3VH4B 1KLVA 1WXMA 3W1SA 2NPTA 2GMIC 2N1VA 4NQKE 1OQYA 2LRUA 2MP2A 2KOXA 2L8JA 2KLCA 3S2AA 2JZ3B 5KHQA 2XK5B 2K25A 1BT0A 1S1QB 2IYDB 3TCAA 2O2VB 4GU2A 2KWVB 5AEKB 5CHVC 3A4RA 2WX0A 4LDTB 4KZ0A 3UF8A 5J18A 1WJ4A 3GZNI 1EF5A 2FCSA 4G0NB 5HKHA 1EUVB 2R2OA 3UQBA 4J6IA 2FCNA 2MLBA 4IWOA 3SD5A 4G11A 4RMAA 2LZ6A 2I1JA 1WGHA 4MJSA 4A20A 3KUDB 4MEMA 1V49A 4DK5A 1UELA 4WQOB 4IM2A 3ZIMA 4PS3A 3M3JA 4NQLB 3V6CB 3TMPB 4W9DA 4XX5A 3Q3JA 3JYUA 4AJYB 2ZVOA 5E6NA 2KNBA 4AP4C 2CR5A 2MBOA 3A33B 4II3B 3WAMA 1H8CA 1WRDB 3PPAA 4TKNA 1VD2A 3UINB 2MX2A 3DVNU 3KUCB 5DPWA 3PT2B 3H7SA 3QHTA 2K8BA 1SIFA 3ZRCA 3ECIA 2DYMA 2GBJA 4F7ZA 4WAAA 2D10A 2IO2B 2RGFA 4FADA 5C23A 4BKSA 4AUQC 2J0KA 2GBRA 3NHEB 2KTFA 3A4SC 3ZKJC 1TGZB 3QIJA 1P98A 1WXSA 4HPMB 3VUYA 1HE8A 1NBFC 1SE9A 1UH6A 1WH3A 2NS5A 1E8WA 3ZNID 3OJ4B 1WX8A 3APDA 4ICUA 4LCDE 2MRPA 1WJUA 1LQBA 2JF5A 2W9NA 3KYDD 3QARA 1RAXA 4GIVA 2KJ6A 2O6VD 2V1YA 5D7GA 4W9CA 4HPLB 2LJ5A 3M95A 1AARA 3DCGA 5JHAA 1KJTA 2KTRA 1L2NA 4IG7B 2RD0A 4DBGA 3V6EB 3DPDA 2JXXA 3HK0A 1IPGA 4WJNA 3K9PB 3BINA 4EZJA 1OEYA 1EF1A 1GNUA 3VTWA 4KSKC 4HK2A 5C1ZA 1UBQA 3A9KA 2MA9B 3UIPB 4A3OA 2QHOA 4FBJB 2NBWB 1WY8A 4MSMB 3RZWC 1I42A 4JIOU 1KOTA 3H1UA 3APCA 1WFYA 3P2BA 4HDQA 4MELA 3HHMA 2LWPA 4DHZB 1WX9A 4PS8A 4F1SA 3IFWB 3QX1A 2BKFA 2L0FA 2C9WB 2LXCA 2ZNVC 3H6NA 4GDLB 3PGEA 4KV2A 3VTUA 1GJZA 2ZEQA 2NCNA 4G3XB 5EDSA 2N7EA 4KIKB 1YD8U 5FR6A 1TTNA 3B08A 3N3KB 2FIFA 4KSLC 4BKGA 3VFKA 2N7DA 4RM9A 3VHTC 2DAFA 4PS7A 4W9FA 3EFUA 4W9HA 3Q3FA 2JVCA 1FXTB 2KJHB 1J0GA 1SGHA 1Q1OA 1P3QU 3BY4B 3MHSD 4K1RB 3V60A 3SU8X 3WIMA 4CHKA 3TL5A 3KUZA 3DVNV 2KD0A 5DPTA 2ZCCA 2UYZB 4EOYA 3HM3A 3SHQA 3VVWB 2LGXA 2NR2A 1LFDA 2DX5B 3PS6A 2N9PC 2FCMA 1WR1A 2JT4B 2K8CA 3ML8A 4AOFA 3KVFB 4TQ1A 2WDTB 1YIWA 2KX0A 1WF9A 4NPNA 2A5UA 2KMCA 2M4NA 3RCZA 4KDIC 5J2RA 2FCQA 3NOBA 4WWPA 1JRUA 2J0JA 1E5WA 2HJ8A 1E8YA 3ZW3A 4I6LB 5JHBA 3JVZX 2L0TA 2KFKB 5CX3A 2D2QA 4CYEA 1WR6E 2PE9A 2N9EB 2KZRA 4HWIB 4W9KA 2KC2A 1ISNA 4A3PA 4WWNA 3O65B 5KHOA 2XK5A 2N9XA 2O2VA 4GSWA 3APFA 4GXBA 2CHWA 4CO7A 1GC7A 1XD3B 4EZKA 2YLMA 2G4SA 3ZUNA 4FA6A 4WJOA 3MJWA 1X1MA 2D11A 4IWQA 4NJ7A 4N9F4 2GBNA 4E74A 1WGYA 2K6DB 2ZCBA 2ZPYA 2XEWA 4IUMB 2GBKA 4W9LA 3PSEB 5L95C 3CSTA 1GC6A 1RRBA 4FN2A 3EC8A 1S3SG 2C60A 2IO1B 1Z2MA 2PEAA 3RT3B 2K6QA 5TR5A 5DPRA 3VXWA 2EMTA 2IO0B 2OJRA 2KQ7A 1LM8B 4IW0A 4MGYE 2HTHA 2DAJA 3AU5A 3PHXB 1A5RA 2KMAA 2L00B 2D3GA 1GG3A 3A1QB 3NZSA 2N4FA 3K9OB 4GB9A 2KLGA 2LGYA 2GBMA 3DDCB 1YQBA 4K7UA 4EZLA 4FLHA 4ANXA 2HD5B 3QJZA 3IBEA 5LXIB 2OOBB 2ZPNA 3L10B 3PLVA 2CKHB 2BYVE 2CHZA 4KDLB 4BOZB 4JQWC 4HCNB 2XBBC 5E6PA 3H7PB 2A4ZA 4ANWA 2KJRA 2IY0B 1M94A 5G55A 1ZGUB 2IO3B 4GN1A 1V2YA 5J17A 3L0WB 4G50A 4FULA 4ZRKA 3DVGY 2KX3A 4ASWC 3PHWB 2PE6B 4MDKE 2M8SA 4EEWA 1E7VA 4PYUA 1WX7A 3WA0A 5IA7A 4PYZA 1UBIA 3TJPA 3ZTCA 4AWJA 2YVCA 3AI5A 3IHPC 3RULA 3UIOB 3WAPA 1I35A 3H9DA 2D07B 1R4MI 2JUOA 2LI5A 3LDZE 4KZCA 5L83A 2GOWA 2O6VB 1C3TA 3U7DA 4HCPB 4XC2A 3V61A 1XQQA 2AL3A 3B0AA 2MBHA 2BWES 2KKCA 1WZ0A 2LVOA 2ZZPB 1GUAB 3NY5A 4LJPB 4FJYA 2C7NB 2JZZA 1UD7A 3CF6E 2REXA 1C1YB 4LJOB 2KANA 3JSVB 3X23A 2LUEA 3VAWA 4FHKA 3ZVVA 3L16A 4NNJB 2L3ZA 1XT9B 3PRMB 2PJHA 2MSED 4W9IA 3R7RA 4TQ0A 3L17A 3T9LA 3ZNGC 4ANUA 1WGGA 1TZ1A 3C0RB 2KWUB 5AZFA 1WE7A 2KDIA 2AEHA 4GDLA 1KM7A 4JL9A 4DHZE 2I1KA 3JSVA 2K1FA 1F9JA 4MSQB 3ZLZA 4NJ6A 1J8CA 2KDBA 3T8MA 4OVVA 1WGDA 4KIKA 4HLEA 1WI0A 3A9JB 3DBRI 3AU4A 2DZKA 4JLCA 3HIZA 1ZKHA 3ZNZB 3PREA 2MBEA 3V62A 4BFRA 4E3CA 1YJ1A 2C7MB 1UZXB 2KN5A 4ZRIA 4ZYNA 3AXCA 4FJZA 3DVGX 3DBHI 4AJWA 4WWOA 2JRIB 3W1YA 3SDLC 4I6NB 3R66C 2NPTB 4P7IA 4RM8A 1IP9A 2DYOA 4MGZE 3AULA 3R3MA 2G4DB 3VUXA 4II2B 4E71A 3NZUA 1V86A 2FUHB 4W9GA 2WWZA 2MCNB 2MW5A 2ZJDA 2Y5BB 1VCBA 1G6JA 2V3SA 2KQSA 2KFJA 3PZDA 2BWFA 2DENB 5D2MB 4DXAB 3ML9A 4XZ4A 2RPQA 3RYTA 2NVUI 3PTFC 3L08A 1E7UA 5JZEB 4LDTD 2LXAA 2ZNVB 5D6JB 2M0XA 2HE7A 1RFAA 4IM0A 3ENEA 4URKA 2Z59B 3MTNB 3WANA 1P1AA 2C5LC 4I6PA 1WJNA 2FAZA 2LVQA 1E8XA 5GMVA 1YX5B 3KW5B 3M62B 3QK0A 1YX6B 4NAWB 3I3TB 3R7QA 1OEYJ 4HJKA 4MJSB 2L05A 2MBQA 3CMMB 3QA8A 1K8RB 2MWSB 3DQVA 1WE6A 1V6EA 2WX1A 1E90A 2KFKA 5AZGA 3CSFA 4TV3A 4GGQA 2AL6A 2BKRB 3VTVA 2M17A 1WGRA 4BKSD 4OVUA 3PLUA 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IVF A;  3KH0 A;  4MGK E;  4M8M A;  4NAW A;  3ZDM C;  4MH0 E;  3GOE A;  1NDD A;  1WXA A;  4B95 A;  3DBS A;  2IY1 B;  2KVR A;  3LJ3 A;  1CMX B;  1J19 A;  1MG8 A;  3UQA A;  5LLI A;  1V5O A;  4DDI D;  4W9E A;  2CU1 A;  2DZJ A;  1WM2 A;  4K81 A;  2DZM A;  3OLM D;  5JH5 C;  4ICV A;  5AZH A;  2G3Q B;  5DCN A;  3PRP B;  3PVL A;  2LVP A;  2K39 A;  4YL8 A;  1Q5W B;  3JW0 X;  1EO6 A;  4WJP A;  2WYQ A;  4IWP A;  4ZRJ A;  2C7H A;  4DWF A;  1WIA A;  4K7S A;  3QQ8 B;  4K7W A;  1WYW B;  4HXD A;  3KYC D;  4HDO A;  4HVB A;  3EHV A;  1WJ6 A;  1UGM A;  2LGD A;  3QCA A;  2N1W A;  3NS8 A;  4TUU A;  4B9K A;  3A1Q A;  2KTR B;  2KXJ A;  4BVU C;  1NI2 A;  2Z0D B;  4BBN C;  2BGF A;  2RSU A;  2MBB B;  1PQS A;  4BKT A;  4DHJ D;  1QZE A;  1RLF A;  3N32 A;  2G45 B;  1V9J A;  2KDE B;  2Z0E B;  4M8N A;  5CHF A;  5D94 A;  3W1S C;  1U4A A;  4EUT A;  3QWZ B;  3VH3 B;  2KK8 A;  3H7P A;  1H4R A;  2K8H A;  3A9K B;  2FID A;  2ZVN A;  2JRH A;  3N30 A;  4DDG D;  5LXH A;  3L54 A;  2J0M A;  2KWC A;  3TIX A;  2PPH A;  4MGI E;  1V5T A;  1OTR B;  1P9D U;  5BO4 B;  1WM3 A;  4DHJ B;  1Z5S B;  3VQI A;  3X0W A;  2BYE A;  3WAL A;  2LAS A;  3PRZ A;  3OAW A;  3DBL I;  2NBU A;  4F8C B;  4GDK B;  2O6V A;  5DPS A;  2DYB A;  3ZNH B;  2KC1 A;  1Q0W B;  2DHZ A;  1V80 A;  4BOS C;  3HM6 X;  2B3A A;  5E6O A;  2R2Q A;  1P0R A;  2V4L A;  3ZDT A;  3ZO5 B;  4ZDV A;  1L7Y A;  5IAA C;  1WMH B;  3QAQ A;  5G2N A;  4BBN F;  2KHW B;  2L7R A;  4IM3 A;  1ZW7 A;  2AYO B;  3TBL D;  4ANV A;  4X57 B;  2VRR B;  3WAO A;  2MQJ A;  4GDK A;  3IG3 A;  1TBE A;  3RZF A;  3EEC A;  1LXD A;  1V81 A;  4M0W B;  3RD2 A;  2BPS A;  2L76 A;  3DOW A;  3UGB B;  4EKU A;  4IC7 B;  3VUW A;  1D3Z A;  2M1M A;  2BYF A;  2AWT A;  3ONS A;  1Y8R C;  2IBI B;  2JWZ A;  2KDF B;  4WJQ A;  2JPH A;  2LRW A;  1OGW A;  3M63 B;  2J7Q B;  3OJ3 A;  4FJV B;  1WMH A;  4MM3 A;  4GOC A;  2UWQ A;  3RUI B;  2RR9 A;  2MP2 B;  1R4N I;  4JGH B;  1E8Z A;  5CTR C;  3D32 A;  1T0Y A;  3A9J A;  2BF8 B;  2NBV B;  1WZ3 A;  3QC8 B;  2EMS A;  2FNJ B;  3ZRF A;  3ALB A;  2LD9 A;  4W9J A;  3ZTD A;  2EKE C;  4GMV A;  3L13 A;  3U8Z A;  1WXV A;  2ASQ A;  3U30 A;  4FHJ A;  3VDZ A;  2DZI A;  4B6W A;  4EFO A;  1IYF A;  2CS4 A;  2IZV B;  3B1L X;  3PV1 A;  5CHW A;  2KO3 A;  2JY6 A;  4KVG B;  4NY0 A;  3VH4 B;  1KLV A;  1WXM A;  3W1S A;  2NPT A;  2GMI C;  2N1V A;  4NQK E;  1OQY A;  2LRU A;  2MP2 A;  2KOX A;  2L8J A;  2KLC A;  3S2A A;  2JZ3 B;  5KHQ A;  2XK5 B;  2K25 A;  1BT0 A;  1S1Q B;  2IYD B;  3TCA A;  2O2V B;  4GU2 A;  2KWV B;  5AEK B;  5CHV C;  3A4R A;  2WX0 A;  4LDT B;  4KZ0 A;  3UF8 A;  5J18 A;  1WJ4 A;  3GZN I;  1EF5 A;  2FCS A;  4G0N B;  5HKH A;  1EUV B;  2R2O A;  3UQB A;  4J6I A;  2FCN A;  2MLB A;  4IWO A;  3SD5 A;  4G11 A;  4RMA A;  2LZ6 A;  2I1J A;  1WGH A;  4MJS A;  4A20 A;  3KUD B;  4MEM A;  1V49 A;  4DK5 A;  1UEL A;  4WQO B;  4IM2 A;  3ZIM A;  4PS3 A;  3M3J A;  4NQL B;  3V6C B;  3TMP B;  4W9D A;  4XX5 A;  3Q3J A;  3JYU A;  4AJY B;  2ZVO A;  5E6N A;  2KNB A;  4AP4 C;  2CR5 A;  2MBO A;  3A33 B;  4II3 B;  3WAM A;  1H8C A;  1WRD B;  3PPA A;  4TKN A;  1VD2 A;  3UIN B;  2MX2 A;  3DVN U;  3KUC B;  5DPW A;  3PT2 B;  3H7S A;  3QHT A;  2K8B A;  1SIF A;  3ZRC A;  3ECI A;  2DYM A;  2GBJ A;  4F7Z A;  4WAA A;  2D10 A;  2IO2 B;  2RGF A;  4FAD A;  5C23 A;  4BKS A;  4AUQ C;  2J0K A;  2GBR A;  3NHE B;  2KTF A;  3A4S C;  3ZKJ C;  1TGZ B;  3QIJ A;  1P98 A;  1WXS A;  4HPM B;  3VUY A;  1HE8 A;  1NBF C;  1SE9 A;  1UH6 A;  1WH3 A;  2NS5 A;  1E8W A;  3ZNI D;  3OJ4 B;  1WX8 A;  3APD A;  4ICU A;  4LCD E;  2MRP A;  1WJU A;  1LQB A;  2JF5 A;  2W9N A;  3KYD D;  3QAR A;  1RAX A;  4GIV A;  2KJ6 A;  2O6V D;  2V1Y A;  5D7G A;  4W9C A;  4HPL B;  2LJ5 A;  3M95 A;  1AAR A;  3DCG A;  5JHA A;  1KJT A;  2KTR A;  1L2N A;  4IG7 B;  2RD0 A;  4DBG A;  3V6E B;  3DPD A;  2JXX A;  3HK0 A;  1IPG A;  4WJN A;  3K9P B;  3BIN A;  4EZJ A;  1OEY A;  1EF1 A;  1GNU A;  3VTW A;  4KSK C;  4HK2 A;  5C1Z A;  1UBQ A;  3A9K A;  2MA9 B;  3UIP B;  4A3O A;  2QHO A;  4FBJ B;  2NBW B;  1WY8 A;  4MSM B;  3RZW C;  1I42 A;  4JIO U;  1KOT A;  3H1U A;  3APC A;  1WFY A;  3P2B A;  4HDQ A;  4MEL A;  3HHM A;  2LWP A;  4DHZ B;  1WX9 A;  4PS8 A;  4F1S A;  3IFW B;  3QX1 A;  2BKF A;  2L0F A;  2C9W B;  2LXC A;  2ZNV C;  3H6N A;  4GDL B;  3PGE A;  4KV2 A;  3VTU A;  1GJZ A;  2ZEQ A;  2NCN A;  4G3X B;  5EDS A;  2N7E A;  4KIK B;  1YD8 U;  5FR6 A;  1TTN A;  3B08 A;  3N3K B;  2FIF A;  4KSL C;  4BKG A;  3VFK A;  2N7D A;  4RM9 A;  3VHT C;  2DAF A;  4PS7 A;  4W9F A;  3EFU A;  4W9H A;  3Q3F A;  2JVC A;  1FXT B;  2KJH B;  1J0G A;  1SGH A;  1Q1O A;  1P3Q U;  3BY4 B;  3MHS D;  4K1R B;  3V60 A;  3SU8 X;  3WIM A;  4CHK A;  3TL5 A;  3KUZ A;  3DVN V;  2KD0 A;  5DPT A;  2ZCC A;  2UYZ B;  4EOY A;  3HM3 A;  3SHQ A;  3VVW B;  2LGX A;  2NR2 A;  1LFD A;  2DX5 B;  3PS6 A;  2N9P C;  2FCM A;  1WR1 A;  2JT4 B;  2K8C A;  3ML8 A;  4AOF A;  3KVF B;  4TQ1 A;  2WDT B;  1YIW A;  2KX0 A;  1WF9 A;  4NPN A;  2A5U A;  2KMC A;  2M4N A;  3RCZ A;  4KDI C;  5J2R A;  2FCQ A;  3NOB A;  4WWP A;  1JRU A;  2J0J A;  1E5W A;  2HJ8 A;  1E8Y A;  3ZW3 A;  4I6L B;  5JHB A;  3JVZ X;  2L0T A;  2KFK B;  5CX3 A;  2D2Q A;  4CYE A;  1WR6 E;  2PE9 A;  2N9E B;  2KZR A;  4HWI B;  4W9K A;  2KC2 A;  1ISN A;  4A3P A;  4WWN A;  3O65 B;  5KHO A;  2XK5 A;  2N9X A;  2O2V A;  4GSW A;  3APF A;  4GXB A;  2CHW A;  4CO7 A;  1GC7 A;  1XD3 B;  4EZK A;  2YLM A;  2G4S A;  3ZUN A;  4FA6 A;  4WJO A;  3MJW A;  1X1M A;  2D11 A;  4IWQ A;  4NJ7 A;  4N9F 4;  2GBN A;  4E74 A;  1WGY A;  2K6D B;  2ZCB A;  2ZPY A;  2XEW A;  4IUM B;  2GBK A;  4W9L A;  3PSE B;  5L95 C;  3CST A;  1GC6 A;  1RRB A;  4FN2 A;  3EC8 A;  1S3S G;  2C60 A;  2IO1 B;  1Z2M A;  2PEA A;  3RT3 B;  2K6Q A;  5TR5 A;  5DPR A;  3VXW A;  2EMT A;  2IO0 B;  2OJR A;  2KQ7 A;  1LM8 B;  4IW0 A;  4MGY E;  2HTH A;  2DAJ A;  3AU5 A;  3PHX B;  1A5R A;  2KMA A;  2L00 B;  2D3G A;  1GG3 A;  3A1Q B;  3NZS A;  2N4F A;  3K9O B;  4GB9 A;  2KLG A;  2LGY A;  2GBM A;  3DDC B;  1YQB A;  4K7U A;  4EZL A;  4FLH A;  4ANX A;  2HD5 B;  3QJZ A;  3IBE A;  5LXI B;  2OOB B;  2ZPN A;  3L10 B;  3PLV A;  2CKH B;  2BYV E;  2CHZ A;  4KDL B;  4BOZ B;  4JQW C;  4HCN B;  2XBB C;  5E6P A;  3H7P B;  2A4Z A;  4ANW A;  2KJR A;  2IY0 B;  1M94 A;  5G55 A;  1ZGU B;  2IO3 B;  4GN1 A;  1V2Y A;  5J17 A;  3L0W B;  4G50 A;  4FUL A;  4ZRK A;  3DVG Y;  2KX3 A;  4ASW C;  3PHW B;  2PE6 B;  4MDK E;  2M8S A;  4EEW A;  1E7V A;  4PYU A;  1WX7 A;  3WA0 A;  5IA7 A;  4PYZ A;  1UBI A;  3TJP A;  3ZTC A;  4AWJ A;  2YVC A;  3AI5 A;  3IHP C;  3RUL A;  3UIO B;  3WAP A;  1I35 A;  3H9D A;  2D07 B;  1R4M I;  2JUO A;  2LI5 A;  3LDZ E;  4KZC A;  5L83 A;  2GOW A;  2O6V B;  1C3T A;  3U7D A;  4HCP B;  4XC2 A;  3V61 A;  1XQQ A;  2AL3 A;  3B0A A;  2MBH A;  2BWE S;  2KKC A;  1WZ0 A;  2LVO A;  2ZZP B;  1GUA B;  3NY5 A;  4LJP B;  4FJY A;  2C7N B;  2JZZ A;  1UD7 A;  3CF6 E;  2REX A;  1C1Y B;  4LJO B;  2KAN A;  3JSV B;  3X23 A;  2LUE A;  3VAW A;  4FHK A;  3ZVV A;  3L16 A;  4NNJ B;  2L3Z A;  1XT9 B;  3PRM B;  2PJH A;  2MSE D;  4W9I A;  3R7R A;  4TQ0 A;  3L17 A;  3T9L A;  3ZNG C;  4ANU A;  1WGG A;  1TZ1 A;  3C0R B;  2KWU B;  5AZF A;  1WE7 A;  2KDI A;  2AEH A;  4GDL A;  1KM7 A;  4JL9 A;  4DHZ E;  2I1K A;  3JSV A;  2K1F A;  1F9J A;  4MSQ B;  3ZLZ A;  4NJ6 A;  1J8C A;  2KDB A;  3T8M A;  4OVV A;  1WGD A;  4KIK A;  4HLE A;  1WI0 A;  3A9J B;  3DBR I;  3AU4 A;  2DZK A;  4JLC A;  3HIZ A;  1ZKH A;  3ZNZ B;  3PRE A;  2MBE A;  3V62 A;  4BFR A;  4E3C A;  1YJ1 A;  2C7M B;  1UZX B;  2KN5 A;  4ZRI A;  4ZYN A;  3AXC A;  4FJZ A;  3DVG X;  3DBH I;  4AJW A;  4WWO A;  2JRI B;  3W1Y A;  3SDL C;  4I6N B;  3R66 C;  2NPT B;  4P7I A;  4RM8 A;  1IP9 A;  2DYO A;  4MGZ E;  3AUL A;  3R3M A;  2G4D B;  3VUX A;  4II2 B;  4E71 A;  3NZU A;  1V86 A;  2FUH B;  4W9G A;  2WWZ A;  2MCN B;  2MW5 A;  2ZJD A;  2Y5B B;  1VCB A;  1G6J A;  2V3S A;  2KQS A;  2KFJ A;  3PZD A;  2BWF A;  2DEN B;  5D2M B;  4DXA B;  3ML9 A;  4XZ4 A;  2RPQ A;  3RYT A;  2NVU I;  3PTF C;  3L08 A;  1E7U A;  5JZE B;  4LDT D;  2LXA A;  2ZNV B;  5D6J B;  2M0X A;  2HE7 A;  1RFA A;  4IM0 A;  3ENE A;  4URK A;  2Z59 B;  3MTN B;  3WAN A;  1P1A A;  2C5L C;  4I6P A;  1WJN A;  2FAZ A;  2LVQ A;  1E8X A;  5GMV A;  1YX5 B;  3KW5 B;  3M62 B;  3QK0 A;  1YX6 B;  4NAW B;  3I3T B;  3R7Q A;  1OEY J;  4HJK A;  4MJS B;  2L05 A;  2MBQ A;  3CMM B;  3QA8 A;  1K8R B;  2MWS B;  3DQV A;  1WE6 A;  1V6E A;  2WX1 A;  1E90 A;  2KFK A;  5AZG A;  3CSF A;  4TV3 A;  4GGQ A;  2AL6 A;  2BKR B;  3VTV A;  2M17 A;  1WGR A;  4BKS D;  4OVU A;  3PLU A;  2CHX A; 
#chains in the Genus database with same CATH topology
 3KH0 A;  1B9R A;  2ICI A;  4NAM A;  1WXA A;  4YSX B;  2Z8L A;  4OZA A;  4W9E A;  4K81 A;  1GPX A;  5HG2 A;  3PVL A;  2K39 A;  3JW0 X;  4WJP A;  4ZRJ A;  1L0Y B;  4DWF A;  5I4D A;  4K7S A;  4MAC A;  3KYC D;  1WJ6 A;  4HRO A;  2N1W A;  2N9K A;  2RSU A;  2MBB B;  4ITK A;  4KGR A;  1PQS A;  1RLF A;  5CHF A;  2KDE B;  4EUT A;  3QWZ B;  2WXK A;  3H7P A;  2K8H A;  2FID A;  3AE8 B;  2JRH A;  1BXT A;  5LXH A;  2PPH A;  1P9D U;  1R4M B;  3VQI A;  2BYE A;  2LAS A;  3PRZ A;  1KRH A;  2B3A A;  3RMK C;  4US9 A;  1F0Z A;  4AQ7 A;  1RM6 C;  1TKY A;  2BT6 A;  1XLQ A;  2AQ3 B;  4BBN F;  1FNW A;  4ANV A;  1ZUD 2;  3WAO A;  2MQJ A;  3O13 A;  2Q5W D;  4MT5 A;  2QIE B;  3EEC A;  1LXD A;  1V81 A;  4M0W B;  3RD2 A;  3UGB B;  1N63 A;  2BYF A;  4N58 A;  1N61 A;  1F2R I;  2JPH A;  3OJ3 A;  2J7Q B;  4MM3 A;  2UWQ A;  3RUI B;  4JGH B;  1T0Y A;  5H8Y E;  3A9J A;  2QSD A;  1K53 A;  2BF8 B;  1WZ3 A;  1N6Z A;  2EMS A;  4A9A A;  3TEY A;  3AEF B;  2NTS A;  1IYF A;  3VDZ A;  4EFO A;  2CS4 A;  5CHW A;  4KVG B;  2NPT A;  4NQK E;  3MC0 B;  5KHQ A;  1WWT A;  1QKZ A;  2YEP B;  2N7J A;  5CHV C;  4LDT B;  5J18 A;  1EF5 A;  1EUV B;  4IDI A;  3UQB A;  4IKG A;  4MEM A;  1UEL A;  4YTP B;  4IM2 A;  3GB1 A;  2EEL A;  3TMP B;  4W9D A;  4XX5 A;  2JQR B;  1T3Q A;  2KNB A;  3WAM A;  1XLN A;  1WRD B;  3PPA A;  2MX2 A;  1CK1 A;  2GI9 A;  2LGS A;  1GB4 A;  2J53 A;  4WAA A;  2IO2 B;  4AUQ C;  3A4S C;  3QIJ A;  4RGT A;  1WXS A;  3AE9 B;  2NS5 A;  1E8W A;  3ZNI D;  3KYD D;  4GIV A;  2O6V D;  3GP7 A;  4HPL B;  3M95 A;  1AAR A;  3DPD A;  2D5G A;  3HK0 A;  3N1Y C;  4K3C A;  3PO0 A;  4EZJ A;  1GNU A;  3VTW A;  1CQV A;  3UIP B;  4FBJ B;  2PKO A;  2RMM A;  1KOT A;  1WGK A;  4HDQ A;  4MEL A;  4PS8 A;  4F1S A;  3IFW B;  3VTU A;  3H6N A;  4KV2 A;  2LXC A;  2ZNV C;  4G3X B;  2E6X A;  5EE3 A;  3Q2A C;  3SFE B;  2FIF A;  1ESF A;  4LK0 M;  2N7D A;  4RM9 A;  1XLO A;  3BK2 A;  1SJH D;  3V60 A;  3TL5 A;  3KUZ A;  3ZJU A;  1LO5 D;  5D3D A;  3BVZ A;  3BYY B;  4EOY A;  2LGX A;  2DX5 B;  3PS6 A;  1J7C A;  2N9P C;  1WR1 A;  3ML8 A;  2K8C A;  5AUK A;  3KVF B;  3ZGZ A;  3I57 A;  3RCZ A;  4KDI C;  1ENF A;  2QMT A;  2FCQ A;  2N0S B;  3NG0 A;  2PMV A;  1E8Y A;  3ZW3 A;  4I6L B;  5CX3 A;  4CYE A;  2WXJ A;  1K50 A;  1ISN A;  4JE3 B;  4A3P A;  3HRD D;  3O65 B;  5KHO A;  2XK5 A;  4PK1 A;  3Q8B A;  2CHW A;  2QC8 A;  1XD3 B;  1C77 A;  1OQQ A;  1X1M A;  2GBN A;  2K3U A;  1JAL A;  3PSE B;  4MH8 A;  1RRB A;  1SF0 A;  2EMT A;  1ZDX A;  2KQ7 A;  3PHX B;  3GS2 A;  4RH6 A;  2L00 B;  2D3G A;  1PYW D;  2N4F A;  4GB9 A;  3K9O B;  4WWM A;  1DOI A;  1T0R C;  1FNU A;  3QJZ A;  3SFD B;  4HPP A;  1TS4 A;  1D5M C;  4BOZ B;  4HCN B;  5HHD G;  2KJR A;  1M94 A;  3MHZ A;  1V2Y A;  4G50 A;  3DVG Y;  3RNG C;  1FIQ A;  5BMG A;  3UI3 A;  4ASW C;  4MDK E;  2M8S A;  1NYQ A;  3TJP A;  4AWJ A;  2L32 A;  2YVC A;  3RUL A;  1OFF A;  2D07 B;  1HTQ A;  3AV8 A;  2O6V B;  4LNI A;  3OWE B;  2AL3 A;  1YQ3 B;  1SE3 A;  3W5V B;  4WAF A;  4LJP B;  2WDV B;  2JZZ A;  1UD7 A;  2LMC A;  3VAW A;  1ZPS A;  2L3Z A;  5C2T B;  1XT9 B;  3DWM A;  2M56 B;  5EE0 A;  4C4V A;  2BW2 A;  3C0R B;  1WE7 A;  2AEH A;  4GDL A;  1KM7 A;  3GE3 C;  2I1K A;  2K1F A;  4FXC A;  1J8C A;  5C3J B;  4HLE A;  2XNA C;  4HEA 1;  2CJN A;  2DZK A;  1MFW A;  3DWG C;  1ZKH A;  3ZNZ B;  3PRE A;  4ZRI A;  2KN5 A;  3V3X A;  3AXC A;  3WCQ A;  3DVG X;  4AJW A;  2JRI B;  4LNK A;  4I6N B;  2GLS A;  3R3M A;  4E71 A;  2L1A A;  2Y5B B;  4P6V F;  2BWF A;  1VRA B;  3ML9 A;  2RPQ A;  2WXO A;  1M4V A;  1FMA D;  3ENE A;  4URK A;  3MTN B;  2ONQ A;  2C5L C;  2LVQ A;  3AMZ A;  3M62 B;  4DXG A;  4NAW B;  4MJS B;  1K8R B;  3DQV A;  1V6E A;  1E90 A;  3AN1 A;  3P4Q B;  3CSF A;  4GGQ A;  2BKR B;  1R7S A;  2M17 A;  4OVU A;  3CIR B;  4M8M A;  4NAW A;  4JWS C;  1NYR A;  5IP4 D;  2WXH A;  1PGB A;  1VLB A;  2KVR A;  4OZB A;  1TKE A;  4QAY A;  1WYG A;  1WSP A;  1ZOY B;  5LLI A;  3P42 A;  1V5O A;  4DDI D;  2CU1 A;  1WM2 A;  4P16 A;  3OLM D;  3EFC A;  5DCN A;  3PRP B;  4YL8 A;  2MHJ A;  4RGO S;  1WIA A;  1WYW B;  3NS8 A;  4B9K A;  3A1Q A;  2KXJ A;  2WDR B;  1QZE A;  3N32 A;  1V9J A;  4M8N A;  3W1S C;  1U4A A;  3V05 A;  1KH0 A;  2KK8 A;  3VH3 B;  3C19 A;  1KLG D;  2ZVN A;  1JW9 D;  3N30 A;  4BZA A;  2H89 B;  2BYT A;  1WM3 A;  3WAL A;  3OAW A;  2NBU A;  4F8C B;  5DPS A;  3VRA B;  1Q10 A;  1KTK A;  3MJ5 A;  2HDE A;  2R2Q A;  4ZDV A;  1JCK B;  1L7Y A;  3VR9 B;  2Y3A A;  5G2N A;  2KHW B;  1JWA D;  2AYO B;  2KQ4 X;  2EKI A;  1TBE A;  1UWX A;  4LNN A;  1IGC A;  4TMA B;  2L76 A;  4EKU A;  3VUW A;  1D3Z A;  2M1M A;  2AWT A;  3ONS A;  2IBI B;  2JWZ A;  4WJQ A;  2LRW A;  3EGR A;  4XE0 A;  4GOC A;  5H92 C;  1F77 A;  1D6E C;  2RR9 A;  1R4N I;  3D32 A;  3KWV A;  2NBV B;  3ZRF A;  1V1P B;  3ZTD A;  2EKE C;  3VRB B;  4S0R A;  2ASQ A;  4FHJ A;  4KGT A;  3OG5 A;  1YN4 A;  3PV1 A;  1L4Z B;  1EM7 A;  2N1V A;  3RNE C;  1OQY A;  1DYQ A;  4XGA B;  1SB3 C;  4WH4 A;  3TCA A;  4NJC A;  1N60 A;  2WX0 A;  2W54 A;  3R2T A;  3HUI A;  2FCS A;  1F52 A;  2R2O A;  3SR6 A;  2FCN A;  3SD5 A;  2LZ6 A;  2SEB D;  4AS1 A;  3M3J A;  4NQL B;  3V6C B;  3Q3J A;  1C9F A;  5E6N A;  3ZJV A;  2MBO A;  4II3 B;  4XDC A;  2RDG A;  1FCL A;  4TKN A;  3DVN U;  3KUC B;  5DPW A;  4YTM B;  3H7S A;  3QHT A;  2BQQ A;  5D3I B;  1SIF A;  2DYM A;  1L6U A;  2LUM A;  2RPV A;  4FAD A;  2J0K A;  3ZKJ C;  1T5X D;  1P98 A;  3TEW A;  1QOG A;  1HE8 A;  3EA6 A;  2ZW1 A;  4A90 A;  1UH6 A;  3P4P B;  3OJ4 B;  3APD A;  4ICU A;  1LQB A;  5D7G A;  2WU2 B;  2WXR A;  3AH7 A;  3KQ4 A;  3K9P B;  3LYY A;  2WHI A;  4KSK C;  4KKI A;  4RGN A;  1I42 A;  1WY8 A;  4MSM B;  3W9C B;  2AX5 A;  4HKZ E;  3H1U A;  3P2B A;  1J7B A;  3AM9 A;  1WX9 A;  2C9W B;  4CQN A;  2ZEQ A;  1L4D B;  2NCN A;  5EDS A;  2N7E A;  1K52 A;  4KIK B;  5FK9 C;  1EWC A;  1NEK B;  2W82 A;  4BKG A;  3IAS 1;  3EFU A;  4W9H A;  3Q3F A;  2JVC A;  3DBR B;  3BZD B;  1J0G A;  2KWD A;  1BUI C;  2GB1 A;  1P3Q U;  3BY4 B;  3MHS D;  4K1R B;  4M0W A;  4RCO A;  4H2A A;  4CHK A;  2WNM A;  3DVN V;  4M02 A;  2D3A A;  2ZCC A;  3SHQ A;  2JU6 X;  3VVW B;  2NR2 A;  1R4N B;  2JX5 A;  3B2F A;  4NZL B;  2PTL A;  2KX0 A;  1WF9 A;  2KMC A;  2M4N A;  5J2R A;  3NOB A;  4WQM A;  3Q3O C;  1JRU A;  2LEK A;  2Y5C A;  5JHB A;  3W5U B;  3JVZ X;  2L0T A;  1QOB A;  1WR6 E;  2N9E B;  5IO9 A;  3DHI C;  2JXT A;  4HWI B;  3N1Z C;  1MG4 A;  4LLG M;  3ZQ4 A;  4GSW A;  4A6Q A;  2HJ1 A;  1JWU D;  2YLM A;  2G4S A;  2LHD A;  2NTT A;  3W2D A;  1NI3 A;  3E9S A;  4NJ7 A;  1WGY A;  4IUM B;  2E3T A;  2GBK A;  5L95 C;  2PVO D;  1MHX A;  2BTE A;  1XCQ L;  2IO0 B;  1TIF A;  2M0A A;  1GB1 A;  4IW0 A;  2HTH A;  2L52 A;  1SE4 A;  4ZRQ A;  2KLG A;  2GBM A;  3DDC B;  1L0V B;  1IUE A;  3AE5 B;  3IBE A;  3VR8 B;  2BBC A;  4KDL B;  2IPK D;  4ANW A;  1YJI A;  4L2Y A;  1T0Q C;  1ZGU B;  2IO3 B;  4GN1 A;  1FD6 A;  5J17 A;  4FUL A;  1JQ4 A;  3ETR A;  3PHW B;  2PE6 B;  4PYU A;  3WA0 A;  1WX7 A;  2RDB C;  4PYZ A;  3ZTC A;  3AI5 A;  3IHP C;  3UIO B;  1YMH E;  3WAP A;  3MFG A;  1I35 A;  4KZC A;  3KLS X;  2IJ0 A;  3U7D A;  3RI7 C;  4LNF A;  4HCP B;  4XC2 A;  1XQQ A;  2MBH A;  2BWE S;  4LTU A;  4RF0 A;  2V3N A;  1GUA B;  5TSS A;  4FJY A;  2C7N B;  3URY A;  1E9M A;  2REX A;  4LJO B;  4BAX A;  2VH2 A;  3BK1 A;  1A70 A;  3PRM B;  3FKY A;  4TQ0 A;  1I4R A;  3L17 A;  3T9L A;  2SAK A;  3ZNG C;  3Q8A A;  1TZ1 A;  3L4P A;  2KDI A;  3ZLZ A;  1TT5 B;  3T8M A;  5EE1 A;  2TSS A;  1WI0 A;  3MC8 A;  3AU4 A;  3T3O A;  3AEB B;  1XXG A;  3HIZ A;  4BFR A;  4E3C A;  1YJ1 A;  2XN9 C;  2WXQ A;  3DBH I;  4WWO A;  4REZ A;  3SDL C;  3R66 C;  4P7I A;  4RM8 A;  1PUT A;  4MGZ E;  3R2I A;  2JZP A;  5HFY A;  4II2 B;  1UWM A;  3NZU A;  2MW5 A;  1FCC C;  1VCB A;  2KQS A;  1D4B A;  2IDY A;  4XZ4 A;  3L08 A;  3B9J A;  1YNT E;  1RFA A;  2HE7 A;  4IM0 A;  2Z59 B;  3WAN A;  1P1A A;  5BYQ A;  3KW5 B;  3QK0 A;  1L5P A;  3I3T B;  3R7Q A;  1OEY J;  2L05 A;  2MBQ A;  4PT5 A;  2WX1 A;  1ZE3 D;  2ACZ B;  2WDQ B;  4TV3 A;  1CJE A;  1I4X A;  3NVV A;  3VTV A;  1XO3 A;  3PLU A;  1SBB B;  2CHX A;  3IVF A;  4MGK E;  3N20 C;  3GOE A;  3P4R B;  4B95 A;  2IY1 B;  2QEJ C;  1J19 A;  3UQA A;  4GLS C;  2DZJ A;  4N6E B;  4ICV A;  5AZH A;  2G3Q B;  1B1Z A;  1L0X B;  1SE2 A;  4IWP A;  2C7H A;  4K7W A;  1IGD A;  3EHV A;  2LGD A;  1ACC A;  3QCA A;  1EU3 A;  2KTR B;  4BVU C;  4BBN C;  2BGF A;  3RNC C;  1NVI D;  5JXV A;  2G45 B;  3AE6 B;  2Z0E B;  3NZ3 A;  5D94 A;  4B0M A;  2QDF A;  3U7Z A;  2OHF A;  3A9K B;  2BS3 B;  2N9L A;  4DDG D;  2KWC A;  4MGI E;  3RNA C;  1V5T A;  5BO4 B;  4DHJ B;  1FM0 D;  1Z5S B;  1N62 A;  3DBL I;  2DBY A;  2O6V A;  2DYB A;  4J3O D;  3ZNH B;  1Q0W B;  2DHZ A;  1TY0 A;  3PZ7 A;  5BYS A;  2H88 B;  1VR9 A;  5E6O A;  5T8I A;  2V4L A;  4IOI E;  4D2K A;  1D5Z C;  1WMH B;  2L7R A;  4IM3 A;  1ZW7 A;  3TBL D;  4X57 B;  2V3P A;  2VRR B;  2J42 A;  4WIP A;  3AE2 B;  3RZF A;  2PW9 A;  2BPS A;  2WLB A;  3DOW A;  2WP9 B;  4IC7 B;  3Q3M C;  2WXG A;  1Y8R C;  2INP E;  3KWL A;  3M63 B;  1OGW A;  1WMH A;  1J7A A;  5CTR C;  1PGA A;  1XCT L;  1TS2 A;  2FNJ B;  2LD9 A;  4W9J A;  4GMV A;  3L13 A;  3U8Z A;  1SSN A;  2MJ3 A;  4K3B A;  3DBH B;  3U30 A;  4B6W A;  2DZI A;  4KGS A;  2IZV B;  1JRO A;  3P4S B;  4NY0 A;  2JY6 A;  4XWW A;  2GMI C;  2KOX A;  2KLC A;  3S2A A;  2JZ3 B;  1BT0 A;  2O2V B;  4ZHO A;  4GU2 A;  1K51 A;  1I4Q A;  2KWV B;  5AEK B;  1SEB D;  3A4R A;  2LJI A;  4KZ0 A;  2WXM A;  2WXN A;  1WJ4 A;  2GRI A;  2IGD A;  3GZN I;  2W3R A;  5HKH A;  3IT6 B;  2MLB A;  4IWO A;  1D5X C;  5MPO A;  2BB5 A;  2KDM A;  1WGH A;  4MJS A;  4A20 A;  2X8X X;  3KUD B;  1WRI A;  4DK5 A;  4WQO B;  2BS4 B;  2UU7 A;  4PS3 A;  3ZIM A;  3NUH B;  1QIL A;  3JYU A;  1I4G A;  4AP4 C;  5LNK 1;  3A33 B;  3UIN B;  3BVM A;  4P1B C;  5FR3 A;  2K22 A;  2K0P A;  1TY2 A;  2VH1 A;  2CU3 A;  1E10 A;  4F7Z A;  2RGF A;  5C23 A;  1T6B X;  3NHE B;  1SIJ A;  2KTF A;  1TGZ B;  3NRZ A;  2IND C;  3P63 A;  2DNF A;  1C79 A;  3SEB A;  1WX8 A;  1WJU A;  1KFY B;  2JF5 A;  2MEK A;  2W9N A;  4C56 C;  1RAX A;  2KJ6 A;  2LJ5 A;  1L2N A;  1KJT A;  4IG7 B;  1IPG A;  4WJN A;  4RF1 A;  1EF1 A;  2WXP A;  1TJE A;  1UBQ A;  2MA9 B;  4RGM A;  2QHO A;  3RZW C;  4JIO U;  2WS3 B;  5IKC M;  4C00 A;  3APC A;  5AUI A;  1HZ5 A;  3RNB C;  3HHM A;  4OW0 A;  2MJE A;  2D3C A;  2BKF A;  3PGE A;  1GJZ A;  1IBX B;  3MP9 A;  5FR6 A;  1TTN A;  3B08 A;  4KSL C;  3I63 C;  4YSY B;  3U4E G;  2DAF A;  4PS7 A;  1GAQ B;  2WXF A;  3Q69 A;  2KJH B;  1JML A;  4ZYS A;  1Q1O A;  3SU8 X;  3WIM A;  2WXL A;  4A55 A;  3HM3 A;  1FFU A;  1LFD A;  3BYT B;  2KMM A;  4YTN B;  2FCM A;  3FC4 A;  1YIW A;  4KKJ A;  2A5U A;  1V1P A;  4L23 A;  3BII D;  3FAH A;  2J0J A;  1WXQ A;  1E5W A;  2HJ8 A;  4C80 A;  1HA5 A;  2KFK B;  1VZ8 A;  2PE9 A;  4W9K A;  2KC2 A;  1F1H A;  4WWN A;  4GXB A;  4CO7 A;  1GC7 A;  1RFK A;  2BVC A;  2HTM E;  2WU5 B;  3GZN B;  3ZUN A;  4FA6 A;  2MJD A;  4IWQ A;  4E74 A;  2K6D B;  2ZCB A;  1I7H A;  1XF5 L;  1XEE A;  4W9L A;  2QCZ A;  4US8 A;  4FN2 A;  1LGR A;  1S3S G;  2PEA A;  3RT3 B;  2K9X A;  3H8H A;  5EE9 A;  2K6Q A;  5TR5 A;  5IN7 A;  2KN4 A;  5DPR A;  3VXW A;  4ARI A;  1A5R A;  1AN8 A;  1VZ6 A;  1TS5 A;  1ZXI A;  1C78 A;  2LFI A;  1YQB A;  4EZL A;  4FLH A;  4XWT A;  4ANX A;  1ET9 A;  1SXT A;  5LXI B;  2OOB B;  2ZPN A;  3L10 B;  3PLV A;  2CKH B;  2J52 A;  4JQW C;  5E6P A;  2XBB C;  3H7P B;  2A4Z A;  2IY0 B;  2ZW0 A;  5G55 A;  3L0W B;  1PFD A;  2KX3 A;  1QOF A;  1UGJ A;  1EWY C;  4EEW A;  5IA7 A;  1FRR A;  1ZDV A;  5HI1 A;  4ZOH C;  2K5P A;  2JUO A;  5L83 A;  2DLB A;  3V61 A;  1TZO A;  2AQ1 B;  2KKC A;  1WZ0 A;  2LVO A;  2ZZP B;  3NY5 A;  4RNA A;  1VJK A;  1C1Y B;  2KAN A;  3X23 A;  3ZVV A;  4ARC A;  1L6V A;  3L16 A;  4NNJ B;  2PJH A;  4W9I A;  1WGG A;  3U52 E;  4ZHP A;  1KF6 B;  1HQR D;  2KWU B;  5AZF A;  5BMI A;  1FRD A;  1N5W A;  4MM3 B;  4JX1 C;  1F9J A;  4OVV A;  4KIK A;  3A9J B;  2G9H D;  3T3N A;  2PVG C;  1HTO A;  2OED A;  2MBE A;  3V62 A;  1UF0 A;  1UZX B;  3IT4 B;  3W1Y A;  2NPT B;  2PIA A;  1RWS A;  3VUX A;  2G4D B;  1V86 A;  2FUH B;  4OVZ A;  2MCN B;  4O1N A;  2ZJD A;  1MI0 A;  2KFJ A;  4YXD B;  3PTF C;  2WGS A;  5JZE B;  1AW7 A;  2LXA A;  5D6J B;  2M0X A;  3EUB 2;  1QOA A;  2YEP F;  4I6P A;  1WJN A;  3I9V 1;  3DHG C;  4HJK A;  2KAC A;  3QA8 A;  3AEC B;  3CMM B;  3J9C A;  2MWS B;  2R61 A;  5AZG A;  4YSZ B;  2AL6 A;  1UNS A;  2VZK D;  1WGR A;  4BKS D;  1AYF A;  1V8C A;  2JYE A;  3ZDM C;  1E7P B;  4MH0 E;  3Q8E A;  1NDD A;  3AED B;  3DBS A;  3LJ3 A;  1CMX B;  1ROE A;  1MG8 A;  4EE2 A;  3BVG A;  2DZM A;  5JH5 C;  1QQR A;  2LVP A;  1Q5W B;  2WXI A;  1EO6 A;  3AE4 B;  4DXF A;  2WYQ A;  3Q8C A;  1FEH A;  3QQ8 B;  4HXD A;  4YWG G;  1I4H A;  4HDO A;  4HVB A;  1UGM A;  1FPY A;  4TUU A;  1NI2 A;  2Z0D B;  1AWD A;  2CJO A;  1JRP A;  2INC C;  5BYR A;  3U2S C;  1E6E B;  1ZXH A;  1DOX A;  4BKT A;  4DHJ D;  4N59 A;  1H4R A;  4OZC A;  5G5G A;  3L54 A;  2J0M A;  3TIX A;  1OTR B;  2LGI A;  3LXF A;  1P7E A;  1FO4 A;  3X0W A;  3LB8 C;  4GDK B;  1UUP A;  2KC1 A;  1V80 A;  5GXG B;  3RNF C;  4BOS C;  3HM6 X;  1P0R A;  1DOY A;  3ZDT A;  3ZO5 B;  4B0E A;  4XYC A;  5IAA C;  3QAQ A;  4GDK A;  3IG3 A;  3TUO A;  2KDF B;  3HVZ A;  3I5J C;  4FJV B;  3MC9 A;  2MP2 B;  1E8Z A;  1E0Z A;  2V0G A;  1HXY D;  3QC8 B;  2OJW A;  4P1C C;  1HZ6 A;  1GOZ A;  1V1O A;  3ALB A;  1WXV A;  1C4P A;  3VH4 B;  3B1L X;  2KO3 A;  1KLV A;  1WXM A;  3W1S A;  2JWU A;  4XDD A;  2LRU A;  2MP2 A;  2L8J A;  2NMQ A;  3Q14 C;  4R3D A;  2INN E;  2XK5 B;  2DWQ A;  2K25 A;  1S1Q B;  2IYD B;  3CWI A;  2V4I B;  2FBW B;  3UF8 A;  2W3S A;  3B2G A;  4G0N B;  2WQY B;  4LNO A;  1P7F A;  1JWS D;  1C4A A;  4J6I A;  3IAM 1;  4G11 A;  4RMA A;  2I1J A;  2Y5P A;  1V49 A;  1TYG B;  3NVY A;  5FKA C;  2VZK B;  4AJY B;  2ZVO A;  1OQR A;  1QLB B;  2CR5 A;  1QT9 A;  4M00 A;  1VZ7 A;  1H8C A;  1VD2 A;  4JWU C;  1YN5 A;  2J4X A;  4L1B A;  3PT2 B;  2K8B A;  3ZRC A;  3ECI A;  2GBJ A;  2D10 A;  4BKS A;  4JPS A;  3FIL B;  2GBR A;  3VUY A;  4HPM B;  1NBF C;  1ET6 A;  1SE9 A;  1WH3 A;  1MJD A;  4LCD E;  2MRP A;  3QAR A;  3TEX A;  1FNV A;  2MH7 A;  2V1Y A;  4W9C A;  3ABV B;  2JYT A;  3DCG A;  5JHA A;  1T0S C;  2KTR A;  2RD0 A;  3FIL A;  4DBG A;  3V6E B;  2JXX A;  2L83 A;  3BIN A;  1OEY A;  4Q2J A;  2QIL A;  1BML C;  2FE8 A;  4HK2 A;  5C1Z A;  3A9K A;  1KLU D;  4A3O A;  2AQ2 B;  2NBW B;  3NJT A;  2B76 B;  4HRS A;  1WFY A;  3AB5 A;  4C4V B;  1JWB D;  2LWP A;  4DHZ B;  3QX1 A;  2L0F A;  4GDL B;  2IGH A;  1STE A;  1YOV B;  1YD8 U;  2BB6 A;  2BS2 B;  3N3K B;  3VFK A;  4C7Z A;  3AE3 B;  3VHT C;  4W9F A;  1MHH E;  3ZXR A;  4WUR A;  1VDV A;  1FXI A;  2V9H A;  2I38 A;  1FXT B;  2ON8 A;  2QJL A;  4DQO C;  1SGH A;  1FFV A;  1RYJ A;  2KD0 A;  1YN3 A;  5DPT A;  2UYZ B;  4HJG E;  2JT4 B;  5E6J A;  4AOF A;  4TQ1 A;  2WDT B;  1HEZ E;  4NPN A;  1PGX A;  4WWP A;  1EU4 A;  3RN9 C;  5G5H A;  2IGG A;  2D2Q A;  2KVZ A;  5IOI A;  2KZR A;  3Q6B A;  3NVW A;  2KT7 A;  3R8B A;  3TEZ A;  2N9X A;  2O2V A;  4S17 A;  3APF A;  4EZK A;  3HVD A;  4ZRP A;  4A8X C;  1PDX A;  4WJO A;  5BMH A;  3MJW A;  2D11 A;  1C76 A;  4N9F 4;  2ZPY A;  2XEW A;  2KYW A;  3C8Y A;  2PLP A;  3CST A;  1GC6 A;  3EC8 A;  3N9Y C;  2C60 A;  2IO1 B;  1Z2M A;  2W55 A;  3ZXV A;  1ZP0 B;  1XLP A;  1YQ4 B;  3AE1 B;  2OJR A;  1LM8 B;  4MGY E;  3ZYY X;  2DAJ A;  3AU5 A;  3N1X C;  2KMA A;  1DGJ A;  1GG3 A;  3NZS A;  3A1Q B;  1V97 A;  4TSS A;  2LGY A;  3AEG B;  4K7U A;  3RFZ B;  2HD5 B;  4M01 A;  4OHJ A;  2BYV E;  2CHZ A;  3AEA B;  2X38 A;  1NEN B;  1F2R C;  4ZRK A;  2RDH A;  2KAJ A;  3P1M A;  1E7V A;  2M19 A;  1N5X A;  1UBI A;  2D3B A;  3H9D A;  1R4M I;  3LDZ E;  2LI5 A;  3Q8F A;  3AEE B;  2GOW A;  3DHH C;  1C3T A;  1I4P A;  2LHE A;  3B0A A;  1QF6 A;  3DBL B;  3E56 A;  3NS1 A;  3CF6 E;  1MVK A;  3JSV B;  2LUE A;  4FHK A;  4HKQ A;  4KX6 B;  3GE8 C;  2MSE D;  3R7R A;  1C4C A;  3IXS A;  4ANU A;  3ZJT A;  4JL9 A;  4DHZ E;  3JSV A;  4USA A;  4MSQ B;  4NJ6 A;  2KDB A;  1WGD A;  1IBX A;  3DBR I;  3TSS A;  4ACF A;  4JLC A;  1CZP A;  1SJE D;  3AE7 B;  2C7M B;  4ZYN A;  4FJZ A;  1IP9 A;  1YJJ A;  3NVZ A;  2DYO A;  3AUL A;  3BWU D;  1Y56 A;  4W9G A;  2WWZ A;  4C7Y A;  2G1E A;  1G6J A;  2V3S A;  1TS3 A;  3PZD A;  2DEN B;  5D2M B;  4DXA B;  3RYT A;  2NVU I;  1E7U A;  4LDT D;  2ZNV B;  3RPF C;  1MPE A;  2FAZ A;  1E8X A;  5GMV A;  1YX5 B;  2JSV X;  2FUG 1;  1YX6 B;  1JWM D;  3Q3N C;  1WE6 A;  4RFB A;  2KFK A;  2I2Y A;  1FXA A;  1TKG A;  3PZ8 A;  4UDU C;  4YT0 B; 
#chains in the Genus database with same CATH homology
 3IVF A;  3KH0 A;  4MGK E;  4M8M A;  4NAW A;  3ZDM C;  4MH0 E;  3GOE A;  1NDD A;  1WXA A;  4B95 A;  3DBS A;  2IY1 B;  2KVR A;  3LJ3 A;  1CMX B;  1J19 A;  1MG8 A;  3UQA A;  5LLI A;  1V5O A;  4DDI D;  4W9E A;  2CU1 A;  2DZJ A;  1WM2 A;  4K81 A;  2DZM A;  3OLM D;  5JH5 C;  4ICV A;  5AZH A;  2G3Q B;  5DCN A;  3PRP B;  3PVL A;  2LVP A;  2K39 A;  4YL8 A;  1Q5W B;  3JW0 X;  1EO6 A;  4WJP A;  2WYQ A;  4IWP A;  4ZRJ A;  2C7H A;  4DWF A;  1WIA A;  4K7S A;  3QQ8 B;  4K7W A;  1WYW B;  4HXD A;  3KYC D;  4HDO A;  4HVB A;  3EHV A;  1WJ6 A;  1UGM A;  2LGD A;  3QCA A;  2N1W A;  3NS8 A;  4TUU A;  4B9K A;  3A1Q A;  2KTR B;  2KXJ A;  4BVU C;  1NI2 A;  2Z0D B;  4BBN C;  2BGF A;  2RSU A;  2MBB B;  1PQS A;  4BKT A;  4DHJ D;  1QZE A;  1RLF A;  3N32 A;  2G45 B;  1V9J A;  2KDE B;  2Z0E B;  4M8N A;  5CHF A;  5D94 A;  3W1S C;  1U4A A;  4EUT A;  3QWZ B;  3VH3 B;  2KK8 A;  3H7P A;  1H4R A;  2K8H A;  3A9K B;  2FID A;  2ZVN A;  2JRH A;  3N30 A;  4DDG D;  5LXH A;  3L54 A;  2J0M A;  2KWC A;  3TIX A;  2PPH A;  4MGI E;  1V5T A;  1OTR B;  1P9D U;  5BO4 B;  1WM3 A;  4DHJ B;  1Z5S B;  3VQI A;  3X0W A;  2BYE A;  3WAL A;  2LAS A;  3PRZ A;  3OAW A;  3DBL I;  2NBU A;  4F8C B;  4GDK B;  2O6V A;  5DPS A;  2DYB A;  3ZNH B;  2KC1 A;  1Q0W B;  2DHZ A;  1V80 A;  4BOS C;  3HM6 X;  2B3A A;  5E6O A;  2R2Q A;  1P0R A;  2V4L A;  3ZDT A;  3ZO5 B;  4ZDV A;  1L7Y A;  5IAA C;  1WMH B;  3QAQ A;  5G2N A;  4BBN F;  2KHW B;  2L7R A;  4IM3 A;  1ZW7 A;  2AYO B;  3TBL D;  4ANV A;  4X57 B;  2VRR B;  3WAO A;  2MQJ A;  4GDK A;  3IG3 A;  1TBE A;  3RZF A;  3EEC A;  1LXD A;  1V81 A;  4M0W B;  3RD2 A;  2BPS A;  2L76 A;  3DOW A;  3UGB B;  4EKU A;  4IC7 B;  3VUW A;  1D3Z A;  2M1M A;  2BYF A;  2AWT A;  3ONS A;  1Y8R C;  2IBI B;  2JWZ A;  2KDF B;  4WJQ A;  2JPH A;  2LRW A;  1OGW A;  3M63 B;  2J7Q B;  3OJ3 A;  4FJV B;  1WMH A;  4MM3 A;  4GOC A;  2UWQ A;  3RUI B;  2RR9 A;  2MP2 B;  1R4N I;  4JGH B;  1E8Z A;  5CTR C;  3D32 A;  1T0Y A;  3A9J A;  2BF8 B;  2NBV B;  1WZ3 A;  3QC8 B;  2EMS A;  2FNJ B;  3ZRF A;  3ALB A;  2LD9 A;  4W9J A;  3ZTD A;  2EKE C;  4GMV A;  3L13 A;  3U8Z A;  1WXV A;  2ASQ A;  3U30 A;  4FHJ A;  3VDZ A;  2DZI A;  4B6W A;  4EFO A;  1IYF A;  2CS4 A;  2IZV B;  3B1L X;  3PV1 A;  5CHW A;  2KO3 A;  2JY6 A;  4KVG B;  4NY0 A;  3VH4 B;  1KLV A;  1WXM A;  3W1S A;  2NPT A;  2GMI C;  2N1V A;  4NQK E;  1OQY A;  2LRU A;  2MP2 A;  2KOX A;  2L8J A;  2KLC A;  3S2A A;  2JZ3 B;  5KHQ A;  2XK5 B;  2K25 A;  1BT0 A;  1S1Q B;  2IYD B;  3TCA A;  2O2V B;  4GU2 A;  2KWV B;  5AEK B;  5CHV C;  3A4R A;  2WX0 A;  4LDT B;  4KZ0 A;  3UF8 A;  5J18 A;  1WJ4 A;  3GZN I;  1EF5 A;  2FCS A;  4G0N B;  5HKH A;  1EUV B;  2R2O A;  3UQB A;  4J6I A;  2FCN A;  2MLB A;  4IWO A;  3SD5 A;  4G11 A;  4RMA A;  2LZ6 A;  2I1J A;  1WGH A;  4MJS A;  4A20 A;  3KUD B;  4MEM A;  1V49 A;  4DK5 A;  1UEL A;  4WQO B;  4IM2 A;  3ZIM A;  4PS3 A;  3M3J A;  4NQL B;  3V6C B;  3TMP B;  4W9D A;  4XX5 A;  3Q3J A;  3JYU A;  4AJY B;  2ZVO A;  5E6N A;  2KNB A;  4AP4 C;  2CR5 A;  2MBO A;  3A33 B;  4II3 B;  3WAM A;  1H8C A;  1WRD B;  3PPA A;  4TKN A;  1VD2 A;  3UIN B;  2MX2 A;  3DVN U;  3KUC B;  5DPW A;  3PT2 B;  3H7S A;  3QHT A;  2K8B A;  1SIF A;  3ZRC A;  3ECI A;  2DYM A;  2GBJ A;  4F7Z A;  4WAA A;  2D10 A;  2IO2 B;  2RGF A;  4FAD A;  5C23 A;  4BKS A;  4AUQ C;  2J0K A;  2GBR A;  3NHE B;  2KTF A;  3A4S C;  3ZKJ C;  1TGZ B;  3QIJ A;  1P98 A;  1WXS A;  4HPM B;  3VUY A;  1HE8 A;  1NBF C;  1SE9 A;  1UH6 A;  1WH3 A;  2NS5 A;  1E8W A;  3ZNI D;  3OJ4 B;  1WX8 A;  3APD A;  4ICU A;  4LCD E;  2MRP A;  1WJU A;  1LQB A;  2JF5 A;  2W9N A;  3KYD D;  3QAR A;  1RAX A;  4GIV A;  2KJ6 A;  2O6V D;  2V1Y A;  5D7G A;  4W9C A;  4HPL B;  2LJ5 A;  3M95 A;  1AAR A;  3DCG A;  5JHA A;  1KJT A;  2KTR A;  1L2N A;  4IG7 B;  2RD0 A;  4DBG A;  3V6E B;  3DPD A;  2JXX A;  3HK0 A;  1IPG A;  4WJN A;  3K9P B;  3BIN A;  4EZJ A;  1OEY A;  1EF1 A;  1GNU A;  3VTW A;  4KSK C;  4HK2 A;  5C1Z A;  1UBQ A;  3A9K A;  2MA9 B;  3UIP B;  4A3O A;  2QHO A;  4FBJ B;  2NBW B;  1WY8 A;  4MSM B;  3RZW C;  1I42 A;  4JIO U;  1KOT A;  3H1U A;  3APC A;  1WFY A;  3P2B A;  4HDQ A;  4MEL A;  3HHM A;  2LWP A;  4DHZ B;  1WX9 A;  4PS8 A;  4F1S A;  3IFW B;  3QX1 A;  2BKF A;  2L0F A;  2C9W B;  2LXC A;  2ZNV C;  3H6N A;  4GDL B;  3PGE A;  4KV2 A;  3VTU A;  1GJZ A;  2ZEQ A;  2NCN A;  4G3X B;  5EDS A;  2N7E A;  4KIK B;  1YD8 U;  5FR6 A;  1TTN A;  3B08 A;  3N3K B;  2FIF A;  4KSL C;  4BKG A;  3VFK A;  2N7D A;  4RM9 A;  3VHT C;  2DAF A;  4PS7 A;  4W9F A;  3EFU A;  4W9H A;  3Q3F A;  2JVC A;  1FXT B;  2KJH B;  1J0G A;  1SGH A;  1Q1O A;  1P3Q U;  3BY4 B;  3MHS D;  4K1R B;  3V60 A;  3SU8 X;  3WIM A;  4CHK A;  3TL5 A;  3KUZ A;  3DVN V;  2KD0 A;  5DPT A;  2ZCC A;  2UYZ B;  4EOY A;  3HM3 A;  3SHQ A;  3VVW B;  2LGX A;  2NR2 A;  1LFD A;  2DX5 B;  3PS6 A;  2N9P C;  2FCM A;  1WR1 A;  2JT4 B;  2K8C A;  3ML8 A;  4AOF A;  3KVF B;  4TQ1 A;  2WDT B;  1YIW A;  2KX0 A;  1WF9 A;  4NPN A;  2A5U A;  2KMC A;  2M4N A;  3RCZ A;  4KDI C;  5J2R A;  2FCQ A;  3NOB A;  4WWP A;  1JRU A;  2J0J A;  1E5W A;  2HJ8 A;  1E8Y A;  3ZW3 A;  4I6L B;  5JHB A;  3JVZ X;  2L0T A;  2KFK B;  5CX3 A;  2D2Q A;  4CYE A;  1WR6 E;  2PE9 A;  2N9E B;  2KZR A;  4HWI B;  4W9K A;  2KC2 A;  1ISN A;  4A3P A;  4WWN A;  3O65 B;  5KHO A;  2XK5 A;  2N9X A;  2O2V A;  4GSW A;  3APF A;  4GXB A;  2CHW A;  4CO7 A;  1GC7 A;  1XD3 B;  4EZK A;  2YLM A;  2G4S A;  3ZUN A;  4FA6 A;  4WJO A;  3MJW A;  1X1M A;  2D11 A;  4IWQ A;  4NJ7 A;  4N9F 4;  2GBN A;  4E74 A;  1WGY A;  2K6D B;  2ZCB A;  2ZPY A;  2XEW A;  4IUM B;  2GBK A;  4W9L A;  3PSE B;  5L95 C;  3CST A;  1GC6 A;  1RRB A;  4FN2 A;  3EC8 A;  1S3S G;  2C60 A;  2IO1 B;  1Z2M A;  2PEA A;  3RT3 B;  2K6Q A;  5TR5 A;  5DPR A;  3VXW A;  2EMT A;  2IO0 B;  2OJR A;  2KQ7 A;  1LM8 B;  4IW0 A;  4MGY E;  2HTH A;  2DAJ A;  3AU5 A;  3PHX B;  1A5R A;  2KMA A;  2L00 B;  2D3G A;  1GG3 A;  3A1Q B;  3NZS A;  2N4F A;  3K9O B;  4GB9 A;  2KLG A;  2LGY A;  2GBM A;  3DDC B;  1YQB A;  4K7U A;  4EZL A;  4FLH A;  4ANX A;  2HD5 B;  3QJZ A;  3IBE A;  5LXI B;  2OOB B;  2ZPN A;  3L10 B;  3PLV A;  2CKH B;  2BYV E;  2CHZ A;  4KDL B;  4BOZ B;  4JQW C;  4HCN B;  2XBB C;  5E6P A;  3H7P B;  2A4Z A;  4ANW A;  2KJR A;  2IY0 B;  1M94 A;  5G55 A;  1ZGU B;  2IO3 B;  4GN1 A;  1V2Y A;  5J17 A;  3L0W B;  4G50 A;  4FUL A;  4ZRK A;  3DVG Y;  2KX3 A;  4ASW C;  3PHW B;  2PE6 B;  4MDK E;  2M8S A;  4EEW A;  1E7V A;  4PYU A;  1WX7 A;  3WA0 A;  5IA7 A;  4PYZ A;  1UBI A;  3TJP A;  3ZTC A;  4AWJ A;  2YVC A;  3AI5 A;  3IHP C;  3RUL A;  3UIO B;  3WAP A;  1I35 A;  3H9D A;  2D07 B;  1R4M I;  2JUO A;  2LI5 A;  3LDZ E;  4KZC A;  5L83 A;  2GOW A;  2O6V B;  1C3T A;  3U7D A;  4HCP B;  4XC2 A;  3V61 A;  1XQQ A;  2AL3 A;  3B0A A;  2MBH A;  2BWE S;  2KKC A;  1WZ0 A;  2LVO A;  2ZZP B;  1GUA B;  3NY5 A;  4LJP B;  4FJY A;  2C7N B;  2JZZ A;  1UD7 A;  3CF6 E;  2REX A;  1C1Y B;  4LJO B;  2KAN A;  3JSV B;  3X23 A;  2LUE A;  3VAW A;  4FHK A;  3ZVV A;  3L16 A;  4NNJ B;  2L3Z A;  1XT9 B;  3PRM B;  2PJH A;  2MSE D;  4W9I A;  3R7R A;  4TQ0 A;  3L17 A;  3T9L A;  3ZNG C;  4ANU A;  1WGG A;  1TZ1 A;  3C0R B;  2KWU B;  5AZF A;  1WE7 A;  2KDI A;  2AEH A;  4GDL A;  1KM7 A;  4JL9 A;  4DHZ E;  2I1K A;  3JSV A;  2K1F A;  1F9J A;  4MSQ B;  3ZLZ A;  4NJ6 A;  1J8C A;  2KDB A;  3T8M A;  4OVV A;  1WGD A;  4KIK A;  4HLE A;  1WI0 A;  3A9J B;  3DBR I;  3AU4 A;  2DZK A;  4JLC A;  3HIZ A;  1ZKH A;  3ZNZ B;  3PRE A;  2MBE A;  3V62 A;  4BFR A;  4E3C A;  1YJ1 A;  2C7M B;  1UZX B;  2KN5 A;  4ZRI A;  4ZYN A;  3AXC A;  4FJZ A;  3DVG X;  3DBH I;  4AJW A;  4WWO A;  2JRI B;  3W1Y A;  3SDL C;  4I6N B;  3R66 C;  2NPT B;  4P7I A;  4RM8 A;  1IP9 A;  2DYO A;  4MGZ E;  3AUL A;  3R3M A;  2G4D B;  3VUX A;  4II2 B;  4E71 A;  3NZU A;  1V86 A;  2FUH B;  4W9G A;  2WWZ A;  2MCN B;  2MW5 A;  2ZJD A;  2Y5B B;  1VCB A;  1G6J A;  2V3S A;  2KQS A;  2KFJ A;  3PZD A;  2BWF A;  2DEN B;  5D2M B;  4DXA B;  3ML9 A;  4XZ4 A;  2RPQ A;  3RYT A;  2NVU I;  3PTF C;  3L08 A;  1E7U A;  5JZE B;  4LDT D;  2LXA A;  2ZNV B;  5D6J B;  2M0X A;  2HE7 A;  1RFA A;  4IM0 A;  3ENE A;  4URK A;  2Z59 B;  3MTN B;  3WAN A;  1P1A A;  2C5L C;  4I6P A;  1WJN A;  2FAZ A;  2LVQ A;  1E8X A;  5GMV A;  1YX5 B;  3KW5 B;  3M62 B;  3QK0 A;  1YX6 B;  4NAW B;  3I3T B;  3R7Q A;  1OEY J;  4HJK A;  4MJS B;  2L05 A;  2MBQ A;  3CMM B;  3QA8 A;  1K8R B;  2MWS B;  3DQV A;  1WE6 A;  1V6E A;  2WX1 A;  1E90 A;  2KFK A;  5AZG A;  3CSF A;  4TV3 A;  4GGQ A;  2AL6 A;  2BKR B;  3VTV A;  2M17 A;  1WGR A;  4BKS D;  4OVU A;  3PLU A;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...