The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
134
|
sequence length |
447
|
structure length |
447
|
Chain Sequence |
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb |
molecule tags |
H3k4me3 binding protein, transferase
|
source organism |
Homo sapiens
|
molecule keywords |
JmjC domain-containing histone demethylation protein 1D
|
total genus |
134
|
structure length |
447
|
sequence length |
447
|
chains with identical sequence |
D
|
ec nomenclature |
ec
2.-.-.-: |
pdb deposition date | 2009-11-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00628 | PHD | PHD-finger |
A | PF02373 | JmjC | JmjC domain, hydroxylase |
A | PF17811 | JHD | Jumonji helical domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Methane Monooxygenase Hydroxylase; Chain G, domain 1 | Methane Monooxygenase Hydroxylase; Chain G, domain 1 | ||
Mainly Beta | Sandwich | Jelly Rolls | Cupin | ||
Alpha Beta | 2-Layer Sandwich | Herpes Virus-1 | Zinc/RING finger domain, C3HC4 (zinc finger) |