3KV6A

Structure of kiaa1718, human jumonji demethylase, in complex with alpha-ketoglutarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 134
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv6A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv6A01
5D1KB 1Z2QA 4QX7A 4BXFA 2LGGA 4FK5A 3U5PA 2L5UA 1IYMA 5F2WA 2XB1A 1X4UA 2I50A 3AL5A 5B77A 5KH9A 2YHOA 5FZOB 2QIZA 2OT7A 2RI7A 4X3GA 3LRQA 2XEUA 3AVRA 5FZCA 5TABA 1WEOA 3ZYQA 2G6QA 2MIQA 5TDRA 2JMIA 5FPUA 2YQMA 5F5CA 3LD8A 1LDKC 5IVFA 4E4HA 2KWOA 3N9PA 2WWUA 4I7DA 2KIZA 5LCWB 5FYCA 4XDOA 4TN7A 5FZDA 2LXHC 2YHNA 4UF0B 2YW8A 5FYBA 3T6RA 3NG2A 4YBMA 2RSDA 4DIQA 4GNGA 4ZDTA 2F42A 4ZUXU 5CEHA 5FZLA 4Y3OA 3AL6A 4DO0A 4IGQA 5KR7A 4LADB 3FL2A 2MUMA 5FB1A 2QJ0A 3U5MA 5B75A 5B76A 1WIMA 5LW9A 5FERA 3O36A 4GB0A 2L43A 3SOWA 5FYZA 5FYYA 2VPEA 5AIUA 2KGIA 5D1LB 5IVEA 1MM3A 4CCLA 3OPTA 5F3GA 4CSWA 4P5OB 3ZPVE 5F3EA 2L80A 2XXZA 3ZPOA 2YREA 5FV3A 5LKXA 5FZMA 3DXTA 5FY0A 5A1LA 2M1RA 5E6HA 5FZFA 3OPWA 3KV4A 3KV6A 4AP4A 4R2YA 2EODA 2ECWA 3DXUA 5FXWA 2K17A 4V2VA 5A3TA 3HCUA 5FP4A 1Z6UA 4LIVA 5A7NA 3PUSA 4QXCA 4GAZA 4C9ZA 2VJFA 5FY8A 5FZ8A 3T7LA 4EZ4A 5H9MA 4XDPA 5FZ3A 5J3XA 5FP9A 2JMJA 1JOCA 5TRBA 4LKAA 5DINA 4B86C 5FXZA 2YBPA 5FUPA 5FZAA 4A49A 2H0DB 5EYAF 4BBQA 3M62A 5C11A 3M63A 4A4CA 2PUYA 2LDRA 2C2VS 3KV5A 5C13A 2LGVA 5TBNA 5FY4A 1WEWA 5ISLA 5IVJA 2AN6A 2C2LA 5F37A 3SOXA 4AVXA 1WEEA 5LY2A 5A3PA 4A4BA 4CUGA 1WEUA 4HOOA 1V87A 5FY5A 4QF3A 3V43A 4ZQLA 4URAA 4D6QA 5FPVA 4UI9B 2F6NA 2G43A 3VK6A 2PNXA 1WENA 2L0BA 1HYIA 3PURA 3I2DA 4WZ0A 4GJYA 4N3WA 2JRJA 1WILA 1RMDA 4BU2A 1X4JA 2VNFA 3PUQA 3LQIA 2Y1MA 4B7YC 2BAYA 5F5IA 3O35A 1F62A 3PU8A 2JMDA 2UZGA 1WEQA 1WE9A 2YU4A 5FPLA 1ZBDB 2P5BA 4BISA 2L75A 5LKZA 4LXLA 4CCGX 2CSYA 2Y1NA 4UP0A 2YURA 2G45A 4YATA 3C6WA 3ASLA 2MNYA 5D1MB 1LDJB 4ASKA 3KV9A 1BORA 1N87A 2YU2A 2ECGA 5IVCA 3N9NA 4N4FA 4R8PK 5ANQA 2Q8DA 4WA6A 4YABA 3KVBA 3O70A 3KQIA 4FO9A 2KR4A 5LWBA 2M6MA 5H1UA 2LGKA 2M85A 4UP5A 2LGLA 2OQ7A 4TKPB 5F39A 1VYXA 2FSAA 5H1TA 2GP5A 5FZEA 4NUBA 4CCOA 4QU1A 5G04B 3ZPV1 4WZ2A 3L11A 3QZVA 2VJEA 2VPGA 4Y4RA 4IC3A 2K1JA 1MM2A 2CT2A 5FP7A 5FZOA 2VD7A 2F6JA 3PDQA 3EB6A 2ECNA 5A7WA 4GJZA 2W2IA 3N9QA 3LDBA 2Q8CA 1WEVA 2VPDA 3AVSA 5LY1A 4CCNA 2VJEB 5FYMA 2E6SA 5FWJA 5IW0A 2FUUA 5DKAA 2KGGA 2NAAA 3RVHA 5A7WB 4YADA 1HYJA 4QX8A 4YAXA 3ZTGA 5FYHA 4YC9A 2YBKA 3UYJA 5A80A 5IVVA 1VD4A 5LKTA 2YPDA 1K2FA 2KU3A 2YU1A 5AITA 4QF2A 3IHPA 3DQVR 4I7BA 3O37A 2VJFB 2MNZA 5H1VA 1T1HA 2MD8C 4D6RA 2LRIC 3K2OA 5G05B 3SOUA 3C5KA 4O64A 2LQ6A 3DPLR 5FB0A 3HCSA 4R7EA 5FZ4A 3RPGB 4S3OB 5FYTA 4Y33A 1WEMA 4L7XA 4W4UA 2H0DA 3LQHA 3HTKC 1X4IA 2K16A 2KFTA 5K4LA 2OQ6A 3PHDA 4AAPA 2KREA 4YBTA 3KNVA 5TDWA 2QICA 4AYCB 4XI1A 1JM7B 2HYED 1WEPA 5FYVA 2ZETC 2Q8EA 3O7AA 2YYRA 4QWNA 4LITA 3N9LA 5KH7A 3MHSA 3O34A 4GNFA 4QXBA 4MSXA 2YSMA 5A7PA 2CKLB 4EZHA 1XWHA 2KWJA 3MHHA 2PXJA 2OXQC 3L1ZB 4PPEA 2WWJA 4L58A 2EGPA 3PU3A 5FP3A 4F52B 1Z60A 2YBSA 5KH3A 2LN0A 1FP0A 1WGMA 2IDAA 4QXHA 2GP3A 5FUNA 3GL6A 3O33A 2EA6A 4WZ3B 2YT5A 2VPBA 2YUCA 3N9MA 5FPAA 2HDPA 2ECVA 2KE1A 4V3KC 3ZLIA 2MD7B 2MA6A 4GNEA 3GV4A 5FZ1A 5FYIA 5FYSA 5FXXA 5FZIA 2ECJA 5B8DA 4BHWA 2E6RA 5FY1A 5F5AA 2MT5A 4CA1A 3ZVZB 5FZ6A 2DX8A 5FY7A 2OS2A 5FZHA 4AYCA 1JM7A 5FEYA 5IWFA 1WFKA 4UF0A 3L1XA 3LQJA 2OX0A 4EYUA 2ECIA 3KVAA 4Q6FA 1DVPA 5FZ0A 4D6SA 5A3WA 4A0CD 2VP7A 4V2WA 3RPGC 3N9OA 5F2SA 5A7QA 4GNDA 3K3OA 5A3NA 5B78A 2CKLA 4PTBA 5FZBA 2MA5A 5A1FA 4V3LC 2D8SA 2KYUA 2XDVA 4FJCA 5FPBA 5FZGA 4LJNA 3RTRB 4IGPA 5A7SA 2M3HA 1WESA 4IGOA 5F32A 5G0FA 4LIUA 2FUIA 4CCMA 4YBSA 3HCTA 5LKUA 3K3NA 2YQLA 4FIPA 5IVYA 2XMLA 2XUEA 2Y43A 5JG6A 2ECTA 4AI9A 2KWNA 3ZNIA 5FXVA 4GD4A 3U78A 5I3LA 4MVTA 5B79A 5A7OA 1VRBA 4HONA 1CHCA 4NN2A 4S3OC 4I7CA 5FJHA 5FZ9A 5F3CA 3U4SA 5FBJA 5F3IA 3PUAA 4C8DA 4CCKA 1U6GB 1FBVA 2LV9A 5FZKA 3EB5A 4LK9A 1E4UA 5FZ7A 5FWEA 2K4DA 1VFYA 4IC2A 3U5NA 5FY9A 3M99A 5IVBA 4LLBA 3U5OA 5FJKA 1G25A 3NJYA 4CCJA 3ZVYA 3SHBA 5FYUA 5FP8A 4AUQB 2CSZA 2KWKA 2YSJA 3PTRB 2LXPC
chains in the Genus database with same CATH superfamily
5D1KB 2JMHA 3MJXA 2O1QA 4IEYA 4X8PA 2YDEA 1OMIA 1XB9A 1TEIA 2BS3A 3TBDA 4XEZA 3BPZA 2G9ZA 2LM2A 1RUI3 3KDSE 2ZGNA 3LDYA 3MGUA 4DR2T 5E0OA 1X9TA 3PUZF 2GSYA 4LQRA 1NEKA 5FPXA 4KH9A 1BMV2 3T09A 1AXYA 4P9LA 4X8NA 2VUDA 3WAJA 5FB1A 4NROA 1XBFA 3MACA 1OA3A 5AQVB 1LOCA 2IAKA 3SOWA 3VBHA 3C4WA 1NZCA 4FP3A 4EWEA 5CBLA 5IVEA 2W0XA 5AQIB 4ONUA 3J8F3 4O65A 2ARAA 3SQOA 3O1VA 4QHBA 1M06G 1R1A3 4FPKA 3MXZA 1UYPA 4KMQA 1KFXL 2R1DA 2DLRA 2BVVA 2EXKA 2TEPA 4MGKE 4F8AA 2HWB3 1WZXA 4BXSV 2W46A 2D98A 5FY8A 4FPGA 1B7TA 2R042 5LBMA 1ULGA 3TLUA 1XNAA 5DINA 5CG8A 4XE9A 4A49A 3LEGA 4IDZA 4HKAA 2JQHA 4BK4A 3KV5A 2WS92 5C13A 5JDHA 2GU9A 1APNA 1WLCA 5FY4A 2VZRA 1M7KA 1X7NA 3VZNA 4D7TA 3VL9A 5C3PA 4QM9A 5FKCA 3U75A 4ZQLA 1URXA 4RD7A 4LBQB 4JRLA 2R061 1NAFA 1YI7A 3S5AA 2LRKA 2Y6JA 3RDIA 2VNFA 4WVZA 2WN2A 3IBMA 4B7YC 2BAYA 1WYCA 5C70A 5DZEA 1SPPB 2ARXA 3B93A 3RJRA 4MLKA 3JD72 3O70A 3O0XA 2BPA2 4QGLA 2HWF1 3UT0A 5FVKA 2J1RA 3WP5A 5HCAA 4PJYA 1GBGA 3L11A 1RVF2 2VJEA 2K1JA 4N43A 2DWKA 3EB6A 2NR4A 4ARYA 2Z4FA 3I3EA 2C1FA 4CU9A 1NLSA 3U07A 5HXEA 2VMEA 3C4XA 1PO23 2QBXA 2YZ4A 3NV1A 1N33T 1RUE3 3WZ1A 2MNGA 1JYCA 5K0UA 2DJAA 4PDWA 4X1YE 2RJ2A 3AA6B 1QEXA 3DQVR 2BVLA 2UXXB 1OF4A 1ND2B 4D6RA 4NIDA 3DEMA 4MG2A 2VMIA 1RXFA 1RUH2 1LOEA 3UK9A 5AQNB 5KXBA 4AVSA 4MXWB 4CUBA 2V4AA 4MYEA 3TN93 4Q5OA 1JM7B 4GIWA 3W59A 4YZ2A 4AZZA 3PJAA 5H6QB 3O7AA 4AQYT 4IEVA 4K6BA 1RHI1 4UOJA 1RUG2 2CTVA 4BJNA 4EZHA 3KT7A 1G9AA 4JHTA 4BLIA 3P50A 3L1ZB 1W06A 1CQ9A 4YZ1A 5JOWA 3AZWA 5C4WA 1G8WA 1UU6A 4LKDA 3IDCB 2KXPB 2VC9A 1A6CA 3TAYA 1PNGA 3ZLIA 3FFZA 2HWF2 2ZKNA 3HNMA 2VZPA 4DXZA 2UXBT 1J1LA 4JTOA 5JCTA 3BIWE 3NZPA 2VM9A 4HWCA 3ZJ2A 3V0AB 2ZLYA 4DR4T 2E51A 3CKHA 4QU2A 4V2WA 3WQ1A 3Q2MA 4YW4A 2K9ZA 3WCSA 2R073 3WF0A 5FLHA 1I5ZA 4IE7A 1W8NA 5C9AA 3RZKA 4AG4A 2WAUA 4WW0A 2WYSA 1R083 3V5UA 3GZEA 5FO9B 3TKLB 1DP0A 2QQIA 1D0ZA 1W6NA 2B9VA 4DFSA 4AWDA 3WDTA 4NO4A 1XU1A 4BMBA 3V5SA 2WJSA 1ND2A 1JNRA 4WVVA 4KX6A 3BQKA 1REDA 3IM0A 5C7GA 2CLYC 4LLBA 4DV2T 1J5WA 4AUQB 4AFAA 4OQ9A 3I59A 3CQOA 3PTRB 4CP9A 4ZS3A 3Q8EA 3JAEA 4QX7A 2XOCA 3O1OA 3ETPA 4UI9L 5E89A 3D0TA 4HFIA 4NPMA 3D0JA 2D6PA 2GH2A 2YGMA 3LK3B 2D3RA 1RUD3 4XAAA 3FJSA 3OG2A 3CVRA 1OQDA 1X8MA 2DCZA 5KWRA 2Q30A 3WI3A 4TN7A 1RUD1 2M6IA 1F4AA 3WX5A 3F2ZA 2LSYA 4BQYA 4ZDTA 3ZC1A 3AFKA 1OD5A 5FRAA 3K75B 3NJVA 4B6XA 1MNDA 5FMDA 4LMLA 2MPFA 2JX9A 1AR72 3CL1A 4UFHA 5FYYA 4Q25A 2O8QA 1MQTB 4LO5B 4K0KT 1QJFA 1HF8A 4ZXEA 4JQRA 2HH9A 3AZVA 2PQQA 2PELA 5FZMA 3DP7A 1SQ4A 3P4RA 1YJKA 1YKHB 5FOJB 5CFCA 1GYKA 4WM8A 1NAEA 1UW8A 2HN2A 3QB5A 4K8FA 1NXMA 1UX6A 5BMVE 3LSVA 2GNDA 3CIHA 2WO1A 5FL1A 1DFQA 1CX4A 3E6CC 1NUKA 5LRRA 1GWLA 2OXBA 3ZT6A 4KNCA 4ZZ8A 1HQLA 3CZUA 4K20A 3ME2A 5L2LA 4QXKA 4UAPA 2VKOA 1EPZA 5LY2A 1ZOYA 2V5DA 1D7PM 5HEUA 2P3IA 4Q1PA 1AR91 1DG6A 3L2YA 4DY5A 5JTGA 4URAA 4U72A 4IGUA 1QJU2 2F6NA 2VMCA 1W6OB 3GNEA 2WZR1 1W8HA 2HBTA 4X6RB 4LBQD 3LQIA 2XVLA 4V1Av 3UFGA 1OH4A 1FXZA 1WEQA 2YY1A 2CY6A 1QY4A 5AQOB 2VTXJ 3VDBA 3W20A 4LT5A 2MNYA 1TVGA 3FWEA 4J6GA 2BFUL 1LDJB 4ATEA 3AB3B 3O7OA 3U10A 2D0TA 3N9NA 4NHKA 1FOD2 1AYM2 4HEAA 2CRRA 1GNYA 4I2OA 4XUOA 3PJYA 1YQ3A 1JHJA 1T7SA 2Q4SA 2FSAA 4NUBA 4CCOA 2NM1A 2XG3A 3ZFEA 4MGSA 4FAHA 4WZ2A 3AC0A 2V7IA 1DGRA 1QQP3 4YJ3E 3A5XA 4MH0E 5HXMA 2JDMA 2KXLA 3U1XA 5AVPA 3LCPA 1YWKA 2GNMA 5J7MA 3C2UA 2JDKA 4R52A 2F4LA 5LGUB 4DXTA 4IV1A 1RUC2 1PGSA 1X50A 4Y1XA 5CFCB 3C7OA 2FHRA 1K2FA 4XXPA 3IIIA 5JSOA 1RUE1 4QX8B 3O37A 4U33A 2UXDT 1ZZ9A 2JD9A 1W2UA 4NHLA 3MDPA 3K2OA 2E26A 2XAQB 3ZDVA 1BCXA 3PNAA 3ESLA 1UX7A 3RPGB 3N4MA 3ZXFA 4M0NA 5KHKA 5LASA 2XVKA 1NLRA 2DU1A 3HR0A 2A72A 4FT8A 2ZGSA 2UWAA 4AYCB 4NWWA 1O4YA 3LIGA 2Q8OA 4LITA 3G6JB 3B5MA 3N3HA 2CKLB 4P0BA 1EYBA 4DBRA 2W1UA 1IBMT 4BQ2A 3BK9A 2A5ZA 1XWHA 1EZ3A 1QNYA 3BTZA 3A7MA 2GC0A 2KWIB 3VZOA 4AI1A 5FMOL 4LF8T 3RX6A 2B5HA 3HIFA 1HLCA 5FVLA 4PHZA 2JIGA 3UTKA 2Y6HA 1OLQA 2HWE2 3FZFB 5HCJA 4QXHA 4XW3A 3POBA 3VBOA 4GULA 3RI8A 1EUTA 2YT5A 3BTAA 1AYM1 5JVDE 3VRBA 1Q8OA 2PTFA 2WFF3 3ITQA 4AYUA 4IETA 1JM7A 4CU7A 1W3XA 3THPA 2W2UA 1H2NA 2G1MA 2LRLA 3VDCA 2QQPA 3HL6A 1MZ5A 1H8TC 3UNPA 1GP6A 2CKLA 3O4XE 4ZHQE 1YQ8A 3TEYA 2KR2A 4XOGA 3I9YA 3QD6A 1PZ8A 4HKWA 1DLLA 2GC1A 5FPBA 3VDDC 3EABA 4ZI3D 4LJNA 3P1IA 3WF3A 4S2GA 3H0OA 4QB1A 5AQMB 5DQ0A 4YBSA 1KEYA 4UW5A 1PVC3 3ZIWA 3A8YC 1LB2A 1JH5A 1YIPA 3THTA 4GYSA 4XHBA 4Y20A 1SFNA 4CEYA 1LESA 2OZ6A 2X67A 5LCWL 5JXGA 3U4SA 1H1AA 3RF1A 3TRSB 3NWIA 3P7IA 3Q8BA 1R1A1 4OMDA 1VBE1 1LOFA 4Q4V3 2W62A 1PVC1 2XZEA 4DV6T 4KMCA 1N3PA 4A98A 4M3CF 3T1YT 2CHHA 3RYPA 3ILRA 3WV6A 1HJGA 1ZBA1 2LGGA 5C8YE 4AXOA 4YFWA 1ULOA 4AKHA 3H1MA 2N1GA 2YHOA 4ZPIA 4D7SA 3CJIB 4EOZB 2GDFA 4QPGC 4IE5A 3OSDA 2A71A 5GZDA 3AKSA 3AXDA 3Q5XA 2UWCA 1CAUB 3X1DA 1ZBE2 2VZVA 5FYBA 2B46X 3KGLA 1D4VB 4KHZF 3VBRA 5FUIA 5HEOA 2JG9A 1CJPA 3GJAA 3BTXA 3LK2B 3EUHA 3O36A 2XQ6A 1FPN1 3FXDB 3N2GE 2E9XA 3AXEA 4Q4W2 2A3YA 2YC4A 2LKHA 5LHIB 2DL1A 2K5BB 1WR6A 1U5YA 3WR0A 5LBEA 3GCWA 3ILFA 3VBUB 5L9RA 2MPKA 1W8WA 3WF4A 5AQSB 3ZXAC 4DMIA 5KHHA 2CE7A 4PF5A 3SMHA 4P5HA 4QX7B 3WDXA 2QQWA 2NP9A 3E6BA 4NOTA 2PYTA 5A33B 2W66A 2VBBA 4R4ZA 2LAUA 3NV3A 4KG0A 4EROA 3M65A 4XF1A 4QX3A 1CAXA 4I30A 4TSVA 1VMJA 3FB2A 4LEJA 4CUGA 5D2AA 2RS31 2BDEA 4XACA 4LHLA 3A4UA 4YVSA 5C8CC 1FV3A 1VCSA 1KITA 1XQNA 1I9RA 3OD4A 1F31A 1X4JA 3WNOA 1YEWA 1RMU2 1F62A 5M0TA 4NXMT 4F83A 1NXD1 2L75A 2HWE1 2IVIB 1WCUA 5LJNA 1IQAA 2C5IT 4UP0A 2YKSA 1RUE2 2IXKA 3GBGA 2GH8A 5E1RA 1PMIA 1UPIA 4CCDA 2Z79A 5LP6E 4QDRA 4YW2A 3UUXB 1AYN2 2OYZA 2XJQA 4TKPB 2ES0A 3NJXA 2V4VA 3ZSMA 3MUZ1 4AGRA 3JUEA 1G9CA 2NWBA 1XJAA 1VBA2 2F6JA 1IJ6A 2EIEA 2LM3A 4K7JA 2HH7A 1QU0A 2VOXA 3AVSA 3KB5A 2IW5B 1EY2A 4ES9A 1S55A 5EZWA 3EQEA 3NVOA 2ZX2A 2V5CA 1UXXX 2CM0A 4KP3C 4D94A 4YAXA 4O9EA 2YPDA 1D1AA 2KZ7B 1T72A 1NCQC 4YSFA 4GXLA 3VKFC 4I7BA 2MNZA 4XCBA 3Q1DA 5DN2A 3S7IA 2WAAA 3RPUA 4O64A 2WDRA 3FZHB 4JDOA 4IEZA 2JMKA 5FYTA 5ABFB 5A33A 4E8CA 2WS91 1UKGA 5AQPB 4XQDA 2WZR3 2ZETC 4MO3M 5AQTB 2ZOEB 1Z78A 3KMHA 1M62A 3N9LA 1U12A 3GZAA 1DLCA 1GOHA 4U74A 4Y1VA 1Y9MA 5IATA 2JE7A 2A6ZA 1JUHA 1QJZA 2ZCWA 1HXS2 5F7UA 3INAA 5C5TA 2XQ9A 4CCEA 4XC9A 1KFUL 4J25A 3TNQA 1AL0G 3LSEA 2XLAA 4YM0A 4TWTA 1LGBA 3SFDA 1N1YA 2W4XA 2DDUA 2VCBA 1BHGA 1SLIA 1FOD3 5KH3A 4Q4Y3 3PUIA 2V1DB 3R05A 5FO8B 2NW8A 4X66T 3HBKA 2Y6LA 5K8SA 5DJQC 2YUCA 2HDPA 3S30A 3PMSA 2VKJA 2WQYA 3O14A 1WLDA 1PO22 1YQ4A 1MNEA 1RUH1 1R1A2 5F5AA 1ZBE3 5D8AA 5IWFA 1D0YA 2HWC3 1LAJA 3LZZA 1ASJ3 2HHHT 4I0UA 1W8OA 1J83A 4F3JA 4AVAA 2WNUC 4NWVA 1FMVA 3HPNA 4CP1A 1SBDA 2E53A 1NCRC 3VBRC 1SFPA 5A6ZA 1GV9A 2Z42A 1KXGA 4CP2A 2PLV3 4FIPA 3K51A 3ZT5A 3D8CA 2BWAA 4PLMA 4LFCT 2FJEA 4OGEA 2LSKA 1IS4A 3OUJA 4XF9A 1PNFA 3NNMA 5E88A 4E9KA 3AEAA 3QB5K 3IDAA 4JYAT 1AR71 1E5IA 4B3ST 1HRV3 4FFGA 2WMNA 1PIV3 2B42B 1ULDA 1NZIA 4MADA 2ZEYA 1QXRA 3SH3A 2L5UA 3P3NA 3WQ0A 4HFSA 3PJAJ 1X4UA 2H6BA 4YWAA 2M6BA 2E5LT 3LRQA 2FDIA 3E2DA 4HN0A 3FZMB 2XASB 4GH4B 4AEDA 5F5CA 4IL4A 1LDKC 4JEUB 5BNQA 4XDOA 3UT5E 3PE0A 5F6KA 1BR0A 3RZZA 4M01A 2A3WA 2WSSV 4DO0A 4IGQA 4I01A 1R081 4PBPA 4IREA 4GB0A 1DBNA 4TYSA 2NTYA 2ZPXA 5JAXA 4H9NC 3MW4A 3FL7A 4BQ4A 3GF6A 5L3EB 3ABZA 5AIUA 4CU8A 2HN1A 2ZGTA 5AQJB 3RIAA 3FZKB 3WG2A 1PGL1 3H3ZA 2JD4A 4XF3A 5ABEA 4O4HE 2GC3A 2R0FA 3KF5A 4AP4A 2Q9QD 4GZ9A 4AKRB 2WO3A 3VZMA 5LRSA 3GHMA 5J36A 2UY9A 4YSZA 4EIWA 3JD71 2CV6A 2A70A 4PIZA 2AYHA 2JMJA 4DR1T 4XYXA 4BQ5A 3E5QA 4CZZB 2EXJA 4BE3A 3DPRA 2YXSA 5C11A 4W50A 2C2VS 5C33A 1IBKT 2HPJA 5BV6A 1FNZA 2WCAA 2CAUA 4GKJT 4MGYE 3A0NA 3WUDA 1WEUA 3FHQA 1V87A 3WG3A 2PAEA 4W6YA 3OPCA 2DSMA 4BIFA 4Q4Y2 3J7NA 3VK6A 1JN2P 3PURA 2VE1A 3VD7A 3A21A 3W5NA 2UUAT 2WBKA 5BNPA 3B7MA 4BH9A 3O35A 2VCMA 4IIJE 3HWJA 1MEC3 4FXKB 1HX1B 1F4HA 2AEYA 1S0GA 4MV2A 5L7OB 3UJQA 1N87A 2YU2A 4L92A 2LEHA 5JPNB 3VL8A 3WUCA 1K5JA 2BV4A 2OW4A 3ZMTB 3OUIA 4UP5A 3B5LB 4GKXA 1RHI2 2RG4A 4I3PA 1PX3A 2V6XA 2WDVA 3PVNA 1C1LA 2GMPA 2D3SA 4QDSA 4JGZB 2D5UA 1JYTA 1CAVB 1WLWA 2Q9QB 4DIDB 4KUMB 2KGGA 4YY3T 3B02A 1AJKA 1PMJX 3AM2A 1OQEA 3MBWA 5ACA2 3GHNA 4IV3B 4JI4T 4EN9B 1OBNA 2XONA 4Q29A 1AL23 1JMUB 2XBO2 1LOGA 4FJOA 5FQ0A 1OEDA 3ZXEA 3QNUA 2WSUA 5FKBA 3ZYLA 4K3UA 4CPBD 1MVEA 4CUCA 4XDQA 1ODMA 2HWD2 3ON7A 3VBSC 4YW5A 1XMQT 2XQRA 4QWNA 1WD4A 4B7KA 1UX4A 1WLXA 4QPWA 1YXRA 4L0PA 2IC9A 4A42A 3LOBA 4FSJA 1OEDC 3M8LA 1DF0A 2G9GA 1OLME 4IEPA 1DHKB 1SBEA 4BPZA 3MIFA 1KS5A 4CEWB 5LXTE 1TZOA 1O5UA 2LJLA 1X36A 5FPAA 4CDQA 4JI5T 1NA1B 1JYXA 2EAAA 3B00A 4ANJA 3VDDA 3T1HT 1Q3EA 3ZYMA 5IJRA 1U0AA 3AZXA 1RB8G 3UJOA 5FBZA 1F2NA 5J37A 5SV8A 5C3RA 2VQFT 2WU2A 5KHGA 1PGW1 3AYAA 4GNDA 4HN9A 4PTBA 2MA5A 5B4XA 4Z2AA 4FJCA 4B3TT 2VXRA 1AR63 4MUVA 3CK6A 1DGWA 5CU1A 3FXEB 2PHRA 3K3NA 2QCSB 2ACZA 2XMLA 4WM7B 3SEEA 4AI9A 5SVYA 2P2KA 5A7OA 1OH3A 1WYBA 1L3JA 1ZRIA 4XFBA 4JGZC 3LK42 4OK0A 4C8DA 1OKOA 4ZI3C 3EMRA 4IUGA 1C4RA 5EK3A 3AAIA 1AR81 3SHBA 4MHCA 2Y33A 3D3AA 4X65T 3NRYA 4FBFA 2C5KT 1YJLA 3RYRA 3JB4C 2JDNA 2X5IA 1Z2QA 3HD8B 3O1HA 3GZUC 4UV9B 3RYHE 5L9BA 2P4EA 2A3DA 1HR0T 1N3QA 1VP6A 1XNCA 2OIIA 4QH5A 3MO4A 5JDFA 2W9XA 3RZJA 1BK1A 3TB0A 5DUWA 3M3CA 3USUB 3BN6A 4JCKA 2PHLA 3NW4A 2QJ0A 2FDGA 2WNEA 3EO6A 3CJIC 1XRUA 4JEHB 2PAKA 1JYWA 3AZZA 3BOPA 1ZX5A 2QRXA 1BQPA 1S2BA 1W8UA 3K3QC 3OPTA 5CADA 2XWJB 4P5OB 3DTOA 1RUJ2 4BZ4A 1LCLA 4RGGA 5T5JA 1UMIA 5A1LA 5AQKB 4L8QA 4O8SA 2VCCA 1UY3A 5H9SA 3AYDA 5JUVA 4XQ4A 4XFHA 4YNIA 3WG4A 1VCTA 1Z6UA 2J1SA 2WL1A 4QXCA 1QHDA 2E5VA 1CJDA 2W95A 1GICA 4XDPA 1NE4A 4Z0OA 1F5JA 1H9WA 4LORA 4QH1A 3RIFA 4XF0A 2H6CA 4KU7A 5KDMC 3DYPA 3AKTA 3SCGA 5L3DB 3LBXB 2WNVC 1AYN1 2NLRA 1WMXA 2VQUA 1CIWA 2ZAHA 2OZJA 1PIV2 2JDPA 2VZOA 2Y8DA 1LHNA 5TBNA 4A6OA 2E8IA 1WUVA 4CYDA 3ASIA 1JZ4A 3SOXA 1WEEA 2RHPA 4RSUA 1VBC1 2VUAA 2WLPA 1L0VA 4OCTA 3FLTA 2JJ9A 4CDUB 2O8OA 1RC6A 4W65A 5CZKA 1SA0E 2ZACA 3LA7A 5C3QA 1XZYA 4FOVA 1OPMA 3VKOA 2NMNA 3FLPA 2BKOA 1HN0A 2JIJA 4G63A 2IZWA 3PIJA 3ZEFB 3I2IA 3C64A 2JIWA 1NT0A 4QQ4A 4OULA 3GCXA 3M3IA 1AR93 2QQOA 1WCQA 4XVHA 3KVBA 1RUG3 1WBLA 1ZBA2 5JZGB 4Z1VA 1QOOA 2GP5A 2YK0A 4LULA 2DBNA 1GKBA 2A3XA 2CT2A 1DYKA 4FVVA 1UD1A 4EJRA 5I0UA 1KRIA 2W2IA 2LHRA 4AFMA 1HG2A 3EVYA 1NYWA 2D6LX 2W91A 4GK5E 5DQWA 1UZYA 3RVHA 3LJUX 5LKTA 4ASMB 1DQ5A 5FDBA 3IHPA 2UUCT 5I91A 4M3CA 5H1VA 4K21A 3AMHA 4QB2A 1MIVA 1R8IA 4YM1A 2WBLA 3ZYHA 3TLVA 4QPIB 1WEMA 4E4ZA 3HTKC 3AEFA 4XBQA 3LSDA 2WLQA 1Y7BA 1ZRRA 3KNVA 4HWFA 4COFA 4AQSA 1AR92 1UYZA 3FM8C 4PNIA 3E6DA 2LSIA 4LKSA 3NRUA 3OBVE 3QK6A 2GMEA 2IFWA 5AQGB 5BPXA 4P1NA 5JXHA 3RZMA 1DQ2A 2PHWA 1WW6A 2Q9QC 1OOPC 2BOJA 1KFYA 1J3QA 1DGRN 3TN92 2ECJA 2JKXA 3D6EA 4A7KA 1HV1A 5L36A 1TE1B 3I7DA 5FEYA 1T8BA 1MEC1 2YMZA 1QJU3 2X51A 2XJVA 4YRDA 1YLLA 5DAWA 3AFGA 4M0HA 1HB3A 4LO8A 3HNBM 2HWD1 3N9OA 2Q0AA 5A3NA 3AEGA 3UU6A 1AJOA 1OEDB 4NVPA 1BEV2 2KYUA 3DWDA 2Z69A 3L39A 3BB6A 2M3HA 1Y9GA 1GNHA 4TZ4C 5IFTA 4DR5T 3J8F1 4CCMA 5HEHA 1C8M1 1J58A 3ZYGA 4RA0A 1MMNA 1NX9A 3ZC0A 1NA1A 1DU2A 4MVTA 1CHCA 4S3OC 1UO9A 2CGNA 5F3CA 5JRCB 4BQWA 3K4DA 3F95A 2KMFA 4META 1SMVA 1CUNA 4CI1B 4LBOA 2VQTA 1HN1A 4HKLA 1V6OA 3U3IA 2ZZQA 2FDHA 3WNPA 3S57A 4UBGA 1CZVA 1XWMA 5LA9A 4KL1A 4GH4C 3FUQA 2D44A 5IHRA 1O4TA 1QF3A 1TME3 1HIXA 5FZOB 2VU9A 1H1MA 1SLTA 1Q56A 4GB31 4NPPA 5A3OA 1BJQA 2VXJA 2JMIA 1GZWB 1KNPA 3LWCA 2VOTA 3AKRA 4KI0F 4Q0PA 3OJAA 2XQ7A 5C2TA 3RKGA 3ZFGB 5J09A 2EHOC 1IS5A 3OGJA 4SBVA 4GWMA 3SXWA 1C28A 3ZVXA 1U5IA 4WNKA 1PGW2 2P17A 1K12A 5BNOB 1S0CA 4HL0A 2KGIA 3ZT7A 4IV1C 2HEVF 2EHOA 1JTZX 4Q4X1 2AGSA 5F9TA 2XXZA 5LKXA 1AL21 2DWGA 2FCTA 3DXTA 5FY0A 1V6KA 2FDJA 4RL7A 1NG0A 3O1SA 5T3NA 1ACCA 5CKNA 3WHUA 1HNWT 3KCXA 1D0XA 4LIVA 3E97A 1XC6A 1KEXA 4UWDA 2BG9C 3T7LA 4WM7A 3JQWA 3S7EA 5IWAT 1LHOA 2BBJA 1X82A 2DURA 1WW4A 2YBPA 4COZA 5CKMA 4G3YC 4N43B 5EYAF 3ZN6A 5FKYA 2E6VA 2IDOB 2LDRA 5JRCA 4R8HA 1O8SA 4B4RA 2RS33 3P4SA 4B7EA 3WG1A 1UOGA 1XXNA 1AVBA 4N90A 3AZYA 2WWVA 1LR5A 2E63A 2LRPA 1SFYA 3APBA 1MS9A 3OBTA 5A32A 5I0DA 3NNFA 3ROUA 4OZXA 4BCUA 1NWMX 3LA3A 2L0BA 2OWAA 1KJLA 3I2DA 4GJYA 4GB32 2VBDA 1LU1A 4BISA 4LXLA 2MOZA 2XM2A 2EGMA 1D1CA 1FI2A 4COUA 2DU0A 3P4QA 1UY1A 4AVTA 1XYPA 2IUWA 3POWA 5JOZA 4EN0A 4HG6B 2R30A 2MHFA 1ZM1A 3MLJA 5H1TA 2QQLA 4UXAA 3N35A 4ZY9A 1D0HA 2XR4A 2IXCA 4Y4RA 4JGYB 4KWJA 3PDQA 1MVQA 5LGNB 5KX5E 1V9U3 4GJZA 4FI5A 5GLVA 2HPLA 2VJEB 3T0DA 2VAUA 2YUEA 2KSRA 3AE6A 3T1LA 2VASA 3J8F2 5LGTB 5FYHA 3UYJA 5LB6A 5A80A 4IEOA 2NP0A 1IGOA 4NIIA 4UFKA 1LOFC 4LUMA 3TYJA 3MFCA 5LEKA 2VH9A 2EIBA 1WCKA 2LRIC 2VL8A 3AEBA 1NKGA 3MIHA 4DUVA 5CFCC 4E2SA 3DDTA 2CEAA 4QQOA 1ZHCA 4AF9A 5JMCA 2LS6A 2XLFA 2W1WA 3PHDA 3RYCE 4LBNA 3AMNA 3JCFA 5JVVA 1D4M2 2VVEA 3OBAA 2CBJA 3WDVA 1W2NA 1N47A 4YW1A 4QQLA 2RS51 4FTSA 2VURA 4ZU7A 3THCA 3W15B 2YBSA 1WCSA 3PJQA 5JQGE 4YYOA 2EA6A 4DUZT 1GOFA 1CPNA 4L2NA 4WBBA 4YSXA 2MA6A 4GNEA 1VPHA 4S2DA 1O7FA 4XETA 4BHWA 2W39A 1IPKA 1A78A 2ZX4A 5FY7A 5EYXA 5FZHA 4LO6B 4MZUA 1JOJA 2GNBA 3DKQA 3P5BA 2CRWA 2BG9B 2QQJA 5FZBA 3I59B 2QZ2A 2XDVA 5GKAC 1X9PA 4Y22A 3ZKRA 2Q5TA 5F32A 1AX2A 4YFSA 3LFMA 2ARBA 1GOGA 2HYXA 2WA3A 3WDYA 3AEEA 4QQ2A 4D3WA 3K48A 5A3LA 5J2TE 4CDWB 2WMOA 1WA6X 1YKEB 5JOYA 3OGGA 1VRBA 3I2JA 1Z7S3 5FJHA 1TMF2 1FBVA 4QAWA 1QH7A 3EB5A 2FCUA 3AMPA 4N9HA 2K4DA 4IE6A 4O2BE 2A6XA 4BQ3A 1W6PA 3VGIA 4KBBA 3T08A 3D5OA 1EPWA 4FK5A 5JDNA 2WNOA 3H42B 4P00B 5CJ5A 4JZRA 1NCRA 1SLLA 3KINB 1W9FA 5HCHA 1KQRA 4X3GA 1UAIA 2R041 3ECQA 4I50E 2WNUA 2YQMA 2XBO1 2WAOA 4O2AE 2WQZC 1VMFA 3EHKA 3JUUA 4ILUA 5FYCA 2LOPA 2P1BA 2P37A 4NUUA 1HW5A 2YW8A 2CSGA 1MEC2 5GONE 1UU5A 2BTVC 1GWMA 4Z8XA 1GMMA 4RS5C 4RS5A 2IC6A 3U5MA 1CIYA 2QQUA 3MK7C 5DUUA 3FC0A 4ZOLE 1U5ZA 1QIQA 4EN6B 3S0MA 3M3QA 2WS93 4GQ7A 1KF6A 1MBMA 5F3GA 4ZI2D 4CSWA 3BPSA 3I4IA 2KKXA 3IKWA 4CDWC 1VBB3 3O5SA 3NNGA 2TBVA 4UFMA 5LK5A 2H89A 2UYBA 2ZX1A 2XKPA 4B8EA 3SLIA 2WSVA 1IPSA 2ECWA 3BYWA 1VBD3 3AYCA 4FPCA 5A3TA 2H7OA 5JDMA 3H7HA 4HZFA 4MLOA 1G7YA 3HT1A 5H9MA 1CAVA 3M7KA 5AQLB 1O3QA 4JHZA 2VL0A 1YHFA 3MW2A 4DR6T 1BBT2 4XBNA 2XTLA 2VZ1A 5H9PA 3H8OA 3M63A 4ZI7E 2LHNA 4ZEYA 3JB8A 2Y0IA 2W63A 1ZZCA 5EQUA 5ISLA 4KGGA 5IVJA 5F5WA 4JKMA 2DVDA 4HFEA 3MPPG 4QF3A 3GXUA 1D4M1 1QGLA 3FMGA 1MS1A 3QCWA 1UIJA 1GP4A 1JZ8A 3D4KA 3M3OA 4N3WA 1Q8VA 4BWOA 4BU2A 2VNVA 3VR8A 1MS4A 2DVAA 4Q4W3 3AAEB 1SDWA 4ZZBA 5KHIA 1OKQA 3AP7A 2JRKA 4N53B 1C8NA 4QB6A 3ZYRA 4DNDA 4U31A 4ISQA 2G45A 3WW2A 2VW1A 1UZVA 3POYA 1N34T 4HT1T 3EHZA 3KV9A 4ASKA 1BORA 1IOAA 1AYM3 4WA6A 5FLIA 3DYMA 4FOWA 3WF2A 3TEZA 5F1RA 3LEKA 2L7PA 4AQTA 1OLRA 3P6BA 2OKXA 1JYNA 1Y43B 4XFFA 2LROA 3JC6C 2H0VA 3AAAB 3B94A 2RM22 4QT6A 3OF1A 1WFDA 5JR9B 2Q1MA 1HTJF 4AEDB 2WZIA 1FATA 4GKKT 1W8FA 2E6SA 1XNDA 2FUUA 2PHXA 3F57A 1JI6A 3ZTGA 2QA7A 3QBQA 2B1EA 2GK9A 4AVVA 3LIHA 1AJ3A 4LE4A 3WINE 2HEWF 4YGDA 3KQ4B 5FCCA 3IT8A 5G05B 2DUQA 1VMHA 3SOLA 4ZI2C 4AHXA 2QJVA 4LBJA 3ZN5A 3LQHA 1Z7S2 2C6SA 3ZR6A 4N8MA 3PUWF 3VHRA 2KREA 5L3FB 3UU4A 1VAKA 5A6YA 1W0AA 3E1F1 1OF3A 4COVA 5JIAA 2GAUA 1UZ0A 3OYXA 5BXXA 3MHHA 2PXJA 4YVWA 2W0GA 2C0SA 4TV9E 4YVSC 2JQ9A 3NBXX 2XAJB 4Q0VA 5JMOA 4Y24A 4XTMA 3ANWA 2C4XA 4FCAA 1HV0A 2R6QA 2ZMAA 3HEIA 4N53A 4ZONA 2VY0A 5EJ3A 4B4PA 1RJ8A 4CEYB 3DCQA 1HRI1 2AREA 2IXIA 5FYSA 4DZGA 2E6RA 4JI0T 2D6MA 2RS53 2WZR2 4XJWA 1OT5A 3ZM8A 4DY3A 2G19A 4UVAB 3J7LA 3ZYPA 5ANNA 5JH7E 5JZGC 3NNLA 2VOKA 2I59A 4Y5SA 3OYWA 3NKTA 5JSRA 4PCRA 4YW3A 1OXZA 1XYNA 1Y01A 5JR9A 3MV01 4X64T 3C7FA 4LIUA 2D40A 4LBQA 4KWUA 3HCTA 2D3PA 2ZX3A 5LG4A 1AR61 4LKFA 2VCAA 2X53S 2Y43A 2FD8A 3MI8A 2ECTA 5FXVA 1IQDC 2N9DA 5I3LA 4TN7B 1GQEA 4PIYA 3Q8FA 2J1DG 3RG0A 5DPNA 5JR9C 4OI4A 1RUC3 4G2AA 5FZ7A 1GNZA 3QOPA 5FY9A 3GBWA 4J2CA 3L9JT 3U5OA 2P3KA 3VBHC 3VHNA 1KJRA 4Q4X2 2XHKA 2ZHMA 1ND3A 2OLTA 5EFUA 4BXFA 3ZMOA 3S4UA 5F2WA 5LBCA 2WP9A 3W58A 4P9YA 5LK7B 3LDQB 3MIGA 5APAA 5F6LB 1HRI3 2VMFA 2VVDA 3ZYQA 4UYBA 3ZYIB 1R082 4NAMA 3VDDB 2AENA 2QKDA 4RHV2 1JUIA 2NYYA 3FE5A 1PO21 5FQ0B 1PIV1 2XJSA 4Q2FA 4UF0B 2IIUA 3TEWA 3CKDA 2Y60A 4DEQA 1BBT1 2HWD3 2X05A 5EWSA 4GMP0 1B35C 3U4XA 3ZFFB 4W8JA 1QJU1 4HVQA 2NZ9A 1BR2A 1UOBA 2RVAA 3AYEA 4ORFA 2VPEA 4IDPA 2WM9A 2K46A 1UK5A 1SEFA 3UETA 2X8KA 3I2GA 5F3EA 3BU7A 4DEVA 2YREA 2I45A 3ZYKA 4DV0T 3D0SA 3ZXDA 2MAWA 2VZTA 5CAZA 3E22E 4E7SA 2WDQA 4FFHA 3VRAA 3RWKX 1KD7A 3LE0A 3PMEA 5GLWA 2A6YA 1FMWA 2BBAA 4L9IA 1C5IA 2R6GF 4JV5T 4NPLA 5FP9A 4O9GA 4ADZA 4P9GA 4ISTA 5FXZA 1W6QB 2VOWA 3ZCIA 4JBWF 1LGNA 5J1GA 4A4CA 1E2AA 3E08A 2AE9A 2CXFA 5T55A 2LGVA 1PMHX 4JDMA 1KNRA 4JI3T 4C0BA 1YNAA 1W9YA 4YJ2E 4YG3A 3OCPA 4RS5B 4FPYA 4P9JA 2CPTA 1S2EA 3MIDA 4NHYA 3ATGA 4P02B 4R9BA 4GIQA 2VZ3A 1JXNA 4PBOA 4XIKA 4H9PC 2JRJA 4U2AA 1GZCA 2RS13 3UGHA 4RHV1 1VLNA 4K1ZA 2M67A 4IV1B 5KC6A 3FHNA 4Y5TA 1ZBDB 3SITA 4PQ9A 3ZMUB 2HWB1 3J7MA 2BFUS 4K1YA 4N7UA 4E2GA 2Y1NA 5ACA3 3HA4A 1VBE2 3QOFA 3C7GA 5FL0A 4IXLA 3RZHA 4IEQA 2VVNA 4PK6A 4DUWA 2LGLA 1RINA 3N7MA 1RUJ3 1VYXA 3VBHB 4YT0A 4ILBA 5CB4E 1VE0A 1F35A 3O1JA 3POIA 3RNSA 1SHZC 4XZCA 5L3GB 1QKQA 3Q8CA 1RUJ1 5HXHA 2P6HA 4WVMA 3ORJA 5G04L 1HNXT 3UULA 3PHMA 2CRBA 4IEXA 5FYMA 5AVAA 5IW0A 1ZA7A 4OFGA 5DZFA 4M3CE 4P14A 3TNPB 3ZDSA 4CDXA 1VD4A 3AE1A 1O6UA 4GMP1 2BQPA 3I1AA 1ZA4A 1FPN2 3W5MA 2WQ8A 4ITCA 1QUUA 2B45X 4DV5T 3OY8B 3L09A 3UFEA 3PUYF 3PUVF 3SOUA 2LQ6A 5JXIA 3SRZA 4WZFA 1GLHA 1I1EA 2KFTA 3C4ZA 4IW3A 2E61A 5T52A 3RC8A 1OA2A 3VBFB 3O12A 3ONXA 4XMIA 1HB1A 2E9XD 1WMEA 2YYRA 2CA5A 4E27A 4GNFA 4ZXLA 4XTPA 1AR73 1DZRA 1VAVA 4N78D 2DI4A 1HQNA 4CVUA 4JKLA 2ODUA 3RQUA 2WWJA 3POFA 3PU3A 2ARCA 2WT0A 4QKNA 1AR62 3VKMA 1RUNA 2RP4A 4LF6T 1ZYBA 4WZ3B 5FPZA 1WW5A 1FT9A 1DGLA 3ILNA 4OHVA 3POJA 5JI9A 1SZBA 1WFKA 3GN5A 3TLSA 2DTWA 4NR1A 4WV8A 2XQ5A 2BUKA 2VP7A 5IHYA 5A7QA 2ZHLA 1B09A 2WA4A 4DINB 3FZLB 2KD7A 2F4PA 4P09A 3MUY1 1WESA 3S6PA 4WZCA 2XOYA 4EV0A 1ZBE1 2Y64A 1OQ1A 2BW8A 4UELA 5C4WC 2DCKA 5AQUB 4F8HA 4BK5A 4N53C 2XQ3A 3AKQA 4AQFA 4JX0A 3LQCA 2KWNA 1PK6B 4LFAT 3SCFA 1ZV4X 1O3TA 2WB5A 3AKPA 3T2PA 4HONA 2W92A 3GM8A 2D7FA 3B01A 4YTPA 4OLLA 2FZ1A 4Q26A 2W08A 5FK7A 2B39A 2QFEA 3ANWB 3GJBA 3ZYBA 3U5NA 4LF5T 3GN5B 4XUQA 4PI0A 4E2QA 3WQBA 2Y6XA 3DF0A 1JYIA 1VRH3 3M4FA 2VTXA 3BCWA 1YYNA 3RHWA 2BNMA 3KM5A 4BA6A 2RPAA 4UFIA 2C5JA 5L73A 4O4LE 1NE6A 4TWFA 1W90A 4CI2B 3ZN1B 3V56A 1N1TA 4ISRA 3N9PA 1HRV2 1RUF3 4GB33 4LNVA 3ZYJB 3VHOA 2L8KA 3POEA 2LXHC 4PF1A 2WZPP 1MS0A 4QHZA 3VZLA 2BWCA 4ZUXU 4PK5A 2JEMA 3CX6B 4A6SA 5EPAA 4MXVA 5LYJE 4ASLA 5B75A 5LW9A 2VR4A 3GMIA 4GWIA 2ADDA 4HKOA 1NA1C 1YC61 3RQ0A 3U11A 5GZEA 1JOBA 1ZRDA 2HEYF 4FPEA 1BXHA 5FLJA 2H88A 1VBD1 4XMAA 3VKGA 5E6HA 3UU3A 3ZCJA 1UY0A 3ZSKA 4S2FA 2FMDA 4XHXA 4ISSA 2WT2A 2YGLA 5FP4A 1VJ2A 3RH3A 2WC2A 2IXJA 1VRH2 1OSGA 2Y0OA 1YFYA 1W9SA 3C98B 3PUXF 4LBMA 3J7Yq 5GLZA 2H0DB 3EDUA 2PHFA 3J9X1 3M62A 4OUMA 3POSA 3I49A 1J3PA 4TXWA 4DR3T 4XXAA 2H0BA 4HOOA 3G06A 1G8XA 2BS2A 4I43B 5GALA 4I4TE 5FPVA 1CX1A 4KHPT 1JODA 2OPWA 4FAGA 3RS6A 4A4AA 1LEMA 3IAPA 1LODA 2Q9QA 3VHPA 2DHRA 4EEBA 3V65A 5G05L 5K9YA 2P5BA 5JDLA 4QPGB 5LA1A 4DVDA 3JXSA 4BMEA 1V6LA 5BNPB 4YATA 1W6QA 3UUMA 4GYRA 5LA0A 5J98B 4N4FA 3ZSSA 4XAEA 4OI2A 5EHDA 2TUNA 1BBT3 2WQ4A 3N7JA 1JOPA 2ZM6T 1Z7S1 3VD9A 4LMKA 2M6MA 5H1UA 4LE3A 3FZ3A 2OQ7A 2J22A 2LALA 2G0UA 2PBIA 1V9DA 4L97A 3ZPV1 4FP2A 2A1XA 5T54A 1HXS1 2RDQA 5FZOA 2J1UA 4URTA 1UIKA 3HQRA 5LATA 4YTNA 3N9QA 1WEVA 2BYVE 3OTFA 3SKJE 3ONJA 4CDQB 4CDQC 1W6MB 2VNRA 3OB8A 1HYJA 1SLAA 4ES8A 2HYKA 1ULCA 2PHDA 4GOUA 3ZN6B 2ACXA 1N32T 3QLQA 3NJZA 1MZEA 1N36T 5IK5A 4Y22B 4DB5A 1UOFA 2VUCA 4IEWA 3MIEA 2QGSA 2LSJA 3PDYA 3C5KA 2RR4A 2BZDA 2VJXA 4GWNA 3K4ZA 2BVBA 1CAUA 2VQAA 4CDWA 2H0DA 1UX5A 1GUIA 2QE3A 3ZFEC 3UV9A 2I74A 4YGEA 2IVJA 2X66A 5GM0A 3Q5EA 3HR9A 2HYED 3GWHA 3KQRA 4BJMA 2LTNA 4U7YA 2J1AA 2CXLA 4RYDA 3WCRA 3ACHA 1TNRA 1QWRA 3V0BA 3TN91 3O0WA 2LN0A 1FP0A 2Y34A 5DAXA 1QJX3 5JWPA 4QPGA 3VLBB 1D4M3 3ZIXA 1NY72 3ZKYA 3T8OA 2SLIA 1QJY1 2ID4A 4XURA 5FYIA 3CQGB 3ST7A 3ZFFC 2WT1A 5DUXA 4DXRA 1VOMA 3FBMA 2G4IA 3ZVZB 3VD5A 2XQ4A 1VBE3 2VULA 4PQQA 3L8RA 2NQYA 4MFRA 1ZP0A 3ZKUA 2YINA 1C8M2 2UXCT 4JVAA 3UKNA 4IQPA 4RFT0 5A1FA 2WO2A 5LMUT 3ZX7A 1YQ5A 5F5QA 2AZ5A 1JU4A 2VQET 4IGOA 5C6CA 3P3PA 4ZHNA 5FK8A 1UY4A 3NKZA 2A6VA 1W9WA 4FPFA 5JG6A 4DV4T 3J4UH 4W6XA 5A3UA 3IEEA 2QVAA 4NN2A 5FMCA 2YC0A 3CX8B 2DFCA 5FBJA 2CMRA 1AXZA 4LOSA 5HI0A 3UQ4A 4JGYA 5GZCA 3B13A 2ZGUA 3R84B 4U36A 3NJYA 4YHJA 3JAFA 4E4DX 2Y26A 2CSZA 2R49A 1X79A 2RA1A 2CDOA 3WLUA 1ND3C 1IKPA 2LSGA 1IYMA 4H3WA 2YDQA 2QDRA 4OHFA 3H1YA 3IDBB 4MX3A 2P6CA 4A45A 1VBA3 1JZ2A 3UU5A 2X29A 2GN7A 4LMFA 1WEOA 1OI6A 5TDRA 1NOVA 1LHWA 2XAGB 4S2HA 1W0BA 5JDBA 4X1KE 1Q8SA 3FANA 2BBVA 1CVNA 2C5DA 3I2FA 4DIQA 2GZWA 4CXYA 1G9BA 4AHZA 3I8TA 4Z90A 2PAMA 1OC1A 1VB4A 2MUMA 1YW0A 5DZGA 4YARA 4GK0E 1NENA 2JENA 2KINB 2ATFA 1W03A 4KGQA 2RS12 5DDJ1 3TLWA 2RV9A 1BEV1 4TLGA 1J84A 3PUHA 2WN3A 3B69A 3IDEA 3AX4A 4LHKA 4UIGA 4QX2A 5LBFA 3ZPOA 5FV3A 5E16A 1KDMA 1S0FA 4FQ4A 4XPVA 5T5LA 2M1RA 1E7PA 2HJIA 2R0HA 3UQ7A 3DXUA 1HRI2 2K17A 2HWB2 2ZTNA 5I8SA 3RFRA 1U5XA 3PUSA 5JZGA 2UUBT 3KD4A 1XE0A 2JDAA 3MLLA 5ERLA 4U7IA 5L7OA 4LKAA 5FUPA 2VG9A 4AISA 1YXWA 2WABA 2W67A 3AK0A 4UXNB 1T98A 1NCRB 1MQTC 3KCYA 2ZEWA 1XSRA 4PFOA 4HTEA 4L11A 4UR9A 5KC5A 5C3JA 2YC2A 1TMF3 1RMU1 2D9DA 3ZN0B 2WNUB 3CJXA 3OJBA 4COWA 4COYA 3WP6A 2EICA 2G43A 3RSJA 1V70A 2RDSA 4EE2A 1WILA 3RMYA 4RR3C 3VZKA 1HB4A 2Y1MA 4EXTA 3PU8A 2VMDA 4Q4V1 1HNZT 2XP0A 3FX3A 5F8PA 5LKZA 3P8CD 3OEBA 2IFRA 4KBZA 3FHIB 3IA3A 3QC9A 3HKBE 2V09A 4HE8A 1IZ3A 4O7XA 1VRH1 4XBLA 3I0QA 3B9IA 2DCYA 2PMWB 4A56A 5FFOC 2ZM8A 2YROA 1AX1A 3I97A 2RS11 5DDJ2 4CN6A 1SE7A 4QPIA 4CA9A 3OGRA 3ZXGA 4IC3A 5FP7A 1W8TA 1MZ6A 2VD7A 2UU8A 1NCQB 3J9SA 1MS3A 4IEUA 3DV8A 4Z82A 1TQ5A 3MDBC 5CIRA 2IXHA 1W09A 2CGPA 3ZSTA 1QOSA 4AL9A 1MPXA 3OGSA 5EXOA 4L0RA 3CF6E 4DS0A 1HS7A 3C50A 1D2QA 2W1SA 5IK4A 1JBCA 3RMXA 4HK9A 3ZXLA 5I93A 5HYAA 2XQYA 3HCSA 4LPLA 3BUCA 3FAOA 4INDA 5K4LA 4AQGA 3ZOIA 2ODVA 1W2OA 1WEPA 5JXJA 1LTEA 4HVOA 4QGNA 1DQ1A 2VZQA 5KH7A 3O34A 2YSMA 4R9AA 2YFUA 1QXJA 4NIGA 4PJNA 4LF7T 5BYNA 2P9BA 4DV7T 4EWDA 4FOYA 4NIAA 2VQ0A 4OHYA 4AE2A 2RDNA 4LBLA 5FP3A 4F52B 1Z60A 4CXXA 1OD3A 3T3YA 3GL6A 3O33A 5H9RA 2OPKA 1FV2A 1XE7A 2VTFA 4XAXB 3CX7B 1H2MA 4YM3A 1ZVFA 1K5MC 5FZ1A 3C51A 1WGPA 2ZAAA 2BERA 1RXGA 3NV4A 2E7QA 4WBNE 4UF0A 2E31A 1CAWA 1O59A 3KBTA 4A0CD 3RPGC 5F2SA 3WW3A 5KHJA 4Z92B 1FMD2 3RPQA 3N2KE 4GMP3 1H9PA 4OGCA 4YG6A 1YFXA 3ZFFA 4JGZA 4IV3C 2E7TA 5FMOS 1SPPA 5ADXL 5T5OA 3THDA 3LEIA 1POV0 2NN8A 3MPBA 5LKUA 3IAQA 4NXNT 2VW2A 1PO12 5DABA 4DUYT 3U78A 2PTMA 1H4HA 1QSDA 1CN1A 3A7QA 1W8ZA 3RQWA 3G7DA 1SG3A 1TME1 5F3IA 3T0AA 4LK9A 4IE4A 1AXKA 4M00A 5C8CA 1ZZ8A 4IC2A 4XF4A 3LB9A 2PN5A 5IVBA 2P57A 1XNKA 4UFJA 3T2OA 4YLZA 5F3JA 1COV2 1XNRT 3O1MA 1DQ0A 2ZXQA 1PK6C 3I2HA 2YOEA 3ZMNA 4D0QA 3I3DA 5JPMB 4IT4A 3M2MA 4GALA 2VKDA 5A70A 2RI7A 4AEJA 3AVRA 3HN1A 1OURA 2G6QA 2MIQA 3ZFGA 4UW6A 1LULA 4GKYA 4K40A 1ONAA 1RYYA 2M13A 2KIZA 5HXSA 1FMD3 3PL0A 2BGCA 3NG2A 1VBB1 2YV8A 4GNGA 4JI1T 5CEHA 5FZLA 3FBLA 1VBC2 3GA8A 3P4WA 1CPMA 3CIRA 1WIMA 3VU7H 5L3CB 2L43A 5BNPC 1CZSA 2R32A 4HFVA 3FBZA 3OBZA 4I3GA 2I6HA 2V8SV 2ETEA 2CHOA 1POV3 1ENXA 5ABJA 4WM7C 5DDJ3 2D5HA 1CAWB 5GLTA 3P4PA 5AFBA 2L80A 3MKDA 4CDUA 4BJ0A 2W68A 4XZUG 2ZGMA 4E8DA 5C4WB 2E2AA 5KXEA 5FIXA 4D8MA 3O1TA 3OKQA 3KV4A 2X0HA 3WXPA 5ABHA 1X8EA 4XQWA 2YPJA 2A7AA 2MEV1 2WO7A 2JDYA 4Y26A 5H9QA 2VJFA 5LNKA 1Q5OA 3V64A 2MEV3 4EZ4A 4Y1UA 5J3XA 4LA3A 4IL9A 3RZLA 4Z0RA 4X62T 4MOAA 3R4UA 1C3HA 3FN9A 4HFDA 1JNZA 4A3ZA 4YXDA 4AQFC 4UVBB 3QH7A 3F31A 1RUF2 1LGCA 5F37A 2Y6GA 4YW7A 3BKZA 2IUBA 3AMQA 2XHEB 1SHWB 5C9AB 4EN8B 2E32A 4EYYR 1BZWA 1KNZA 2LM9A 1HYIA 4WZ0A 1YD8G 1W04A 4HWHA 3AXJA 3VBFA 2VZSA 5I0RA 5C71A 2IQJA 2Q1FA 5IFPA 4NIQA 3DKWA 1UMZA 5FPLA 4HN1A 3LFIA 4GWJA 3PUGA 5D1IA 3T1MA 3GZTB 3C6WA 4JLEA 4ET7A 3ASLA 1OVSA 3KSCA 1WRDA 3VV1A 3JC6D 1JZ5A 4R8PK 2I07B 5IK7A 5DG2A 2R16A 3BOWA 3KQIA 4RR3B 4FO9A 1MMAA 2NPIA 1XNQT 4A7YA 3NAPC 4HPKB 3VD3A 5FZEA 2CLYB 4UEMA 3RIUC 5G04B 4HXCA 3HN3A 2ZEZA 4AKIA 3ZMSB 4YLHA 4JI8T 5A7WA 2ZHNA 2JG8A 3FEHA 5LY1A 4FXGB 4M4PA 2YDSA 4HMZA 2BNNA 5DKAA 2JDZA 4ZZCA 4NRQA 1O3XA 3I2OA 4PT6A 4DXSA 2JECA 2YBKA 5AC93 4BIOA 2VB6A 4NRMA 4PLOA 4YSYA 2CYFA 2KU3A 1VAMA 1YO8A 1O3SA 2D2SA 2VJFB 4UT5A 5AQQB 1W0OA 1RUI2 1HJFA 3K8PC 3ZXKA 1REEA 1RUC1 3LJCA 3BGAA 3ACIA 4S3OB 4Y33A 1XSQA 4IERA 1LRHA 4HFBA 1YI9A 3IMNA 2OQ6A 4QGMA 4YGCA 4QKDA 3RGBA 1W9TA 4LK6A 3PLWA 1SBFA 3R0RA 3IB3A 1BLZA 2WYFA 2ZX0A 1LNSA 2OA2A 4Z2WA 1J1TA 3MHSA 4AQ6A 4QXBA 4OUSA 4K0UA 4MGZE 5A7PA 1BR1A 2X09A 1V00A 1AYN3 5CVRA 5LCYA 2XL9A 3RI9A 1AF9A 1UPSA 4WVWA 2EGPA 1ENSA 3LA2A 3CDZB 4RFRB 3BI3A 2G9FA 2DWRA 1P8JA 4PDWB 4Z07A 4CTEA 1OFNA 2K48A 1Y64B 1JU3A 5FXXA 5FZIA 5LBQB 2QUOA 1NLQA 2MT5A 2BOIA 2DX8A 4AR2A 5K3QA 2FMYA 1PHMA 4CQIA 3L1XA 5EK4A 3POGA 4ILAA 4EYUA 1JW6A 5CNAA 2X0LB 3KVAA 3E5XA 4D6SA 5T50A 3HQXA 3GDBA 1W6PB 1K5MA 5HCBA 2V73A 4V3LC 3AP5A 1OUSA 2X5IC 1WR0A 1BR4A 1Q43A 2VOVA 5A1AA 3AE8A 1GZTA 2FFWA 5D8AC 1WMFA 3DUIA 4H63V 3ZXJA 1QJX2 1N1VA 5GLUA 4N43C 2L9LA 2RMU3 5E8AA 1OA4A 1XU2A 4MGQA 5B79A 4OYKA 3AJYA 4WBOA 1HG5A 4KU8A 3I3MA 1UOJA 5HCFA 4OYJA 3Q9OA 3KHBA 5L3BB 2BKPA 3URFA 4PW8A 2J7MA 3D82A 4O4IE 3MF6A 1JZ3A 4QH4A 2FJAA 5DXDA 3UUBA 4TX5A 2K3WA 1Z0HA 1POV1 2YSJA 4QWNB 4C90A 3VKNA 5IYYA 1CGPA 2I50A 1QQP1 3AL5A 1E5SA 4QXBB 1CONA 5KH9A 3SEPA 3T4HB 5TABA 2C0ZA 5FPUA 4H14A 4E4HA 1OXCA 1RTVA 3Q8AA 4HVRA 1EV12 4YM2A 4CXWA 3JADA 3DYOA 2V7LA 2WU5A 3HT2A 3B57A 3ZN4A 2Y48B 2VUJA 4XJUA 1S0JA 2DYCA 3OPZA 1S0DA 1LHVA 1UXZA 2JQKA 1W39A 2P3JA 4LFBT 5DAQA 3W9AA 4HANA 3MEPA 2DUPA 2RR11 2KNDA 4CEYC 4BB3A 3O47A 4DRRA 3KDEC 4FPOB 2Y6FA 3ONLC 2CWSA 1T6BX 2LE8A 1IS6A 2X9HA 2VO5A 4BQ1A 2PFWA 4OQ8A 4FQZA 1UUSA 5EJZB 1NY71 5LJMA 5I8YA 1GSLA 1CWPA 1GP5A 1SDDB 4LKEA 5FO7B 4AFDA 4XUTA 1MMGA 1UNBA 2ES3A 5FZ3A 1UKRA 4CDXC 1POQA 5TRBA 4B86C 1R091 4ZS2A 2WNVB 2ZABA 4NHMA 2E7AA 3IBPA 5ABFA 1E57A 2V72A 5J3UA 1SCRA 4R4XA 4AI3A 1PM4A 1O8PA 3H8UA 4DNYA 1NQDA 4D7YA 2FBEA 1RUOA 5CG9A 4YGBA 1O91A 4CI3B 3KLSA 3VB9A 1SACA 1A3KA 5KBFA 5IT6A 4HFHA 4LF4T 2QQMA 2X5IB 3C3VA 4JI2T 1DCSA 5CA1E 4QPYA 2CONA 5CYYA 1J5ET 1WE9A 1UYYA 1V6MA 2XPKA 3I0OA 1HXS3 2ZMNA 3ZMZB 1GZWA 1QH6A 5J1XA 1YUDA 1FYUA 2YURA 3H9AA 1QJEA 3T30A 2WNVA 2ECGA 3V0BB 1I94T 2V6YB 1H7CA 2XPJA 3DECA 2M85A 4CPBA 3EDVA 4HETA 5J48A 1ZRCA 2FJBA 4AI2A 2A75A 2KLQA 4QMAA 2PLV1 2HWF3 1U5PA 4JQTA 2VPGA 1MM2A 5JOXA 5FAXA 1JS9A 1CZTA 5JI7A 1FJGT 1VBD2 2RS52 4CP0A 2D93A 2Q8CA 1ZNPA 1DQ4A 4CCNA 3VBFC 2XWBB 1KGYA 3ACFA 5FWJA 1EUUA 2B4KA 2YFZA 1V6JA 4PLNA 4Y20B 3RYIE 5IVVA 3NV2A 1FAYA 2R063 2WZ8A 2FZ2A 4X6QB 1SUMB 2CSVA 2BBHA 4TNWA 1ALYA 4AKLA 2FDKA 4F6RC 4R7EA 2C26A 4YFZA 1UCUA 2D6OX 2K16A 2W5FA 2MBGA 2YN6A 4AAPA 1UURA 1FOD1 2QICA 4B3MT 1FMD1 3LEMA 2EAKA 4MXWA 2RJLA 3TLTA 4RR3A 4MSXA 3H8XA 1FX5A 4H63H 2LW8A 2GNTA 2ZM2A 3AA1B 2HBUA 4PPEA 3ACGA 2LKGA 3SS1A 1QJX1 1K3IA 3O1PA 4OI0A 4JAAA 2XAFB 2JG8B 4E7ZA 2IDAA 1SLCA 3ETVA 1IS3A 2FQPA 3U14A 4TUYE 2BKNA 2VPBA 4DV1T 2ECVA 1DIWA 1HDKA 1STMA 3V0AA 2BP6A 4DUXA 3I54A 3CO2A 1L7LA 2KWHA 5FTTC 1H0BA 5EIYB 1S0IA 4B3RT 1OWAA 3E0ZA 2ILMA 2OS2A 4DR7T 1W9RA 3LVRE 3RRWA 5HCMA 3JZVA 3LQJA 4K9SA 2AC1A 2V5YA 1PVXA 4HWDA 1H8TA 5A3WA 4Q4V2 4B3NA 2D6KA 4LTAA 3HNYM 3AP4A 2MTQA 2OVUA 1IG0A 4PAGA 4I0AA 3NO8A 2CAVA 3RTRB 4IGPA 5A7SA 4AHYA 1KK7A 3I3BA 3ZJ1A 5G0FA 3WVJA 3VKHA 1UGOA 2GN3A 2Q1ZB 3T9KA 4J1XA 4H9QC 1RUI1 2P3YA 4AFBA 5LBBA 3LF7A 3FFQA 1ASJ2 5IVYA 1OUXA 4A2UA 1QNWA 4GD4A 1LHUA 2WFF2 1FNYA 4OHWA 4ZZ5A 4QQPA 1SLBA 3MICA 2QQVA 2LV9A 2RM21 5FREA 3R4DB 5FWEA 3Q5DA 1CR7A 1VFYA 5HWXA 4I09A 1A8DA 1B35A 4TZDA 2XVGA 4RGKA 3AB0A 3FUOA 5FP8A 1CD3G 4CE8A 1H8TB 5CFBA 2GC2A 4A97A 2MYSA 3BQIA 4Q1RA 1Y3TA 1UYXA 1R64A 3AE3A 2D8UA 2WZEA 3HQUA 1YQCA 4LA2A 1OFSA 4OYUA 4AQ2A 4IDNA 1WWYA 4TWHA 4DMVA 3OEAA 1D2SA 1PO11 1WMDA 4I7DA 2B0OE 5FZDA 3ZO0B 2J42A 1YQ2A 4KG8A 2IMLA 4P9XA 2UXNB 2RSDA 4OVEA 5BNNB 2C9AA 3HMYA 3T0BA 4NE9A 5B2GB 3AL6A 4LADB 1ULEA 5DQVA 1YIFA 4PIXA 3OD0A 3R6SA 5SVIA 2W47A 3QH6A 1XDOA 2HKXA 5D1LB 2NW9A 4OZOA 2WRAA 4FTBA 3IMMA 3MZHA 4CCLA 4TNVA 4RQPA 5J2UE 3EI0A 4AW7A 1V6NA 1GU3A 3PLQA 4AGVA 5CB7A 3WQ7A 2YVRA 2XGXA 2VMHA 3UKTA 1QQP2 2XJTA 1MZFA 3DN7A 2EODA 3VBOC 5FXWA 2ZGPA 4Y5Z0 2JDUA 4CP9B 1PGL2 5A7NA 1I3HA 3K77A 4GAZA 4C9ZA 2D5FA 4QM8A 5FZ8A 1G86A 1WLTA 2Y8KA 4IV3A 2V7KA 4YTMA 4EGWA 4I0BA 2JG9B 4M4RA 4BBQA 1F5FA 3RGLA 2DBIA 2VVFA 3HAGA 1WA4A 2XLGA 1S0BA 3OTOT 5C3SA 1ZEEA 2P34A 2AN6A 4AVXA 2WDBA 1DDLA 1COV1 2X10A 3PV0F 3H3MA 2N2NA 3V43A 5JR7B 2QTWB 3M3ZB 2AEZA 2J1TA 3ZFGC 2R1BA 3ABVA 3LGRA 2ORZA 1LRZA 4B1LA 2QYWA 1ULPA 5EYYA 2MEV2 4V1PA 5GZGA 3IHRA 3M7AA 2YU4A 4MHUA 3WNXA 4CEWA 4CCGX 4Q8KA 3HOBA 4DQAA 1JZ6A 4WZXA 1LVKA 2FDFA 1A8MA 4JKKA 3WD5A 5IVCA 3DGTA 4ZU5A 3E5UA 3ZFEB 4YZ4A 1ULFA 2QQKA 4AKGA 1OVPA 4W4ZA 4B4QA 2LGKA 1CAXB 5F39A 5JREA 4BOWA 3RIUA 4XJ9A 3RC3A 1Q8QA 3MA9A 5C9AC 5L47A 5L7OC 3UUNA 3AP6A 3MIBA 3CWZB 2VPDA 4H9SE 2YDRA 2JE9A 1MMDA 2ZM0A 1X9BA 4Q0QA 1J1JA 2JM3A 2XBO3 1N3OA 2E9QA 2TNFA 4QX8A 5CA0E 4RGAA 2IWGB 2YHJA 3KBUA 3OY8A 1R092 1S35A 3NQHA 5AQRB 3RRCA 2HWC2 4QF2A 1DCQA 2F6BA 1W6OA 1WW7A 1T1HA 2KT9A 3O1RA 2W1QA 3UGFA 5FB0A 1NQJA 1O3RA 5SVXA 1BEV3 2DTYA 2PHUA 2ZHKA 4AI0A 4W4UA 1X4IA 1IPJA 2EHOD 1L7RA 5TDWA 1EAH3 4AXPA 2PLV2 1C8M3 4BDVB 1IZNB 3N2OA 4WYVA 3OYWB 5DG1A 1XNBA 4TWDA 2W3JA 3SH4A 2Y38A 1SCSA 4XBFB 3WF1A 2OXQC 2RDRA 4QXHB 1VBA1 4SLIA 3VBOB 4A5XA 1LEDA 4PFPA 4CRQA 3L3PA 5LG3A 4KI5M 5LB7B 5T5PA 3PIGA 1ASJ1 4IESA 5AFUL 5K7PA 4C0HA 3UKVA 1VALA 2XJPA 1UQXA 3N9MA 3SWHA 3MV11 2Z5WA 4V3KC 2MD7B 5EJ1B 3GV4A 4TV8E 4YVWC 4U3CA 3H3UA 5GJ6A 3OVUA 5BNOC 2XJUA 3CLPA 3LAGA 2EXIA 4FPJA 2LLYA 2OA5A 4AYCA 3KS7A 1YFWA 4PJMA 2JG8C 3VBSA 2ECIA 1HQWA 1EAH1 1DVPA 4Z91A 3WP3A 5B78A 3O1UA 2ET7A 1UCXA 2D8SA 1H2LA 4XZPA 4DPNA 5CKQA 1BKZA 1D1BA 5DAVA 1EV11 1X33A 3WW1A 2XJ7A 5HV4A 1PM7A 3KWVA 3U37A 5LMNT 3OOXA 3VZJA 2PJQA 4EN7B 1OEDE 1FEWA 1U4QA 3RJ2X 2EALA 2XSBA 2B76A 5HPOA 4JV4A 1OHFA 2CGOA 3PUAA 4CCKA 4MGTA 1U6GB 5D8AB 2K9AA 2X68A 1GFF2 1GANA 4CN4A 4EEDA 1UU4A 3L2HA 5FYUA 3PTYA 4NMIA 1RMU3 3MW3A 3HBZA 4JDNA 2XB1A 5B77A 5A3MA 4A7ZA 1QLBA 2OT7A 2R062 4HFCA 1YCIA 4ARXA 2XEUA 5FZCA 1JHNA 4YVWB 3LDRA 2WUHA 2ZGQA 1UWWA 4HSJA 2VVSA 4CN1A 3H3LA 3K1SA 2WWUA 5LCWB 2VECA 3EXUA 3AE4A 5KXJA 1LOAA 3T6RA 1UZWA 4YW6A 1BVP1 4XFAA 1VBC3 2N7GA 2F42A 1RUF1 3WW4A 2E9XB 4Y3OA 1ZKEA 2A6WA 3CMGA 1HCIA 4XIOA 5FMNA 2ZBJA 4QX5A 4U2ZA 1VR3A 5FERA 3DL3A 3SFEA 5FMBA 4A41A 2CBIA 2XQAA 4H2AA 4EWAA 1F9KA 5IK8A 2ZGLA 4BHPA 1YFUA 2JKBA 4NHXA 1W2TA 1RVF1 2BG9A 5H6RB 3SISA 4P9IA 4AIUA 3FLRA 3JBG1 5FOBB 4EV6A 4AVCA 4LHNA 3DPRC 2W00A 3KV6A 4R2YA 3CZJA 4NJ4A 3ENRA 2B7YA 3EJKA 5I0TA 2H7VC 3BTYA 4IDQA 3MLKA 2BRTA 4H7LA 3BALA 4LLOA 4XFCA 2B8MA 4EB6E 2BGPA 3OBRA 4OMCA 3AE9A 1XOYA 2ZMKA 3WNNA 3QACA 4PJLA 4MBQA 4FTEA 4Q0SA 2I2SA 2VPVA 2PUYA 4MGIE 5SV5A 1V6IA 3WY6A 1H8VA 4X1IE 4CCCA 1B35B 3O0VA 4OFZA 3KFWX 3ZYFA 3VBRB 2X9YA 5HBAA 3VBUA 2XHNA 4G9SB 4D6QA 5HEGA 3X29B 4UI9B 1S0EA 1DQ6A 5TAOA 1WENA 1GZ9A 3AE2A 4LOTA 5I0SA 4AOCA 3PVBB 1XDPA 3EB7A 4LK7A 2DFBA 5AQHB 2WS3A 2VKHA 2XQ8A 5IAVA 2CSYA 4AI8A 4N7IA 2RM23 5D1MB 2BU9A 5HXVA 2Q8DA 3KT4A 1Y9QA 3GALA 1AR83 3JBG3 2WINB 5DAPA 1Z8UA 3VDAA 2NOXA 1K42A 1E5RA 4QX0A 1LVFA 2RR12 4YVSB 4FFIA 3QZVA 1IJ5A 1KDKA 1RVF3 3FBYA 2ECNA 2BJSA 3U0ZA 4OI1A 2ADEA 4Q0UA 1R1ZA 3Q9DA 2NAAA 1ND3B 4R9CA 4CEWC 1W0PA 3CQCB 2LT3A 4YC9A 4HLTA 1YRZA 5GZFA 2R072 1ENRA 1AZDA 2YU1A 4XFGA 2VGDA 1ZZBA 4BA9A 2FCVA 4AK3A 3VR9A 4UW4A 3UESA 4ZKTB 4XUNA 2V7MA 2J1EA 2EVXA 4M1PA 2UWBA 2WWSA 3WDWA 3R4SA 3H7JA 3UU8A 2PFVA 4L7XA 1FIOA 3ZSJA 1ZREA 3OGVA 4XI1A 3T4VA 5M4YA 2V26A 5FYVA 4LO7A 1W99A 3VHLA 1ZZ6A 1AHSA 1Q8PA 2D0UA 3H7YA 4QHOA 4BAYB 1CESA 3WNMA 2KWJA 1ND2C 4C1XA 1VIWB 1MIWA 1RHI3 3SUBA 1GWKA 1UL9A 5JDGA 4JGYC 4I0WB 2FUPA 4Y1YA 4RN5A 3RZGA 1WGMA 3LBXA 5FUNA 1LJ7A 2DVBA 3CU7A 1HX6A 1GQHA 2KE1A 1D0GA 4OHZA 4LHSA 3ACLA 2YEVC 5L9VA 2CHNA 3UL2A 3RKOA 3VUOA 4XFIA 3NRXA 5FZ6A 4B29A 1WKYA 2JJ6A 1H1IA 1H4GA 2EIGA 2LUWA 2OX0A 1Y4WA 4QKBA 1DYPA 4Q6FA 3WP4A 2EHOB 2MKEA 4IL7A 5EV7A 1QMJA 2H3RA 1IG3A 4KWKA 3TEXA 4WVMB 5LOVE 2NW7A 3B9CA 2HWE3 3HI2A 1ZZ7A 4F7ZA 4FI9A 1WBFA 4W6WA 4YHHT 2DVFA 1RL3A 2QNKA 2BG9E 3IIAA 3ZNIA 3LPFA 4CDXB 4JUYA 2KM2A 2RMU2 4AHWA 4QPIC 5CFDB 3N7KA 3MHZA 4I7CA 4L99A 5FZ9A 4H55A 2DCJA 3I3QA 4BQXA 5TSWA 1C1FA 2AUYA 3M99A 4R9DA 3M70A 4H9DA 2W52A 3ETUA 1G73A 5LA6E 3NAPB 5CFDC 3H8RA 3ES4A 3U5PA 1VB2A 3H50A 2UURA 3PVEA 1CHUA 3WAKA 4UFLA 1PVC2 1VBB2 2QVSB 4JRAA 1E5HA 3PVOA 2EXHA 2D97A 4CUAA 5HV0A 1F15A 3ETQA 2JB4A 4FFFA 1OOPA 3LD8A 5IVFA 3TWIA 2XUMA 3R6NA 4D69A 3QUJA 2JDHA 2IHR1 2W94A 2YHNA 3OYZA 4GH4A 4LLFA 3KHCA 1RJ7A 4U2YA 4JTNA 4IDOA 5JSPA 2ZEXA 5KR7A 3FL2A 4YZ5A 1EAH2 4DMWA 1I6XA 1US2A 2JICA 3NVCA 4EQVA 2XM1A 3SC7X 5L4HA 3NAPA 3GBFA 1JZ7A 3AMMA 3T2TA 4X5TA 4JC1A 3ZPVE 3LDKA 2PA7A 5EZYE 4DOUA 1V0AA 4XABA 3JD73 1HFAA 2JWPA 2B9UA 2WIIB 4YPJA 4X20E 4NPRA 2IC1A 1LU2A 3HCUA 4YG0A 2ET1A 2O0OA 1DYOA 2IXLA 3EYPA 5JDQA 4UV8B 4TLFA 2DCFA 2W87A 3I9WA 1S2KA 2BDRA 3A0KA 4ATFA 2CNAA 1TG7A 1BVVA 3A23A 1G6NA 4JI7T 4QQHA 5L4EA 4AEDC 5KXCA 3AE7A 5D21A 1K5MB 2C2LA 5LA2A 5A3PA 4H7MA 1BK0A 1OPOA 2DVGA 3ELNA 3JQXA 3HJRA 2YB7A 5FY5A 2VWAA 1AX0A 5AC91 1N1SA 2YYOA 1UMHA 2PNXA 4RHV3 4LF9T 3WNLA 2WFF1 4FPHA 3PUQA 4DRVA 1K45A 5C3OA 2F17A 2O14A 5CA6A 4LR4A 4I02A 4F1PA 1C5HA 3NKGA 2J62A 1OOPB 1WD3A 4AEMA 2ZGRA 3AE5A 5J96B 2XJRA 5ANQA 2FJDA 4YABA 3NSTA 2JXAA 4CZSA 1PK6A 4JI6T 5LWBA 4UVCB 1RGSA 3JBG2 2XY8B 4NIHA 2VNGA 5HXRA 1V9U2 3KF3A 2WZHA 3ZMVB 3M3EA 3K46A 1OLMA 5KXDA 2CCQA 3LDBA 2ZGOA 2VNOA 4KWLA 3BU0A 2EA7A 1T2XA 5IUQA 2ZMLA 2UYAA 3IZOA 5FNVE 4YZ3A 4FOQA 2PG8A 1JYVA 4AI6A 1W0NA 5AITA 2ZGKA 3AEDA 3IN9A 1J59A 4CDUC 3CJIA 2ORXA 2DNXA 2CWOA 1TNFA 4ZXKA 5LEJA 3C7HA 3ZSEA 3WNKA 1RITA 3H1WA 5FZ4A 2WKKA 3VN4A 3KCCA 4RQPC 2ZJCA 3CQXC 3LPGA 1ST8A 2J1VA 1H6YA 3AJZA 1W28A 3NNJA 4FPLA 2Q8EA 4HBNA 2GALA 3C8XA 5ETWA 4QKFA 2BS4A 4OUEA 4IHJE 3NWKA 2FD4A 3MZKB 4C91A 4KQ7A 1DZTA 5HXCA 1G9FA 4K8RB 2V6YA 1S4CA 1YQ6A 5C8CB 5C8WA 3N5LA 3AA0B 4XJ8A 2QQNA 2AACA 2VK9A 2ERFA 1LENA 3BVCA 1RUH3 3WDUA 4O4JE 3MFAA 1HKDA 1MS5A 2XL7A 5BNOA 3CEWA 4CU6A 1R093 5JIUA 2EIDA 3WOGA 5DMYA 5AQFB 3USSA 5L19A 1WCRA 1G9DA 1KS4A 4HGAA 5BNNA 3AP9A 2XOMA 5FZ0A 3VD4A 1H2KA 3K3OA 1XMOT 2Y6KA 1PZ7A 1EP0A 1RUG1 5SVIB 2CDPA 2OUJA 3SKVA 3WHTA 5BY5A 2FUIA 1W6MA 4XJZA 1BYHA 4O61A 2GMMA 2YQLA 3IPVA 1COV3 2R7EB 3FHAA 1IHMA 1RUD2 3HKCE 4H9RC 1XPWA 2JE8A 1QOTA 2XB6C 3EAMA 2CWMA 2JB8A 3RYKA 1E4UA 3SCHA 2XSAA 4OX9T 1GR3A 1Z0PA 2K2SA 3LG7A 1G25A 4CCJA 3ZVYA 2PQSA 5A32B 3IF8B 1TMF1 3BODA 3OUHA 3JCIA 1I6ZA 1UZZA 2LXPC 2WFPA 2XKOA 1HRV1 4Q27A 1ODNA 2W61A 4LMJA 5CGMA 3CHXA 2QIZA 1ENQA 1WCDJ 3KZ4C 4MSVA 4AFCA 4J1WA 1A34A 1GQGA 4BYYA 2A2FX 2ZZJA 2E9XC 1HX8A 3USUA 2KWOA 1XE8A 4ILCA 2C9KA 4BLJA 2RJKA 5HEJA 4YBMA 1O5LA 4MALA 2QDNA 2QZ3A 2XQXA 2LOSA 2VZUA 4OHXA 4GA9A 2X9WA 2OUHA 3NMBA 3T2QA 2DV9A 5B76A 1S94A 4Z8BA 1LKXA 5ABJB 1H6XA 4HK8A 5FYZA 3ZSLA 1QDOA 4Y1ZA 2HLEA 5CFDA 1XNTA 2AXDS 1MM3A 1DU3D 3UGGA 4L9BA 5AC92 1S1AA 4I55E 4QXCB 3O9XA 5FZFA 3LKJA 3F2EA 3OPWA 3ALQA 5J0ZA 4V2VA 5FR3A 2CXDA 2L3LA 3MF9A 2SBAA 3WSOA 2XAHB 4L5GA 5I8TA 5JR2A 4G4FA 3AECA 4P0AA 2KKYA 4C1WA 2ZS6B 1JOCA 4UBHA 1XYOA 3IPVB 4XILA 3WT3A 4DBQA 3LOIA 2EXUA 2BNOA 1MIYA 5EK2A 3WEZA 5FZAA 1LOBA 5A6XA 2WY2A 3BIEA 4H9OC 4QDQA 1PO13 3NL1A 3N7LA 4AGGA 1WEWA 3I2KA 3NZQA 1PX4A 2A9UA 4EAHA 5AFEA 3RWNA 4A4BA 1IKQA 1ZRFA 4ERRA 2K0GA 3AXJB 1NCQA 2CU5A 2VMGA 3RLFF 1MACA 4LBKA 4Q4W1 4BM8A 1RMDA 3LVQE 5IAXA 3SHRA 3JU9A 5F5IA 3H3AA 2R071 2JMDA 2UZGA 2A73B 4Q4Y1 2JPFA 2UY8A 1FPN3 4XCAA 1E1HB 4KBMB 3CNAA 4O62A 5K0UB 4PDWC 1BMV1 1T6GC 4HPKA 4RQPB 1US7B 4QD2A 4TTGA 5LHGB 1W3VA 2KR4A 3TOJA 2X9XA 3HVDA 3J7HA 4N9IA 4QU1A 3K4AA 3H37A 2NTXA 5K0UC 2AR6A 3VKLA 2NMOA 1I5PA 1UN1A 2V7JA 1IBLT 4NN0A 4LUKA 4MHRA 3SNMA 4Q8LA 2RS32 1ZBA3 3VBSB 4P9WA 5A7WB 4YADA 1QJY3 3Q5WA 1MR5A 3N36A 1QXPA 4NRPA 4PK4A 1F8VA 5C5UA 2BZBA 4AAXA 1PZ9A 2MD8C 3S5QA 1QDCA 2RE9A 4LO4B 4P08A 4DV3T 2BGOA 2VBPA 3DPLR 5HAXA 1M4WA 1US3A 1EV13 2RR13 3J26N 4M3CB 3C7EA 5ACA1 5DUVA 1J3RA 1O4ZA 3O1IA 2ZA9A 2KA3A 4YBTA 2UU9T 3RI5A 3EBRA 2J47A 4LJHA 4AVBA 2ENRA 2F4VT 2X0YA 3GGLA 2XOZA 4A44A 1AUYA 1UF2C 1V9U1 2JUNA 2Z2SB 1W6NB 3IWZA 1HB2A 3ZR5A 1AR82 3FJUB 5LHHB 1RIRA 4L58A 2R043 1QJY2 5KMGP 1REFA 2K24A 3VBUC 2YG0A 1TME2 1C57A 3BQLA 1AL22 2DCTA 3W21A 2GP3A 2RMU1 4QX1A 4HWIB 2DF7A 3M1HA 2CL2A 1MS8A 5A6QA 4NAOA 2VL4A 2DUOA 5B8DA 1DZQA 5EP9A 5FY1A 5ABJC 2I0MA 2C24A 4CA1A 5CISA 3CPZA 2JG9C