3KV6A

Structure of kiaa1718, human jumonji demethylase, in complex with alpha-ketoglutarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
447
structure length
447
Chain Sequence
b'PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 134
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv6A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv6A01
1U6GB 3ZPV1 3EB5A 3LRQA 5FP9A 4MSXA 5A7PA 3N9OA 2FUUA 3PU8A 5H1TA 2D8SA 5H9MA 2YBKA 2ECIA 1WIMA 4UP0A 2H0DB 4C8DA 2XEUA 4MVTA 5B76A 4XDOA 5FJHA 2KFTA 3NJYA 2ECWA 4X3GA 5J3XA 3OPTA 3LQJA 4TN7A 2Q8EA 5C11A 4YBSA 1N87A 2YT5A 2JMJA 5FPVA 4I7BA 4V2VA 4R8PK 3SOWA 4ZUXU 2YU1A 2KYUA 1LDJB 3KV9A 4AVXA 4CCNA 2F42A 3K3OA 2KGIA 4QU1A 4S3OC 4DO0A 5FP3A 5G05B 2MD7B 4O64A 4XI1A 5FERA 2H0DA 5FXVA 5FYCA 5FZOB 4DIQA 5TBNA 5FZ0A 3IHPA 5A7SA 3GV4A 2ECNA 4LIVA 2L43A 5A7WB 5IVJA 3KV6A 2ECVA 4Y33A 5FYZA 5B77A 3LQHA 2LN0A 2QIZA 1JOCA 5FXXA 2YPDA 2RI7A 2MNYA 2XDVA 3U5MA 3T6RA 3KV4A 1MM3A 4UF0B 2Q8CA 1WFKA 3HCUA 5B75A 4WZ3B 2YUCA 4GAZA 4CCJA 2YU2A 2OT7A 5FZLA 5FYTA 2Q8DA 5LY1A 2EGPA 1T1HA 4B7YC 2HDPA 2QICA 2W2IA 3O7AA 5FYHA 5G0FA 3RPGC 5CEHA 2Y1NA 5AITA 5FYVA 4QWNA 2C2LA 3SHBA 2EODA 3ZNIA 2YBPA 1HYJA 2MT5A 2CSYA 4QXBA 4I7DA 4NN2A 4YATA 2F6JA 2YW8A 5FZCA 5B8DA 5DKAA 3GL6A 4CCGX 5FZHA 5FXZA 2KWKA 4S3OB 1WILA 2K16A 2ECGA 1MM2A 2YHNA 5ISLA 2M1RA 1E4UA 4YC9A 4QX8A 1V87A 3HCSA 3N9QA 1HYIA 5A1LA 2LGLA 4Y3OA 1FP0A 5F5IA 4QX7A 5A3NA 3MHHA 2K4DA 4AYCA 2LV9A 2QJ0A 5FZ8A 3I2DA 4HOOA 1WENA 2KR4A 4A49A 5FZ4A 2MIQA 5A7NA 4BXFA 2OX0A 3RTRB 2YURA 4LKAA 3SOUA 4EZ4A 1X4IA 3PUSA 3O36A 5FY0A 5FY7A 4LK9A 2XXZA 4CUGA 5F3IA 4Y4RA 1IYMA 3RVHA 2UZGA 2OS2A 2L80A 5FXWA 1X4UA 3C5KA 2YSMA 4FO9A 3HTKC 4GNGA 3FL2A 3RPGB 2KIZA 5H1VA 2VJEB 4ASKA 5FZ3A 2VPGA 2KU3A 3N9MA 1JM7B 3UYJA 2I50A 4R2YA 2FUIA 1WEUA 2CKLB 4QXCA 4A4BA 4AUQB 4W4UA 4B86C 1F62A 2XUEA 5FY9A 5FYIA 1VRBA 3AL6A 3LD8A 5G04B 1VD4A 3MHSA 2VPDA 5E6HA 3QZVA 3KVBA 3C6WA 2M3HA 2L5UA 4GNDA 5FZGA 5IVVA 4GJZA 2YREA 1WEEA 4BHWA 4YADA 4AP4A 2PNXA 2OQ7A 5FZAA 4BU2A 1G25A 5FZKA 5ANQA 3U4SA 3N9NA 5FP7A 5FPUA 3AVSA 4EYUA 2G43A 2L0BA 2GP5A 4AI9A 1K2FA 5FZOA 5FB0A 2KWOA 3LDBA 3ZVYA 5FV3A 4CCOA 2M85A 2YHOA 4A4CA 5FZMA 2GP3A 2IDAA 5B79A 2LGKA 5A7WA 4CCLA 3ZLIA 5B78A 2LRIC 5IW0A 1Z6UA 1WEOA 2MUMA 5FY1A 2E6SA 3N9LA 1VFYA 2YSJA 2LQ6A 1BORA 5A7QA 3PUQA 5LY2A 3ZVZB 2XMLA 4HONA 4LXLA 4I7CA 3M63A 2PXJA 2VPEA 4F52B 3DXTA 4UF0A 4EZHA 5H1UA 2VJFB 3HCTA 1WGMA 1WEQA 1FBVA 4PTBA 4CCMA 1DVPA 3O35A 3V43A 5D1MB 4QF3A 2YBSA 2MA6A 1WEVA 2JMDA 3ZPVE 2G45A 5IVFA 5FY4A 4LLBA 3U5OA 5FZ7A 4GJYA 2KREA 4FK5A 5FWJA 4P5OB 4YAXA 5A1FA 4WA6A 5IWFA 5AIUA 4URAA 2WWJA 3PURA 3O33A 4IC2A 3N9PA 1XWHA 4NUBA 1WEMA 1VYXA 3KNVA 5LKZA 4ZDTA 3PTRB 5FYMA 4LADB 2NAAA 2YU4A 2VP7A 5IVYA 2LXHC 2OQ6A 3AVRA 4WZ0A 4UI9B 4YABA 4YBMA 5FP4A 2MNZA 2C2VS 4FIPA 2KE1A 4QXHA 4ZQLA 4GNEA 5D1KB 4R7EA 4GD4A 1LDKC 2AN6A 4L7XA 5F5CA 3K3NA 2VD7A 2MA5A 5TRBA 5FY8A 3ZPOA 4V3LC 5DINA 4L58A 2BAYA 4CA1A 5TDRA 5FZBA 4TKPB 3U5PA 3KQIA 5F3CA 2HYED 5A3WA 2CT2A 5FB1A 2KWNA 1X4JA 5FYSA 4GNFA 3T7LA 2LDRA 4WZ2A 2VPBA 1WESA 3NG2A 3L1ZB 5A3TA 5FEYA 5FZEA 2P5BA 2F6NA 2JMIA 2YYRA 5KH9A 3ZYQA 5FUNA 2VJEA 2VNFA 1WEPA 5LKXA 5IVEA 4CSWA 3ZTGA 1JM7A 3PU3A 4AAPA 4PPEA 3DXUA 5FYYA 5K4LA 2RSDA 2CKLA 4V2WA 2Y1MA 5F3GA 5FYUA 2XB1A 2ECTA 4E4HA 2Y43A 5F5AA 2LXPC 5FJKA 3VK6A 1WE9A 5TDWA 5A80A 4QF2A 3ASLA 5FZIA 4A0CD 2LGVA 2FSAA 2JRJA 5I3LA 3O34A 3EB6A 5EYAF 5FWEA 4LITA 3KVAA 5KH7A 3SOXA 4UP5A 4IC3A 5FZ9A 5LCWB 5F2SA 1CHCA 5KH3A 5F32A 2DX8A 5F2WA 5FPAA 5F3EA 5FYBA 5FPLA 4FJCA 3O70A 5JG6A 2M6MA 3PUAA 5FZ1A 3M99A 5FP8A 2YQLA 5LKTA 5FPBA 5FZ6A 3O37A 4GB0A 5F39A 5C13A 5IVBA 3M62A 4N3WA 5F37A 2PUYA 2KWJA 3DQVR 5D1LB 4N4FA 3PDQA 5LW9A 1ZBDB 2CSZA 2ECJA 3OPWA 4XDPA 2E6RA 2K17A 2MD8C 3PHDA 4AYCB 4YBTA 3KV5A 5IVCA 4IGQA 3L11A 3DPLR 4D6QA 5FY5A 3AL5A 2L75A 2VJFA 4Q6FA 5FZFA 4D6RA 4CCKA 4V3KC 2G6QA 4D6SA 2K1JA 3U78A 5TABA 4IGOA 2YQMA 2EA6A 3LQIA 4BBQA 5FZDA 2OXQC 1WEWA 5FBJA 1Z60A 2KGGA 5LWBA 4IGPA 5LKUA 2ZETC 3U5NA 5FUPA 1Z2QA 4C9ZA 3L1XA 1RMDA 5A7OA 2LGGA 4LJNA 5KR7A 3K2OA 2WWUA 4LIUA 5A3PA 4BISA
chains in the Genus database with same CATH superfamily
4NHLA 1WLWA 3LIGA 4QX2A 4AAXA 2ECIA 1VMFA 1WIMA 1DZQA 4IE7A 1UPSA 2DBNA 3AA6B 3NZQA 2Y6FA 1G8XA 4XCBA 5AQPB 4IE4A 2XJSA 4YGCA 1R083 4HWDA 3IMNA 2W66A 3TNQA 2IC6A 1AR73 2VW2A 4XJ8A 4QU1A 4ET7A 2MD7B 4GZ9A 1SLBA 2JJ6A 2KMFA 4XAAA 1UXZA 3CQOA 4N53C 3T0AA 4HN1A 3TKLB 1K5JA 4L0RA 1VBD2 3LQHA 3GDBA 5JMOA 2Y0IA 5H6QB 3QCWA 1LAJA 3WDYA 5HXCA 1G7YA 3PE0A 1QJU1 2ARCA 4B7KA 5CEHA 4AXOA 1RUI2 2YK0A 1UCUA 1UY3A 4I7DA 5JOZA 5FZCA 3E0ZA 5B8DA 1W8WA 2K16A 5AQKB 2RDNA 2IFRA 1HYIA 3E6CC 4U3CA 2DVAA 5L9RA 4NPRA 4COYA 4Y24A 1SCRA 3O36A 2DU0A 3RPUA 4QKBA 1R1ZA 3ONXA 5DAVA 2WYFA 5KWRA 1IGOA 3POEA 2WL1A 2V1DB 1W9FA 3RNSA 4LKFA 5CADA 3RPGB 2JWPA 5LJMA 4ORFA 2W92A 2F17A 4FTBA 3VHNA 3DPRB 1PMJX 5C8YE 1F62A 5C2TA 1N34T 1VBE2 3WV6A 2RJLA 1XYOA 5L3BB 3R0RA 2R043 1XB9A 4XBNA 2L5UA 3MIEA 4GNDA 4I09A 5C9AA 3FX3A 4RN5A 5ABFB 4JRLA 4FOQA 4EN6B 5G04L 4BU2A 2WIIB 3U4SA 3VBSA 1Z7S1 1BK1A 4AI9A 4JEHB 5BNPC 1DDLA 2VQ0A 4FCAA 1JYIA 3PVBB 5FO8B 1JZ3A 5FY1A 2YPJA 2WQYA 2XQ7A 5C5TA 1BORA 1Q56A 2PXJA 2VPEA 3DXTA 5B4XA 4RR3B 2UXCT 1POV3 2YBSA 1RUD1 2FUPA 5FMBA 3JCFA 4HANA 2KZ7B 3E6BA 3ZCIA 3GM8A 4BQ4A 4QM8A 2P17A 5FZ7A 4FK5A 2N7GA 1RUJ2 2OPWA 2R063 4AQTA 5JUVA 4MADA 1JZ6A 4URAA 4AK3A 3W9AA 4IV3A 1BEV1 4LFAT 3VBOA 1AUYA 5T55A 4XBFB 1CJDA 1N47A 1A6CA 1OQDA 1NAFA 2IW5B 2H0VA 2IXIA 1RVF3 5TAOA 3HKBE 2F4LA 4AW7A 2VL8A 2HWE3 3OUJA 1MEC2 2E9XB 2DU1A 3HT1A 2E9XD 2W67A 3NO8A 2XVKA 5FB1A 2CWSA 4BQXA 4DY3A 1LCLA 1ZV4X 1H8VA 5SV5A 4RSUA 5L7OC 4O62A 5CU1A 2K9AA 5LKXA 2ZZJA 4CSWA 1XWMA 3SFDA 5JRCA 5LMUT 1OA3A 5T5PA 2MOZA 3ASLA 5FKYA 4CDWC 2E53A 3UU5A 4QX0A 2IXHA 2UXNB 1OBNA 2YKSA 3WNKA 3CJXA 4KWJA 3RRWA 5KH7A 1Y43B 2CRBA 5F2SA 1HKDA 4GH4B 3LPGA 4HZFA 4LO8A 3VKLA 2A1XA 3ILFA 4QB2A 4CEWB 3K46A 1YQ5A 3AP5A 3IDEA 4QX1A 4QX8B 1RUC1 2ZM0A 4H9NC 5LCWL 1NLQA 3I2GA 3MIHA 4J1WA 5L9BA 2DCZA 2W39A 5BY5A 3L11A 4GK5E 3ZC1A 1VB4A 4AFDA 1H8TA 1HNZT 4IL4A 5LBQB 4COWA 2E32A 2PHRA 2ZMLA 2D6LX 4B6XA 5AQMB 2DL1A 2EA6A 3BU0A 2ADEA 1JYVA 3U3IA 1JZ8A 2WFF2 5JH7E 3JD71 3BPSA 3HR0A 3C50A 3SH4A 2WLQA 4H9DA 3DDTA 2IUBA 4R9DA 4BK4A 3IA3A 4JQTA 4DMVA 2E63A 3FLPA 1TQ5A 4F1PA 1VE0A 3J7HA 3QBQA 2VQTA 1X8MA 3RZMA 2GC3A 3NJYA 4QPGC 5CKMA 2VZ1A 5FUIA 1Y7BA 5LHIB 1F15A 4NIAA 3KQRA 4ZUXU 2QQUA 2W63A 5CFCC 3WDTA 5HAXA 5T5JA 4Q4W3 3ELNA 4I3GA 5J3UA 5TBNA 4R9AA 3O1JA 4BK5A 3ZYHA 1MNEA 3TAYA 1Q8SA 1FOD3 3ZFGC 3SRZA 4CP2A 5LB7B 3W58A 4UIGA 3ZXKA 2WNUC 5CISA 4PJLA 2WO2A 1V6KA 3RKOA 4OI1A 5IAXA 2YU2A 3FMGA 4HVQA 3I3MA 5HXVA 3LEIA 1R1A3 1AXYA 3JU9A 1RMU1 4HFHA 3KGZA 3S5QA 1NCQB 4QXBA 2W1WA 3O1UA 1Q8PA 4A98A 1B7TA 2HN1A 3K1SA 1QOOA 3WQ1A 2E33A 1G86A 3AAAB 1BVP1 4QX7A 3CWZB 1PGL2 1UD1A 3I2DA 2KR4A 4QPIC 1D1BA 5FTTC 5LHGB 4YW5A 1B09A 1JZ2A 3VDCA 4Z0RA 2YZ4A 1ASJ3 4EZ4A 3WG2A 4AFBA 1NCRC 1MZEA 3ZIXA 3SQOA 4MXWA 3BOWA 1MMNA 2YROA 3LOIA 1FV3A 2Q8OA 4YW3A 2YSMA 2LSJA 1O3QA 3ZIWA 1NE4A 2JDMA 1QJX3 2WAUA 4ASKA 1Y64B 4UWDA 2H7VC 1KITA 2KU3A 1JBCA 2E51A 4Q0VA 4LK6A 5JDLA 4ZOLE 4AUQB 4DV0T 5J09A 4O65A 4XJUA 3DL3A 2CGOA 1U0AA 1CAVA 4A56A 1AL21 1ZZ6A 4FI9A 2VPDA 5FK8A 3AKRA 4QQPA 3OBTA 1GFF2 2FCVA 4Y5TA 5M4YA 3NV3A 1ZP0A 3IM0A 3I59A 4OI2A 3O1IA 2HWD3 1GNZA 2L7PA 2G9ZA 3S0MA 1Y01A 2KWOA 3LDBA 2L8KA 4A4CA 4YZ3A 5A7WA 3R6NA 3ZLIA 3ECQA 2RS51 4ADZA 2AUYA 4GK0E 1ZA7A 4AI6A 1LVFA 4LULA 3IF8B 1U12A 1DQ2A 1V6IA 4XUOA 4EZHA 3T0DA 2NOXA 1M62A 1F2NA 1TG7A 3MI8A 3AXDA 2QYWA 2WS91 1ZZ9A 2WLPA 1XE8A 1MIWA 3USSA 2YC0A 1TME1 3NWKA 5CKQA 2XAHB 2W9XA 3MHZA 5EYXA 2V4VA 3NMBA 2PAKA 4P0BA 1GZWB 4S2FA 1ZRIA 2GN3A 3LKJA 5BNOC 1UUSA 2ATFA 3VRBA 2LSGA 4HT1T 2WBKA 5AFBA 2OYZA 2R1DA 4HL0A 1UF2C 1I6ZA 2CAVA 2VAUA 2JB4A 2CWOA 1W2NA 4YW7A 4XUPA 2CDOA 1K12A 3I2KA 3POFA 3PMEA 3BU7A 2IC1A 1HNWT 4F3JA 4E9KA 1R092 5C3RA 5GLUA 2R32A 5FZBA 3G06A 2DCTA 3KCCA 1OXCA 5J37A 1X4JA 4DXTA 4OGCA 3KCYA 2OPKA 1OWAA 2Y60A 4GMP3 4DXSA 3R4UA 4IDQA 5FVLA 4A7YA 3OGRA 4ILUA 4KG0A 2ARBA 1W6OA 3L2HA 3VUOA 1W39A 1NYWA 3AE1A 1KS5A 4AGVA 3AXJA 2Z69A 3Q1DA 3V5SA 4UOJA 3H8OA 4JYAT 1AYM1 4G2AA 1W0AA 4O4LE 4LITA 4IV1B 4GULA 1VLNA 3L8RA 4DBQA 2EA7A 4Y1ZA 3ZYMA 4AF9A 3AE6A 4QH4A 5FZ6A 1OKOA 2C5KT 4AQ6A 4JAAA 2BNNA 4QDSA 5DQ0A 3VL9A 3ACGA 3TYJA 3A23A 2PHLA 3AE5A 4DFSA 4NIIA 2CSZA 4HTEA 1U4QA 3HVDA 4YBTA 1CAUB 1OEDC 2PAMA 3OY8A 4LKDA 1VBA2 3ZXLA 2GNMA 1PO23 2FMDA 2K46A 1CIYA 1PK6B 1YQ4A 4MBQA 2IXLA 1J1JA 4TLFA 4K21A 5HXSA 3TLWA 1PIV3 3Q8AA 1Y9QA 1XSQA 5EQUA 5FP9A 1J5WA 5AQTB 1XNBA 1I6XA 2UUCT 1OSGA 3ZYBA 4HE8A 1YIPA 5A33A 2DHRA 3WDVA 2VK9A 2CL2A 1SBEA 4FFFA 4FOWA 1MS8A 2W52A 2VQFT 4TYSA 3OPTA 3HT2A 3LQJA 4YBSA 1EPWA 4FPHA 4ASMB 4JLEA 4Q4Y3 1NLSA 2VOXA 3DCQA 2SPCA 5LBEA 5C3PA 4AVXA 2M6IA 1BBT2 2VNVA 1CJPA 2C24A 4NJ4A 1D4M2 1LGCA 2JIJA 4EWDA 1MPXA 2WWSA 2A3DA 4DV1T 1ND3C 4EEBA 1H7CA 4V1PA 2KXLA 4Y33A 2FDIA 1OLRA 1SLTA 3AAIA 4O9EA 2MEV3 2J1AA 2JG9B 1KNZA 1RUF2 4MGYE 3WSOA 3SH5A 1VMJA 3MZHA 3O12A 5LK7B 5JSRA 5L3EB 1QQP2 1KF6A 1WFDA 5LY1A 1E2AA 1R64A 2XQ3A 4JTOA 4JGZA 4B7YC 5JOWA 2OW4A 2VL4A 2QQMA 1FMD1 2ZGLA 4A7KA 4DUZT 5CZKA 3AZWA 4B4RA 1KK7A 3B00A 4X1KE 1V9U1 3NRXA 4AEDC 3JBG1 3RI5A 4M01A 2KWKA 4ZI2D 3HIFA 1G9CA 4YC9A 1WLDA 4RGKA 4A6SA 2LGLA 2VVFA 3I4IA 3JB8A 1RUG1 2X9HA 1VCTA 2K4DA 5D8AB 4LF9T 3MICA 2QJ0A 2JG8B 3QC9A 1JHNA 5IUQA 2NW8A 5FL0A 2OX0A 3RRCA 4LKAA 3J26N 4ES8A 4NUUA 3GF6A 4AWDA 2WA3A 3UT5E 4UXNB 3J7LA 2VM9A 2XAGB 5H9RA 2WT2A 1VBB3 3SCGA 3VD3A 3VBRA 3WG1A 2XQ9A 2BG9A 5F6LB 5AFUL 4CUBA 2ES3A 2EIDA 1GMMA 2WO1A 1DYOA 5C6CA 2IAKA 1ZNPA 2I50A 1FMWA 2AE9A 2VZ3A 4RA0A 3WHUA 3DKWA 2BNMA 3P4RA 2CXLA 1QHDA 2A2FX 3NKZA 4CXXA 4UW5A 1ZRCA 1KGYA 4YADA 3ZOIA 4TNVA 1UW8A 4GMP0 3THDA 4XOGA 5FZKA 3SOLA 5FPUA 4EYUA 3I2IA 3ONJA 4XQ4A 5JR9B 3U75A 2KD7A 5GONE 5ABJC 3J8F2 1XNAA 3VBHB 2EALA 5BMVE 5FZMA 1LODA 2ZGNA 1T6GC 5JOYA 3W15B 1VFYA 3PUQA 3WNMA 1D0GA 4ES9A 1GOFA 4HONA 4HPKB 4LF7T 1UQXA 4D0QA 1J3PA 3HCTA 2WZR1 3QK6A 1EV12 2BZBA 5JIUA 2LHNA 1WEVA 4HFBA 5I91A 4QHOA 3VBUB 1ZEEA 2VO5A 4P5OB 1W8ZA 1TMF3 3ZFFC 4CEYC 4LO4B 1H6YA 2ARAA 4KGQA 3VKMA 5LEJA 4AHZA 4IC2A 3TEZA 2J1DG 2ODUA 2BV4A 4HVOA 1ZZ7A 3BTZA 3IB3A 3V56A 2JIWA 3S57A 3Q5DA 3MZKB 1KD7A 4YPJA 4YBMA 4R4XA 3ASIA 4LMKA 2NMNA 3C98B 1O5UA 1C8M2 3U0ZA 4XDQA 2XHNA 1LEMA 4Y1XA 5JPMB 4WM8C 2RS32 4L58A 4CA1A 3CNAA 1UYPA 3W21A 2PTMA 4QGNA 3RZZA 2KWNA 1QNYA 1XNRT 1ZRFA 1TZOA 5T52A 1SG3A 1RUE1 3MBWA 1LHNA 2WSVA 3OGGA 2DCYA 1W9TA 3K48A 3ACIA 1XNKA 3SKJE 2RDQA 2ZGTA 5FYYA 3DPRA 2EXJA 1DFQA 1OT5A 3IWZA 4XIOA 1SE7A 4E4HA 5FL1A 3T8OA 2ZEYA 2QNKA 2ZMKA 3ZR6A 5A80A 4WZCA 5HBAA 4JI3T 3OD0A 1CUNA 4IDNA 4QHZA 2XHKA 3ZT5A 2WT0A 2KNDA 4IL7A 5ABFA 4NHYA 3SS1A 5FLIA 4HG6B 3O70A 2WZPP 2QZ2A 5EJZB 4D7YA 1W6PB 3DJBA 4KWKA 3DQVR 4L9BA 2D5FA 4W6XA 2D3PA 4YNIA 4BJ0A 3RZGA 4MHUA 3ANWB 1DU2A 5L3GB 4YGBA 2PHUA 3TWIA 2EHOC 3K8PC 5FO7B 1OMIA 3AP9A 5FOJB 2HWF1 4D6SA 1PVC1 1HRI1 1SLCA 1Z60A 5EK2A 4ARXA 3DKQA 4IGPA 4PK6A 4Q2FA 4WM7C 4HXCA 2RJ2A 1G9BA 3ZMNA 2WCAA 3AXEA 1H4HA 3O4XE 1DHKB 2WWUA 2OA2A 5CKNA 2DCJA 5CFDB 1XPWA 4B1LA 1T7SA 4UV8B 2J1EA 5HWYA 2J1TA 5EV7A 2EICA 1F8VA 2DF7A 4DMWA 2DURA 4DUVA 1BHGA 1J58A 4CDQC 4P1NA 3IDBB 2XBO2 4B4QA 1WMFA 3CVRA 1N87A 2UYBA 4I7BA 4V2VA 1J3QA 2E9XA 2XAFB 2AR6A 3ZYIB 4LUKA 4O64A 3LIHA 3NV2A 4JKMA 4O8SA 2GNDA 3THPA 1CESA 1VRH1 2PQQA 3ZXDA 4FI5A 2PLV2 3P4WA 3ZFEA 4OZOA 3T1YT 2UUBT 3RC3A 3AB0A 2ECVA 1ODMA 2Q9QC 5H9PA 3CX8B 4YW2A 2V26A 1C4RA 3WF0A 5LZ6A 1MM3A 4O7XA 1RINA 3POBA 2XSAA 1GLHA 4FPCA 2EXHA 4JQRA 1JI6A 4XBLA 1CGPA 3HCUA 1NLRA 4FBFA 3WP5A 5FZLA 3AX4A 2QUOA 4G3YC 3RFRA 4XF1A 1QEXA 2ES0A 2BVMA 1JYCA 3TLTA 2YBPA 2R071 3U14A 1Z7S2 4GH4A 2CSYA 3I2FA 2YDQA 1EY2A 4XUQA 1Z0HA 5I8SA 5EFUA 4S3OB 2WNEA 2Y38A 3PUZF 2JXAA 4TNWA 4HFEA 2M1RA 2D2SA 1O7FA 4QX8A 3VL8A 4PI0A 3FFQA 2DV9A 2VW0A 1S0GA 3WF3A 3OYWB 2RMU2 3JQWA 3ABZA 2JEMA 3D82A 3C8XA 2MIQA 3P7IA 1SQ4A 5HXRA 1CZVA 5DAWA 5ABHA 1XSRA 4GWNA 2D7FA 2KKYA 1OF3A 2BWCA 4JKKA 4YSFA 4WNKA 4IDZA 1QOTA 2A5ZA 1N1YA 3FL2A 1R081 2KIZA 2VJEB 4P9XA 1COV2 3AJZA 1Z0PA 2NN8A 2JDPA 3T2QA 1EPZA 3ZO0B 1VBD3 3FANA 4Q8LA 1CQ9A 4XUTA 4W4UA 3POIA 2QJVA 1UZZA 2YXSA 3C7OA 2YY1A 5A32B 3ZC0A 3ZKRA 3GBGA 1OURA 1UMZA 1JU3A 3EMRA 5FZGA 1GQHA 4DR2T 3AEGA 1LOGA 4GWJA 1ND2B 4I02A 4DRVA 2PNXA 3APBA 1F31A 3VDDA 4KU7A 5AQFB 4KI5M 2FBWA 1RUI3 2BS2A 3ME2A 3I1AA 3ROUA 5L3FB 2MPKA 2GP3A 4WW0A 4Y20B 1VAKA 2B1EA 4P02B 4CCEA 5B78A 3PJAA 4JI7T 1SCSA 2AEYA 2UXBT 2XWJB 3WCSA 1MZ5A 4O4JE 2ZAHA 4LBOA 3ZEFB 1QGLA 3O35A 4A3ZA 5D1MB 2FFWA 3E2DA 2H3RA 4QT6A 4MZUA 3IIIA 1QJU3 3WNOA 3WT3A 1N36T 5IVFA 4LLBA 4N53B 3PL0A 5HWXA 3U4XA 4XTMA 1NCQA 4EEDA 4O4IE 4INDA 3LSDA 3PUYF 5LGNB 3OSDA 3RHWA 2RDSA 2HH9A 3CX7B 2Z6EA 3ZYGA 1VBE3 3ZN6B 3AVRA 4UI9B 4IREA 4H3WA 3JADA 2A73B 4W4ZA 2BGPA 3KCXA 4GD4A 3H7JA 1AX1A 4PIZA 5F5CA 1OOPB 3RIAA 1G6NA 3LF7A 1TNFA 2GC0A 2KINB 3B5LB 3FXDB 3D0TA 2L9LA 3JXSA 3H9AA 1KFUL 2C5JA 3POYA 5T3NA 2R041 3Q8CA 4LUMA 2YYRA 5KH9A 2YYOA 4XF0A 3H3UA 3VZKA 3GJAA 3J7Yq 2ET1A 5IVEA 3WNPA 3WVJA 5LB6A 2BTVC 2EHOD 1AYN3 2ET7A 5ABEA 3KB5A 4FPLA 1X82A 1AR92 3RX6A 1NQDA 3RWKX 1E5RA 4F6RC 4X64T 4I01A 3WP6A 5EYAF 2HJIA 5FWEA 1QH7A 1YQ2A 2P6CA 5KH3A 1RUJ3 2FMYA 5FPAA 3BN6A 5FYBA 5FPLA 1AR62 2P3JA 3VD4A 3AE4A 5FPBA 3BPZA 4H14A 2DVFA 3FB2A 2JQHA 4WBOA 1POV1 4ILAA 1LTEA 5JR2A 4LR4A 3UESA 2BWAA 5IVCA 5C9AC 3PVNA 2EXIA 2R061 1DQ1A 4F7ZA 1DGWA 4CI1B 4LO5B 1ULCA 2LSKA 3VBSC 4Z91A 3H8UA 2QVAA 2LT3A 3HR9A 2LEHA 3ZCJA 3OVUA 2YQMA 3FZMB 5F5QA 1WEWA 3VKOA 2HEYF 5LKUA 4KBZA 4B3TT 3QH7A 4EJRA 3CQXC 1RVF1 4N8MA 1Z2QA 1US2A 5A7OA 3K2OA 5LK5A 2X0HA 1GZWA 3FAOA 2Q9QD 1QOSA 2ZM2A 2GMEA 2HWE1 4YM0A 2FUUA 2Y64A 5JREA 4P9IA 1NEKA 1YXWA 2VW1A 1P8JA 2Q1ZB 3UKNA 4CDWA 4D7SA 5I0TA 4BHPA 3BOPA 5FVKA 3O1MA 3LCPA 5J3XA 2CLYC 3ST7A 3CZJA 2P57A 3B69A 2F4PA 2WP9A 5JVDE 1UU5A 3C7GA 1QXRA 1SFPA 1RXGA 2OKXA 2XY8B 4G4FA 4NUVA 3O0XA 4IV3C 3HQXA 4QB6A 5FERA 3VBOC 2H0DA 4LPLA 5FZ0A 1SLAA 2VCMA 1FV2A 4LIVA 2WZHA 1HLCA 5IK8A 4DXZA 2W94A 1W8OA 4QM9A 2OUHA 3VBFB 1BMV1 5FXXA 3TN91 2GH2A 2Q8CA 2E7AA 2I74A 4QU2A 2PHFA 2YDSA 4U31A 4NXNT 2HH7A 2XWBB 4IV1A 1JHJA 2Y1NA 2WFF3 5AITA 1ZM1A 2C2LA 1LVKA 3K4ZA 4FPFA 5IFTA 1REEA 4NN2A 2YG0A 2Z2SB 4Y26A 2YW8A 2W95A 2XASB 1C1FA 2Y6LA 5LMNT 4Z1VA 3H3AA 2RS52 3TLUA 5LBBA 1HB1A 3EO6A 3A0KA 2E5LT 1PGW1 1BCXA 2QE3A 5JZGB 2DVGA 2E5VA 1QF3A 1ZBA2 4A49A 1NOVA 5CFCA 1SBFA 4HSJA 3M3ZB 4JVAA 4WV8A 1H1MA 3I8TA 5FY0A 2FDKA 4LK9A 1IYMA 3LK2B 2OUJA 4D69A 2W0GA 4PCRA 3AP4A 3JD73 3SWHA 3BALA 1W2OA 4A44A 4GNGA 4LO7A 4N90A 2LOSA 4H63H 2IIUA 1W9SA 5JMCA 2VOKA 2CGPA 4YSXA 3I97A 5JDBA 4B86C 2XUEA 4AVAA 4Q4W1 2MBGA 1VBC1 3LDRA 5IFPA 4E2QA 4MFRA 1TEIA 2WDBA 4ARYA 1QH6A 1UY4A 4GALA 1A34A 2LJLA 4MGZE 4MYEA 4AP4A 3QOFA 1FOD1 2ZHKA 1KS4A 4TUYE 4PJNA 3H7HA 3UUBA 5LJNA 1STMA 1UOJA 1KNRA 3TLVA 4CZZB 5E16A 5HCBA 3AC0A 3T4VA 4CCOA 1YFUA 3H1WA 1PO12 2F6BA 4RHV2 3WG3A 1R1A1 4P9YA 4JZRA 3LJUX 4YG6A 5A6ZA 4YM2A 2JG9A 1UY0A 1XU2A 1S94A 1HX6A 4LXLA 4WZFA 2PAEA 3BUCA 1GSLA 2D5UA 1AYM2 3ZXJA 2Y33A 2VNGA 2BUKA 4DUYT 3GNEA 4X1YE 3IT8A 4CP1A 1QY4A 3FZKB 4XZCA 3NAPB 3UGFA 3E97A 4GIQA 5C3OA 3PVEA 3TNPB 4ERRA 3ABVA 5DDJ3 2WNOA 1Q8QA 5IWFA 2IC9A 4MG2A 4QB1A 1LOFA 4MGSA 3N9PA 1ASJ1 4MLOA 2V4AA 5J96B 4OHFA 1DYKA 5FYMA 4XJ9A 2VZUA 4ZPIA 1OVSA 4I30A 3O1VA 5IVYA 4CP0A 5D8AA 3ILNA 3F57A 2ZX0A 2JG8A 2DFBA 2BDRA 1QJX1 1PZ9A 1URXA 5GLTA 3EJKA 1JU4A 4OQ9A 2MA5A 3F2ZA 4KP3C 4V3LC 2W1QA 2DCKA 2D6MA 3E1F1 4LBQB 5TDRA 1O3TA 3U5PA 2WYSA 4LBQD 3SHRA 2DWRA 3RYCE 4RS5B 1M7KA 4WZ2A 2UY8A 2GC1A 5FEYA 2BEOA 2VJXA 2L3LA 2F6NA 3AM2A 3K4AA 4KL1A 3ZYQA 1XYPA 1SACA 1QJY1 4J6GA 2A75A 4D7TA 1GANA 3X29B 4AI0A 2HWD1 2FD4A 3VDBA 2VZPA 3JAFA 1M06G 4ZHQE 4G9SB 3NJXA 1GR3A 2LGVA 3KM5A 4XF3A 4OI4A 1V6NA 3L39A 3VDAA 3WDXA 5FKCA 1IHMA 5EYYA 2RR13 1SFYA 1GP6A 4C90A 4S2HA 1AXZA 3K77A 3T1LA 4Z2WA 1SZBA 1I1EA 5JR9A 1L7QA 4RD7A 2Y6GA 5IVBA 3VBHA 3LK3B 1XMOT 1XBFA 1QXPA 2KWJA 3OOXA 3EAMA 2EIGA 2C5IT 2Y6KA 1ODNA 1BR0A 5FY5A 3V0BB 4HPKA 2CONA 1X9BA 3RJ2X 5ERLA 5AVPA 4HFSA 4V3KC 1R093 5GZCA 1YI7A 4AQFC 1FXZA 2JECA 1MVQA 3BQLA 5EWSA 1V6JA 2FDHA 2QKDA 4LJNA 3Q2MA 2XOCA 5IYYA 1EAH2 4A41A 4PJYA 1Y4WA 2GNBA 3KT1A 4OZXA 4I55E 4YSYA 2GZWA 3WR0A 2K0GA 3KQ4B 2YDEA 4JV4A 1PMIA 3GMIA 1RJ7A 2IXKA 2X8KA 2IXCA 3LFIA 4A42A 1ZBE2 2XQ4A 4CCNA 4JEUB 1FJGT 2OZ6A 2HWC3 4XI1A 4KWUA 2VH9A 1O8PA 4DIQA 5SVIB 1WKYA 4AOCA 2L43A 4AIUA 4F83A 5FYZA 3L9JT 2LM9A 2RM22 1JODA 4NHMA 3ZSSA 1YCIA 4MHRA 3ETQA 4FOYA 3OUHA 5KHHA 4E2GA 3L3PA 1WCUA 3LZZA 4K20A 4CCJA 5B4NA 4BPZA 1XOYA 2MKEA 5JI7A 2UU9T 1RB8G 3VD7A 4MALA 3O7OA 5FPZA 3FBZA 4HWCA 1JNRA 4ZI7E 4QWNA 1ZRDA 2EODA 2WINB 4W6YA 4TSVA 2Z4FA 3GL6A 5JVVA 1WLCA 4Q4V3 3KD4A 1WILA 1JYXA 1W6PA 2P9BA 3UU8A 1YJLA 1HQWA 1PO21 5JXGA 4Q8KA 3VU7H 5F5IA 1US3A 4XHBA 5LOVE 3ANWA 4NN0A 1PIV1 4CE8A 3NRYA 1HN0A 5FZ4A 4P5YA 2W3JA 4AG4A 3VRAA 4XMIA 1H1AA 4L92A 4XPVA 4DV2T 3MDBC 1G73A 2OS2A 2WSUA 1HF8A 1D4M3 4N43B 2ZXQA 5GZEA 1IBKT 2NW7A 1UX6A 2HWB1 2XONA 3N9MA 4Q4Y1 1NUKA 4R2YA 3N7KA 2RE9A 1OA2A 5FY9A 4X62T 1YQ6A 1CR7A 3ZM8A 3NWIA 5J2TE 1OF4A 3MHSA 1GICA 4CDXB 1QQP3 2W0XA 1V9DA 4QAWA 4YW4A 3IZOA 2MEV1 3IBMA 5ANQA 2P6HA 5FP7A 5HV4A 1ZKEA 2RJKA 2Y34A 4K1YA 4X8NA 4EAHA 5CG8A 3U1XA 2FQPA 3LK42 4H7MA 1Z6UA 2MUMA 3H37A 1AR81 5A7QA 2D9DA 2VY0A 1WWYA 2ZX2A 1WEQA 3AA1B 5L9VA 5GKAC 3V43A 4GA9A 2G45A 4OK0A 3ORJA 3BODA 1LR5A 4DS0A 4OMCA 1ND3B 1D1CA 3MJXA 1NWMX 4YAXA 4YSZA 3VN4A 2JDYA 1D0ZA 2LROA 2XAQB 3VZNA 2G19A 5LYJE 1V00A 2Y8DA 4AQ2A 1WCRA 4YWAA 5ETWA 4RGAA 4AYUA 5KHKA 1VBB1 4JGZC 2SLIA 4LA3A 5CAZA 2E7TA 1CX4A 1PZ8A 3H7YA 3VHOA 4ZQLA 2E26A 4UFJA 4NHXA 4MXVA 5H6RB 1RUH1 3WW3A 1JOPA 1HRI2 5FREA 1S2EA 2IQJA 5F3CA 2HYED 3I3BA 4GB32 3DV8A 5TSWA 3B3QE 3KSCA 4K9SA 4E7ZA 3NNFA 3J8F3 1LHVA 3RQUA 2VJEA 4CU6A 3I54A 3JCIA 3GWHA 1X79A 3AE7A 3Q8FA 4DQAA 2P4EA 1WE9A 3AYCA 4AI3A 4QF2A 5DXDA 1WA6X 3F95A 5FZIA 3RC8A 2B4KA 3VBRC 1EV13 4PF5A 3EB6A 2BG9C 1ND2A 3NQHA 3IN9A 2D6NA 4BMBA 4IC3A 2I07B 4UFHA 3UV9A 2DX8A 1CZTA 4FP3A 3AJYA 2WS3A 4E2SA 5LRSA 2ZKLA 3I7DA 3AK0A 1MACA 1REFA 4Y20A 2X9YA 1SBDA 5D1LB 3PIJA 5F5WA 4QH1A 2WZEA 3PHDA 3SNMA 4XW3A 2AACA 1TMF1 2L75A 5T5LA 4IE5A 1MQTA 5ADXL 3ZYPA 2YV8A 3Q5EA 2RS33 1W0OA 3I3QA 2ACXA 2NTXA 3ZVXA 3BTXA 4JRAA 4XILA 4ZHNA 3IAPA 5BR8T 5GLWA 1XDPA 3UUNA 4JI0T 1MMAA 1SEFA 5AQNB 4AHYA 3M8LA 3N9OA 5ACA2 1OFSA 1H2MA 3GHNA 2VVDA 2XQYA 2D8SA 2P2KA 1D0HA 1DU3D 3MLLA 3FEHA 3WXPA 2X66A 2NM1A 4U2ZA 1DGRA 3R84B 1OOPA 4XFIA 5FPVA 5DAPA 1W06A 3PUWF 5HXEA 4IIJE 1J59A 1ZZ8A 4QQHA 2VUAA 5FXVA 4FPEA 2BDEA 4HKWA 2V8SV 1O3RA 1UU6A 5HV0A 2ZPXA 4NXMT 1AR72 2EHOA 5G05L 3CQCB 5E1RA 4GKYA 5FMCA 4QPYA 2GAUA 3BIEA 1WFKA 2VMCA 3PUIA 2GNTA 2HDPA 1W6NB 4ASLA 3MPPG 4DV6T 3RPGC 2P3IA 2A72A 3OBAA 4I0BA 3KDEC 2DCFA 3CJIA 2X05A 1WLTA 5EHDA 1G9FA 2ZGMA 3CKHA 4I4TE 3DPRC 1UOBA 3C4XA 2ZGOA 3KFWX 5BYNA 5J7MA 5FR3A 4MGTA 5HEUA 2LHRA 4WVMB 3MIBA 4BXFA 5JDNA 2O0OA 2JPFA 2XBO3 3R4SA 4BJMA 4TWFA 3RF1A 1W6MB 4QX3A 3VZOA 5F3JA 5F3IA 1VJ2A 3RVHA 4ZZ5A 4Z8BA 1F9KA 2DI4A 2DTYA 2WA4A 2GH8A 2EAAA 1BK0A 4JBWF 1LESA 3W20A 2PLV3 4L97A 4QKNA 2H6BA 1RC6A 4BLJA 3KMHA 1XNDA 3MXZA 3N7JA 3URFA 2C9KA 4BE3A 2VGDA 4AI1A 5JDHA 5BNNB 1QJFA 2J1RA 2QVSB 3NV4A 4FPKA 2XTLA 2CSGA 1LOAA 3QZVA 4Z8XA 1MZFA 2E61A 4O2AE 4ZZCA 4CA9A 2BGOA 3AMQA 4CDUB 2QA7A 1W2UA 3N9NA 3AFKA 4OUMA 5FB0A 4NIQA 4JCKA 2VU9A 2LKHA 2NPIA 4JDMA 2R0FA 4CDQB 1KEYA 2RMU3 2PHDA 3WW4A 1UYZA 4DV5T 2E9XC 2WABA 2FJBA 1FBVA 3FLTA 4DNYA 4QF3A 2JDAA 3C51A 4XVHA 1OD3A 2H6CA 3FN9A 5IHRA 3ZPVE 1W3VA 3BGAA 1NA1A 3HEIA 3VKHA 2M13A 4CCCA 3RG0A 2MTQA 5APAA 2BNOA 4AQSA 4JI1T 4MOAA 1D7PM 4LADB 4RQPB 1FPN2 2BS4A 2IUWA 4AGGA 4DZGA 2VWAA 2C2VS 5JZGA 4QXHA 4FSJA 5HEGA 2BRTA 4KHPT 4GH4C 3EABA 4OFGA 5TRBA 1HFAA 4R9CA 1VBD1 4QGLA 4CEWC 2VQET 1BVVA 3KQIA 2MPFA 4AGRA 4ZXEA 2XVGA 3UUMA 3EXUA 2EAKA 4OUEA 4GKJT 2W46A 1NXD1 5KC5A 2ZGRA 2VBDA 3M3EA 1W8NA 2VNFA 5IAVA 2V7MA 3OGJA 5HXHA 1X7NA 3PVOA 5DZGA 4K6BA 4V2WA 2JQKA 2ZHLA 2CEAA 1RUI1 3ZMOA 1DG6A 4D8MA 3UU4A 1T8BA 2LOPA 3J9SA 5HXMA 1UX7A 1AJOA 1UCXA 2D6PA 2NP9A 2FCUA 1G9DA 3P50A 3PTYA 5DUVA 4OQ8A 2R6QA 2WAOA 5DZEA 4BQ5A 3VHRA 3CPZA 5C13A 2IDOB 1S0CA 1WYBA 3ACLA 3J4UH 5F37A 3SXWA 5LW9A 4SBVA 1GYKA 5CFBA 1BMV2 2CHNA 2DTWA 3HOBA 4P9GA 1O91A 4LHLA 4V1Av 4AYCB 3OBZA 2BVLA 1KXGA 2CM0A 4U72A 2QBXA 3IMMA 3VDDC 1UXXX 4Z90A 5DAQA 2XLAA 2VXRA 2K1JA 1IZ3A 3HKCE 4BM8A 4FTSA 1LECA 2CTVA 2VR4A 1NAEA 4R8HA 2KGGA 3NAPA 3B02A 1IG3A 1VBE1 1RHI2 1RGSA 4DV3T 3WEZA 2JUNA 1TVGA 3TLSA 5I0DA 1E5IA 3LA3A 1V6OA 1S0JA 4W50A 1S55A 1HXS2 1N3PA 2XEUA 1AR93 2A6ZA 2CSVA 1L7RA 2V09A 3O1PA 2KM2A 2OVUA 5CB4E 3WF4A 4K1ZA 2HYXA 4LMLA 1NCQC 2WB5A 4YTPA 3KV9A 5FPXA 1AYN1 4LBQA 1HJFA 5FP3A 4A97A 4DR5T 4KMQA 1CWPA 1EP0A 4Y1YA 4RS5A 5FYCA 5FZOB 1AR63 4C0HA 3GV4A 2JX9A 4CCDA 3HKEE 1JTZX 2VOWA 4FPYA 4PBPA 3ETPA 2G0UA 5B77A 1HV0A 3FBYA 2ZX4A 4BWOA 5HCHA 4Y22B 3C7HA 1RUJ1 1LNSA 3FFZA 3A8YC 3EDUA 3NSTA 4FPOB 1PNFA 3AYEA 3M7KA 3AZXA 5F6KA 2A70A 1FOD2 3I2HA 2ORXA 1GNHA 3CIHA 1GP4A 1ZZCA 3N35A 4YZ4A 2MT5A 2K48A 4UR9A 2F6JA 4TLGA 2DNXA 2JKXA 1E4UA 4AHXA 1MEC1 4XQDA 3JUEA 5A1AA 4IXLA 2WUHA 5A3NA 5JQGE 1WZXA 1B35B 3O0VA 5AQSB 3V0BA 3BB6A 3VHPA 2N9DA 2JRKA 3WUDA 4Q25A 2ZEZA 5IK7A 3VKNA 4H9SE 3I3DA 2BFUL 2YMZA 3AFGA 2PHWA 4OGEA 3NZPA 3THCA 4JI4T 3FZLB 5H1VA 2V5YA 3RYPA 1ASJ2 2EVXA 2X5IB 4IEYA 1JM7B 4XMAA 3U11A 1WEUA 4H9PC 4D94A 1XDOA 1YKEB 2JICA 2WC2A 2PTFA 1QUUA 1J1TA 4PDWA 5AQJB 4YLHA 1QJX2 3ZXAC 5CVRA 3TB0A 2YREA 1G25A 2E9QA 2Z79A 5L47A 1HW5A 4CRQA 2CDPA 5JTGA 5F1RA 4OFZA 1K2FA 5SVIA 1CZSA 2BVBA 1OFNA 5B79A 2Z42A 4B1MA 1WMDA 4CCLA 5IW0A 4ITCA 4UFMA 1DLLA 3KWVA 3TN93 2WFF1 4ANJA 3RDIA 3FBLA 3JZVA 1KRIA 1ZBA3 3MA9A 2DUPA 4M3CE 3X1DA 2XJVA 4HFIA 5GZGA 3VBOB 2XHEB 3H1YA 5L19A 3U5OA 4ZS3A 1UGOA 2BFUS 3AMMA 1EZ3A 3GHMA 3HN1A 2HBTA 4HK9A 2BOIA 3E5XA 5HEHA 1GKBA 4JC1A 2AZ5A 4XF4A 3PURA 2YINA 2D44A 4ZDTA 3SCFA 2YU4A 3KHCA 3K4DA 1OLME 2VCCA 4FIPA 2WAAA 5A3LA 4XFBA 4IV1C 2F4VT 2P3YA 3K3NA 3P6BA 4BJNA 4NWWA 5DINA 2O1QA 3LDYA 1YC61 2VTFA 4GYRA 2EF6A 4QGMA 1YO8A 5JRCB 4AEMA 4GNFA 3HMYA 3B94A 5C3JA 2VPBA 5JDGA 2VMHA 3NG2A 2VKDA 4N43A 5HI0A 2BERA 1IOAA 2CPTA 2VMDA 4RHV3 4LMFA 2W87A 2VG9A 2KWIB 4L2NA 2B46X 3DN7A 2B8MA 1VBC3 1ZREA 3D0SA 1UOFA 5TDWA 3RSJA 4CDXA 2VZVA 2K5BB 4WVVA 4JX0A 5I3LA 2XQAA 1OXZA 1CHUA 1AJKA 1NY72 4PIYA 4Z92B 1O4TA 2B9VA 1SLLA 4AKRB 3H50A 5DUWA 5F32A 1PGL1 2QRXA 1U5IA 3LBXB 1H8TB 5FZ1A 2R7EB 2TBVA 1XE0A 4L8QA 4CTEA 2PUYA 4MGKE 3QNUA 1AVBA 4AR2A 2YB7A 3AEFA 3RQWA 1MVEA 3O0WA 4MV2A 1JOBA 4XDPA 4B29A 2MD8C 3FZHB 4FVVA 5ABGA 4FT8A 3AL5A 4X65T 5DDJ1 3UULA 4Q6FA 2RS13 4LO6B 5LBFA 4Y5SA 3V64A 4XFAA 1RITA 1I5ZA 3KGLA 1C3HA 2E2AA 1A8DA 5LCYA 5FBJA 1U5YA 3CMLA 1POV0 2JE7A 1XXNA 3WX5A 1BZWA 3L1XA 1RMDA 3RPQA 2JG9C 3S6PA 3ZPV1 4DV4T 1PO22 4DUXA 3UJQA 2WY2A 5C3SA 2OWAA 2JQQA 5H9MA 2PFWA 1H30A 5SVXA 4NO4A 3UFEA 3DP7A 1Z78A 1PNGA 3RI9A 3Q9DA 2VULA 1D4VB 1AXKA 1MS3A 2WQ4A 5IATA 1GZ9A 1JYTA 4KQ7A 4KMCA 3SOWA 2YU1A 1UMHA 1AHSA 4ZI2C 1FT9A 1LOFC 2DSMA 5IJRA 3P4QA 3O1TA 2FHRA 2JB8A 3ZSJA 1UOGA 3PIGA 1JN2P 4EV0A 2IHR1 5D8AC 1QJY3 4Y1VA 2JG8C 3KT4A 1S0EA 1UY1A 4AFCA 5C8WA 3HI2A 1ZX5A 3GCWA 2D0UA 2RR11 5HCFA 3RYIE 1ULDA 4ILCA 3OGSA 2IFWA 3NJVA 2LS6A 3KLSA 1YFWA 1DLCA 3OD4A 3FZFB 1W03A 4WZ3B 4MGQA 4AQFA 2ZABA 4XXAA 1E5SA 4ZXKA 1XJAA 4AVVA 2YN6A 3UGHA 2W61A 4PFPA 2HEVF 5DJQC 1VAVA 3H3ZA 3IHRA 2AEZA 3DUIA 2Q1FA 5JDFA 2ECGA 2YHNA 1R091 2ZGUA 1AL0G 5FCCA 3M2MA 5H9QA 2C9AA 5LA9A 3GYDA 5FZ8A 1JYNA 3ACHA 3OTFA 1ONAA 3RTRB 3C2UA 5J0ZA 1X4IA 2JM3A 5JR9C 1ZBE3 1PVXA 2ZEXA 1I3HA 3VBHC 4XCAA 1CAVB 2ORZA 2HBUA 4FO9A 2ZS6B 1YKHB 2CWYA 1YWKA 2QQVA 2XOZA 3I59B 2RM23 1CN1A 1OA4A 1WW6A 3DYPA 1H0BA 2WMOA 2HWC1 3LWCA 5K0UB 3LD8A 5G04B 2PJQA 3OEBA 3LFMA 2J4GA 1VD4A 2FBEA 2FD8A 4K0UA 5AQLB 2WSSV 3VBUC 3SISA 4BHWA 1SPPA 2OQ7A 3PJYA 5JI9A 2AH2A 1GUIA 5DPNA 3Q5XA 4PK4A 1ST8A 3LDQB 1ALYA 5D21A 2E6VA 1OQ1A 4QDRA 4LFBT 2ZLYA 5IHYA 5C5UA 4WZXA 1W05A 1BJQA 4DUWA 3ZVZB 4YARA 1MS5A 3WNLA 3LG7A 1Q43A 3CQGB 4CU7A 4YM3A 1PM4A 4Q4V1 2VZTA 2JD9A 1W6NA 4BH9A 4FOVA 1K42A 1XMQT 2X51A 1D0XA 2ACZA 5FWJA 2YHJA 2VZOA 3ZN1B 3EVYA 5EIYB 2QFEA 3H1MA 3N2KE 5LKZA 3UQ4A 2CY6A 4LORA 3NNJA 4HN0A 1T2XA 2MNZA 4WVMA 4BB3A 2M67A 1D4M1 3JC6C 5H9SA 4M3CB 2AN6A 2VD7A 3HPNA 1W6MA 4CPBD 4ZZ8A 4JI8T 3VLBB 1X8EA 4M3CF 2FDGA 3AZZA 5A3WA 2CCQA 1RUF1 1W90A 1J1LA 1QQP1 3WF1A 1YYNA 3KZ4C 5E89A 4E8DA 3CIRA 2HWB3 5FUNA 2EXUA 3P5BA 3USUA 1WEPA 3PU3A 4ZI3C 5JPNB 3FHNA 1WUVA 2RSDA 1M4WA 1BR1A 1Y3TA 3HNBM 1F4AA 4A7ZA 5EZYE 5BNNA 1S0BA 4X66T 2DYCA 5C8CB 4LHSA 4AI8A 2QTWB 5HYAA 3BCWA 4JTNA 2VZSA 1SLIA 3N5LA 4DR7T 5LCWB 1CHCA 4L9IA 4CDUA 3QB5K 3H0OA 2VTXA 5AQHB 3OY8B 2ZJCA 5AQQB 3M99A 2D3RA 2CA5A 1OH4A 5L2LA 2BBVA 4KI0F 3SC7X 1W8FA 1UIJA 1AR83 3ZYRA 2ECJA 2CGNA 5KMGP 4Q0SA 3I2JA 2XP0A 1POQA 1JZ4A 4RFT0 3T1MA 1UX4A 4H9QC 2ZCWA 4IGOA 2JDNA 4YVSA 3WF2A 3CEWA 2XPKA 4DEVA 3PJAJ 2VNRA 4LFCT 4YFWA 4GB33 4IETA 2O8OA 3VD5A 3P4PA 3MV01 3RYHE 4MGIE 3HWJA 4JI6T 4CP9B 2H88A 3PU8A 4QXCB 1GZTA 2GDFA 1I94T 5GALA 4GWIA 4RQPA 3LOBA 4B4PA 2SBAA 4MVTA 5B76A 2FZ1A 5HEJA 1XZYA 2DVDA 3J8F1 4R52A 2FJAA 2BP6A 2W1SA 1RUH3 4R8PK 4A6OA 2VQAA 4GOUA 5C4WB 3W5MA 5GZFA 3D6EA 4S3OC 4AFMA 2NP0A 5AFEA 4BQYA 1LKNA 2RR4A 3N7LA 4Q4X2 2XQ8A 4QHBA 1EV11 3LE0A 4M0HA 3Q8BA 4TWTA 1Q5OA 2ZGPA 2YPDA 4ONUA 3T6RA 2UWCA 2HPLA 4JI5T 1JW6A 1GV9A 1IPJA 4GAZA 1SUMB 2WJSA 4PQ9A 4OX9T 4KWLA 4IEQA 3O1HA 4AZZA 2Y6JA 3MEPA 4DIDB 1VB2A 4YT0A 4SLIA 4YG0A 2XVLA 3GZEA 1HYJA 1SDDB 4LKEA 3NVOA 1JUIA 1VCSA 1LU1A 1C8M1 4ATEA 1TNRA 2B9UA 2CBIA 5ACA3 5AC93 3OF1A 2OXBA 1J83A 2RS31 3OYZA 1IAPA 1IJ5A 3MV11 5JXHA 1W2TA 2WZ8A 2XL9A 1FAYA 4AYCA 2TEPA 3WDUA 1ND2C 1WENA 1LEDA 4TWHA 1PGSA 3WAKA 1IS6A 3M65A 4EGWA 5A7NA 2X29A 2HEWF 3MIGA 3I49A 3BYWA 4MH0E 4O61A 3I9YA 3ATGA 5FMOL 5AQGB 2A6WA 3WW1A 1X4UA 4HMZA 2PMWB 3WI3A 2DJAA 5LXTE 4XC9A 4ZXLA 4CN4A 4Q29A 4BA6A 5IYZE 3UYJA 3DTOA 2VXJA 5JR7B 4A4BA 4RL7A 2ZKNA 2J7MA 4YJ2E 1MQTC 4LE3A 3KINB 4O9GA 4OYJA 3ES4A 4M4PA 2XOYA 5E6HA 2D43A 4XETA 3BTAA 4QDQA 4AKIA 5GM0A 3ES1A 1HQNA 5GZDA 3AVSA 5M0TA 3OEAA 1RJ8A 4FQ4A 5FZOA 2WR9A 4QQLA 1YW0A 2H0BA 4JGYB 3ZN4A 2VUJA 2LRIC 3D0JA 1L0VA 3N9LA 3ZSKA 2C0SA 3LVRE 3JC6D 1OOPC 2WNVB 2K24A 4I50E 4Y22A 1UZ0A 5H1UA 3WLUA 4MHCA 3HNMA 4OHXA 2ZACA 1US7B 4I0WB 1W0BA 5FMOS 3C4ZA 4YZ1A 2KREA 5FLJA 4OCTA 4LF4T 1XYNA 4BXSV 1MS4A 4ZI3D 4RR3A 2WWJA 3INAA 2XBO1 3BQIA 1ENXA 1K5MB 3ZMUB 4IL9A 4NHKA 3IDCB 1QJU2 3JAEA 4B3NA 1RUOA 2DVBA 4UBGA 3QLQA 4H2AA 3PLWA 4WZ0A 4UVCB 5FP4A 4LA2A 5EP9A 3ZMTB 3RMXA 3WY6A 2D3SA 2V7IA 1B35A 4TN7B 3WNNA 4YY3T 3QD6A 5CA6A 2PLV1 2X53S 3CJIC 4LBMA 2DWKA 3B13A 2G9FA 3CL1A 4EOZB 5BNQA 3ZT6A 2BU9A 4AVTA 2CT2A 4JUYA 5FYSA 1BKZA 3MUY1 4Z07A 4UW4A 1O3XA 2P5BA 2RG4A 4MUVA 4PW8A 2XOMA 4O2BE 3RQ0A 3AZYA 2LTNA 3FXEB 2X5IA 2D98A 1JM7A 5SV8A 5GLVA 4IW3A 3FC0A 1VIWB 1DQ5A 4B8EA 3JB4C 1UPIA 3GN5B 3IKWA 1MS0A 3SKVA 4Y4YA 4IT4A 4XUNA 3RIFA 2WMNA 1DGLA 2JDUA 2W5FA 1AYN2 2RMU1 2ZEWA 4L11A 5F3EA 4E7SA 1IPSA 3M1HA 4E4SA 3UK9A 3RI8A 2UU8A 3NNMA 4H7LA 3WNXA 4EQVA 3FL7A 4N9IA 3HL6A 5JXIA 1ZBDB 1HRV3 4YVWB 1FPN3 4PLMA 4NIDA 5LNKA 1HR0T 2J62A 3KV5A 1A3KA 3T2PA 1PZ7A 3WAJA 3DPLR 4P0AA 4YRDA 1ZZBA 1IQAA 4CZSA 4OVEA 4CEWA 5FZFA 4S2GA 1IBLT 2XJQA 4CCKA 4A4AA 5LA6E 1PX3A 1COV1 1GNYA 2EGMA 2ARXA 4U36A 2XB6C 3OBVE 1ENRA 3T30A 5LWBA 3J7MA 2ZETC 2XPJA 4E4DX 3VBFC 1WMXA 4ISSA 1H9WA 4KBBA 3LRQA 3HKDE 3WQ0A 2BJSA 3I3EA 3RH3A 1RUD2 3CO2A 4UP0A 3GXUA 3L2YA 1OHFA 2NYYA 4NRPA 1RIRA 4PT6A 2QZ3A 2VCBA 1NA1C 3ZFEB 2Q8EA 1BEV2 1K45A 1WGPA 4TWDA 1LDJB 3K3OA 3ETUA 1RL3A 4DO0A 1ULEA 2G9GA 5CIRA 5KHJA 2IWGB 5AQOB 3ZYKA 3AP7A 5IWAT 4BA9A 1RUNA 2VURA 3UUXB 1DGWX 2ID4A 3GZUC 4BZ4A 3Q5WA 1W0PA 5JZGC 2VC9A 1AF9A 2LN0A 3D5OA 1D0YA 1K3IA 1ULGA 2RI7A 3KV4A 3TOJA 4RFRB 3AEBA 5FNVE 2R0HA 2MHFA 2XH6A 5B75A 2YUCA 1LRZA 1NENA 3UNPA 2OT7A 2Q8DA 2WDQA 4TV9E 2DWGA 2QICA 2HKXA 4PBOA 1O8SA 1RTVA 1Y9MA 1H2LA 3O7AA 5DN2A 3FUQA 4NRQA 3SUBA 2Y6HA 2VMIA 3N4MA 3SHBA 1HB3A 3OJBA 1RHI3 2AENA 1IJ6A 3V5UA 3BI3A 1F4HA 3LBXA 3RGBA 4R4ZA 2XJPA 2O14A 2VUDA 4Q27A 1R8IA 3N9QA 1X36A 3DECA 1XC6A 1SHWB 5AQUB 2R16A 2JENA 3OTOT 1O4YA 3MHHA 1V6LA 1HXS3 2B5HA 4LT5A 1W6QB 4HFDA 2R6GF 4NPPA 3SOUA 3S5AA 3PUSA 2P3KA 4U2YA 1RUC2 2A6XA 5C33A 5JXJA 4J1XA 2UZGA 5BUVA 3LSEA 3ZN5A 2YDRA 5A6YA 4ZEYA 4PJMA 2K2SA 3ZPYA 3C5KA 4IUGA 1AR91 3POWA 3J7NA 3R05A 5A3MA 4X6RB 2GN7A 2VPGA 3VDDB 2IZWA 2P1BA 3OB8A 3G6JB 4J25A 4KBMB 1VRBA 3JD72 3NBXX 3P3PA 1WBLA 1AR61 2WN2A 3NAPC 3EBRA 1HS7A 1U5XA 4DV7T 1C5IA 4CUCA 5C3QA 1Q8VA 1XE7A 5FZAA 4QXKA 3ZMZB 2HN2A 1YUDA 3N2OA 5KXDA 4DVDA 3ONLC 4PI2A 4RYDA 4YZ5A 2LGKA 3F31A 1WEOA 2C6SA 4XFFA 1JZ7A 4B7EA 3D4KA 4I7CA 2LM2A 3VV1A 5GLZA 5FRAA 1DCQA 2ZM8A 4LE4A 2A71A 3M70A 2A7AA 1XNTA 4CCMA 1DVPA 2ZTNA 4RS5C 4YM1A 5BXXA 3EHZA 4Z2AA 2XJ7A 2QQIA 5FY4A 4LK7A 4AQYT 1IS4A 4LF5T 5EK4A 4NE9A 5EPAA 1GU3A 3ACFA 2VKOA 2JE8A 4EWAA 1PMHX 4AVCA 4X5TA 2NW9A 2W68A 2LRPA 1MEC3 4FFIA 3E5UA 5BNPB 1NQJA 4QKFA 1RMU2 3PNAA 2LE8A 3WINE 4X1IE 1QJEA 5F8PA 4AISA 4K0KT 4AQGA 2CHOA 3ENRA 2KE1A 5DDJ2 5IK5A 4R7EA 1LDKC 1SFNA 2V6XA 4PLNA 2B76A 4L5GA 1Q8OA 4G63A 4IE0A 1W3XA 4LKSA 1NX9A 4LNVA 4DR3T 4TKPB 5LA2A 3T7LA 4Y5Z0 3L1ZB 2VOTA 3MW4A 2JMIA 2VKHA 1RXFA 4AEJA 3VZMA 1CVNA 4XEZA 5KBFA 3DXUA 3MW2A 3AAEB 2G4IA 5K0UA 3QB5A 2R1BA 3UETA 4HGAA 2XG3A 4U7YA 2J1VA 1YJKA 4NAOA 2P34A 5BPXA 3U37A 5T54A 4KHZF 1E1HB 5FIXA 4K8RB 5A6XA 1AL22 2XR4A 1SHZC 2H7OA 4AI2A 3R6SA 1ZBA1 2M6MA 1IPKA 4LHKA 1HQLA 4N3WA 3U10A 3WP3A 1W09A 4BLIA 4LEJA 4PDWC 2C4XA 5FDBA 2I45A 4AKHA 4EV6A 4JDOA 3OPWA 2RR12 1C57A 2BVVA 3ZXEA 1CAXB 3EUHA 5L7OB 3T2OA 4D6QA 2CXFA 1LOCA 3RGLA 3IBPA 1KNPA 3C7EA 4W8JA 1OEDE 4L99A 4YW1A 3LQIA 1D2SA 4UELA 3LGRA 5A6QA 2CMRA 4CDWB 1JOJA 1JNZA 1CAUA 3AB3B 5DABA 5JWPA 5JDMA 3FWEA 3LSVA 1U6GB 5I8TA 2WS92 3A22A 1MMDA 5H1TA 1PK6A 3T9KA 4DOUA 2AC1A 1OD5A 3KBTA 1TME2 1S2BA 3FHIB 1QU0A 1NZCA 2H0DB 4C8DA 3THTA 2KFTA 4YJ3E 4AHWA 1I5PA 3V65A 1WW5A 4M3CA 4U7IA 4CPBA 1AX0A 4CQIA 4P09A 5CJ5A 1PO11 4RHV1 1HB2A 3RYRA 1CAWB 2DUOA 2DFCA 3NRUA 4WYVA 2PN5A 3VGIA 3UT0A 2ECNA 1WR6A 1W9YA 2KSRA 1G8WA 3KV6A 3B57A 2A3YA 3WD5A 1S35A 4GKKT 3GBFA 2HWC2 1YLLA 1OLMA 4H55A 2AREA 1HIXA 3A7MA 3WUCA 3LPFA 3P4SA 4K7JA 5C8CA 4OMDA 5ANNA 5CBLA 3SCHA 4ISRA 1W99A 3UTKA 4N43C 4QPGB 2VKJA 3B5MA 5JCTA 3OYXA 3OGVA 2RHPA 5FMNA 4NPLA 1ULFA 1WD4A 1DP0A 4YATA 5CFCB 5HCJA 3RKGA 2RS11 4P00B 5FZHA 1PX4A 1OQEA 1VAMA 4N9HA 5ISLA 3CF6E 4CDXC 3ALQA 4Y3OA 1FP0A 4ZS2A 3NV1A 3MGUA 3CZUA 4B3RT 3ZFGB 2FDFA 2VE1A 2FDJA 2NMOA 4Z0OA 4Q4V2 2WNUB 3C3VA 3O1SA 2CYFA 2XXZA 5LATA 3D8CA 2B7YA 2FZ2A 2L80A 4AVSA 4U74A 4UVBB 3HTKC 1HJGA 5FQ0B 2W4XA 4P9WA 1WMEA 5C70A 2K3WA 2V7KA 1KFYA 2GALA 3V0AB 3B9CA 4CP9A 1NXMA 1WLXA 4JKLA 4QXCA 3ON7A 3POSA 2VMGA 4LLOA 1I9RA 4WBBA 4CYDA 3N36A 1AJ3A 1QJZA 4HEAA 2OLTA 3Q9OA 5LBCA 4DR1T 2A3XA 4MSVA 1YFXA 2X0LB 4QPIB 1APNA 3FLRA 4LLFA 5C4WA 4QMAA 4E27A 5A70A 3AKPA 3H3MA 1NCRB 1S4CA 4CVUA 3QOPA 1WCQA 4AVBA 3OKQA 3J9X1 1QDOA 1E7PA 2G1MA 3SH3A 2VL0A 4UFLA 2VUCA 3FBMA 1WGMA 4FFGA 2ENRA 4PTBA 4JV5T 3UU3A 1T6BX 2VMEA 3I0QA 4EB6E 2EIEA 1EAH1 3KF5A 2QQJA 2MA6A 1QWRA 4W65A 4OHWA 3QACA 3ETVA 4C1XA 2JMKA 3AKSA 3MLJA 3AE2A 4LF8T 4HKOA 1UY2A 3GCXA 2XJUA 2Y6XA 1XQNA 2XLFA 1XWHA 1JS9A 1FMD2 4NUBA 4HWIB 1VYXA 2VZQA 4LBKA 3NL1A 1ZBE1 2JDHA 2NAAA 4Z82A 2BS3A 4XTPA 1V9U2 2J47A 3B01A 2OQ6A 2ZOEB 3JBG2 3VBUA 2WRAA 5AQVB 4JDNA 5KC6A 2W1UA 3O1OA 3ZPOA 2RM21 4ZU4A 4UI9L 1RUG2 3MFAA 4YTMA 4XF9A 4Q1RA 4QX5A 4PNIA 2DBIA 1MNDA 3G7DA 5A3TA 1IKPA 2WKKA 4ZZBA 1FX5A 3O9XA 1UURA 3PUGA 1CONA 4PPEA 1V70A 4IEWA 5BNOB 5F3GA 1MIVA 3DF0A 4CUAA 1PM7A 4IGUA 2XKOA 5DQVA 5FJKA 5CG9A 4IEPA 4HN9A 4IEZA 3ZSTA 3MPBA 1A8MA 5E0OA 1GOGA 2PQSA 3SMHA 2KT9A 5K9YA 2QQPA 3NJZA 2Q1MA 4XURA 2X0YA 4OLLA 4FJCA 5JG6A 4IDOA 2LKGA 2ZM6T 3MUZ1 1GWLA 2YQLA 5DUXA 1VBA3 2X10A 1UKGA 4P9JA 1Y9GA 2QQOA 4CI3B 3KT7A 4JGYA 1W9WA 3UKVA 1C28A 1FEWA 2WNVA 2H89A 5JAXA 5IK4A 4N7IA 2V5CA 2KR2A 5T5OA 4D6RA 2YVRA 3E22E 1H2KA 4XXPA 3U78A 5L4EA 3AE3A 2J1SA 1HG5A 1FNZA 1REDA 2LRLA 3K75B 1NZIA 5KXJA 4TV8E 1S0IA 4LOTA 3TEYA 4OULA 3NNGA 2HHHT 2WZR2 5CYYA 2Q30A 4AFAA 3HQRA 4PF1A 4MSXA 1KDMA 5LGUB 2NTYA 1K5MA 3GGLA 4NPMA 1UO9A 3I9WA 1BBT3 4IESA 2J1UA 3ZKUA 5FOBB 4DRRA 3ZMSB 3M3OA 4XDOA 4H63V 4A5XA 3HJRA 2ECWA 4EXTA 1SA0E 4TN7A 3KHBA 1VP6A 3FJSA 5DG2A 1GQPA 2YC2A 3P8CD 5CFDA 3NNLA 4M00A 2YT5A 1QMJA 2JMJA 5KHGA 1OEDB 2BKNA 1NE6A 3IIAA 4I2OA 2F42A 4CXWA 1RUF3 3OPCA 2V6YB 1IQDC 2VQUA 5A7SA 5FAXA 2UURA 2RV9A 2XM2A 4LF6T 2HPJA 2HLEA 1HV1A 3T4HB 2WDRA 2VBBA 4LQRA 4JI2T 1IZNB 2YFZA 2V7JA 1BXHA 4QWNB 3ZMVB 4WVWA 4LBNA 3DGTA 1GQGA 4XZUG 1RUE2 3ZSEA 1H1IA 4FPGA 3GN5A 1LRHA 1KQRA 4IE6A 2RPAA 2W2IA 1LULA 1WCDJ 1KEXA 3FHAA 4XE9A 4IQPA 3C64A 2A3WA 1A78A 1LU2A 4LMJA 3HA4A 1SMVA 5FXZA 4EIWA 2ZGQA 1IS5A 4KGGA 5BNNC 2NWBA 1V87A 2Y0OA 3HCSA 4XFCA 2OIIA 4YVWA 2Q5TA 4TX5A 1HB4A 4GB31 1N33T 1UL9A 4UFIA 2GMPA 2PFVA 2YURA 4CDUC 1UN1A 1YXRA 1GQEA 2QQWA 1ZHCA 3OYWA 4HK8A 2RVAA 1OLQA 3VKGA 2LW8A 4Q4X3 4HSLA 2CU5A 5LRRA 1DF0A 1D1AA 5JIAA 4KNCA 1S0FA 2HWF2 4AEDB 3VR8A 1PVC2 2UY9A 1HTJF 2LAUA 1CPMA 1OVPA 2D0TA 5FYIA 4BQ3A 1MBMA 4UBHA 4YVSC 1KJRA 2V72A 5C71A 3UJOA 2BBHA 1OH3A 2QDRA 5IVVA 4EROA 4K3UA 4GJZA 2WQZC 3DYOA 1WEEA 4DBRA 1OKQA 1KFXL 2JQ9A 3ZSMA 2FJEA 5A32A 2G43A 1O4ZA 5DAXA 3A21A 2KWHA 3ZVYA 4RQPC 5FK7A 2BQPA 4P08A 4DEQA 3RIUA 3RS6A 3MW3A 4AKLA 2ETEA 2FCTA 2LM3A 4F52B 1VRH2 2VJFB 4M1PA 2BGCA 4FXKB 2GMMA 4XYXA 1H9PA 5AC91 5ACA1 5EXOA 4E4ZA 2XUMA 2JMDA 1N1SA 3M3CA 3GJBA 4GQ7A 1TE1B 4ISQA 4GJYA 3FM8C 3H42B 4IEXA 3OPZA 3CBNA 1C8M3 5IT6A 5AIUA 5KHIA 2WT1A 1QSDA 5ABJB 3EB7A 4N53A 1WR0A 2R072 4NAMA 2YGLA 2JKBA 2O8QA 4I43B 5DMYA 3AE8A 2JDZA 2YGMA 4WBNE 1W6QA 3PHMA 5DUUA 1GP5A 4PK5A 4OHVA 3ZXGA 1AR71 1YRZA 2PHTA 1HN1A 5BV6A 1J5ET 3IPVB 3ZN6A 5L73A 4BQ1A 3M7AA 1T98A 4H9RC 1WESA 3EYPA 3AECA 3RRDA 4PHZA 5FZEA 4XABA 4YXDA 2X9XA 5AQRB 1QIQA 2WN3A 3ZFFB 4CEYB 1DCSA 2C26A 3GALA 2M6BA 2XB1A 5I8YA 1O6UA 2JJ9A 3ZT7A 1DGRN 1X9PA 1R082 4A0CD 2Z5WA 1JUHA 2FSAA 4QPWA 4ILBA 3ZYFA 3R4DB 1BR2A 4U33A 3WHTA 3SOXA 4UP5A 4CU8A 1W9RA 2IMLA 4WM8B 5F2WA 3AE9A 3ZXFA 5KDMC 2B0OE 4NR1A 1JYWA 3EHKA 3H8XA 5FP8A 4GKXA 3Q8EA 1MQTB 2X68A 4W6WA 4GYSA 4PQQA 5IUXA 4N4FA 1N1TA 4YG3A 4EN0A 2E6RA 1H6XA 3T08A 1EUTA 2AXDS 5J1GA 3BKZA 3RZLA 5K3QA 3JUUA 2WDVA 3VZJA 3UKTA 1YD8G 5FBZA 2MNGA 2XLGA 3RZJA 2D8UA 1CIWA 2CHHA 5FFOC 5LBMA 5D2AA 2WU5A 3S7IA 4YFZA 5JSPA 1O3SA 4QQ2A 2LGGA 4XAXB 1QKQA 1UWWA 1GWKA 4BISA 5I0RA 2E8IA 1NG0A 3EB5A 5A7PA 4BDVB 5BNPA 2YBKA 3S7EA 3LQCA 3WOGA 4KU8A 2HYKA 4Q0UA 5DZFA 3AYDA 1QLBA 1VPHA 4X3GA 2L9QA 4IEVA 3ZX7A 4HKAA 3AKTA 2B39A 1MS9A 4NVPA 2EHOB 2KYUA 4C0BA 3PJQA 4RR3C 1N32T 2WBLA 2Y26A 5A3UA 4P5HA 4YGDA 1IKQA 3IHPA 1FNYA 3LDKA 4XAEA 1HX1B 4WM7B 5IVJA 4HWHA 4J2CA 3ITQA 1B35C 4KG8A 5LHHB 2LUWA 3MF6A 4U2AA 1JOCA 5C7GA 1DQ0A 4LTAA 2MNYA 3CJIB 1Z7S3 3UGGA 4UF0B 2MAWA 5B2GB 3EI0A 2I2SA 2R042 3KDSE 5J1XA 4XQWA 1VALA 4YHJA 1OUXA 2XQ5A 5FYTA 2W00A 1XNQT 2EGPA 5L36A 2A9UA 1C5HA 1T1HA 3CX6B 4FXGB 3AMHA 2QQNA 2OA5A 2C5DA 5LEKA 2J22A 3VBFA 1HRV1 1FPN1 5FYVA 2ZMNA 3T1HT 3ZNIA 2X5IC 1WW7A 4XBQA 3WDWA 3ZDSA 2TNFA 5KXEA 3N3HA 5DKAA 2KKXA 2D6OX 3VKFC 2A6VA 1O5LA 1LB2A 3PUXF 1CD3G 1RUD3 4A2UA 3RLFF 2YUEA 1YQ3A 1CAXA 4QQOA 3E5QA 5L7OA 1YQCA 4LHNA 2Q9QB 2YC4A 4XHXA 4PAGA 1COV3 3MK7C 4GXLA 1BEV3 4F8HA 2D40A 4CUGA 4Y4RA 2I59A 2JMHA 2BPA2 2PA7A 1GBGA 2R062 1OPMA 4FAHA 2GC2A 3DWDA 4META 5LASA 4BQWA 1ULOA 3N2GE 2LSYA 3BVCA 2FUIA 5J36A 2CKLB 3MFCA 3AL6A 1RVF2 3LVQE 4AKGA 2ZX3A 1F35A 4OHZA 3TRSB 3L09A 3LEMA 3LJCA 2M3HA 5E88A 2HWE2 4C91A 1DYPA 1FYUA 3POGA 2IVIB 5JDQA 2NQYA 4Q1PA 1KDKA 4EN8B 3GZAA 2ZGSA 1WA4A 4EE2A 2L0BA 1C8NA 1H4GA 2GP5A 2VECA 1CAWA 2BBAA 2M85A 4BMEA 2IDAA 3SEEA 1ULPA 3GA8A 5L3CB 1YEWA 4C1WA 4P14A 1NA1B 3IEEA 1W8UA 1RHI1 3C7FA 5D1IA 3EDVA 1UNBA 4QD2A 1PHMA 1UYYA 1S1AA 2QQKA 1FMVA 1RUC3 1LKXA 2VB6A 4HFVA 3HN3A 4QPGA 2XAJB 5LG4A 3TN92 3GZTB 1UZWA 4A3XA 3HBKA 1HXS1 1MS1A 2WQ8A 3B9IA 4QXHB 5EZWA 4DINB 3AZVA 3O33A 1LJ7A 1IG0A 1WEMA 1LGBA 1XU1A 3PTRB 3IAQA 2WM9A 4X8PA 3T2TA 3VB9A 1XRUA 2VP7A 2LXHC 5L4HA 4Q0PA 5E8AA 4FFHA 2PG8A 3ZFGA 5D1KB 4L7XA 3HQUA 2XQ6A 2WNUA 2W47A 5DG1A 4MLKA 2D5HA 1H8TC 2BAYA 5FKBA 1PGW2 3SEPA 3WP4A 2CRRA 3AYAA 1HNXT 3ZYLA 5F7UA 3P1IA 2ZGKA 4OYKA 5CA0E 2DDUA 5FQ0A 4BIFA 4MX3A 2QDNA 1F5FA 3V0AA 3RZHA 5K4LA 2Y1MA 2MYSA 5SVYA 4NIHA 2ECTA 2Y43A 1SDWA 4KH9A 4QKDA 2ZX1A 3LEGA 4UT5A 1WYCA 3O34A 4ZU5A 3CK6A 4QPIA 1LOEA 4X20E 2LALA 2PHXA 1QXJA 1E57A 3AKQA 1NKGA 4EN7B 4CN6A 4Q4W2 1VBC2 3IDAA 3CMGA 4DR4T 1NCRA 4UW6A 2XSBA 2C1FA 5T50A 4XJWA 4NROA 1DQ4A 3NW4A 3DEMA 3LEKA 4COUA 5LP6E 1JH5A 5F9TA 4YGEA 1RMU3 2VVEA 2K17A 3UQ7A 2E31A 4RGGA 4IGQA 4UW3A 2ZBJA 4DNDA 4ZY9A 4TZ4C 2X67A 3MKDA 2G6QA 1VOMA 4EWEA 3ZJ2A 3HAGA 3ZKYA 4YLZA 5FZDA 2OXQC 1J84A 2ZMAA 1R1A2 1VMHA 1OC1A 2CE7A 2JD4A 3WQ7A 4DR6T 3MIDA 5FUPA 2ZA9A 2GU9A 4PLOA 2RS12 4BOWA 2ZAAA 3AMNA 3KS7A 3NKGA 2NLRA 2WZIA 2KA3A 5FJHA 4ZONA 1U5ZA 4AE2A 5KXCA 3VD9A 3MYXA 3B93A 4R9BA 5C9AB 3QH6A 4DY5A 2TUNA 1T72A 1MMGA 2KLQA 3CHXA 3FZ3A 3VBSB 1X33A 5G05B 3KBUA 1HX8A 2R49A 1AL23 2EIBA 5I0SA 4COFA 1ACCA 1U5PA 1OPOA 4FP2A 3GBWA 1WBFA 4GWMA 1AZDA 4CXYA 3ZJ1A 2N2NA 3BK9A 3B7MA 4Q26A 1UAIA 5BNOA 4NRMA 2XDVA 3U5MA 4PJJA 1ZVFA 3LAGA 3MDPA 3MACA 1UZYA 1QJY2 2RS53 1NT0A 1QDCA 5A3OA 3EQEA 5G0FA 2CLYB 1FI2A 2HWD2 4BIOA 3T09A 2BKPA 3UU6A 4CI2B 4HKLA 1ZYBA 4FAGA 1W8TA 1WCKA 4CCGX 4IV3B 2WS93 4L0PA 5K0UC 1MM2A 4I0AA 1LGNA 2WFPA 3P3NA 2E7QA 1CPNA 5EK3A 1TME3 5CGMA 1JXNA 2LV9A 4HETA 3U07A 1YHFA 2VTXJ 2PELA 4Y1UA 2ODVA 4XJAA 3ZN0B 1YIFA 2LSIA 5AQIB 1LHUA 1DBNA 1Z8UA 2BZDA 5HCAA 3NKTA 4PDWB 2UWAA 2KXPB 2BKOA 3BIWE 2IXJA 3A7QA 4GMP1 1N3QA 1CX1A 4BQ2A 1NY71 2JE9A 4BYYA 1W04A 4YYOA 2XQRA 2GK9A 3H3LA 4Q0QA 2V5DA 3C6WA 2VMFA 2WWVA 2PYTA 2W91A 4HLTA 3F2EA 1E5HA 3E6DA 1PO13 3HD8B 4N78D 1GOHA 2P37A 1OEDA 1UU4A 3AEEA 4AXPA 3ZSLA 2V6YA 1PK6C 1AYM3 2VVSA 2ZHMA 3E08A 4OI0A 2YHOA 4QQ4A 1OUSA 1L3JA 2CWMA 1UKRA 4COZA 2YSJA 3FE5A 1LOBA 3M63A 3OCPA 1WCSA 1LHWA 1Q3EA 4XFHA 4JHZA 3TEWA 4OHYA 2QCSB 1DQ6A 4M0NA 4DB5A 4NOTA 4F8AA 2WU2A 2YEVC 1IS3A 5A1FA 4ZU7A 2Q0AA 2EXKA 1LHOA 4AL9A 1YFYA 3KNVA 4TXWA 4UV9B 1FIOA 5C8CC 1BLZA 3ZDVA 2OZJA 3POJA 1ND3A 1UYXA 4YABA 3T0BA 4BAYB 4GNEA 1DZTA 4YTNA 3O14A 4LBLA 4B3ST 3S4UA 2UXXB 3QUJA 2UXDT 1HDKA 2OV9A 1PIV2 4IEUA 4LJHA 2UYAA 2LDRA 5J98B 4WVZA 5JOXA 3C4WA 2CRWA 1HG2A 4AEDA 3RYFE 4AAPA 2K9ZA 5GJ6A 2J42A 2Y8KA 1YNAA 2XL7A 2PBIA 3AEDA 5LG3A 4K8FA 5F5AA 2LXPC 3VK6A 5JSOA 4XIKA 2ZZQA 2JRJA 5K7PA 2HWB2 2ILMA 4Q4Y2 3PDYA 2NZ9A 5CNAA 5LA0A 2I6HA 1N1VA 4XFGA 2VPVA 4URTA 4QXBB 2BG9E 2CNAA 4IERA 3O37A 1FMD3 5FO9B 4EN9B 3PDQA 2MEV2 4QH5A 4QX7B 1FATA 2XM1A 2VVNA 2RDRA 4B3MT 1V9U3 3CU7A 3JBG3 1MIYA 2YOEA 4K40A 2W2UA 2DUQA 2CXDA 5C4WC 3O1RA 2VJFA 3O47A 4YZ2A 5CB7A 1EAH3 3I2OA 5HCMA 4MXWB 5TABA 4BBQA 1AR82 4IDPA 1RUG3 2QQLA 4C9ZA 4O4HE 3PUHA 2WO7A 3ILRA 5KR7A 1KJLA 5A3PA 1F5JA 1O59A 3N7MA 3HBZA 3VZLA 5HPOA 4UEMA 5ABJA 1ENQA 2W08A 3BTYA 2QGSA 4XZPA 1WD3A 1W28A 5C11A 4UAPA 5I93A 4GIWA 2KGIA 1VBB2 3BQKA 4PIXA 3IPVA 2JIGA 4MO3M 2X09A 2R30A 3PMSA 1ZOYA 2NR4A 3WZ1A 2JDKA 5A7WB 1WW4A 3OG2A 3CDZB 2BYVE 1RUH2 1UK5A 5J2UE 3WW2A 2CAUA 1UZVA 2UWBA 1RYYA 2QIZA 2VOVA 3ZFFA 4CEYA 5LA1A 3TBDA 3M3IA 3W59A 5CA1E 2AGSA 1VBA1 1J3RA 1YQ8A 4M4RA 5FLHA 1UX5A 4P9LA 4E8CA 5FYHA 4XJZA 3M3QA 4PFOA 4S2DA 3MIFA 4I0UA 4LBJA 4WM8A 4X6QB 3HNYM 2WZR3 4NMIA 3OJAA 3W5NA 3JQXA 1BR4A 1S0DA 2VCAA 5J48A 2D97A 5A1LA 4D3WA 3ESLA 4HOOA 4FQZA 2ADDA 3T3YA 3O5SA 3AA0B 4FPJA 3H8RA 5AC92 4TZDA 4Q5OA 3SLIA 5FY7A 3FHQA 4OUSA 5FMDA 4NIGA 1C1LA 1G9AA 4YFSA 1W0NA 4DMIA 5KXBA 3FUOA 1BBT1 4UYBA 4JGYC 5FXWA 1TMF2 1LENA 3DYMA 3LA2A 3RWNA 4HVRA 3LA7A 3MO4A 2WNVC 5FZ3A 4UFKA 1UMIA 1SPPB 1W6OB 2UUAT 1JZ5A 2ERFA 3PUVF 3AXJB 2C0ZA 3D3AA 4FJOA 2VZRA 3CKDA 3UFGA 1RUE3 5K8SA 3KVBA 3S30A 3A4UA 1X50A 4YW6A 2XGXA 4CU9A 2XZEA 1L7LA 1D2QA 1AX2A 3M4FA 1GWMA 2W62A 1WRDA 1K5MC 5HEOA 4BCUA 3PLQA 5FV3A 4UXAA 1GZCA 1ENSA 4WM7A 1YI9A 2E6SA 2LQ6A 2VBPA 3ZYJB 5LY2A 3TEXA 3RZKA 5CFDC 1OI6A 2XMLA 1EUUA 4UF0A 2AYHA 3WQBA 3RYKA 4HBNA 1W2AX 5EJ3A 2LRKA 4ISTA 4OYUA 2WO3A 4KX6A 4CDQA 5I0UA 3RMYA 1BYHA 4IHJE 1UIKA 3AP6A 3K51A 3KF3A 4IEOA 4WA6A 5KX5E 3K3QC 4COVA 2XQXA 2HWF3 1XNCA 1PVC3 3WG4A 1HRI3 5A33B 4ATFA 4HFCA 3A0NA 4KUMB 4I3PA 2B42B 4Q4X1 4A45A 2Q9QA 3VHLA 2N1GA 2B45X 3USUB 4TTGA 1V6MA 3VR9A 5FY8A 5LGTB 3FJUB 1QNWA 5JLVA 2GSYA 2I0MA 3CLPA 1EYBA 1MZ6A 1DZRA 2V7LA 2YFUA 1BQPA 3WCRA 4NWVA 3PV0F 1H2NA 1S2KA 3AMPA 1ZA4A 4YVWC 2CBJA 2LLYA 1N3OA 1VR3A 2RP4A 2DLRA 3ZTGA