3KV6A

Structure of kiaa1718, human jumonji demethylase, in complex with alpha-ketoglutarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
447
structure length
447
Chain Sequence
PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
molecule keywords JmjC domain-containing histone demethylation protein 1D
total genus 134
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv6A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv6A01
2KU3A 2L80A 1WEVA 3C5KA 4HONA 5A7PA 2EA6A 2QICA 3ZLIA 3KVAA 2UZGA 2JRJA 2KYUA 2MIQA 4B7YC 3O7AA 2L5UA 1HYIA 2KGIA 5FP8A 5FXXA 2AN6A 5LKZA 5EYAF 1Z60A 5A1LA 5FP9A 4YAXA 2Y1NA 3LQIA 5FY0A 4LLBA 4V2VA 4YATA 4V3LC 2HDPA 3L1ZB 2YT5A 3RVHA 5FWJA 2YU4A 2OS2A 2KWNA 3SOUA 3RTRB 5J3XA 2KWKA 2H0DA 2ECNA 2LRIC 3RPGB 2YHOA 2LQ6A 4Q6FA 5FZMA 3N9LA 2GP3A 3C6WA 3PU8A 5F2SA 2YSJA 5F3IA 4QF2A 3AL5A 2CKLB 2OQ6A 3KV5A 5F39A 5FEYA 2P5BA 3UYJA 1VYXA 4LIVA 4YBMA 5FJKA 3MHHA 3VK6A 2XEUA 5DKAA 5IVBA 5FYBA 2M6MA 4N4FA 2MA5A 5FZ1A 4QXHA 4X3GA 5FYHA 4CCJA 2JMIA 5FYCA 2LV9A 1JOCA 3O70A 2M3HA 2YBPA 5FXVA 2ZETC 3O34A 3HCSA 4QF3A 5D1LB 4R7EA 4B86C 5FYSA 1WENA 2WWJA 3EB5A 4YC9A 2LGKA 4A49A 1MM2A 2EODA 2NAAA 2KGGA 4AYCB 4URAA 5FYVA 5K4LA 1U6GB 4GNEA 4S3OB 3KV6A 4YADA 4FIPA 2BAYA 4I7DA 3U78A 4UF0B 2JMJA 5D1KB 4LKAA 2YU1A 4GJYA 3N9OA 2XMLA 3HTKC 4I7BA 5LCWB 2LXHC 3GV4A 3K3NA 1VRBA 4LADB 4GNDA 4YBSA 5B76A 5FXZA 2LGLA 2KFTA 3SHBA 5FZDA 5F5IA 4YBTA 5FPLA 2CKLA 5LKTA 5FZ4A 2K17A 3LQHA 5A7OA 4EZHA 4FK5A 3U5NA 2Y1MA 3KVBA 5FY8A 4BXFA 3U5MA 2KREA 2CT2A 5F5CA 5KH3A 3MHSA 3QZVA 2CSYA 1WEWA 5F3CA 3ZPVE 3N9PA 3PDQA 3T6RA 2KWJA 5FZ7A 3V43A 5A7WA 4W4UA 4CUGA 4IC3A 5IVJA 4XDOA 5A3PA 4LK9A 3N9MA 1LDJB 2WWUA 4Y3OA 5F2WA 4CCNA 4BBQA 2IDAA 4IGPA 4D6SA 3I2DA 4AVXA 3LRQA 2KR4A 3HCUA 2RSDA 1WEMA 2Q8EA 5FZGA 3KV4A 1WE9A 5LY1A 5A3TA 4DO0A 5FZKA 2XUEA 4GB0A 5LKXA 1DVPA 4HOOA 5A1FA 3N9NA 2ECWA 4CCKA 3AL6A 4TKPB 5FZ8A 2YQLA 5FYMA 2YQMA 1VFYA 2VPDA 4CA1A 2YREA 2VP7A 4MSXA 4GAZA 5F32A 3L11A 4QU1A 1WEQA 5FP4A 5FV3A 5A7NA 1X4UA 5H9MA 1V87A 4TN7A 2Q8CA 4BU2A 4GNFA 5I3LA 5IVYA 2ECJA 3SOWA 4XI1A 1MM3A 4NUBA 3U5OA 2GP5A 4UI9B 5G0FA 5FZEA 5FZ9A 1K2FA 2MD8C 5LW9A 3AVSA 4I7CA 5FERA 4S3OC 5A7QA 4CCMA 5H1UA 5FZ6A 5FPUA 5G05B 5FYIA 5FY7A 2K16A 3O33A 1JM7B 3O37A 5AIUA 5FWEA 2OT7A 2FSAA 5FPBA 5FZOA 2VD7A 5IVCA 4D6RA 4UP5A 4A0CD 2CSZA 5TDWA 2XDVA 1WESA 2L75A 2D8SA 4IGQA 1Z2QA 3OPTA 2HYED 2K1JA 3GL6A 2I50A 4D6QA 4PPEA 5C13A 5FB0A 4F52B 2C2LA 2LDRA 4L7XA 4WZ3B 2VPEA 4DIQA 4N3WA 5AITA 3KV9A 2L0BA 2XB1A 3M99A 5B8DA 3ZVYA 4CCLA 5FZOB 3ZPOA 5FZIA 4R8PK 2E6SA 2EGPA 4LXLA 5FY4A 2OQ7A 4AUQB 5F37A 2YSMA 2G6QA 2YBKA 2FUUA 4FJCA 3ZVZB 3U5PA 5FYYA 1F62A 4MVTA 3RPGC 2F42A 2KWOA 3PHDA 3KNVA 5E6HA 3K3OA 4WZ0A 2K4DA 2KIZA 2VPGA 4CCOA 2M1RA 5A80A 3PU3A 1WGMA 3EB6A 2YYRA 2LGVA 2YUCA 1WEPA 5FZ0A 2F6JA 4AAPA 5IWFA 1WILA 2VJEA 1BORA 3DXUA 1LDKC 2Q8DA 2MNZA 5JG6A 5FYZA 5KH7A 5FBJA 5F3GA 4QWNA 3O36A 1RMDA 5LKUA 1Z6UA 3O35A 5TABA 5ISLA 2YURA 2YPDA 5ANQA 3N9QA 2VPBA 3T7LA 4EZ4A 2MD7B 5A3NA 4A4CA 2LGGA 3ZPV1 3DXTA 2VNFA 4CSWA 5FY9A 4XDPA 4NN2A 4GNGA 3ASLA 5IVEA 1HYJA 2L43A 5A3WA 4WA6A 5H1TA 2MUMA 4UP0A 2F6NA 4UF0A 4IGOA 2LN0A 2W2IA 3IHPA 4QX7A 4GJZA 2QJ0A 4WZ2A 5FXWA 5FYUA 4L58A 5FB1A 4O64A 5A7WB 1JM7A 5DINA 2YBSA 3LDBA 4C9ZA 2MT5A 4Y4RA 4YABA 4FO9A 2OXQC 2JMDA 1WEUA 5B75A 5H1VA 1IYMA 1WFKA 1G25A 5KR7A 3OPWA 4R2YA 1WEEA 5FPVA 2PNXA 4LIUA 5IVFA 2PUYA 4ZDTA 5TRBA 4IC2A 5KH9A 2C2VS 2YHNA 5LY2A 3ZNIA 5F3EA 2VJFA 5FP7A 5B79A 3NG2A 5LWBA 3DQVR 3LD8A 5FZ3A 5FZLA 4P5OB 2QIZA 1XWHA 2G43A 4QX8A 4AI9A 2E6RA 3DPLR 3K2OA 5FYTA 4Y33A 5FP3A 3PUQA 5FZFA 5TBNA 3SOXA 4AP4A 3FL2A 1WIMA 2ECGA 2Y43A 3PURA 4ZUXU 2OX0A 2DX8A 5IW0A 4V3KC 2VJFB 2LXPC 4PTBA 4AYCA 2ECVA 5C11A 5TDRA 4CCGX 5D1MB 4LITA 1X4JA 4E4HA 2PXJA 3KQIA 5FUNA 2XXZA 1T1HA 3M62A 5B78A 1X4IA 3U4SA 2RI7A 5B77A 4EYUA 5FZBA 2YU2A 4C8DA 2H0DB 2ECTA 4ZQLA 4GD4A 3ZYQA 2G45A 4QXBA 3PTRB 2M85A 3HCTA 2KE1A 5FZAA 3M63A 1N87A 4A4BA 1E4UA 3LQJA 5FY5A 3NJYA 1FBVA 3PUAA 1CHCA 5FJHA 3AVRA 4QXCA 5FZHA 5CEHA 3PUSA 5FY1A 3ZTGA 5FUPA 1VD4A 5F5AA 5FZCA 5G04B 5A7SA 2MNYA 3L1XA 1WEOA 4LJNA 4BHWA 5FPAA 4BISA 1FP0A 4ASKA 2YW8A 5IVVA 2MA6A 2FUIA 2ECIA 2VJEB 4V2WA 1ZBDB
chains in the Genus database with same CATH superfamily
2VKHA 2WZIA 4V1PA 3VRBA 5L3FB 4JKLA 3CHXA 1ACCA 3WDTA 2VJXA 3KBTA 3HD8B 2ZEYA 2UWBA 2ZGMA 4QWNB 5FXXA 4JI2T 1QJY2 5AFBA 1L7QA 3AEDA 1MBMA 2YU4A 3N36A 2ODUA 1RUI3 5IAVA 2BKNA 2XQRA 3S30A 4IDNA 3E5UA 2RVAA 2EHOD 1W9YA 5FEYA 2XBO1 1FMVA 1B7TA 4QPWA 1VYXA 1GSLA 4L2NA 4M4RA 4ZS2A 1FOD2 4WNKA 4QM9A 4QGLA 4BIOA 1XNCA 5BNPB 4IREA 4COZA 3AZWA 1VP6A 1Z78A 3RLFF 2OA5A 3P3NA 3M2MA 4COYA 1XNDA 4XQWA 1D4M1 4QF3A 2ZZQA 1LOEA 1WENA 1XNTA 4EE2A 4JV4A 4XJ9A 2W92A 2HLEA 3I1AA 2V7JA 5KHIA 5HXMA 1OFNA 4XMAA 4GXLA 2D6NA 4N43A 3E6CC 3VBHC 1BR4A 1IZNB 4YJ2E 1ZRRA 4GZ9A 2VNGA 3SHBA 2R7EB 3IF8B 1UX5A 1PGL2 1HNXT 3CZJA 4NAMA 3FJUB 3USSA 3MUY1 1NA1A 1IG0A 2VUJA 4YXDA 5JLVA 2LTNA 4WBNE 3AEAA 2GNDA 5DUUA 1SMVA 2CV6A 3DKQA 2HEYF 3V5SA 4CDXC 1UOBA 1H9PA 5L19A 2JJ6A 4CP2A 2RE9A 4EYYR 4BBQA 1S4CA 4XJ8A 4LBLA 1JYTA 4PFOA 3O1SA 4MO3M 5DZGA 4BDVB 2WO2A 2CWMA 1DVPA 2HWB2 4MXVA 5LASA 3D4KA 3NV4A 5BUVA 4CA1A 1JHNA 1WEQA 3ONLC 5A7NA 1J3QA 1YIPA 2P17A 1YC61 4GNFA 3KHCA 1YLLA 4ISQA 1QJX3 2JENA 4LR4A 5D8AA 4DEQA 3ZFGB 1GR3A 4ITCA 1JZ5A 3T0AA 4AQ6A 3ME2A 1X7NA 2FSAA 4OGCA 2VKJA 1DQ1A 1MZ5A 2BPA2 5C3JA 1OF3A 4CCCA 1UN1A 4RS5C 2E33A 3BALA 2B9VA 3POIA 4D0QA 2DCJA 3RRDA 1Z2QA 3LEKA 1PO12 2FJDA 2OKXA 3A0KA 2A75A 3T1YT 3RFRA 4DIQA 2HH9A 3WLUA 4RYDA 1GOHA 5JVDE 4R8PK 3WSOA 2E61A 2AR6A 4IHJE 2XQ9A 4LKDA 3PIGA 2W2UA 1ZREA 5JDQA 1UZVA 5E6HA 1UY3A 4CCOA 2M1RA 3B5LB 4RHV1 4LOTA 4PJMA 1PIV3 2E26A 5IWFA 3IIAA 2DVBA 1HJGA 3WG1A 2IHR1 3ACIA 1QJU2 4JYAT 3A4UA 3RMYA 2KR2A 2MNZA 3WNPA 3H1YA 3O36A 3AZYA 2IIUA 4EXTA 5TABA 5ISLA 3VDAA 5K0UA 2ES0A 2VPBA 4O62A 3VL8A 4MFRA 4G9SB 2WIIB 4A4CA 2VNFA 1GOGA 4CSWA 3RSJA 4GWMA 3WNXA 5LNKA 2E31A 4DBRA 5L4HA 2XPJA 3UUNA 1DQ6A 4COVA 2QVAA 1REFA 2MPFA 3BQIA 4GJZA 3BOWA 1WMXA 3JAEA 1YNAA 1NOVA 3NNJA 5A6ZA 3WNKA 2V6XA 4OMCA 1NY72 3L2HA 4META 3S7IA 4JGZB 1RUD2 1HNZT 2YXSA 3MHZA 1IYMA 3J8F2 1XNRT 2ZX2A 1CZVA 2H0BA 5FPVA 4LMFA 4XILA 2PNXA 4NPRA 2IWGB 5BY5A 4M3CE 5LY2A 3PIJA 1BR2A 5TAOA 5LWBA 3MFCA 3ZX7A 4M01A 2UXCT 2E6RA 3ZXEA 4D94A 3MEPA 4BQ2A 5CFDB 1MIWA 5AQJB 2C24A 2L9QA 4UVBB 3WG3A 1UYZA 3OYXA 1RXFA 2N2NA 2OUHA 4ES8A 4Z2WA 4HTEA 1AR61 3I2IA 5A3OA 4FOWA 4CN6A 2YGLA 3ZYGA 5JDFA 1S0GA 4XZUG 5B77A 5FZBA 3ZFEA 2ECTA 4DINB 2PAEA 1NENA 4GOUA 5AQFB 5FJHA 4QXCA 1G9CA 2WP9A 2VW1A 1WA4A 3FZMB 4C0HA 2Y0IA 1JZ8A 1FXZA 2R6GF 2LAUA 4B7KA 2W1WA 5ABGA 3Q8EA 3O1JA 1W8FA 2RJLA 3PHMA 2MIQA 3O7AA 4CRQA 2AN6A 5LKZA 2XQXA 2B4KA 3ZMSB 1KDMA 3T2QA 3AKRA 4EV6A 2P3KA 3O9XA 2O8OA 1DYOA 4DUVA 2FCUA 3PJAJ 3RC8A 4FPHA 3GBWA 3D3AA 4X6RB 3ZCJA 1N1YA 3VKOA 1FATA 5LA2A 2AH2A 1PO22 2AREA 3H1MA 3CIRA 1OEDE 3AP4A 4MX3A 4QQHA 1DF0A 1B35A 4AI6A 2LS6A 1I6ZA 3UYJA 3ZN6A 1LULA 5DKAA 2QQVA 1ZRDA 2D44A 1NYWA 3TOJA 4XXPA 3O70A 2OPKA 1XYPA 2YG0A 2M3HA 3MLJA 3WDYA 5CA6A 5DQVA 2VMDA 1GV9A 4I0BA 2VNRA 2AZ5A 2P3IA 4Q0UA 1W90A 4F7ZA 2VOKA 2BVBA 4Y1XA 2EODA 5H9QA 5FYVA 3ETPA 1HQWA 1UU4A 2RV9A 2CCQA 3POFA 3N9OA 1BBT2 4KX6A 2VH9A 4I7BA 5LCWB 3IDBB 4EWEA 5FO9B 2QKDA 2EAAA 4YBTA 5LZ6A 4BQ4A 5A7OA 4PF1A 4YTMA 4CDWA 3AE4A 3IZOA 4Q1RA 5AQKB 4PBPA 4CQIA 3DGTA 1X79A 3T6RA 4NVPA 1CPNA 1Q8VA 4KNCA 2ZGKA 4R9BA 2P9BA 3AKPA 3I2DA 3GJAA 3WDVA 3OG2A 1CAXA 1VBA2 1VRH1 4FFFA 2J42A 5LY1A 1RUG2 1DBNA 4GULA 4P9WA 4RHV2 1XXNA 5LKXA 1GZTA 1WW7A 3KGLA 2YQMA 3IIIA 4INDA 3ZXKA 5C7GA 2XKOA 1M7KA 4WBOA 5FV3A 3WQ7A 3MF9A 5H9MA 1ULDA 5JZGC 3GWHA 2ECJA 5JR7B 4XI1A 4F1PA 1UQXA 2E9XA 2WM9A 3VBRB 4D8MA 3UQ4A 1POV0 3G7DA 3TN91 1YJLA 4DIDB 2VZUA 2OT7A 4D6RA 4QX3A 1OLQA 1OEDB 3C7EA 4YW5A 4XE9A 1EAH1 5TDWA 4ZI2C 1W0PA 3CBNA 2XAQB 3ZR6A 4CYDA 1D0YA 1GUIA 3VBOB 1B35C 4LMJA 1RUC2 4GKJT 2XB6C 1IBLT 1XSQA 3PMSA 2I6HA 4LXLA 3N2KE 2OQ7A 2Z5WA 4NPPA 3TNQA 3OKQA 4LBQD 5LOVE 2B76A 1KK7A 1ENRA 4QQPA 4NN0A 4DR3T 1MEC1 3J7MA 1VMJA 2YUCA 3FXDB 1QJFA 3QOPA 3P4RA 4MUVA 3HVDA 2YYOA 2UY9A 2H89A 3OSDA 4DNYA 4Y24A 3CVRA 3BTZA 3J4UH 3SHRA 3NO8A 2MD7B 1H4GA 3TEXA 3LEGA 5FFOC 2GZWA 1W9SA 4HFEA 3VBHB 2PHXA 2Y0OA 4M3CF 3TAYA 3VD9A 1GQGA 4FTEA 5A3WA 3Q9OA 4RQPA 1MIVA 2W1SA 1COV3 1ND2C 2X5IB 4IV3B 3IHPA 2QJ0A 1OWAA 4HVRA 2BBJA 5A33A 2AENA 3K51A 1R1ZA 5A6YA 2X0HA 1A34A 4FQ4A 2WMNA 1PO11 4LBQA 4OFZA 3S4UA 4FO9A 2DHRA 1W6NB 5JPMB 4FPGA 1ZHCA 2LRLA 5H1VA 3ASIA 2QCSB 1W9TA 1VPHA 2C0ZA 4HBNA 4M3CB 4HPKA 1NQDA 2DVGA 4KH9A 3AMMA 4B3RT 2W95A 1XWHA 3NWKA 4C1WA 3KB5A 2A6XA 1IQDC 4OLLA 1MS5A 1WMEA 3NVOA 3ZXLA 2UWCA 1BJQA 2QA7A 4Q4X2 4I0WB 1V9U1 4MXWA 1BEV3 4YFZA 3U4SA 2ZMLA 4DV1T 1ENQA 4DR1T 2XHNA 2A6VA 3WNOA 5IFPA 5C3QA 4Q4W1 3WCSA 1HRI3 1CAVB 1V6OA 2DWKA 3ZN6B 5IAXA 2HWE1 4QPYA 1QJY1 5CNAA 1T6GC 2DI4A 2CM0A 1X9BA 2VQTA 3VHRA 4TWDA 3M8LA 2LT3A 4CP0A 1BMV2 3WF3A 2DUOA 2BG9B 4IQPA 4PT6A 3LQIA 3UU5A 3F31A 3RVHA 4RA0A 1RUI1 3W15B 3BU0A 3I3MA 2HWD2 2W1UA 4B4RA 4Q6FA 2G9GA 4PDWB 1ZA7A 4G3YC 4QHZA 2YSJA 4CU9A 4AG4A 5F3IA 3O0XA 3NRXA 1HXS2 4Z8BA 3FBMA 4UXAA 2PMWB 4QXHA 4M0HA 5FYHA 4BMBA 5FKBA 2EF6A 2JMIA 4H9PC 4PK4A 2A70A 1HJFA 2HWD1 5A32B 1Z7S2 4I55E 5A33B 1XE7A 2NAAA 4E8DA 4B1MA 2ZGNA 4LFBT 5D1KB 3FLRA 2NP9A 4XACA 4JUYA 2TEPA 4CU8A 4LADB 4YTNA 4K7JA 2PTMA 1ZBE1 3VV1A 3MDBC 3KDSE 2CHOA 1W6PB 3P1IA 4JI6T 1DHKB 1PGSA 4YGDA 5EJZB 2VXRA 3V0AB 5BYNA 4I3PA 1IS3A 2FDJA 1UW8A 4EROA 2QQJA 3FZHB 5BNNC 2IXKA 2PHRA 2WYFA 4QB6A 2R6QA 2E63A 5LK5A 3H8RA 4CUGA 2M67A 5BNOC 1LNSA 3LPGA 2HEVF 4Q4X3 2XVLA 5F2WA 4S2HA 4F8AA 1E5IA 3LRQA 1FV3A 3HCUA 5CB4E 3KV4A 4SBVA 4IEWA 4ASLA 4MGSA 1WE9A 4GALA 1W06A 1RMU2 3M3QA 4P09A 1AL23 2QYWA 4XYXA 4IE7A 2WT0A 3DPRB 5A1FA 5T5OA 3R84B 3C4XA 4XEZA 2B42B 3KCYA 4NJ4A 1AR91 2WAUA 4K1ZA 5L36A 1UOFA 3UGGA 2AE9A 4ANJA 4MLKA 2XBO2 2Q8CA 3RZZA 4LOSA 5IWAT 1N32T 2D2SA 4GH4C 4QXBB 1C8M2 3P8CD 1F15A 2MAWA 4YTPA 1VBC2 3MI8A 3LA7A 2EALA 5H1UA 5FPUA 1CAWA 1SBEA 3T3YA 2FZ1A 2P1BA 3H7HA 2YROA 2TBVA 1OHFA 1JOBA 4L99A 4AFDA 3HQXA 1RITA 4A6SA 2PAMA 4D6QA 3C7FA 2QQKA 4YPJA 4WZ3B 5KXJA 3U75A 3ZJ2A 3PVNA 1SPPA 3JZVA 1TME2 3M99A 1GQEA 1UF2C 1OA2A 3T08A 4XIKA 2OZ6A 2FD8A 3Q1DA 5FREA 1RUJ3 2PQSA 2Q9QB 5FQ0A 3Q8FA 4XHXA 4P14A 1ZP0A 3TRSB 3AXDA 4QU2A 3UUXB 3W5MA 5LBQB 2W46A 1W8NA 4GYSA 5L9VA 5IUQA 2V73A 1NZCA 1Z6UA 1UZWA 5A3LA 2VCBA 4YW3A 3B13A 3N5LA 4EZ4A 4GMP0 4EV0A 3IDAA 4MALA 4NIQA 2F4LA 3U10A 4NAOA 5LA0A 4NN2A 1OOPB 3AMQA 3TN93 1VOMA 4KMCA 2F6NA 3WP4A 2LN0A 5JXGA 4WM8A 5A6XA 3E5QA 5FB1A 3ZYMA 4CDQA 1UMHA 3FEHA 4Q0QA 1RTVA 3PUZF 2C0SA 1TMF3 2LKGA 2B5HA 3ZM8A 2QQLA 2X9YA 3LZZA 3CMLA 4BJNA 4JI4T 2ZX3A 3LSDA 2UXXB 1X8MA 3NZQA 2R072 2VCCA 3S6PA 2HWE3 4CE8A 1JH5A 4AVCA 2R30A 3O1IA 5HCHA 1W8UA 3DWDA 1NEKA 4I50E 5FYTA 5FP3A 2D43A 2ECGA 2BBHA 3DCQA 1CVNA 3ALQA 1RVF1 1WGPA 4AYCA 3ATGA 4GYRA 1AYN1 1QQP1 3MF6A 4ORFA 3FUQA 1XYNA 3LFMA 1RUJ2 4QXBA 2ZHMA 2DTYA 2VNOA 3VD7A 2KE1A 3ZPYA 1TNFA 2C1FA 5FK7A 5JCTA 2BKPA 1R8IA 3ZXFA 3CJXA 1CGPA 3E1F1 3UT0A 5JDGA 3MBWA 5B4NA 1US7B 2HYKA 4H2AA 2V6YB 3OY8A 4EWAA 4WZFA 4RR3A 1YFXA 2VJEB 5EFUA 3IT8A 3JBG3 1Y7BA 5KXDA 2EA6A 1E5HA 3KVAA 2ZEXA 4JI5T 1UUSA 2IC6A 3PUVF 4NWWA 1FJGT 5KXCA 5EYAF 5FP9A 3OUHA 1Q43A 4LLBA 4YATA 4ZEYA 2I45A 5GLUA 4JGYC 1J1JA 4K0KT 2ZM8A 3SOUA 4FI5A 1H2KA 2KWKA 1H6XA 4JI0T 5ABJC 4GIWA 5HEUA 2KWHA 4HK8A 3RYRA 4Q4W2 3N7LA 2IDOB 3UU8A 2GNMA 1O3QA 3RI5A 5JMOA 2M6MA 2PHDA 2MA5A 4N4FA 1K12A 2QQOA 4YNIA 2Y6LA 3Q2MA 1WLWA 1PGW1 3VRAA 4QDRA 1SEFA 4O7XA 3TYJA 1XNQT 3E22E 3SCGA 1YHFA 4BK5A 3EB5A 3ETVA 2ZEZA 3DYPA 2FD4A 2NTXA 1LHOA 3RH3A 5CIRA 5DG1A 4FIPA 2JMJA 4DUXA 1PVC1 5K0UC 1BK1A 5FVLA 4QX5A 2W52A 1HQLA 4GNDA 3P4SA 4MGKE 2LGLA 3B94A 3PVOA 2ZJCA 1W03A 5FZDA 5LKTA 2AACA 3LA3A 5LHIB 1ODMA 5CFDC 5IK7A 3LK2B 4F6RC 3M3IA 2BRTA 3WV6A 5JOXA 3MHSA 3B02A 1RUE2 3IB3A 1KXGA 4D7SA 4Q4Y1 1WBFA 2VZQA 1WCSA 2MEV1 4OI2A 2P37A 5LMUT 2UY8A 1HTJF 4COFA 5HBAA 2X5IA 5JDBA 2X9XA 4D6SA 4K20A 1PK6B 5TSWA 1AJKA 4B3NA 4PCRA 1REDA 4R4XA 2Q1FA 1GNYA 5FZKA 1Q56A 4Q4Y2 3MLKA 2NP0A 5ACA3 3I49A 1RL3A 4AQYT 1R081 4YLHA 3DV8A 5FYMA 4B8EA 4DY3A 1POQA 3O12A 3PVEA 2YDQA 1WWYA 3L11A 3QUJA 1PNGA 2B45X 3HNYM 3ZC0A 2ZX4A 1N1TA 4DR7T 3SOWA 4PJLA 2A6WA 4XJAA 3L8RA 2RR12 5GLWA 3AVSA 2IQJA 2JEMA 2JXAA 4MBQA 1SLBA 5FERA 2B0OE 1F2NA 4AXOA 3O37A 5AIUA 4LUKA 5AQIB 1WYBA 1XWMA 3ZYJB 4O2BE 5KXBA 3J9X1 4YG3A 2FCTA 1YXRA 3QNUA 3RF1A 4GK5E 2CSZA 4A0CD 1CUNA 1LOCA 2HYED 4UYBA 2I50A 1OOPA 3ZIXA 3P3PA 4ZZ8A 4DV0T 2JD4A 3OGVA 5B8DA 1QOSA 5C3OA 2WBKA 5FZOB 3AAIA 2NPIA 2W00A 1AR92 3DTOA 1XE8A 1BR1A 2UXBT 2DU1A 4FVVA 2BG9C 1F62A 1ZEEA 1LGBA 3T09A 2D6MA 5DMYA 5LATA 2JG8A 4RS5B 2AEZA 2RS32 4EN9B 1VAVA 4ASMB 5LCYA 2I74A 3B01A 2J47A 5HCBA 2BGPA 3IPVB 3ORJA 4DVDA 2XWJB 2MOZA 4PIYA 5HAXA 2WN3A 2WQYA 1H8TA 4M00A 1UO9A 3WINE 4HEAA 1QDCA 2WFPA 4LEJA 1MVQA 1OVPA 3K48A 1OA4A 5I0UA 5EQUA 4Z92B 4IE6A 5CZKA 4ATEA 1AL0G 4FPLA 1WLTA 2XOCA 3JXSA 4O4LE 4TTGA 1RUE3 1ULPA 2YBSA 1SE7A 3CO2A 5LRRA 4B3MT 4RQPC 3H8XA 4CPBD 1G25A 4JDNA 4HFIA 4BWOA 1W9WA 2QQMA 2PUYA 3EHZA 3RNSA 1QJU1 2W5FA 5F3EA 2VJFA 5HWXA 4P9LA 5FZ3A 2VZOA 5BR8T 4BIFA 4NIGA 3A7QA 1STMA 4U3CA 1RUH1 4EN0A 1FAYA 3NRUA 4NOTA 1SHZC 2Q1MA 3SS1A 2RDRA 1RIRA 4NHYA 5I8SA 3URFA 3AMPA 2XJQA 4ARYA 4TX5A 1UAIA 5FLJA 4CDXA 1CAWB 2IFWA 2LALA 2PQQA 5JI9A 4QGMA 1W0NA 3MIHA 3L39A 1AR81 4MSVA 4A4AA 2G45A 3FUOA 3AE9A 4IEYA 3NJYA 5FZHA 3AVRA 2MHFA 4QX1A 1PZ9A 3PUSA 3ZSMA 4BCUA 2IC9A 5FUPA 1VD4A 1F9KA 4YG6A 4OYKA 4PLNA 5J48A 2A71A 4XFGA 1N34T 2XR4A 1MMGA 2VMGA 2PYTA 2IXCA 2ZGTA 1FMD3 2RA1A 1OH4A 1RUC1 3Q8CA 1KJRA 3VKLA 2JDPA 3J8F3 2L5UA 3SFDA 4HKOA 1H0BA 5CFCB 4JHTA 3EYPA 3ZMNA 2BG9A 3DDTA 5FOBB 5T5LA 2ZPXA 1AR62 4UELA 3H3LA 3OBRA 2J1RA 3RTRB 5E16A 2W63A 2WNVA 4CEYB 1ZRIA 2HWB3 3C6WA 4QKBA 1R082 3AB3B 4YW1A 2QTWB 3OBTA 3VUOA 4GQ7A 2HN1A 5T3NA 3EDUA 5FJKA 2KXLA 1U5XA 4LHKA 1WCKA 5F9TA 4UVAB 4IT4A 1V6MA 1POV3 1YQ8A 4XBNA 2VTXJ 2WS92 4K40A 4TYSA 1S2EA 5EPAA 1BQPA 2ZACA 2HBUA 1QLBA 1J3RA 4IL7A 1X33A 3I2HA 3KDEC 4WYVA 4W8JA 4XHBA 4A49A 3T4VA 3UFEA 3H1WA 2VL8A 1R64A 2OIIA 3WZ1A 5L9RA 5KHJA 3CLPA 3TEWA 4ZZ5A 2YU1A 3HTKC 3LDQB 2WS91 1N36T 2UURA 4FAHA 4YG0A 1TNRA 2W87A 1JHJA 4BXSV 3SH5A 3VZJA 2CA5A 5D21A 3LOBA 5FMNA 2A9UA 4LA3A 1W3XA 4CA9A 1N3QA 4AF9A 1KS4A 2RS11 2Y1MA 3AEFA 3SC7X 4TXWA 5JRCB 4QQ2A 1O5LA 2BUKA 5ETWA 5I93A 4WZXA 3AECA 1PO23 5IHYA 5IVJA 4UFLA 3J8F1 4XF4A 1NUKA 4RN5A 1US3A 4AGVA 1YQ4A 2RSDA 5FZGA 3IAQA 2JG9B 1LGCA 4UV8B 3AAAB 2DCKA 3U07A 1IJ5A 4GH4A 1ZZCA 5AQVB 4HOOA 3N9NA 3ZFEB 2XHEB 1HRV2 3LDRA 2DV9A 1MQTC 2RMU1 2JQQA 1BXHA 1KRIA 5GALA 1DYPA 1L7LA 3DKWA 3HMYA 2YEVC 2WFF3 1VBC3 2MD8C 4HE8A 2L8KA 3IMMA 4LPLA 3AZZA 1FV2A 2E8IA 4CDQB 2XP0A 4PJNA 2CBIA 1W05A 2Q4SA 4XDQA 2BYVE 4UP5A 2C26A 2QZ2A 1UPSA 3IDEA 5K7PA 2XKPA 1IG3A 1HCIA 4CDUB 2WKKA 4PPEA 5FB0A 5KHHA 4CXWA 2KD7A 3ACFA 5AQNB 2VPEA 2ERFA 1KNPA 4ISSA 5E8AA 5JDMA 3ZYBA 4DXSA 2HHHT 5D1IA 2R1DA 1VIWB 1S0FA 1H2MA 2VBDA 4IE0A 1R1A1 1XYOA 5L73A 3CWZB 4ZHNA 3CKDA 3CDZB 2YYRA 3T4HB 4FFHA 3O0WA 1W04A 3AB0A 4NXMT 3AEGA 5C3SA 1AYN3 2Y60A 2X8KA 3POWA 2W39A 3RQ0A 3ITQA 3HKBE 3I2JA 2R042 3NV3A 1NQJA 2OVUA 2LM9A 2YURA 2YPDA 5ANQA 3WF4A 2DFBA 2ACZA 1KFUL 4XFFA 2WZHA 2XAHB 3WUDA 5A3NA 1H8VA 3ZPV1 3FBZA 4I09A 4CDQC 1U4QA 1QMJA 3FHQA 3L2YA 4LO4B 4XCAA 1XSRA 1OD5A 3GN5B 1CJPA 2PA7A 4O4IE 4IEZA 4O9GA 4EOZB 5FKYA 3KLSA 5KR7A 3OPWA 3KS7A 1ENSA 5HV4A 2YC0A 1PM7A 5TRBA 4IC2A 5HI0A 1Y9QA 3POBA 4AI2A 4IV1A 2YOEA 3BOPA 3LBXB 3ZN5A 2Y8KA 4EN7B 2D5FA 1S1AA 2WINB 5ABHA 2P6HA 5ANNA 1I3HA 2ZHNA 4AI9A 5FZFA 4OHYA 3VHLA 2YDEA 4XJUA 5ABJB 4AI3A 2Y43A 2WL1A 4TNVA 4NIHA 2VJFB 2LXPC 2Y38A 3WD5A 5FNVE 1VBD3 2ECVA 3LFIA 5C11A 3LCPA 2JDMA 1CPMA 1UMZA 3OUJA 2PXJA 4EAHA 1N3OA 2QUOA 4ZXLA 3R4SA 4UOJA 2RS52 1HV1A 2RI7A 3IKWA 2E5LT 3V64A 1OEDC 5HPOA 3VDDB 2K5BB 1UD1A 5LCWL 5FO7B 1L7RA 4UFJA 3PNAA 5LBBA 3B7MA 2B8MA 2EXIA 2O0OA 5F5AA 3V5UA 4BQYA 4AEMA 5G04B 3C4WA 3TKLB 2W91A 1EUUA 3N7KA 4W65A 1ULFA 2RS12 5IVVA 1ODNA 1WD3A 3JBG2 1POV1 1K5JA 3BK9A 1VBB1 1NCQA 2KYUA 3UQ7A 3ZSSA 3N4MA 2MBGA 1JZ6A 3KFWX 4QAWA 2X10A 4HWDA 3UGHA 1SDWA 4LO6B 1CIWA 4HFCA 2QNKA 3UULA 4CP9B 4N9HA 1SBFA 1J59A 3BTYA 3ZT7A 2LQ6A 2V5DA 4Q4W3 3VB9A 2OQ6A 2P5BA 3DEMA 4IDOA 3MHHA 1P8JA 2XEUA 2G4IA 3O1VA 1WD4A 4Q26A 4RD7A 5JXIA 2VL4A 4UVCB 3J7NA 2VKDA 4XAAA 1RUH2 1WCRA 1W6QB 1DGLA 2FJBA 1V6IA 4Y20A 1A8DA 2W4XA 3I9YA 2PAKA 1KFXL 4MXWB 1ZX5A 4YC9A 1LHNA 4XOGA 2LEHA 2RJ2A 2VKOA 4UF0B 1GOFA 4Q0PA 3BB6A 3ELNA 3ANWB 2RS53 4Z90A 2YVRA 4GH4B 1D2SA 1SZBA 4R52A 1IS6A 3P4PA 3A7MA 2NW8A 3MIDA 1XMQT 5HCMA 1KGYA 5FZ4A 3LQHA 4WV8A 4XTMA 3DECA 3I97A 3D0TA 4P5HA 5EK2A 3GGLA 4P9IA 2ZZJA 3MJXA 3MLLA 3Q5WA 2GMPA 1S94A 3ZN1B 3AA7B 1WEWA 3Q8AA 4LBMA 3GYDA 3P7IA 1RVF2 2Q0AA 2JIWA 1TME3 4YM1A 1QXPA 4GIQA 4LK9A 4Y3OA 1NA1C 4HKAA 5GONE 3I2GA 3GHNA 4U33A 2M6IA 3CJIC 3H9AA 3NNGA 4HSLA 1RUG3 4YVWB 2F4VT 1APNA 1H2NA 1XNAA 4OQ9A 3LGRA 5FMCA 3H3UA 4H9NC 2XPKA 3O47A 1Z7S3 3HNBM 4UBHA 1IS5A 5F32A 5CA0E 2D3SA 4FPFA 2VC9A 2E5VA 5JZGB 4JAAA 1F35A 5JXHA 4HLTA 5FUIA 4TNWA 1ST8A 4K8FA 5FZ6A 1SBDA 4U36A 1GZ9A 1G8XA 3NAPB 2VD7A 1V6NA 2K2SA 4COUA 4BJ0A 2UUBT 1J5ET 1QXJA 2QRXA 4QPIB 2FDFA 4JX0A 1TMF2 3T1HT 4N78D 3RIUA 1V6KA 4CCLA 3ZPOA 5DUWA 2EGPA 5H9SA 1AR93 2G6QA 2FUUA 2IW5B 3G6JB 1NY71 1K3IA 5FYYA 3MV11 4IEUA 1RUH3 2VVSA 1YYNA 3PJYA 1WGMA 1RUE1 3FN9A 1PMJX 5FL0A 1IHMA 4YZ1A 5AQUB 4WM7B 3L3PA 1TG7A 3O35A 3ES1A 2W68A 1DP0A 1OKQA 5HEOA 3APBA 2J1VA 2LRKA 1RUG1 2P34A 1VBB3 4P0AA 1IJ6A 1JYNA 4A6OA 4UP0A 4H14A 2C9KA 1UKRA 2XLGA 3RJRA 4QDSA 1ZBA3 3LEIA 3HT1A 3RZGA 3QB5A 4O64A 4JBWF 4ERRA 5LEJA 3RPUA 4L97A 1KJLA 2BNNA 5C9AA 4Y4RA 1JZ2A 2WSVA 3MIEA 5JQGE 3UJQA 5JI7A 4E4SA 3AYEA 2QQUA 4NUVA 1UX4A 2E7TA 2JKXA 1ZBE3 1T98A 1HN0A 2GC0A 2VVDA 5FP7A 5SV8A 1U0AA 2IUBA 1GZCA 3RIAA 1VALA 2NR4A 4GA9A 5LBCA 1VBE2 3HR9A 3AZVA 1N1VA 3SOXA 4QX8B 2E32A 1YW0A 4AEJA 3JC6C 4P9YA 3OF1A 3RI8A 5J98B 1LOBA 4YW4A 3KQIA 2XXZA 2A3YA 4BQWA 1BEV2 1Z0HA 5D8AC 1HB1A 4C8DA 3OD0A 2E9XB 5EWSA 2Q1ZB 2ILMA 3UGFA 3BIWE 5FY5A 1JUHA 5CVRA 3A23A 2A3WA 2Z79A 2HWB1 2SPCA 3USUA 1T6BX 2R041 3CQOA 2XAJB 3L1XA 2J62A 1Z8UA 1ULGA 5EJ3A 4ASKA 3HWJA 1DGRN 4DUYT 4DEVA 3F2EA 3WF2A 1G73A 2XQAA 4QHBA 1G9BA 1HRI1 4KWJA 4RGAA 4YSYA 3I2OA 4W50A 1NA1B 1QJY3 3OYZA 5H9RA 2Q8OA 2PTFA 1QUUA 5FY0A 3CKHA 3TLVA 1ND3A 2O1QA 2VZRA 2PBIA 3WW4A 3RGBA 3N9LA 2VQAA 1Y43B 3FHAA 2OZJA 2RDNA 2ZAAA 1LB2A 3VR9A 4K3UA 3O5SA 3ON7A 3TEYA 4PK6A 3OTFA 3P4WA 1B35B 2FMDA 4JKKA 1C8M3 2YC4A 4TSVA 4ET7A 2XJ7A 4LTAA 2ZETC 3FANA 1DYKA 5AQLB 1EY2A 3LJUX 1Y4WA 3Q5XA 1SLAA 4HFSA 1YFUA 4A7KA 1CWPA 1R091 4YYOA 3ZXAC 3UESA 4URAA 4GNEA 4GB33 3H8OA 2I2SA 2W0XA 5L3BB 3U78A 1DQ4A 5CFDA 1OPMA 4P0BA 4U2ZA 4HN1A 3M3EA 3ZKYA 3FE5A 5L7OB 1MNDA 3NJZA 1JODA 2P2KA 3MO4A 4HPKB 5FXZA 3OY8B 3SH4A 1T2XA 5F5IA 1Y3TA 4N9IA 2K17A 4YZ5A 1JU3A 4BXFA 5DUVA 4CCEA 3OGSA 4N43C 3VKMA 2NW9A 3ZPVE 3VZKA 2KWJA 2GU9A 1PZ7A 1YRZA 2E7QA 1KF6A 2A7AA 4I2OA 1QY4A 3VHOA 1YQCA 1A78A 4KP3C 2HWE2 1WUVA 3O14A 1E1HB 1WYCA 3VKHA 3AYDA 1K42A 4IESA 2EGMA 1J83A 5IATA 4LUMA 4MLOA 1D7PM 1AYM2 2L3LA 4GAZA 2VOXA 4JI8T 3C7OA 3QB5K 4XFCA 1WLXA 4EN6B 2ZMNA 5JDHA 2ZA9A 4XTPA 3QK6A 3PE0A 3IAPA 3U5OA 4WZCA 5G0FA 4IE5A 4DV2T 4I7CA 2NLRA 3K4AA 4MH0E 3AE1A 4OMDA 3GZTB 2QJVA 1OOPC 5FYIA 2JJ9A 2J4GA 3F2ZA 2CRBA 3W5NA 2BW8A 2D98A 4JC1A 4FBFA 4A45A 4EN8B 4YZ3A 2XDVA 1M06G 1O3TA 2VQFT 1G86A 2D8SA 5IHRA 3PJAA 4HWCA 2ZX1A 4RFRB 2K1JA 3HN3A 5C13A 4AEDA 3NKGA 3I2KA 3OGJA 2JD9A 3VL9A 4AQFA 5J0ZA 1XBFA 3BU7A 5A70A 5AVPA 1QJZA 4AUQB 4BYYA 3IWZA 4FJCA 1T7SA 5LBMA 1FI2A 5KHGA 1MNEA 1MZFA 4LE4A 3NZPA 3WI3A 3INAA 3GALA 4AQTA 2RHPA 1Z0PA 2KIZA 3ZKUA 4LE3A 2ZHLA 2XH6A 4KG0A 4ZZBA 2BS3A 1QU0A 2DUQA 3MZHA 2M13A 2RM21 1O3SA 1BHGA 1XPWA 1LESA 1SUMB 2R043 1NE4A 1FIOA 4FFGA 4ZI2D 3SKJE 3S7EA 3GMIA 4K6BA 1Y9MA 1OURA 4XF0A 5L47A 1XOYA 2UU8A 4IDZA 4XDPA 4O9EA 2BJSA 2OA2A 4MGQA 4OGEA 3LA2A 4XUNA 3WQ0A 5JSRA 3H42B 4PNIA 4QQ4A 5I0TA 3VD5A 3I9WA 2GNBA 4YFSA 2WDBA 5JREA 4JTNA 2E51A 5F3JA 2CL2A 2DL1A 3NG2A 4NHMA 4P5OB 1BBT1 5J2UE 1JNZA 1TMF1 2DFCA 4QX0A 3DPRA 3A21A 4CDUA 1HR0T 4PW8A 2KMFA 4PI2A 2XM1A 2XWBB 4KHPT 2FDHA 4DMWA 4QX2A 3PURA 2VK9A 4DV7T 2DX8A 1OEDA 2RMU2 3VBSC 2VW2A 2V09A 2DWRA 1O4YA 4QX7B 3NL1A 2JRKA 1VBA1 2WRAA 2LW8A 5L3EB 2YU2A 3JAFA 2VVEA 4LBQB 3I3DA 2M85A 4H63H 3M63A 1Q3EA 4A4BA 3RKOA 3LQJA 5H6QB 3ZYFA 3VLBB 2JE8A 4MHCA 2RDSA 5AQTB 2ARCA 3W20A 2ZAHA 3VZNA 2JB8A 2XAFB 2VZ3A 3OGGA 4NHLA 2MNYA 5L3CB 1CJDA 4H9SE 4BPZA 1FP0A 4CVUA 3ZO0B 2VQ0A 5DXDA 2XJTA 2LSJA 1MR5A 2VOTA 2NYYA 2XJVA 3AJZA 4M1PA 4XABA 5C4WC 4B7YC 1MMNA 4XMIA 5IYZE 4HN0A 3E5XA 2FJAA 3EDVA 4X1KE 3RYFE 2VO5A 3V0AA 2VCMA 1I5ZA 4L0PA 5FWJA 4GWIA 4NPLA 2OYZA 1UZ0A 3T1MA 4HGAA 2LRIC 1SA0E 1AR82 5FZMA 4PDWC 4XQ4A 2D6KA 3JADA 1LKNA 5LBEA 1ND3C 3OYWB 2XHKA 2KZ7B 1H2LA 4X65T 4YBMA 2B1EA 5FYBA 2E2AA 1OLMA 3NMBA 2DCYA 1EV11 3VBFB 1S0DA 2RR11 2AC1A 1IGOA 1JOCA 4DXTA 4CI2B 2XJRA 3ZYPA 2BBVA 1BVP1 2YINA 5JIAA 3ZMZB 3O34A 3OBAA 4BQXA 4IEVA 3BCWA 4HXCA 2Y26A 4WM8C 4A3XA 2KKXA 4TN7B 1YXWA 3HN1A 4XIOA 2DLRA 2AEYA 4XZPA 1FMD2 1W8OA 2LROA 4CDWC 2RS51 4WVVA 3IMNA 1VRBA 3UK9A 4CXXA 3ZVXA 2KT9A 4QHOA 5HWYA 2R071 3CF6E 2KFTA 1AR73 5DAQA 2BBAA 1IKPA 2OWAA 4AIUA 2VASA 2WU5A 3U5NA 4JCKA 4UW4A 3CQGB 1H4HA 1MEC2 3QZVA 5DPNA 2V7MA 5DAPA 3M1HA 4LBNA 5A3PA 4H3WA 4FTBA 3M7AA 1GICA 1RUF1 4AFMA 1SACA 1WEMA 2NTYA 3RX6A 2HYXA 2IC1A 2PELA 5A3UA 1FPN1 1NWMX 3NAPC 3SNMA 4NMIA 4NROA 2WQ8A 2H6BA 3IN9A 1GZWB 1K5MA 1LJ7A 3ZT5A 2ZEWA 4ADZA 4MSXA 3TEZA 1W6PA 1QXRA 4KWKA 2ZM0A 1CX1A 3PUIA 1G6NA 5I0SA 2W62A 2X68A 4FSJA 1X4UA 4E2QA 4TN7A 5C70A 2W08A 3UL2A 1UPIA 4WBBA 4TWHA 5FZ9A 4Q8LA 5C4WA 1IZ3A 1ASJ1 1OT5A 5EK4A 3O1UA 2YB7A 3O33A 4QXHB 4JGYA 3RMXA 4OUSA 4YM3A 4NWVA 3JQWA 2XQ3A 4PHZA 5LG4A 4HFVA 1QOOA 2Y6XA 3MZKB 2LDRA 1ASJ2 3BODA 1KITA 2UUCT 2ARAA 4KU7A 1AR72 1NCQC 1EPWA 3AMHA 4QXKA 4AKRB 4NUUA 1XU2A 3RPQA 2DCZA 2KWOA 1QJX1 3KNVA 4ILCA 2ARXA 1XU1A 5A80A 3D82A 2XQYA 2LGVA 1S0JA 1UYYA 3FZFB 2G19A 3M3OA 1UYPA 2VM9A 4Y1ZA 1YFWA 2H0VA 2Q8DA 3WNMA 4H9DA 4X1YE 4KI5M 3K3QC 1D0ZA 2OPWA 1YD8G 3NV1A 4OZOA 4AI8A 3AA6B 1OVSA 4LF9T 4FAGA 4D7TA 4XBFB 2LRPA 4FPOB 3HEIA 5H1TA 2DSMA 4OHXA 2MUMA 3V0BB 2WQZC 2QZ3A 3VKGA 4A97A 2XTLA 2XJUA 4QX7A 5ABFB 4WZ2A 1ZVFA 3OGRA 1U5ZA 2X05A 3PUWF 2GC1A 5FL1A 2X9WA 4IV1C 4YHHT 2L7PA 1MEC3 4J1XA 4C9ZA 4YVSC 4AW7A 1R1A2 3VBRA 3DL3A 3OOXA 3VBUA 1GP4A 1JMUB 3QD6A 3VHNA 4LIUA 4A5XA 2XL7A 2YHNA 2C5KT 5B79A 2XSAA 3T0BA 3WNNA 4Q4V2 2JX9A 2ADEA 2DVDA 2UWAA 3FMGA 5TBNA 3RHWA 4ZZCA 3UFGA 1HNWT 4G2AA 3RRCA 4CN1A 3KCCA 2CLYB 3WAKA 1V00A 2ID4A 4PK5A 2E9QA 2QQIA 1W2OA 4OHWA 3GA8A 1T1HA 4LJHA 3CU7A 3AFGA 5C5UA 4E2SA 2H0DB 4ZQLA 3ZYQA 4UXNB 2PHTA 3CJIA 4QKNA 2J7MA 4ONUA 2WNUC 1ENXA 2CTVA 2DWGA 5LHHB 1HRI2 1JOJA 3KSCA 4YY3T 3ZYHA 1X50A 5FY1A 3H50A 1WA6X 2CAVA 3E08A 5FZCA 5A7SA 3V0BA 4AFBA 3VU7H 1HF8A 4QD2A 3WR0A 2WFF1 2HWC2 3OEBA 1MS0A 4D3WA 4WM7C 3ZN0B 5HCAA 5LB7B 2XY8B 1CHUA 1OI6A 4Y4YA 1FOD1 2YT5A 3NJXA 3HBZA 5AQRB 1YCIA 1GQPA 3C64A 5GJ6A 4YSFA 4UFMA 1RVF3 5JSPA 4TWTA 5GM0A 1AXZA 3MK7C 1AUYA 1W6OB 1RB8G 3RIUC 5SVIA 1V9DA 3SCHA 5J37A 4M3CA 5LGTB 4YGBA 3WG2A 4HWFA 4PQQA 5ABJA 1VBC1 2JMHA 3LSEA 4UIGA 4Q8KA 4NIAA 3W9AA 1L3JA 2GMMA 2WWJA 1W8TA 1CQ9A 3SQOA 2KGGA 1U6GB 2RS13 3IBMA 1UURA 1DCSA 2VMIA 1Q8PA 1OQ1A 3JCIA 1LR5A 3HKDE 1OF4A 4OHFA 2VOVA 2WLQA 3I59B 2J22A 5B76A 2DBNA 4TWFA 2QE3A 3Q5EA 4GKKT 5FMBA 4U2YA 4EZHA 4FK5A 1PX4A 3KVBA 4AYUA 4QH1A 3RQUA 2FDGA 1FX5A 5CADA 4DUZT 3P50A 4CZSA 3PDQA 4DNDA 2DF7A 3ZXJA 1VCTA 3V43A 3N9MA 2Q9QA 2R062 1I94T 5A3MA 1SCRA 4A2UA 4CU7A 4Q5OA 1Y64B 1EV12 2VGDA 4CEWA 5BNOA 5KBFA 3HT2A 4XFBA 3SLIA 1FEWA 4CI1B 3KD4A 4IEXA 4CDWB 3GBGA 3ZMVB 2EA7A 3E6DA 2G0UA 3MIBA 3AL6A 2VZ1A 4J6GA 1HS7A 3CNAA 5J2TE 2VPDA 4P02B 2VMCA 5HCJA 2XZEA 4Z91A 2XBO3 3I8TA 4Q25A 2JDZA 2GP5A 3AA1B 4H7MA 3ZFEC 5A7QA 4CU6A 4CCMA 4E9KA 4E7ZA 2JDAA 5FY7A 2KKYA 1DZTA 5IVCA 4OK0A 1UZYA 2XVKA 3MFAA 1UY2A 1H1MA 1X36A 3OPTA 4AEDB 5JWPA 3GL6A 2WLPA 4IETA 5BNPA 3VBFA 2HWD3 3UV9A 1NLQA 2DURA 1I5PA 5FZIA 3GCWA 2E6SA 4XBLA 3NBXX 3AE6A 1DFQA 3TNPB 3ZSTA 2YBKA 1RUJ1 1VRH2 1RGSA 3O1TA 2FBWA 3LEMA 3W59A 2D8UA 3FL7A 4YZ2A 4E2GA 1TZOA 2CXFA 3IA3A 4X66T 3PU3A 3POEA 5JOYA 5DQ0A 2JDKA 1HN1A 4Z82A 2B46X 1WILA 3ZJ1A 5CAZA 2ZX0A 3N35A 2BWCA 1YI7A 3FZLB 5DQWA 1VMFA 4KL1A 4YW7A 4IDPA 4HT1T 1UCUA 1UK5A 1OQDA 3HI2A 5D2AA 2ET7A 4DV4T 3FM8C 4XF1A 4LULA 4WA6A 1PK6A 4LFCT 5IK5A 4UF0A 2CSVA 5LBFA 1GP5A 4XZCA 5GZDA 1HRV1 2YY1A 1W0OA 1CD3G 1O91A 2K3WA 3ACLA 2W67A 2WO1A 4K9SA 3CJIB 3MA9A 1QF3A 3MV01 3CIHA 2JG8B 1PVC2 3WHUA 2RG4A 3EABA 3VBOA 4ZI7E 3WUCA 5FO8B 4K1YA 4FI9A 1MS8A 5IVFA 3O1MA 5KH9A 4UEMA 4IEQA 2X53S 1HQNA 3ABZA 1D1AA 2ODVA 4P9GA 1RMU3 2WABA 1BLZA 2VMHA 3DPLR 2NMOA 4F8HA 1K5MC 2A72A 1W3VA 3K77A 1O3RA 4AHWA 3ZOIA 5IW0A 4AVAA 4N53A 4LBOA 1MQTA 4PTBA 2CDOA 3LKJA 2WDVA 3FHNA 4IGUA 4I0UA 2PLV2 5DAXA 1F5JA 5JXJA 3JB8A 4E4HA 5K9YA 3ONJA 3M62A 3A0NA 3D6EA 2HPLA 3R4UA 2V7KA 1UU6A 1QKQA 3PTRB 1LKXA 2VVNA 3ESLA 3IHRA 4GKXA 4N7IA 4M4PA 1AXYA 1CHCA 1PIV1 4WVMB 5L7OC 1D2QA 4H9RC 3VDCA 4QH5A 3UNPA 2GDFA 4OHZA 4BHWA 3VD4A 2WA3A 2E6VA 1YQ3A 1VCSA 1SG3A 2KU3A 1ZV4X 1DGRA 2NZ9A 4QB2A 1YWKA 3TN92 1CAUB 2KGIA 3QLQA 2GH8A 3HOBA 4SLIA 2VCAA 1YQ2A 3HQRA 2Z4FA 1D0HA 3AP6A 1EYBA 5F6KA 3RPGB 3WDXA 2CRWA 3RZHA 2BERA 2GP3A 2IVIB 3CQCB 3MIFA 4IUGA 3RJ2X 5F39A 3USUB 5LP6E 2R073 3OEAA 5AQHB 4QXCB 3EI0A 3ZYKA 1W8HA 4LKSA 4X5TA 3AK0A 3BTAA 4PJYA 2VBPA 1O3XA 3RKGA 4JGZA 3C98B 1Q8SA 4DZGA 5D1LB 4YHJA 1YQ6A 5BV6A 4HETA 2Y6GA 4HVOA 4AYCB 3VDDC 3P4QA 2WS3A 3DF0A 4IV3A 4S3OB 1MACA 3WW1A 2N7GA 1O4TA 1XJAA 4CPBA 3KT7A 2IUWA 3KT1A 3T2PA 1W6QA 2Q9QD 5LG3A 1I1EA 2ATFA 4WW0A 1G8WA 4FQZA 1J5WA 2PG8A 4KWUA 3UETA 4AHZA 5KDMC 5HEHA 4ZI3C 4U74A 5KH3A 3VBHA 2YFUA 1PO13 2KINB 2HWC1 3ZEFB 5FOJB 5FZ7A 5C5TA 1SDDB 2WQ4A 4NRMA 1ND3B 1ULCA 5JRCA 2VTFA 5J96B 5H6RB 3JCFA 5J3UA 3RDIA 1FYUA 4P00B 2IDAA 1QNWA 4LT5A 5LHGB 4AVXA 3NNLA 2Q8EA 1RUF3 3WG4A 3ZSKA 4BLIA 1GBGA 1IOAA 2EXJA 1UZZA 1UY4A 3ONXA 2VY0A 1OC1A 1RUNA 4ZU7A 5C8YE 2Z42A 5EYXA 5LK7B 1S0BA 3LPFA 4W6WA 2DVFA 4CN4A 4MOAA 1OMIA 4OVEA 2QDRA 5KMGP 4B3ST 2CWOA 2JDNA 2QFEA 2IMLA 2JDYA 4R4ZA 1JYVA 5DAWA 1BEV1 1J1TA 4XETA 2D3RA 3HQUA 2Z2SB 1DZQA 1HB2A 1W9RA 3RYPA 3R4DB 2BV4A 2AUYA 3L9JT 3LSVA 1TE1B 3GN5A 1NE6A 2YDRA 1UCXA 3FJSA 4F52B 4PJJA 5JSOA 4L7XA 2ZM6T 4N3WA 3KV9A 2L0BA 2FBEA 1W2UA 3KF5A 1KNRA 1LENA 4Y22B 3JUUA 1D1BA 4AFCA 1RJ7A 2R49A 1LRZA 3B93A 5JUVA 1LECA 2G9ZA 1YO8A 4FT8A 1HB3A 3KT4A 2K4DA 2XAGB 2E7AA 4XXAA 2AXDS 3I7DA 4XUPA 3S0MA 4Q1PA 4CI3B 4JHZA 2ES3A 2XJSA 5K0UB 5CFCC 5JG6A 5KH7A 2LSKA 5FBJA 3V65A 5C8CB 5DJQC 4Z0OA 1RMDA 3EAMA 1WKYA 3HR0A 1LOFC 3VDBA 5JR9C 2DDUA 3GBFA 4XJWA 3T7LA 2YHJA 1F5FA 3GHMA 2YUEA 2BFUS 3AE5A 5IUXA 4DOUA 3RC3A 3AP9A 3OBVE 2L43A 1AJOA 4UFKA 3CX6B 3ZDSA 3KQ4B 1ZZ6A 4W6XA 5DAVA 3WP5A 4XCBA 2FHRA 3FHIB 5T5PA 5FXWA 1UYXA 2UYBA 3AKTA 2N1GA 4DFSA 5J1GA 3G06A 3GZAA 2WAAA 4XFAA 1GNZA 1JBCA 5L2LA 4K21A 5AQGB 3JD71 3E2DA 2FCVA 1QQP3 4ZDTA 2YV8A 3I54A 1VJ2A 4Y22A 4E4DX 4JGYB 3PJQA 5HXVA 1VRH3 2VUCA 1RJ8A 2J1UA 3VBOC 2OXBA 2DBIA 4AP4A 2R1BA 3WOGA 4IE4A 1J58A 4ZUXU 3GM8A 4H9QC 2LUWA 4A42A 4GB32 5LB6A 4OQ8A 4AAXA 5B78A 3SRZA 4RQPB 3C50A 3T9KA 1V0AA 2BKOA 4LMKA 4CXYA 3HCTA 1QNYA 1XDPA 3OPZA 3PUAA 1HX6A 5EXOA 3ETUA 2I59A 1XE0A 3I3EA 1WLCA 5JVVA 4LJNA 5AC93 1BBT3 1G9FA 4NO4A 4V2WA 3I59A 3U0ZA 2BVMA 1W39A 1O8SA 3C5KA 1QJX2 2MEV2 1NX9A 3ZLIA 1BK0A 4S2GA 1PHMA 1LTEA 4Y1VA 2LSIA 2W66A 4QQOA 5G05L 5H9PA 1AR71 4K8RB 4LO5B 1COV1 2MTQA 4AVVA 4OCTA 4V3LC 3L1ZB 2UXDT 2CAUA 1YEWA 4O4HE 2OS2A 3CX7B 5IJRA 1AL21 2JE9A 1RYYA 4XF3A 3B57A 1F4HA 2A6ZA 1CZSA 3AZXA 5F2SA 3FC0A 2EIEA 2XSBA 4QPIC 1U5IA 1QQP2 2PLV3 4PBOA 1GWKA 5SVIB 2XL9A 2IVJA 2WZR3 1D4VB 4AHXA 3JUEA 4X3GA 5I91A 1C57A 4WVZA 5IK4A 5FYCA 4I4TE 2GNTA 3KCXA 1QDOA 2JDHA 2YBPA 3N2GE 3F95A 3KQRA 4QDQA 5F1RA 1W6MA 1REEA 1AYN2 4R7EA 4B86C 1BVVA 2PLV1 4IV1B 3H7YA 1C4RA 3WVJA 3BQLA 2LGKA 2XOZA 4E4ZA 3KV6A 3AKQA 3DYMA 2KM2A 4IXLA 5LEKA 2BOJA 2A2FX 4KMQA 1SLIA 4YVWC 2K9ZA 4Q2FA 1UKGA 4DRVA 3A8YC 1RXGA 2YDSA 2VMEA 2CXDA 2Q9QC 2E9XD 3AEBA 1XNBA 2HN2A 4D69A 2HJIA 1W6NA 4Z1VA 3THDA 4MV2A 3EMRA 2UXNB 1OA3A 2XLFA 1KQRA 3N3HA 4IC3A 3VBUC 1LVKA 1SFYA 1LDJB 4GWJA 4CCNA 5AFEA 3BKZA 5G04L 2H88A 1J1LA 2VTXA 1KEYA 1C8NA 2DUPA 4DO0A 1S2KA 2PJQA 3QCWA 4TLFA 4NXNT 2RS31 4R8HA 4P9XA 5JOZA 1C5HA 2BEOA 1GMMA 4TKPB 2JICA 2VG9A 4XBQA 1YKEB 1DQ2A 5JH7E 4QU1A 4CEWC 5DDJ1 1KEXA 1UGOA 1XNKA 3OTOT 1D1CA 2WFF2 3CX8B 5LW9A 3ZMTB 4DQAA 3BYWA 1QWRA 1ZOYA 4PAGA 3JD73 4OZXA 1DLCA 1R093 2E9XC 5DN2A 2L75A 3NKTA 2FQPA 5D8AB 4IGQA 3RQWA 5ABEA 5KWRA 1UMIA 5DG2A 1C1FA 2RDQA 4QPGC 3E6BA 4QPIA 5AITA 5C9AB 3M4FA 4FPKA 4QM8A 3IEEA 4FOYA 4AGRA 3O1PA 3CEWA 2P4EA 2IXIA 3KHBA 5HXRA 1N47A 4IEOA 2BVVA 3OVUA 2DTWA 2WNVB 3PHDA 4QT6A 4A7ZA 1QH7A 4ZHQE 3J7Yq 4JGZC 3VZMA 3B9IA 4ZONA 5FRAA 2VPGA 5FMDA 1Z7S1 1SCSA 2V1DB 2C4XA 3N7JA 4JRLA 1LDKC 1MIYA 1HFAA 4IW3A 5APAA 4QWNA 1DU2A 2K48A 3D5OA 3N9QA 3FWEA 4A3ZA 5FLHA 4HK9A 5F8PA 2Y33A 2CONA 2LHRA 4DUWA 5GZFA 2DU0A 2K24A 2LKHA 4H63V 2K46A 1W0BA 3MW2A 3ZIWA 1HRV3 2BOIA 2WO3A 2X67A 1QSDA 5A7WB 4AZZA 1XZYA 4JI7T 1PK6C 3DJBA 5EZWA 2W0GA 1ASJ3 2CE7A 1WEUA 1F31A 3AA0B 2R32A 3MPBA 2CMRA 3MIGA 4WVWA 2ZKNA 1OSGA 5I0DA 1GU3A 4OYUA 3WW3A 2PHFA 4HVQA 3H0OA 3MICA 4URTA 5FZLA 4O2AE 4OULA 2I07B 1K45A 2VUAA 4LHNA 3LJCA 2RS33 1WCQA 3U11A 3KBUA 2BGOA 3O1RA 2WJSA 2WNUA 5L4EA 4H9OC 1JZ7A 2CGNA 1A3KA 1Q8OA 1JTZX 4YW6A 2XVGA 4LBJA 2ZMKA 3PUXF 2H6CA 3ZFGC 2PFWA 2BQPA 2CWYA 3KMHA 4GD4A 2ENRA 1KDKA 2V5CA 4Z07A 2VL0A 3GZEA 1UIJA 4ILUA 1FBVA 4BOWA 3HJRA 1E5RA 4CEWB 2FZ2A 1RC6A 1QJU3 2EIBA 4GKYA 1LVFA 3JD72 1ZBA1 4HG6B 3T8OA 3TBDA 2ZCWA 3AEEA 4YSXA 2FUIA 1NT0A 2ECIA 3AJYA 3DQVR 4BAYB 4AQFC 1R1A3 3D0SA 4YARA 4PFPA 3MXZA 5LXTE 4BJMA 1EPZA 2WNVC 3LDYA 3SKVA 1Z60A 4ISRA 5DUXA 2HWF2 4LF5T 3SXWA 1V9U2 2XM2A 2GSYA 3O1HA 3JBG1 5J3XA 3PDYA 2H0DA 4EJRA 2IXJA 1LGNA 2GN3A 1JYIA 1D0GA 4ILAA 2LSGA 2PFVA 1ALYA 4QB1A 3ROUA 3VK6A 2WUHA 5DDJ2 1IPSA 4IL9A 4OI4A 3WW2A 1SLCA 3FFQA 5FAXA 4ZI3D 4DY5A 4IV3C 4NR1A 4U2AA 3PLWA 1WCUA 2C5DA 1LCLA 4PIZA 1NZIA 3ZYIB 3POYA 4ARXA 4YRDA 3OJBA 1IBMT 4Q0VA 3J9SA 3HCSA 5JIUA 1OD3A 3POSA 2P3JA 1VBD2 3C4ZA 4Y5Z0 1MQTB 2DCTA 1Y01A 4FPJA 4I01A 2BAYA 3HAGA 4I7DA 5ADXL 2NQYA 4BH9A 3K3NA 1TEIA 3KINB 4H55A 1X82A 3AXJA 3UT5E 3AAEB 2OUJA 1K5MB 3JB4C 5GZGA 2BP6A 2J1SA 4L0RA 2VXJA 4LHSA 3C7HA 4MHUA 3LK3B 3T30A 4W4UA 3ZDVA 3A5XA 1H9WA 2IFRA 5CYYA 4BQ5A 4DV3T 1A8MA 2WU2A 1IQAA 4XFHA 1DZRA 3CMGA 1BR0A 4LNVA 5CGMA 2WZR2 3EUHA 3RZJA 3SH3A 2C5JA 3DUIA 1J3PA 3ST7A 4M0NA 3U3IA 1HG5A 1EUTA 4RHV3 2ZGOA 3ZSLA 4CCKA 3VR8A 2VP7A 4HWHA 4QKDA 3B3QE 4MADA 5FBZA 4LKFA 5KXEA 2JECA 2H7VC 2PHWA 5GLTA 5IVYA 4YJ3E 2FFWA 2D7FA 2RR13 4DR4T 3FZKB 5EHDA 4JVAA 3WF1A 3E0ZA 3I3QA 3VHPA 4LF4T 3T0DA 4AOCA 1UXZA 2EVXA 3VZOA 2QDNA 4G4FA 1ZRFA 2GAUA 5JMCA 4E27A 1W09A 4S2DA 5SVXA 4IIJE 3POGA 1UU5A 4XUTA 3HPNA 3R0RA 4O65A 1IPJA 3K1SA 3ZVYA 1RUC3 4FPCA 1JNRA 1HX8A 4R9DA 4EEDA 3WX5A 2VZTA 3LVRE 1Q8QA 5F37A 3GZUC 5FMOL 4WM7A 3U5PA 3T2OA 3PV0F 4AEDC 1S0IA 2F42A 3AXEA 2ACXA 3FFZA 4NIIA 3K3OA 4EGWA 2Z6EA 1V70A 3W21A 5J09A 4EIWA 4AK3A 1W2TA 2JUNA 4CZZB 1WEPA 4AAPA 4ZPIA 4NRQA 2V7LA 1DDLA 4A56A 5M0TA 2BG9E 4F83A 2GC2A 2WZEA 3GXUA 4QH4A 2BZBA 2HWC3 1XMOT 1YIFA 1DGWX 1LHVA 4CUAA 1WW5A 3ASLA 2EXHA 3SOLA 2CHHA 1OXCA 4AXPA 3AE8A 1PVXA 3FBLA 5JOWA 3ZSEA 3BQKA 1ZBA2 1H30A 4L58A 2WCAA 2Y6FA 3U37A 1R092 1E7PA 3FX3A 3LVQE 4XAXB 4LKEA 1LOAA 3WY6A 3GF6A 4MGZE 2OXQC 2JMDA 1H1IA 1M4WA 5B75A 5AQMB 1VLNA 2YC2A 4CCDA 2RR4A 1ZYBA 4EB6E 2D0TA 4ZXEA 2NM1A 4J1WA 1QEXA 3NAPA 5BNNB 3SEEA 4H7LA 1LAJA 3LQCA 2CBJA 1DQ0A 3ECQA 3FL2A 2JQ9A 4NRPA 5CFBA 2QVSB 3H8UA 1WRDA 3OYWA 4KUMB 2ZS6B 2JQKA 4L8QA 4AE2A 5CISA 5E88A 3WXPA 5FUNA 1W99A 1ZRCA 1GKBA 4CDUC 1X4IA 2JM3A 4K0UA 4YZ4A 2D0UA 2ORXA 2Y48B 3ZTGA 3HKEE 5I0RA 1IBKT 1AYM3 3GJBA 2L9LA 4JI3T 1YQ5A 1YJKA 3RYIE 3SMHA 2DCFA 5EYYA 4Q29A 2JKBA 1CAVA 3BPSA 1VR3A 1HKDA 2VUDA 5HXHA 4HONA 2NN8A 2YPJA 3MGUA 2QICA 4HWIB 4E7SA 4MGTA 4Y1YA 2J1AA 3HKCE 2JRJA 4W6YA 4YWAA 2WT1A 4FJOA 2KNDA 2ZGPA 3IPVA 4YAXA 5A6QA 1AR63 4V2VA 1JN2P 4O4JE 2HDPA 4X8NA 5EV7A 3RIFA 5HXEA 4CUBA 3N2OA 4V1Av 2IXHA 2GN7A 5T52A 1JZ3A 1SFPA 2Y8DA 1E57A 1E5SA 3K75B 4UR9A 2W61A 1O5UA 5CKQA 1FOD3 3RYCE 4B3TT 2BU9A 3HA4A 5I8TA 4BHPA 1LOGA 3VDDA 3DYOA 3ABVA 2LV9A 4PDWA 3C2UA 2WS93 5FXVA 5CJ5A 3HL6A 1O59A 5FIXA 5HCFA 1BCXA 2PHUA 4Z2AA 4YVSA 1ZZ9A 3RS6A 2JB4A 4GJYA 5FPXA 4RGGA 2V5YA 4I3GA 4EEBA 2J1EA 4YGEA 4L9BA 2HBTA 3ZMOA 2QQPA 4YBSA 3I2FA 2K0GA 3TLTA 2ZKLA 2Y6KA 2XQ7A 4J2CA 1V6JA 5GZCA 1ND2A 2W9XA 2DNXA 4FFIA 1V9U3 2CT2A 1T8BA 3ZSJA 4CP9A 3AM2A 3J7HA 2BWAA 2JWPA 2RM22 3LF7A 5F5QA 2VPVA 2H7OA 5C9AC 3WF0A 3M65A 4QPGB 4AKGA 2Q5TA 3O1OA 2R063 2ZXQA 1VMHA 4IGPA 3R05A 4O61A 2CSGA 3H37A 2Y6HA 2JIJA 3QC9A 4DR2T 3T2TA 1VB2A 3EQEA 5C2TA 3VN4A 1S0EA 4Y5SA 1ND2B 1S0CA 2X5IC 4DR5T 4JQRA 2ECWA 2BTVC 1NAEA 1BMV1 3LAGA 4COWA 5FP4A 3M3ZB 2YGMA 4A7YA 4DBQA 2EHOB 1PM4A 4MZUA 3DN7A 4BU2A 5I3LA 1HXS1 2CPTA 1UWWA 1PVC3 1MM3A 3SITA 4UI9B 3CZUA 1K2FA 1C5IA 1LHWA 5DZEA 1QIQA 2WNOA 5G05B 1JM7B 3CL1A 5FPBA 2EIDA 3WNLA 1HV0A 5HYAA 1RHI2 4AL9A 4XF9A 5I8YA 4P08A 1W6MB 2X29A 3F57A 2LM2A 1WESA 5LMNT 3THCA 3N7MA 2N9DA 1NLSA 1HG2A 2B9UA 3LE0A 3VBUB 4KU8A 4UAPA 3VKNA 4RFT0 2NW7A 3S5QA 4JDMA 5B4XA 1G9AA 3THPA 1AJ3A 3S5AA 3Q9DA 2V4AA 2BNOA 3B00A 3ZVZB 3J7LA 5EIYB 1U5YA 1MS4A 1UY0A 4MVTA 1BKZA 5FK8A 2HKXA 4OI1A 5F7UA 5JR9A 3IM0A 5BMVE 1PIV2 3OB8A 3M3CA 4D7YA 2P3YA 2RM23 2F6JA 3UKVA 3MDPA 3FLPA 5L3DB 5FQ0B 3P5BA 4W4ZA 5T54A 5FYZA 4ZXKA 3RZLA 1D0XA 3FBYA 1EAH3 1AX2A 1HDKA 3RG0A 3WDUA 4AVSA 4Y5TA 2LGGA 2A6YA 5KHKA 5LRSA 5FY9A 4UV9B 3JU9A 5J36A 4R9AA 4GNGA 4L11A 2Y64A 4UW5A 4KQ7A 4GK0E 3MUZ1 2A73B 2OW4A 2ZGRA 4U31A 2KSRA 5FYUA 3WDWA 5AQQB 4AKHA 4N8MA 4S2FA 3POJA 3T1LA 1SHWB 4YM0A 3ZMUB 5DINA 1G9DA 3AE2A 2MT5A 2KXPB 2CGPA 5JTGA 2VAUA 4YABA 2XUMA 2WNEA 5C8CC 3DPRC 2R061 1WEEA 4LLFA 4NHXA 3B9CA 4OUMA 3ILRA 5FLIA 3BTXA 1CZTA 5GLVA 5E89A 2WN2A 5ERLA 1O4ZA 4DB5A 2JQHA 4Q27A 1FMD1 2QIZA 4C0BA 1FNZA 4XVHA 1I9RA 2VBBA 1WBLA 3UU3A 2VURA 2BS4A 3KWVA 2XASB 5BNNA 1DCQA 2RMU3 3EO6A 1FT9A 3O4XE 4XAEA 1W6OA 1TME1 3PVBB 2EHOA 5BNQA 4CCGX 5D1MB 2YMZA 3SCFA 2C6SA 2VULA 2ETEA 1X4JA 1RUF2 5T50A 5IT6A 3WCRA 2P57A 2Y6JA 5GKAC 3H3MA 4LK6A 1NG0A 4EYUA 2G9FA 3AMNA 3M70A 1VBB2 4N90A 4LK7A 1U12A 4BLJA 1GQHA 2ZGUA 2RPAA 3K4ZA 1JYWA 3ZYLA 3ETQA 1WEOA 1H6YA 3BGAA 3WP3A 5BXXA 5C71A 1URXA 3UUBA 2YW8A 4HSJA 3X1DA 3H3ZA 5ACA1 3JC6D 1ZBDB 3TLWA 4DPNA 3V56A 4X1IE 1ZA4A 3NW4A 1MMAA 1AZDA 4IEPA 2V6YA 1UOGA 4LLOA 4YSZA 1HYIA 5FP8A 4IL4A 5AVAA 2Y1NA 4ATFA 2R16A 4RR3C 1DLLA 1QHDA 2R0FA 5EK3A 5EZYE 1VBE3 3UUMA 1N33T 1IPKA 1DU3D 1HIXA 2ECNA 4ZS3A 4HL0A 5CG8A 4JEUB 3ZXDA 2WWSA 4AQSA 1S55A 3AE3A 1QOTA 1US2A 1MS3A 2JPFA 2AGSA 2CKLB 1CESA 2ZM2A 5IK8A 2R0HA 5CU1A 1EAH2 5C33A 5IVBA 2HH7A 3NNMA 4MGYE 4CCJA 1LU2A 4PLMA 2D6OX 2X0LB 2VECA 4NPMA 1T72A 4KHZF 1RUD1 4UW3A 2MPKA 1UX6A 2EXKA 3BI3A 4XUOA 1GLHA 4XW3A 5DZFA 2NWBA 3ILFA 2D5UA 3PUGA 5AQOB 2D5HA 4NIDA 2FJEA 3B5MA 1CN1A 2XONA 4OX9T 4TUYE 1EZ3A 3TWIA 1LU1A 3OCPA 3BUCA 4ZY9A 3C7GA 2CRRA 2XQ5A 2VZVA 4LA2A 1JU4A 3ENRA 3U5MA 4FP3A 2XG3A 2KREA 4Y26A 3QH7A 2LHNA 3SWHA 3EXUA 2BS2A 1XQNA 2W3JA 4X64T 2WO7A 2YN6A 1FMWA 3N9PA 3U1XA 5CBLA 3ZYRA 4LO8A 3ZT6A 2QQWA 2W94A 4Y1UA 3I0QA 2CWSA 3HBKA 3MKDA 4CDXB 3RYKA 3D8CA 4LF8T 3CK6A 4Q4V3 1V6LA 4JQTA 3UKNA 3RZMA 1ONAA 4PQ9A 3UTKA 2WR9A 1YKHB 2P6CA 3AC0A 3LG7A 2D93A 2SBAA 4HFBA 1SLLA 4LF7T 4AI0A 2VOWA 3AYAA 4ILBA 3VBSA 4ZKTB 2GH2A 4C91A 2WNUB 3L09A 4FXKB 2VB6A 4XJZA 2ORZA 4I30A 5FZEA 3RGLA 4UWDA 1BYHA 4AQGA 2ZHKA 2Q30A 2ZABA 1RINA 5SV5A 2K16A 3LK42 4GB31 2XOYA 5FZOA 2XLAA 2VQUA 4JZRA 3C3VA 3WHTA 2WBLA 4QKFA 3P6BA 4HKWA 4L9IA 4U7YA 2W47A 2VR4A 4JRAA 2MEV3 1MS9A 2JG9C 2VZSA 1IAPA 5SVYA 1JOPA 1WR6A 3M7KA 5FY4A 2FMYA 4DXZA 2WYSA 4HFHA 3AYCA 2CNAA 5IFTA 1H1AA 4DR6T 3Q5DA 1FPN3 4IERA 3NNFA 2BDEA 5FVKA 3EB6A 4BZ4A 2I0MA 3DP7A 5FZ0A 2BZDA 2VJEA 3WQ1A 1BORA 3DXUA 5LA9A 1N1SA 1GP6A 1S2BA 4HANA 1L0VA 5LKUA 2WB5A 3EB7A 3NRYA 1YUDA 2JG8C 2XQ4A 1OLME 3DXTA 1NCRA 3MW4A 1WMDA 2IXLA 1QH6A 5IVEA 1UIKA 2ZOEB 4JKMA 5LGUB 3VBRC 1COV2 3K4DA 5C3PA 2W2IA 1RHI3 2FDKA 1GWLA 3ZCIA 2QBXA 4DMIA 2YFZA 2D6LX 3OD4A 1R083 3I4IA 3RI9A 4R2YA 2ZLYA 4F3JA 3KM5A 4GWNA 1ZBE2 1RHI1 3OBZA 4EQVA 3QH6A 4EWDA 2WZR1 4RSUA 4JDOA 1SLTA 4Y33A 2UUAT 3J26N 1X9PA 4CEYC 3ZKRA 1LODA 2LOPA 4C90A 4YFWA 2D6PA 3SUBA 2OX0A 4V3KC 1IKQA 2TUNA 1JS9A 5CKMA 2KWIB 4UT5A 1C1LA 2BFUL 1C3HA 4LITA 1GWMA 2WT2A 1WW4A 4P1NA 2TNFA 2F17A 2ZTNA 5LA6E 1A6CA 3I3BA 1DG6A 1OKOA 4PIXA 3AX4A 1F4AA 4N53C 3OUIA 1D4M3 3LIHA 5B2GB 1NCRB 3LDKA 4U72A 4OYJA 4MG2A 2K9AA 4OI0A 1ZZ8A 2XOMA 4FCAA 4RL7A 5JDNA 1OH3A 5BNPC 2MA6A 2PHLA 3NKZA 2GC3A 4PF5A 2L80A 1WEVA 3ZC1A 5J7MA 2CU5A 4UI9L 1RUD3 4YT0A 1OPOA 3TLUA 5JR9B 2CYFA 3RZKA 2O14A 1OQEA 3TLSA 5C3RA 5A1LA 3FB2A 1I6XA 2ARBA 4XUQA 1KD7A 1CAUA 4LHLA 1GFF2 2KWNA 3E97A 1F8VA 3HNMA 1FPN2 4FPYA 2YHOA 4LORA 5C8WA 2G1MA 4YLZA 3PU8A 4QF2A 1WZXA 2CGOA 3AL5A 3AFKA 3UKTA 3R6NA 3KV5A 4ES9A 1MVEA 3ZFFC 4LBKA 4KI0F 4BMEA 2WAOA 3VGIA 3B69A 3BIEA 1ULEA 2JMKA 1PZ8A 1IS4A 1NAFA 3O7OA 2KLQA 4GMP1 3AP5A 1CIYA 1Y9GA 4KBMB 2VVFA 4X62T 1SQ4A 2CHNA 2ZMAA 1MM2A 1MMDA 2F6BA 4YADA 5LJNA 4LKAA 4AI1A 5C6CA 4AR2A 1N3PA 3QBQA 1H8TC 3GV4A 1GANA 5EP9A 4QMAA 2HEWF 2V72A 5E1RA 1D4M2 2YKSA 1UOJA 5FDBA 2CKLA 3BN6A 4LQRA 1KFYA 2X9HA 1OFSA 5IYYA 5FY8A 1JYXA 1VBE1 5JR2A 1VAKA 5F5CA 4BB3A 3QACA 2CSYA 1HB4A 5F3CA 1AVBA 1JW6A 5L9BA 2SLIA 4TLGA 1AR83 4ISTA 3GDBA 4RR3B 4HMZA 1W2NA 1AYM1 3KF3A 4YW2A 4R9CA 4KBZA 1XRUA 4X20E 5DDJ3 5A3TA 4DV5T 4AVTA 2XUEA 1PMHX 4C1XA 3NQHA 3GCXA 5FZ8A 2YQLA 1AX0A 3H7JA 3EJKA 1X9TA 4L92A 1HXS3 2EAKA 1V87A 3SEPA 2LLYA 4HFDA 1E2AA 1JYCA 1AX1A 2VW0A 2LJLA 3ES4A 4NUBA 4RS5A 3ZFGA 2D3PA 1C28A 1KS5A 3WT3A 3U4XA 4S3OC 1O8PA 3VBFC 1MZEA 1FNYA 4A41A 2VWAA 5FWEA 4FTSA 3H3AA 3RYHE 5A1AA 5JAXA 1W8WA 3LBXA 4KBBA 1GYKA 3JQXA 4B7EA 2GK9A 2XQ6A 4UW6A 2GMEA 2D9DA 3WEZA 4ZOLE 1XDOA 4G63A 3UU6A 2J1TA 2XB1A 3WQBA 1CONA 4DRRA 2XQ8A 4KWLA 2ADDA 3A22A 2YSMA 1OXZA 4X8PA 3EHKA 2FDIA 2X09A 1UX7A 3RPGC 5L3GB 5HEGA 4ZU4A 2JIGA 2FUPA 2W1QA 3FXEB 4DXRA 2JE7A 2EIGA 5FCCA 1KNZA 2MYSA 3PTYA 1H8TB 1LRHA 5F3GA 2WSSV 4UFIA 2D40A 2CY6A 2WC2A 3UJOA 4BK4A 3MYXA 4WVMA 1SPPB 3ZN4A 1AHSA 3CPZA 4BA9A 1RMU1 4MGIE 3D0JA 1HYJA 5LA1A 4J25A 4JV5T 4HKLA 4IGOA 3NWIA 3OJAA 2HWF3 3NVCA 4BE3A 1J84A 3ZFFB 4UBGA 1OBNA 4I0AA 4AGGA 2A5ZA 1NKGA 1OUSA 3CQXC 2WY2A 3RWKX 2ZGSA 4BA6A 5F5WA 5EJ1B 1OUXA 1ULOA 2LM3A 2XJPA 3PUHA 3ZXGA 1EP0A 3MPPG 3C51A 5JDLA 3VKFC 2C2VS 1UNBA 2V7IA 3ZNIA 3NJVA 4KGGA 3WAJA 3K46A 4FOQA 2V26A 4DS0A 2WDQA 1JUIA 5K3QA 1YFYA 5HV0A 3WP6A 4QX8A 1HX1B 3PUQA 1OLRA 1C8M1 2E53A 3VD3A 4E8CA 1WLDA 1VBD1 2MNGA 5FPZA 2PN5A 3X29B 1LHUA 4FOVA 1O6UA 2M6BA 1ZZ7A 2LE8A 4PI0A 1QGLA 3R6SA 4NE9A 4U7IA 5FZAA 1N87A 2J1DG 1E4UA 1O7FA 5DABA 2EHOC 4AKLA 5KC6A 3OPCA 4LF6T 1W8ZA 4LO7A 3IBPA 5FKCA 4B29A 3S57A 3FZ3A 1UXXX 5T55A 5FPAA 1JZ4A 5LGNB 2Z69A 1NXD1 2Y34A 5L7OA 2CLYC 2JG9A 5A7PA 4RGKA 2CEAA 4AEKA 2UZGA 2B39A 1HW5A 3GNEA 2CXLA 1CAXB 3PMEA 4A44A 1XB9A 1XC6A 4AKIA 2C9AA 1JXNA 5CA1E 1WW6A 1NXMA 1PX3A 1MZ6A 3MACA 3ACHA 1LEMA 4AWDA 5JPNB 1ZKEA 3QOFA 4N43B 2A1XA 3MW3A 4BQ1A 1PGL1 5FR3A 2VQET 4YVSB 1SFNA 4B1LA 3AXJB 4LIVA 4Q4V1 4KGQA 4AHYA 5FZ1A 2BGCA 1HLCA 1UL9A 1WR0A 4A98A 1DGWA 5K8SA 4TV8E 1BZWA 2ZGQA 3PL0A 5FYSA 2DJAA 2QGSA 4OUEA 4PLOA 5K4LA 4BM8A 1WMFA 2WZ8A 3AE7A 4FPEA 5KX5E 2VNVA 2RP4A 2XMLA 4CUCA 1GZWA 2IAKA 2LXHC 2WWVA 3SISA 3TB0A 4WM8B 4I43B 3NV2A 1VE0A 3C8XA 3LOIA 2X66A 3BPZA 5FPLA 1AXKA 3EBRA 5BPXA 5GZEA 4CEYA 1NCQB 5M4YA 4NHKA 4YGCA 4YVWA 4Z8XA 4XURA 1W9FA 2BVLA 5A7WA 1DQ5A 1WFDA 4AISA 4P9JA 2HPJA 3IDCB 1ZZBA 4XDOA 3FAOA 1MS1A 4BQ3A 5ABFA 5CKNA 2DYCA 2KA3A 2WWUA 2KR4A 1PMIA 2NMNA 1VBA3 3BVCA 4Q4Y3 2X51A 1Q5OA 1TVGA 5ACA2 4TZ4C 5FMOS 4GB0A 1YI9A 4MYEA 3ILNA 3U14A 2EXUA 5J1XA 4UFHA 5LYJE 1VFYA 1CX4A 3RRWA 3O0VA 2YREA 2UU9T 4Q4X1 4B4QA 3ACGA 3EVYA 3Q8BA 2HWF1 4I02A 2F4PA 5GLZA 2LSYA 4QGNA 5A32A 1AF9A 1PGW2 2V4VA 2DVAA 4XPVA 4TV9E 4MHRA 5JZGA 3W58A 4Q0SA 2VMFA 2VE1A 1S35A 2RJKA 5AC92 3UU4A 2MKEA 1W2AX 1CR7A 1GNHA 3AP7A 4XC9A 4JTOA 2C2LA 2GALA 2B7YA 3VBSB 4LFAT 2O8QA 3ZFFA 2D97A 5HXSA 5E0OA 3PUYF 4CTEA 2NOXA 5AC91 1H7CA 2WA4A 5CFCA 3KZ4C 4QPGA 1EV13 2VU9A 5KC5A 5BNOB 4OHVA 4WZ0A 1RUI2 4CP1A 4QQLA 1AL22 5AQPB 5LJMA 4N7UA 1PNFA 4ZU5A 2WZPP 2WMOA 3VZLA 4XFIA 1W28A 3KGZA 1M62A 1B09A 1QJEA 4IDQA 2CDPA 3I0OA 4HZFA 2VZPA 4KG8A 2ZBJA 4YM2A 2OV9A 1ZM1A 3FLTA 2H3RA 2EICA 2V8SV 4AQ2A 5HXCA 2BNMA 2YK0A 4Z0RA 4L5GA 5C8CA 1LOFA 2XGXA 2A3XA 2C5IT 3PLQA 5T5JA 1MPXA 1NCRC