3KV6A

Structure of kiaa1718, human jumonji demethylase, in complex with alpha-ketoglutarate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
447
structure length
447
Chain Sequence
b'PPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGSSLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 134
structure length 447
sequence length 447
chains with identical sequence D
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kv6A03
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kv6A02
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 3kv6A01
4I7BA 3OPTA 2FSAA 5FPVA 2CSYA 5FZIA 3ASLA 2CT2A 5F3GA 4FO9A 3ZNIA 5IVFA 2K17A 5A3WA 2MD7B 5FZ6A 5B75A 4Y3OA 3M62A 4D6SA 5F3IA 2DX8A 1WEOA 4BISA 2YQMA 2PXJA 4YBSA 3C5KA 3O36A 2LQ6A 3MHHA 4CCMA 4LIVA 4FJCA 4R7EA 2MT5A 3O7AA 5F37A 4B86C 5F5IA 2E6RA 3C6WA 4PPEA 4XDPA 4IGPA 5FP9A 4WZ2A 2G45A 1WILA 5B78A 2ZETC 4CA1A 5FZFA 5C13A 4LADB 1WFKA 5A7PA 3PURA 2C2VS 3HCUA 2MA5A 2YW8A 4NN2A 3ZPV1 2MA6A 2W2IA 2IDAA 2XXZA 3LQJA 4W4UA 1FBVA 5FYCA 2D8SA 5FJKA 2L0BA 3O37A 2OS2A 2JRJA 4UP0A 5FXWA 1RMDA 2LGLA 5LY2A 2VD7A 2Y1NA 2MIQA 4CCGX 2L75A 5LY1A 4GNFA 5A7QA 5F3EA 1V87A 5FYUA 5FWJA 3U5NA 5TBNA 3NG2A 1XWHA 1E4UA 3PUSA 5FJHA 2Y1MA 2OQ6A 1VRBA 5FB1A 5A7OA 4Y4RA 2JMDA 5D1MB 3O35A 3SOUA 5J3XA 2YYRA 1Z60A 2CSZA 4A4BA 3O33A 3GL6A 4BXFA 4Q6FA 3ZPVE 2ECTA 2VPGA 1T1HA 3VK6A 2NAAA 2LRIC 5FZ3A 1BORA 5H1UA 2VJFA 4I7DA 3PUAA 1FP0A 5F2WA 5FY5A 4MSXA 5LCWB 2H0DA 2KU3A 5LKTA 5FZOA 4GNDA 4V3LC 5A7WA 2K4DA 5C11A 3N9QA 2F6JA 3K3NA 3LDBA 3L1ZB 4TKPB 3O34A 3PTRB 4BHWA 2M85A 2LGVA 3I2DA 4QF3A 5I3LA 2L80A 3PU8A 4UF0B 3KV5A 2E6SA 4GAZA 5DINA 5KH7A 4R8PK 2RI7A 4CUGA 2GP5A 5G05B 4QU1A 5KR7A 3ZVZB 5ISLA 2M6MA 5F32A 5FY9A 4LJNA 5IWFA 5KH3A 2VPBA 4QF2A 3N9LA 2MNYA 4YBTA 3NJYA 2AN6A 3IHPA 4N3WA 3ZVYA 2ECIA 1K2FA 2G6QA 3LRQA 3PUQA 3KV6A 2YSJA 4CSWA 3MHSA 2OXQC 3U78A 5TRBA 5LW9A 4CCLA 2C2LA 3KVBA 5FYMA 4YADA 2LXPC 2CKLB 2LGKA 4YBMA 4HOOA 2KREA 1HYIA 4C8DA 1JM7A 2MD8C 5G0FA 3T6RA 2ECWA 4LXLA 4E4HA 5CEHA 1LDJB 4HONA 5LKUA 2OT7A 1IYMA 5A80A 5FZGA 5FZKA 3PDQA 5A1LA 4EZHA 2M3HA 5IVBA 2P5BA 5FPUA 2YBPA 1WIMA 3LQHA 4ASKA 2Q8CA 2BAYA 5TABA 2OQ7A 2UZGA 4V3KC 2L5UA 5FPAA 2VPDA 5F5AA 4AP4A 5F5CA 4AYCB 5FZHA 2K16A 5FZDA 4AAPA 1WGMA 5FWEA 2F42A 4CCKA 3EB5A 4LKAA 3N9OA 2YU4A 5FP3A 3L1XA 4CCNA 3V43A 4O64A 3OPWA 2HDPA 5FZMA 2VJEB 2YUCA 4YABA 2M1RA 5KH9A 3KV9A 2YBKA 5FY8A 3EB6A 3K2OA 4L7XA 5AIUA 3ZPOA 4GJZA 5FY1A 1Z2QA 3RPGC 4S3OC 1F62A 1WEVA 4V2WA 5DKAA 4MVTA 3LD8A 4YATA 3UYJA 4XDOA 5FZLA 4N4FA 1WESA 4P5OB 2KE1A 4BBQA 3AVSA 2YQLA 5FZ1A 4TN7A 5B77A 2YREA 5FYBA 2F6NA 5LKXA 4V2VA 3DQVR 4IC2A 4QX8A 4IC3A 1JOCA 5IVCA 5LWBA 2LGGA 1G25A 4S3OB 5FXXA 1X4IA 2LV9A 2ECVA 3PHDA 2YSMA 2YHOA 2OX0A 5FZCA 3U5PA 1WEPA 2YHNA 2XEUA 5ANQA 3ZYQA 2GP3A 2I50A 5FYVA 2KWNA 3AVRA 5IVYA 2KWJA 5FYTA 4QX7A 5F3CA 2MUMA 1VD4A 3ZLIA 5FV3A 2YU1A 4AUQB 1WEWA 2MNZA 2K1JA 2PUYA 5B8DA 4ZDTA 2ECGA 1WEEA 3AL6A 5FY0A 4LIUA 4C9ZA 5FZ4A 5FYHA 1MM3A 2EODA 4CCJA 3FL2A 3PU3A 4IGOA 5FZ9A 3N9PA 5FP8A 5FPBA 1DVPA 2VPEA 2KGIA 4XI1A 2ECNA 4FK5A 4ZUXU 1WEQA 3KNVA 1WENA 4DO0A 5FZAA 1LDKC 5FYSA 4FIPA 4LLBA 3AL5A 3DPLR 1WEUA 2LXHC 5FZ7A 4AVXA 1MM2A 5AITA 3KQIA 5FYYA 1N87A 2XUEA 5FZ8A 2YT5A 1HYJA 5A3TA 4LITA 3M63A 2FUUA 3SOXA 3DXTA 1ZBDB 4QXCA 2VNFA 4L58A 3DXUA 5TDRA 5FYIA 2XDVA 1Z6UA 3K3OA 4UF0A 3KVAA 2VJFB 2XB1A 2H0DB 4PTBA 3N9NA 5FXZA 5A1FA 1VFYA 2KR4A 5FZ0A 5H1TA 3KV4A 2XMLA 5FZOB 4DIQA 3U4SA 5A7WB 2KGGA 5LKZA 2YU2A 2KFTA 4GJYA 5H1VA 2YBSA 4B7YC 4F52B 5D1KB 3M99A 3SHBA 4I7CA 2KWOA 5K4LA 3HCTA 4A49A 5H9MA 5TDWA 4NUBA 4QXHA 4QXBA 4YAXA 3LQIA 5D1LB 3O70A 2ECJA 5FY4A 1VYXA 2LN0A 5EYAF 5FPLA 4WA6A 4QWNA 5FUPA 4GB0A 3RTRB 2G43A 5FP4A 5IVJA 2CKLA 5E6HA 1X4JA 2KIZA 1WEMA 4D6RA 2WWUA 1U6GB 4LK9A 2VP7A 2FUIA 5B76A 5A3PA 2Y43A 5A7NA 4BU2A 5A3NA 2Q8EA 5FY7A 3HTKC 4GD4A 4Y33A 3GV4A 5FZBA 2KYUA 5FEYA 5IVVA 5FZEA 4GNEA 5IW0A 4CCOA 4URAA 3ZTGA 2PNXA 3U5MA 4AI9A 3RPGB 4ZQLA 3N9MA 1JM7B 2JMIA 4EYUA 1CHCA 2L43A 5FP7A 2Q8DA 4AYCA 3L11A 2RSDA 4WZ0A 3SOWA 4WZ3B 4GNGA 4X3GA 5FB0A 5FBJA 5FXVA 5A7SA 1X4UA 4UP5A 2WWJA 5FUNA 3U5OA 5FYZA 3HCSA 2QJ0A 4A4CA 3QZVA 2LDRA 5JG6A 2YURA 2YPDA 1WE9A 3RVHA 4UI9B 2JMJA 2EA6A 2HYED 2QICA 4IGQA 5IVEA 2EGPA 2VJEA 5B79A 2KWKA 5F39A 3T7LA 5F2SA 4EZ4A 4YC9A 4D6QA 2QIZA 5FERA 4A0CD 5G04B 4R2YA
chains in the Genus database with same CATH superfamily
4I7BA 4NUVA 3CVRA 2VO5A 1FMD1 2CSYA 2JENA 2I59A 1TME3 2E6VA 1VRH1 3TN92 5C3SA 1XE7A 4COVA 4YVSB 3LDQB 4NIGA 2GSYA 4QM9A 1W3XA 4NO4A 4AFCA 3RZJA 4OI4A 2E51A 2EIBA 1H2NA 5J98B 1HFAA 2G45A 4FFHA 3HNBM 5FZFA 1W2OA 2YG0A 3OY8A 1A6CA 2YW8A 4QX8B 3MIGA 4XQ4A 4JQTA 4RQPC 1IZNB 1PGSA 1RTVA 1GWKA 1BLZA 5D8AA 5JXJA 1BVVA 3O37A 5SVIA 4O4LE 2P1BA 3MV11 2JDPA 1A8DA 3WW1A 2VQFT 4YZ3A 1VOMA 3VHPA 4JI3T 3I3QA 4WM7B 3I97A 5D1MB 3DJBA 5DAPA 4RQPB 5JRCA 2OZJA 2BS3A 4A2UA 4Q29A 3LGRA 3ZMVB 2D5UA 3GL6A 3I2GA 4AEMA 3RZGA 2EXKA 4MHRA 3ZJ2A 1QJU2 1MS4A 3VRAA 1UXZA 4Q4Y2 1SLIA 2O8OA 1W6QB 1NUKA 3AE3A 3HOBA 3POYA 3RIUA 4YW7A 5LCWB 2WO7A 3WNKA 3POIA 5CJ5A 3I3MA 5DZGA 4IREA 3VLBB 5LKTA 5A7WA 5LEJA 1AUYA 3BODA 3BTYA 2V7KA 1QDOA 2WN3A 1QQP3 2XG3A 1DGWA 4ILCA 2HWB1 1W8TA 1LKNA 3DDTA 2UXBT 4UBHA 3SRZA 3UQ7A 2FQPA 2M6MA 3AP5A 2J22A 5J09A 1OQDA 1IJ5A 2DVGA 4N3WA 1K42A 3ZXFA 2PFVA 3AEBA 3H7YA 1KFUL 3LDKA 1RINA 3ZSKA 3PIGA 3PLQA 4I0WB 4JLEA 1RUD1 3H3ZA 1QEXA 5AQQB 1T72A 2LJLA 5H9PA 4AQSA 4C8DA 5G0FA 3RIUC 4HPKB 3VD9A 2F4VT 1PO12 2RS51 1OHFA 5LKUA 2CSGA 5BNPA 5CA6A 4EV0A 4LO4B 1DQ1A 2M3HA 2D3SA 3ROUA 1RVF3 3ACGA 1DU3D 4Q4X2 5L7OB 2ZGNA 4X62T 1HQWA 3OKQA 2L5UA 2VBBA 5FPAA 1OFNA 1ZBE1 3VKOA 3OCPA 4JRLA 1HRV2 4COZA 4GWNA 2XR4A 4ZI3D 3UQ4A 1BKZA 2BS4A 2PAMA 4RGAA 5L4HA 2ARBA 4AHWA 2EAKA 2RDRA 4FPFA 4AWDA 4N53A 3I9YA 5FKBA 2W92A 1AL21 3I4IA 3WQBA 3LD8A 1UPSA 2NW8A 5BNPC 4LE3A 5JIAA 1COV2 2YQLA 5DQWA 1C57A 2QFEA 4LTAA 4V2VA 5A3UA 5FRAA 3I59A 4Q4W1 2D6MA 4BA6A 2DCTA 4XF9A 3L2HA 2VOKA 4XMIA 2BGCA 5CG9A 4L5GA 3JQXA 2YSMA 3TBDA 3WDUA 1X82A 2BKOA 2VVDA 2BV4A 4HWDA 2W08A 3M4FA 2YU1A 4DB5A 4GIQA 5AC93 4AI6A 2PUYA 5B8DA 4ZDTA 1DU2A 4GMP0 3ZDVA 4JBWF 1GOFA 2V7JA 3AAEB 3N9PA 4CPBD 1QJY2 5L3EB 4DO0A 1RUJ3 2G9FA 2A70A 2QQNA 3CX6B 4AKRB 5EZWA 4B29A 1J1LA 2WZR2 3ZXJA 2JMKA 2CA5A 2UXDT 1RUF1 2B5HA 3DKQA 5FZ8A 3J7LA 3H3MA 2XB6C 1PHMA 3QOPA 1DDLA 5FPXA 1W8ZA 4UF0A 5C33A 1LRZA 2YDQA 3RWKX 3BTXA 4W8JA 1LVFA 5DUXA 2YBSA 4B7YC 4CP9A 2OUJA 2XQRA 2H0BA 3O0WA 2VKHA 4ILUA 3RQWA 1LHWA 2YPJA 3RGLA 1SHWB 3FXDB 5E0OA 1MZFA 2CHOA 1T6GC 3RTRB 2CKLA 5E6HA 3JC6D 4HWHA 1ACCA 1J3QA 2HWE3 4LKDA 4I02A 1F35A 2OW4A 2AE9A 3GM8A 4QDRA 3HTKC 2D2SA 1W9FA 3AAAB 2DTYA 4R9AA 4HFEA 3H9AA 4Q1RA 4O9GA 5EJ3A 4C1WA 1DQ2A 4EYUA 1UOGA 1FXZA 3A22A 2ET1A 2Q8DA 5EYXA 3CPZA 3L9JT 1BXHA 3GN5B 4PIZA 1D7PM 1GNHA 1K3IA 5LBBA 2Q1MA 1OA3A 2CAVA 3ZM8A 2XKOA 4RR3C 2Y0OA 4ONUA 1I5PA 3QCWA 1O5UA 4DR3T 3ZMSB 2LS6A 3Q8BA 4HFDA 2Q9QD 1DIWA 3M62A 2LM2A 4KHZF 2VMHA 2A3XA 2YQMA 2W46A 2HWF3 3G6JB 3A0KA 4RR3B 3BTAA 2RJKA 3O1HA 5HWXA 2YINA 5F5IA 5J1XA 1R091 2KKYA 1WFKA 2VVNA 4WZXA 1YHFA 3HCUA 2ZGPA 1UMHA 4A44A 1LRHA 2IDAA 2RJ2A 4NIHA 4UP0A 1SPPA 5F9TA 1UZ0A 5LY2A 2MIQA 3H1WA 4IUGA 3IF8B 4XQWA 3GYDA 4QPWA 3MDBC 3AMNA 4YSFA 4QHBA 2WJSA 2QQJA 4ZY9A 3AEEA 1PMHX 4DR7T 3PJQA 1NCQA 1JYVA 2ORXA 3O33A 4A97A 4AFDA 1GP5A 4FOQA 5J2TE 5A6QA 4TNVA 1WCKA 1MMDA 1VB4A 2VJFA 2NYYA 3POFA 2KU3A 2LHNA 3P4SA 1UD1A 1W6OA 3K4DA 1WCDJ 4TKPB 3PTRB 4HFIA 1LECA 1V9U1 3MHZA 3ETVA 1JYXA 1IKQA 1F9KA 1K45A 2E6SA 2WS93 5SV5A 4Q2FA 2Y6FA 4QX3A 1WW6A 5C7GA 2XH6A 1LHOA 1NCQC 5FOJB 3WDXA 3ZVYA 4LBQB 4K3UA 4QXHB 1BMV1 2JDAA 2R071 2E9QA 4CSWA 5DAXA 3CQGB 1Q8OA 2BS2A 2P6CA 2G9GA 3HJRA 3VHRA 2XY8B 1OEDE 4MGQA 5A80A 4TX5A 4H2AA 1NLQA 4E9KA 3NQHA 5JZGA 1ZZ9A 3ZN1B 2N7GA 5FBZA 3CIRA 4AYCB 1N32T 2XBO3 3DGTA 4GB33 2J1SA 4PBPA 3NNFA 2C0SA 4YSXA 3OPWA 4A6OA 3JD72 1HXS3 2WT0A 1XJAA 3NNLA 3WZ1A 1OA4A 3MV01 2LSKA 4WM8C 3CKHA 4L92A 2R0HA 2VQ0A 3W15B 3VZLA 3RI5A 4KBMB 1KXGA 1BZWA 4B1LA 3ZEFB 3TAYA 1UZVA 3ZT6A 3RJRA 3NRUA 4OHVA 1ZVFA 4IC3A 2ARXA 2DDUA 3DYOA 4H9PC 1JW6A 1ZV4X 4ZPIA 4WM8B 4WVZA 5B2GB 3I8TA 3ILNA 2LV9A 3KHCA 1YD8G 2BWCA 4GKXA 1U5ZA 4XILA 3ZCIA 1JU4A 3AVRA 5DABA 2BOIA 4O9EA 2NMNA 4XBFB 3ZFEA 4GOUA 1W6PA 4N8MA 3T4HB 2KM2A 2XQ3A 2A72A 4L9BA 3K48A 2A6WA 4BIFA 1HIXA 3RZLA 2P3KA 2B8MA 1HG5A 5H9SA 3EUHA 3NZQA 1OQEA 4AAXA 3QB5A 4OYKA 3IAPA 3T2OA 2VOVA 1E5RA 1EP0A 2FDJA 5J7MA 2WA4A 2Q9QA 3LFMA 2JDKA 4F8HA 2XHKA 4U72A 4Z8BA 4AVXA 2VCCA 1EY2A 4KHPT 1N3PA 3VBRC 2P37A 3UV9A 3AFGA 1MMGA 5CBLA 3WQ7A 4I01A 4HGAA 3AE6A 1Z6UA 5HXSA 3GF6A 2QBXA 5LATA 2XOMA 5HAXA 4CCCA 4PT6A 4DXZA 4P9GA 3M1HA 3JAEA 3POSA 5HBAA 1QJZA 3VBRB 3M99A 1GBGA 4I7CA 2D43A 2KWOA 2VW0A 3C64A 4UOJA 4A49A 1LU2A 1U5YA 1MQTB 1FPN2 2VMIA 2XQAA 3WR0A 4BE3A 4PCRA 3VB9A 2FDGA 3WAJA 4S2FA 5I93A 1SCSA 1NA1C 4D6RA 2WWUA 1AR83 3D0TA 4IT4A 1WW4A 2ZZQA 1EPWA 3V5SA 3MIDA 3BQIA 3K4AA 2Y60A 2GDFA 2MEV1 3SUBA 3N9MA 2VCBA 2WKKA 2XJQA 2D5HA 3WNXA 1NA1B 2PMWB 3VDDA 1UX6A 2X9XA 2ZEXA 2XL7A 3Q5DA 1AYN1 3TLTA 4CVUA 5KHIA 4IQPA 4FSJA 4AFMA 3JCFA 4A4CA 2W1QA 4JI0T 3B94A 2UURA 3U11A 3ECQA 4GALA 5F39A 1MR5A 3NRXA 4YFWA 5AFBA 4A0CD 2CU5A 2PG8A 3AA7B 4PI2A 3OPTA 2UUBT 3MEPA 1RUI1 5LGUB 5K8SA 1W8UA 2CM0A 5K9YA 5AQNB 2VURA 2RM21 4HL0A 4AGVA 2BVLA 4AF9A 4EWDA 4XAXB 3AECA 4YSZA 3C5KA 3AEAA 4CI1B 4CCMA 2RVAA 3OUHA 2Z5WA 5IFPA 1H7CA 3C3VA 3EBRA 2PHTA 4IL7A 5A7PA 2P3JA 3F57A 4ZI2C 5JSOA 3HN1A 2W2IA 2Y6HA 4HSJA 3HBKA 4Q5OA 5KC5A 1EUUA 1RMDA 4BM8A 2VQAA 2VD7A 4URTA 1XB9A 4Y1XA 5LG3A 1NLRA 2F17A 3IKWA 3W59A 4OK0A 3O1IA 3ZN6A 3ZKUA 3U1XA 2UYAA 4BLIA 2NZ9A 1TMF2 3MLLA 2XTLA 4Z90A 2UYBA 2YDSA 3FFZA 4LF5T 1H9PA 4CQIA 1KFYA 2BNNA 1AXKA 4E8DA 5EK4A 2HWD1 3JBG3 1SBFA 1YXWA 1JYTA 5JR9C 1I6ZA 3WSOA 1MMNA 5DAWA 1VALA 1S35A 3KMHA 3L1ZB 4PF1A 1LGCA 4QH5A 1Z0HA 1QJFA 5L3BB 3FZFB 1ND3C 4UWDA 3WP5A 2VC9A 5GKAC 5APAA 1K12A 4QGLA 3A23A 2X0HA 1BBT2 1U5XA 5JR9B 5ISLA 4N7UA 4PF5A 2YROA 4RD7A 5IWFA 5I8SA 1CVNA 2CMRA 2R6QA 2XOZA 4QXBB 2RMU1 4CP1A 1ND3B 3L39A 1H1IA 1W6MA 2ZGQA 1VBB1 2LXPC 1QOOA 3IHRA 1JM7A 3K3QC 1VCSA 4M3CE 1SDDB 2HWB2 3E5QA 4FQ4A 1YRZA 4WNKA 1REEA 1CHUA 2CYFA 3LZZA 2RJLA 3K51A 1BYHA 5CFDA 4CDUC 4ZHQE 3ES1A 2ZX1A 5DAQA 2PBIA 1U4QA 2C6SA 1YYNA 1J58A 2JE9A 3OGGA 4LFCT 4DFSA 1RUD2 3VDBA 2JD4A 1GANA 4JDMA 4CI2B 4KI5M 5DXDA 1WW7A 1DZQA 3M7AA 3WOGA 4CDUB 2XVGA 1H2MA 4KH9A 4ZZ5A 1ULDA 4Q4V1 5BNNA 3M3IA 2QTWB 4P5OB 4BH9A 4EN9B 3G7DA 2G4IA 2RDQA 2LTNA 3A7MA 1SCRA 2NOXA 3VBHC 2C24A 1ZOYA 2EIDA 3JB8A 2RS12 1VBD1 2LSYA 3J9SA 3NV4A 5HV0A 1UKRA 1V0AA 3T1LA 3ZN0B 4G3YC 3D8CA 3NKTA 4RFRB 1AL22 3ACFA 4EOZB 2PTMA 1JHJA 3VBHB 2YC4A 3RHWA 5HXRA 5LCWL 4DINB 1FMD3 5BY5A 1MZ5A 3C8XA 1VRH3 5FZ4A 5BNNC 4Q0QA 4IGOA 2ACZA 4PJNA 1DVPA 2CWMA 5AQUB 4CEWA 3UTKA 1XNDA 2PELA 4XEZA 1OKOA 1A34A 1S0FA 4HN9A 2LRKA 3P4PA 1XNRT 5L3DB 4XBQA 5L3GB 4AQFA 4P14A 1W2UA 3LG7A 5A3TA 2ZX4A 4UFMA 3VZKA 3K3OA 3S0MA 1HW5A 2ZKNA 1UMIA 2ZHKA 4CUCA 3IDCB 1G9DA 2N1GA 2DLRA 4PQQA 5F1RA 3E2DA 1W9WA 2NQYA 3CL1A 1PVC1 2OXBA 3RZZA 2AEYA 2QQKA 3FZKB 3LQIA 3C98B 3T08A 4HFHA 1O3TA 3ZSSA 2JICA 4CEWC 5L36A 3BI3A 4MGIE 1EZ3A 2YYOA 1RMU2 4AQFC 1AXYA 3GV4A 3S7EA 3ZIWA 3LB9A 4AQ6A 4Y24A 3AZZA 1CHCA 1MMAA 5FP7A 4MXWA 4RL7A 5EP9A 1RHI2 1LHUA 2Z79A 1BR2A 5JSPA 5A3OA 1W6NB 5EIYB 3A4UA 4BQXA 2VVSA 1CAXB 4IEZA 2NMOA 3AE4A 2DJAA 1ND2A 2CV6A 1FYUA 2TEPA 3HIFA 3SCHA 3QNUA 2RG4A 4MSVA 3T2QA 3AZVA 2ACXA 4LF6T 2RS53 4IXLA 5CIRA 3LA3A 2CRWA 3IAQA 4JVAA 2VECA 3N7KA 3B13A 1CAVB 5F37A 1O3SA 1T6BX 1WILA 2J62A 1J3PA 4MH0E 1SEFA 4LADB 1UW8A 4F83A 4WBOA 1ZBE3 4PLNA 4QQ2A 1LU1A 1PZ9A 4XPVA 4X66T 3MYXA 4XUTA 3CQCB 5JOXA 4NPLA 4HVQA 1ZRDA 4MXWB 3OJBA 4OHZA 2E33A 3E6BA 5LY1A 1ND2C 5A7QA 1SLLA 2RPAA 5FYUA 4AVVA 4EE2A 1W2NA 5TBNA 3ZFGB 1UAIA 3CF6E 2Y1MA 2WO2A 3KLSA 1HN1A 2CBJA 2YYRA 2FMDA 5C4WB 3FX3A 5ABHA 1MVEA 1RJ7A 3ORJA 4MGSA 3UKTA 4BXFA 1T1HA 1D0XA 4P08A 2QCSB 3MW4A 1SA0E 1RUE1 4JI7T 2IDOB 3SCGA 1NWMX 4CZZB 1ZM1A 4Q4W3 1WBFA 3S5QA 3WDVA 1YQ4A 2I45A 2K4DA 5HEGA 2BGOA 4J1WA 1CGPA 3CWZB 3LAGA 4QXCB 3VV1A 4HTEA 1JZ2A 4RGGA 4JTNA 2GC0A 1AZDA 3M3EA 2MNGA 5G05B 3WXPA 2CWSA 3P4WA 1VAKA 2OIIA 1N3QA 3CMLA 4HVRA 1HJGA 4CDQA 4H63H 5BPXA 4RHV2 3VZNA 2LSJA 3HQXA 2F4PA 1O3RA 4FAHA 2XSBA 2QUOA 5FDBA 3BOWA 3ELNA 4JKMA 2DU0A 4B7EA 1RUF3 1V9U2 4XDQA 2GK9A 1US2A 3FUOA 5FZGA 5EHDA 1WR0A 5A1LA 3R6SA 4AXPA 5AQLB 1VMJA 1D0GA 4NRPA 5C3OA 5L3FB 5ABGA 1IGOA 4QH4A 4TNWA 1BMV2 1L0VA 4CN4A 2ZTNA 1VP6A 4LKAA 1FEWA 4JC1A 1JYWA 3VBUA 1POV1 3KQ4B 4I30A 2QRXA 1PMIA 4EV6A 2YUCA 1QLBA 4YABA 1MS9A 3C7EA 3FMGA 3PJAA 5FY8A 4LOSA 2ZLYA 1X8EA 2EICA 2ZZJA 2QVAA 5FY1A 3IZOA 4JHTA 2PAKA 5LA2A 3RPGC 2IZWA 3MGUA 1MPXA 2F6BA 3RJ2X 1AR71 3UKNA 3P6BA 4QPGA 2CXLA 4OHXA 3HKBE 2CDPA 2DWGA 2J1RA 2YREA 4QU2A 5LKXA 4KQ7A 3L09A 4FFIA 3WNLA 4IC2A 1U12A 2FFWA 1G25A 4FCAA 4XFFA 3ZYKA 5AVPA 2ECVA 1OXZA 1V6NA 2VVEA 1YKEB 5FMDA 2Z4FA 3KT4A 3VBUC 4Y5Z0 4NOTA 2MUMA 1Q8SA 5LBFA 2DVAA 4AQYT 1ZRIA 5L2LA 3NAPA 1MBMA 2W63A 2P4EA 2FCTA 1WEWA 5HCHA 3BB6A 1KS4A 1G7YA 3QACA 5FYHA 5JXGA 4YW1A 4IGUA 3R4UA 1BCXA 1I3HA 5CISA 3RYFE 2D0UA 1UZYA 3B00A 4M3CF 1EV12 3DPLR 4YG6A 2WSVA 2FCUA 5FYYA 5JMCA 1R093 3TOJA 1GP6A 5AQHB 2A73B 4INDA 5FYIA 2X10A 3F2ZA 5H1TA 3N9NA 3CKDA 3KV4A 2KWHA 4UV9B 5AQOB 2E8IA 4LUMA 2JB8A 4XHBA 2WSSV 3U4XA 3SHBA 2BBAA 3ZN4A 5HXHA 2BKNA 1H6XA 2I07B 4C90A 5AQKB 4WA6A 3IN9A 3S6PA 2GNTA 1SHZC 4FPGA 1X4JA 2RE9A 4IETA 4LK9A 5IATA 3SFEA 5T55A 1ODMA 2Q8EA 5LXTE 4IEWA 1D1AA 1LEMA 4BQ2A 4COWA 4S2GA 2AREA 4QB1A 4CDWA 4X3GA 4GNGA 2DURA 2OPWA 1QNWA 4GKJT 2D6LX 3MIHA 4FOYA 3J8F2 3KCYA 2ZAAA 1FMWA 2VY0A 3JUEA 3KBUA 4P02B 1HLCA 4H9DA 1YWKA 2XPKA 5CADA 4QQPA 4DEQA 2CT2A 2MEV2 1OEDA 2JEMA 2R073 4ZZ8A 3SS1A 3SC7X 4I43B 2XJUA 2YZ4A 3O5SA 1TME1 3EDVA 3TLWA 1YQ6A 5JPNB 4ES9A 1AYN2 1JODA 2CRRA 4BJ0A 1WMDA 5LK5A 4UW4A 4LF9T 5HXVA 2LOSA 2CGNA 3OPCA 2XVLA 2DCKA 3AFKA 5DG1A 3LQJA 1DBNA 2D8SA 1H4HA 4LBNA 2WNUB 4C1XA 2FDKA 1JUIA 3OD4A 1NKGA 4CCGX 3VD5A 2J47A 5FPZA 2E9XA 2FDFA 5T5PA 2AEZA 3MZKB 1NG0A 4TTGA 4TUYE 1MVQA 5AQJB 2LM9A 3KB5A 4LBLA 4A4BA 4U7IA 5JR7B 1PZ8A 5EPAA 3VU7H 1IS5A 4ASMB 5CU1A 5CKMA 3UT0A 4HWFA 2YC0A 2BYVE 3LK2B 5H1UA 4YHJA 4W6WA 2X9YA 2YK0A 2D97A 4UFKA 4XTMA 4NVPA 5EWSA 2WC2A 3N9QA 1H8VA 4I50E 3AEFA 4BLJA 5CB4E 1UCUA 4DY5A 1YI9A 2JDUA 2E9XC 1WMEA 5ETWA 1PX3A 4XXPA 5JI7A 2CXDA 2GP5A 1EUTA 4QU1A 4DV7T 5KR7A 3OGJA 4K21A 3E6DA 5JOYA 4NXNT 3ZDSA 3A8YC 4OYUA 1S0CA 3T1MA 3THTA 3PUQA 2R6GF 2XLFA 2DYCA 3RG0A 2W5FA 4K20A 2MD8C 3R4SA 3ZC1A 2C5KT 3G06A 2E32A 3B3QE 5DZFA 4LO6B 3B01A 5LASA 1O8PA 4H7MA 3C4WA 4L0PA 1U0AA 2W1SA 3EQEA 4QKBA 4NIIA 4YTNA 3THPA 5C8CA 1R081 2BBJA 2OQ7A 1XC6A 2DCFA 5IAXA 4AI2A 1ASJ2 4M0NA 1IPKA 1RVF1 1QOSA 3HNMA 2VKDA 3N9OA 1BK1A 4CCNA 5FVLA 3ABVA 2D3RA 3OYWB 2I0MA 1RGSA 5FREA 4GMP3 2VUAA 4U2YA 3UUNA 3MLJA 3VBFB 3RS6A 2VPVA 5KMGP 4BHPA 4ZHNA 4Q27A 2HEYF 4ISRA 4DR6T 1LHNA 1W8HA 3JAFA 3TEYA 3DQVR 4S2DA 5C8CC 3IDEA 1YNAA 3ZMTB 5LOVE 3GBWA 2WBLA 1DCSA 1DGRN 2OX0A 5FZCA 5L47A 2JIWA 2IXKA 1YJLA 5I0RA 3MKDA 4DUVA 1HJFA 1RUI3 3WEZA 4H9OC 5IFTA 3T30A 3KS7A 1MIVA 5DDJ3 2EODA 5GZDA 3WF2A 5FZ9A 2WZHA 3OBVE 2RM23 2X5IA 2GU9A 2VPEA 2NTYA 3MIBA 1RUH1 5F5QA 1VBD2 3E5XA 4QB2A 4AHZA 1WENA 4LULA 1UL9A 4FIPA 1VCTA 3KCXA 3N7JA 2A3WA 1WEUA 2LXHC 4Y5SA 3OB8A 5AITA 3KQIA 3OBTA 2XJTA 4QGNA 1Y9QA 5BUVA 3SCFA 4G4FA 3ETQA 1DLCA 3VR8A 5FQ0B 2EHOA 1J84A 1Y01A 4WVVA 4AVCA 3V0BA 4NWVA 2ADEA 2XDVA 4YGDA 4KL1A 3ZO0B 2KA3A 2G1MA 3BQLA 2H0DB 3C7HA 3FLPA 4DIQA 2YVRA 3SLIA 1LODA 2V6YA 4HKLA 3SH3A 1CAUB 5JMOA 5D1KB 1YKHB 2LLYA 2KXPB 4BZ4A 5JVVA 5HXCA 4HKOA 5TDWA 2WNVA 1KF6A 3GZEA 5GZEA 2RDSA 2VM9A 4QWNA 5FUPA 5C8YE 3RIFA 3KWVA 4RS5C 1UZZA 2G43A 4XUNA 4TWDA 2LRLA 1FNYA 2XWJB 3L8RA 2YXSA 1HDKA 2VZ3A 4M4RA 2HN1A 4JZRA 3AXJA 1GU3A 4Y33A 2HWE1 4CU9A 3ZYRA 2HWD3 4MZUA 1BEV2 1W0NA 2WQZC 4GXLA 3ZYMA 4RS5B 5GLWA 2HH7A 4L0RA 2MOZA 5ABJC 4UP5A 4QDQA 2CGOA 5JG6A 3J4UH 2Y64A 2WNVC 2HYED 4KU7A 5IVEA 2ZGUA 2C1FA 1N47A 2BKPA 1WMFA 4QM8A 3OPZA 5LJMA 2WO1A 5CB7A 3WG2A 4DNYA 1YUDA 2EIEA 3DYPA 2ZCWA 4E4ZA 1VIWB 5G04B 4L2NA 2MBGA 5LZ6A 5ABJB 4X1YE 2RMU3 1R64A 4OMCA 5IK4A 4COFA 2VG9A 2RDNA 3FE5A 5DN2A 1GR3A 1VBB3 3GDBA 5LHHB 1MEC1 2R043 4DR2T 1BK0A 3APBA 1D4M1 5LMNT 3JADA 2NN8A 3P4RA 2AC1A 3WLUA 3O7AA 5LNKA 3AB3B 1O4ZA 3E08A 2VR4A 2QDNA 4BK4A 3R05A 1KGYA 1RUC3 5C13A 1AR61 2WQ4A 3KT7A 1HQLA 1VBA2 3ZPV1 3SEPA 5JVDE 2MA6A 4PLOA 2ZMKA 4IEUA 2XXZA 5GZCA 4XW3A 4ZS3A 3LOBA 2HHHT 5FTTC 4FI9A 3RMYA 1KNPA 4ZU5A 1QHDA 1DYKA 5JDBA 4EN7B 2XOYA 5F3EA 5FWJA 3MK7C 4BQ3A 4FPEA 3TEWA 5AQSB 4AEDA 4LMLA 1ST8A 3FXEB 2AACA 1EAH2 1RJ8A 4Q4V3 4PHZA 5IT6A 5JPMB 3FUQA 4QHOA 4A3ZA 4GKKT 1Z60A 4LORA 1OA2A 4DXTA 2W47A 4P00B 3Q1DA 3DYMA 5L19A 4PIYA 3R84B 3U37A 3LBXA 5L9RA 1GFF2 1XYNA 3TNQA 1QIQA 1KD7A 4FVVA 2IHR1 1O4TA 1NEKA 2DUPA 1YFUA 5IAVA 3D3AA 5IWAT 3NBXX 2K48A 4I09A 3JB4C 3ES4A 4YWAA 2XAHB 2PN5A 2BERA 4K7JA 1OT5A 3OGSA 2XASB 4LT5A 5A6ZA 2ZM2A 2Y6GA 4AEDC 4B3ST 2RI7A 4CUGA 4AKGA 2EVXA 4QKNA 3F31A 4CXXA 3LF7A 5A6YA 4O4IE 4F7ZA 1RUE2 1K5MB 1QU0A 5JR2A 4HKWA 5B4NA 3FBYA 4B8EA 1ZZCA 3AKSA 3EXUA 4BCUA 3V0AA 2LGKA 2KREA 2IXIA 1AX1A 4Q8KA 3T6RA 2BG9A 4F1PA 4R8HA 1D2QA 3MJXA 3MACA 3OGVA 4MV2A 4AE2A 4FTBA 4A3XA 4EZHA 2Y33A 2YBPA 1BR4A 4GA9A 3C7GA 3RI8A 1W8FA 1VJ2A 3I2OA 3O1SA 4V3KC 2DUQA 3QC9A 2OKXA 1ENRA 1S2BA 1W06A 3C51A 1PVC3 4XZCA 4IE7A 2R16A 3Q8CA 1GUIA 3POGA 3UKVA 2XBO1 1BR1A 3N4MA 1AR91 4ES8A 1C8NA 3I1AA 4PW8A 4TZDA 3RFRA 4OHWA 2CWOA 1MS3A 2BG9C 1IPSA 3PUGA 4QHZA 2ZKLA 2V6XA 3VKNA 3LIHA 2B7YA 2QA7A 3DCQA 5FYBA 1JZ6A 3GBFA 3B93A 5A32B 2VBPA 2LGGA 4TV9E 3IMMA 2BG9B 3FZ3A 4XABA 2YFUA 5JDNA 1S2EA 5T54A 3PE0A 4IEOA 2BNMA 4NIAA 1XNQT 4QX7A 3KHBA 2JG9C 1GLHA 2CHHA 1C1LA 2R49A 2QVSB 4YVWA 3AYDA 1ZBA2 4J6GA 2ZGTA 4JEUB 1E5HA 5ACA3 3MF6A 1CX1A 5FP8A 3H42B 1VMFA 3CQOA 4XI1A 4LHSA 4MGYE 1N36T 4K1ZA 3T0AA 2WT2A 1OD5A 3UJQA 2JG9B 1HB4A 5G05L 3RKOA 3AK0A 4LBMA 3ZXLA 4NUUA 1N87A 3ZYHA 4B6XA 3NL1A 3TEXA 4DV4T 3DXTA 3GHNA 4L58A 4BJNA 5K0UA 1XU2A 2RS31 2FUPA 5HEOA 3AB0A 1F4AA 5EXOA 1UOJA 2XHEB 5A1FA 1O6UA 3GWHA 5FZOB 2VNOA 2BNOA 2KGGA 2KFTA 3Q8FA 4Z2WA 2VUDA 4D94A 2Y38A 3H8RA 1LOGA 2FD8A 1HNZT 2VL0A 3E1F1 3LA7A 4QKDA 2LN0A 5CFCB 1PIV1 1Z7S2 3KDEC 2XZEA 4FOWA 1JYIA 2X67A 1JOPA 1SFPA 3MUZ1 3AYCA 5GJ6A 1V6MA 4A6SA 2WLPA 5FZBA 1LNSA 3ZFFA 2QE3A 2DVFA 3AZXA 3ZXGA 2ODVA 3LQCA 5K0UC 3MIFA 1UF2C 5ABFA 1KFXL 4AQGA 2V5CA 4UFJA 1IPJA 3BUCA 3FL7A 1OF3A 5FBJA 3ZMOA 2XSAA 1V6LA 2V4AA 2QJ0A 3ZMUB 1H8TC 2W62A 4KI0F 3QZVA 4XFGA 3AE7A 2PQSA 2VJEA 4XMAA 2EGPA 5F2SA 4OHYA 1Q3EA 1YCIA 5HCFA 4D6QA 2L7PA 1HRI2 1V9DA 4K0KT 2JDNA 1ZZ7A 1H8TB 4HFVA 5LBCA 1LTEA 2AUYA 5A3WA 2K46A 1O5LA 5FZ6A 5B75A 4BXSV 4S2HA 3LEMA 3ZFFC 5F3IA 3BALA 4MLOA 2KMFA 3BPZA 3MHHA 4GH4B 1LJ7A 4GK5E 3AP4A 1ZKEA 1AJ3A 5AFEA 4IGPA 3RYCE 2RP4A 1HB3A 1YQ3A 1QXPA 2PYTA 1JUHA 2C2VS 2NW9A 1OLQA 4BWOA 1OSGA 5HWYA 3ZFFB 1S0GA 3T3YA 3V56A 1YQCA 1C28A 1NCRB 3VBOC 3ST7A 1TME2 1POV3 1DGWX 3HWJA 5HCBA 4IDQA 1MS1A 3Q2MA 2HYXA 4EGWA 4KWLA 1X7NA 1CPNA 2G0UA 2XM1A 5M0TA 4TLFA 4Y4RA 3O35A 4DPNA 4BPZA 2KWIB 1AR73 3VBOB 4FPJA 3T0BA 4LKFA 3WDWA 2VNRA 2V1DB 2ECTA 4KMQA 4CXWA 4DUZT 1MS8A 4BAYB 3S30A 3M3OA 2CSVA 4I7DA 2D98A 1VMHA 5JOZA 1W9YA 3WY6A 4XJ8A 3JBG1 3LDBA 1DF0A 2ZGKA 2N9DA 5A3LA 4QPIB 1UYXA 3NV3A 2OPKA 1QJX1 2L80A 4C0BA 3D6EA 1G86A 4Q0SA 2PLV1 1N1TA 3S7IA 2DL1A 3WQ0A 2HH9A 2WDBA 4IV3B 1RYYA 3ILRA 5FY9A 5HEUA 5KH3A 2V5YA 2H88A 2MNYA 5JDQA 2WMOA 5CKQA 2GH8A 1SFNA 3KV6A 3MHSA 5JQGE 3U78A 4FTSA 5LW9A 2UUAT 2FDHA 3L2YA 4HOOA 2V7MA 2TUNA 2JQHA 4LXLA 1KQRA 4GKYA 1RXGA 4LO5B 4P0AA 3ONLC 4CEYC 5JOWA 1PNFA 4JV5T 1QQP2 3WD5A 3LQHA 1ALYA 2IVJA 3NO8A 5D1IA 4NPRA 4FAGA 1HG2A 5FZHA 2K16A 4NMIA 3AA1B 1NXMA 4LA2A 1YIFA 4UAPA 4PK6A 2LW8A 4IEXA 4CEYB 4Z82A 2W0XA 4L97A 3I2HA 2WM9A 3OG2A 4O64A 4YVSA 5ANNA 4Y22B 3VDAA 1SACA 3KV9A 4DRVA 3EB6A 2X29A 2GC3A 2P2KA 3QH7A 2E53A 1AF9A 5HEHA 3HAGA 2ILMA 2XQ4A 3CX7B 1RVF2 3CNAA 4QDSA 3LK42 4HK9A 2F6NA 1PZ7A 4ISTA 2OZ6A 4QX8A 3AMQA 3O1VA 4ORFA 1WEPA 1YLLA 3PLWA 2VKJA 2RA1A 3ETPA 5FYVA 2IVIB 2VMGA 2R32A 2KSRA 4WM7A 1FOD1 1G6NA 4YJ2E 1NZCA 2YGMA 4RQPA 5FL1A 2MNZA 4AOCA 1WYBA 3HEIA 5FY0A 3R6NA 4SBVA 1DLLA 4XURA 4CN6A 2H89A 1XBFA 2ADDA 2FHRA 1W6QA 1GWMA 3AL5A 3N5LA 1Q5OA 1HX8A 1M7KA 5EQUA 2EXJA 3B5LB 5E16A 1HYJA 4LITA 1GP4A 3HD8B 3OYXA 3ZXAC 2XKPA 3ME2A 4FPCA 3JUUA 4WBNE 3BK9A 5FXZA 1VFYA 4BQYA 3A0NA 4WM7C 1D1BA 5AC92 2B76A 2YDRA 1G9CA 3EHZA 4KBZA 3O70A 5FY4A 1VYXA 3MA9A 4H9QC 4P1NA 2FJEA 4GB0A 1RUJ2 2ES3A 4Q0PA 1PK6C 3VKHA 4CU6A 2E26A 4DZGA 5A33B 4HPKA 3IT8A 2Y6KA 1DZTA 1IOAA 4A7KA 3IBPA 2VP7A 1FT9A 2FBEA 3WF3A 4WVMA 2Y43A 2Q4SA 4FPHA 1C8M1 4CUAA 5L7OA 1UIKA 4AI3A 1PK6B 1TNFA 4NPPA 2L43A 3BYWA 2RSDA 1WR6A 4IE0A 3P8CD 3JZVA 5FYZA 3HCSA 1URXA 4IERA 5M4YA 4CCDA 3RVHA 2WQYA 4IHJE 1J5ET 1ULOA 4YT0A 1ZZ8A 3OBRA 1UCXA 1VBC1 5TSWA 2HWE2 5T52A 4YM1A 5FPVA 1CX4A 2VW1A 1CQ9A 3WUCA 1CD3G 2Y6LA 2H3RA 2JG8B 4A41A 3MO4A 4D6SA 5KHGA 1RXFA 2Q1FA 2XQ6A 1PO21 5L7OC 2BZBA 2W67A 1NAEA 2W0GA 4R7EA 2B42B 4Y5TA 4XFHA 2YMZA 4WZ2A 1H9WA 4WVMB 4Q1PA 1R083 5I91A 1WFDA 1PGL2 3Q5EA 1QXJA 5DPNA 1FBVA 2PHFA 2OS2A 4LBQD 2Y26A 5FO9B 3HI2A 1JZ7A 3J9X1 4PJYA 2B39A 4GNFA 1JZ8A 4NJ4A 2W66A 4N78D 1E4UA 1B7TA 2VB6A 3IDAA 2N2NA 1Q8VA 2WU5A 2JMDA 1H4GA 2HWF2 4B4RA 3AMPA 4LHKA 1N33T 2HN2A 4XIOA 3PVNA 2CE7A 2FZ2A 3I2FA 4A56A 2C9KA 2VPGA 2JJ9A 1US7B 3TN91 4ATFA 3FC0A 3HKDE 3FANA 5KWRA 4HVOA 2JDMA 1WCUA 3PUAA 1S55A 3O1UA 1LULA 3ACLA 2HWC3 2XJRA 1UGOA 3AKTA 2XQ9A 4DOUA 2XGXA 4W4ZA 4YZ4A 1Z8UA 1LGNA 2WIIB 2DWRA 3X29B 2KXLA 4YGBA 4AISA 4XJ9A 4CI3B 5GLZA 3CZJA 4COUA 5JDHA 1IHMA 5JDFA 1IJ6A 1RL3A 2VL8A 3ZSJA 1YO8A 3PVEA 3J7NA 4CE8A 3MPBA 3N3HA 3ZCJA 4NAMA 1IG0A 1RUH3 3LEGA 1K5JA 4OUMA 4Z92B 5L9BA 1W28A 2M67A 1A3KA 3ZMNA 1JI6A 2ECWA 4N7IA 5G04L 3ONJA 1LDJB 4LEJA 3MI8A 3GN5A 4ATEA 2CLYC 3GZAA 4E2GA 5IYZE 2JJ6A 2WS92 4Q4Y1 3AKQA 4CA9A 4CDXC 1D2SA 3I3EA 1GZWB 4JQRA 2D6NA 4P9JA 3EB5A 3QBQA 3WNMA 2CLYB 4JGYB 2IFRA 2XVKA 3ZC0A 3ZX7A 1I6XA 4HKAA 1F62A 4RR3A 4AI0A 4CDXB 4MVTA 4YATA 1XE0A 3RRWA 5JIUA 1NQJA 3ZR6A 4FFGA 5FO7B 5B77A 1AYM3 2ZPXA 3KINB 1UNBA 4NRQA 1N34T 1AJOA 4LBOA 2XBO2 2X0YA 3N35A 4GB32 4MGZE 2Y34A 3AXEA 4XUOA 4RN5A 4OUSA 3KBTA 3KZ4C 2DCYA 1HXS2 1J1JA 3WHTA 1JZ4A 1ZREA 3KDSE 1LGBA 1XXNA 2ENRA 3IB3A 2VVFA 4AUQB 4UW6A 2KZ7B 2K1JA 1GQHA 1HRV1 3KGZA 2VTXA 4AKHA 3PU3A 4PJMA 3MPPG 2QQMA 2MHFA 1UYPA 2D5FA 3ACIA 4F8AA 2ECNA 1MEC3 4ZUXU 4RYDA 5LP6E 4LMJA 3QD6A 1LDKC 2PHUA 1D4M3 5FZ7A 2IUBA 2DCZA 5DMYA 1Z0PA 4WVWA 1AVBA 3ZYGA 2OA5A 1AR63 4Z0OA 3V5UA 3OEBA 1UX7A 2R1BA 5FKCA 2HYKA 2OWAA 2E31A 5BR8T 3QH6A 1UKGA 1NXD1 4B3RT 3S5AA 1QDCA 3PUHA 2VZSA 4LBQA 1LOBA 2QQIA 4QXHA 5CA0E 4AQ2A 4YJ3E 4XJWA 1ZRFA 4BB3A 1KJRA 2BDRA 2V09A 2EIGA 1ZZ6A 4AI8A 3W9AA 2E2AA 1QUUA 4XOGA 3LKJA 4HFCA 4DMIA 4FI5A 5IW0A 4H9SE 5AQIB 2IUWA 3IWZA 4IEVA 1KDMA 4DIDB 2NM1A 1UURA 4AYCA 1J83A 3UFGA 2TBVA 4IEQA 2XQ7A 4LHNA 2UXCT 4TWFA 1QH7A 5ADXL 3ZVXA 1XSQA 2LDRA 1NY72 2QICA 4LJHA 4ZI2D 2JKXA 1O3XA 4MHCA 4OUEA 1WZXA 4HZFA 5FOBB 3O47A 2YKSA 1G9AA 4LO7A 2XQYA 1AR82 4B1MA 2RV9A 3DKWA 3AJYA 5F3GA 3FZLB 3NWIA 4H63V 3GMIA 2FCVA 1XMQT 2MAWA 2JE8A 1TNRA 4Y3OA 4OQ8A 2DX8A 2VGDA 1JNZA 1MIWA 2VU9A 4JGZA 1DQ4A 4WM8A 4UR9A 2CWYA 4LIVA 1YW0A 2X53S 4O2BE 1Y43B 2E6RA 1GKBA 1OC1A 4A7YA 4KWKA 2K9ZA 1IZ3A 1T2XA 1HV1A 1FNZA 2WA3A 1CPMA 3ANWB 2LKHA 2ZGOA 3DUIA 4LLOA 1UOBA 2GAUA 3FBMA 4W4UA 2ZJCA 1TZOA 1G9FA 3I9WA 2WFF3 3OYZA 5FXWA 2Z2SB 4E4DX 4FBFA 4JYAT 1OLME 4KG8A 1AR93 2IC6A 3SKJE 1LCLA 2FD4A 5FB1A 1UWWA 3WHUA 4NE9A 3HT2A 1UQXA 4FQZA 1MNDA 4QT6A 4JGZC 2A6YA 1UU4A 1UPIA 4MO3M 5LA9A 1IS4A 2BP6A 3WCRA 3IIIA 2NAAA 1ENSA 2XOCA 4IEPA 3WX5A 2CEAA 3LSVA 3JXSA 2XQ5A 3PVBB 3E5UA 1BORA 5C3JA 1W09A 4MFRA 4R4ZA 1Z78A 4JTOA 3HA4A 5C11A 1F2NA 4JGZB 1VBE3 4XC9A 3VBRA 2LGVA 3NWKA 2IXHA 1O7FA 3ZYLA 3NKGA 3M8LA 1YC61 1MQTA 3KV5A 4N43C 3RGBA 3EAMA 3FLTA 2E5LT 2LHRA 3IBMA 2FJAA 4BDVB 1DYOA 3GNEA 3P7IA 4TXWA 4LPLA 5FR3A 1HNXT 3LDRA 3LRQA 1VAVA 4K6BA 2PFWA 3DN7A 2QQLA 4XZPA 4N43B 3JBG2 1B35B 1WW5A 5JDLA 3ZPYA 2JDYA 4PNIA 4AI1A 4U7YA 1S2KA 1CJDA 5BMVE 1NA1A 1G8WA 1MS0A 4DEVA 3PDQA 4AHYA 4MYEA 3D0JA 4PK4A 3VL8A 2RS33 4CUBA 2LAUA 5DUUA 5T3NA 4DXSA 2GC2A 4O65A 2PJQA 1BQPA 2EXIA 3MIEA 1MQTC 5JUVA 2VPDA 3I2IA 4I0AA 3S57A 2HPLA 2R30A 5F8PA 5FZDA 1WGMA 4EAHA 2WRAA 1BR0A 4IDPA 3SISA 4Y1ZA 4EN0A 2D3PA 3LPFA 1C5IA 1PIV3 3AA0B 3ONXA 5JREA 2ODUA 4IV1C 5JXHA 4GJZA 1R1A3 4GMP1 3UYJA 4PDWC 2ZHLA 2KE1A 4UW3A 1F5JA 1V6OA 4YM2A 3THCA 1ULGA 3VRBA 2ZGSA 4IV1B 5IVCA 4HXCA 1LOFC 2B0OE 4UYBA 1NYWA 4TV8E 2PQQA 3R0RA 1X4IA 3PV0F 2D6PA 2GNBA 3RPQA 2YHOA 2BWAA 1HN0A 3KF5A 4PDWB 1LAJA 2KWJA 5JAXA 3GJAA 1FI2A 3CIHA 4XIKA 5AFUL 4CP2A 2QQOA 4C9ZA 1GNYA 3FL2A 3WNOA 2ZACA 2XAFB 5FPBA 2V72A 3ABZA 1OOPC 5DDJ1 2P6HA 1WEQA 3JD71 1WKYA 1FJGT 1HNWT 5F6LB 3AKPA 1X33A 5FAXA 2VZQA 2ZHNA 2DBIA 4Y20B 2L9QA 2XUEA 1NLSA 1UYYA 3BVCA 4E27A 5JSRA 3ZSTA 1OOPB 1PGW2 5L4EA 2E5VA 1ZA7A 5JR9A 3RSJA 1FMD2 4JI6T 1JN2P 1W8OA 1VRH2 2K5BB 1SLCA 4NUBA 4QXBA 1JXNA 2J4GA 5D1LB 2H7VC 1ND3A 5FPLA 4FP2A 1WD4A 5FP4A 1WEMA 5D2AA 2EGMA 1W2TA 5B76A 5A3PA 4RGKA 4JI2T 3RZHA 2ZM6T 2WBKA 2R063 3GBGA 3SFDA 3PTYA 1LKXA 2KYUA 3ZKRA 5FZEA 2RR4A 2WZIA 3ZMZB 2K2SA 1Y9MA 4X20E 3K1SA 2Y8DA 3WW4A 4OI2A 4FTEA 2VTXJ 5LCYA 4KWJA 4WZ3B 4ILBA 3ZSLA 1QJX3 1YFYA 4DNDA 1VR3A 4BJMA 2Q0AA 4YXDA 5LRSA 4YZ5A 5FKYA 2ZX3A 2PLV3 2BDEA 4AR2A 4DR4T 3EHKA 5AQFB 5KX5E 1RITA 2BEOA 4EN6B 3UU8A 4YC9A 2QIZA 4CDUA 4NN0A 3ITQA 1OD3A 5CGMA 3AP6A 2JQKA 1FATA 2FSAA 3CLPA 4DVDA 1HB2A 1OMIA 3I7DA 3PIJA 5IVFA 2K17A 3M2MA 3ZXDA 3OTOT 5BNQA 1FPN1 3EDUA 1MACA 4K40A 1JTZX 5I0TA 4LFBT 4UI9L 2ZGMA 2WQ8A 1F5FA 1W0PA 4EQVA 2LQ6A 3H8XA 4I55E 4L99A 2UY9A 2MT5A 3VKLA 4DBQA 2R041 4PPEA 4GK0E 1CONA 4EN8B 3IA3A 3K4ZA 2QQWA 3LOIA 3NNJA 3WDYA 1WUVA 1MNEA 1RUC1 4SLIA 3VBHA 1CAWB 5FYCA 2K0GA 5FJKA 1D0HA 2AGSA 4Z1VA 4P9IA 3WG4A 1CJPA 1UY2A 3RQUA 3KCCA 2R0FA 4HLTA 4FPYA 4ARYA 4DV1T 3BGAA 3OEAA 4L11A 4XETA 1RUG3 2IXJA 2RS52 1XDPA 1QGLA 1WA4A 5DG2A 3V64A 1TG7A 2CSZA 3LJUX 1LESA 3WNPA 3K77A 4X8PA 3ZPVE 2J1UA 3CDZB 1HTJF 4YPJA 1A78A 3I3BA 4AVBA 2LRIC 1ZBE2 2WLQA 5GONE 4XFAA 3I49A 5SVXA 2A75A 1RUNA 1UK5A 4FXGB 4NAOA 2E61A 2C5IT 1VAMA 3ZYPA 2J1AA 1ZX5A 5BNOC 4AHXA 1O8SA 1S4CA 1DFQA 1FOD3 3FZMB 4QPYA 2VQUA 3KQRA 3ZVZB 3RI9A 1ZNPA 3UUMA 4AVSA 2F4LA 4EEDA 4QF2A 3N9LA 1UZWA 5L73A 3ZYIB 4EROA 3DPRC 3B02A 2G6QA 5BNOB 2A6XA 2JDHA 1BVP1 1WLCA 4AYUA 2YSJA 3H1MA 1UO9A 1JBCA 4D69A 3IEEA 5FYMA 4CN1A 4Q4W2 1HYIA 1SZBA 2B46X 5LBQB 3POEA 2EXUA 2ARCA 3UNPA 1SMVA 1GOHA 1X79A 4HONA 2OT7A 5DUWA 1TMF1 1X9PA 2BRTA 5FVKA 5CNAA 5DQ0A 3DPRB 1CUNA 2KNDA 1W6NA 5LGNB 3POBA 3P5BA 1GZCA 5TABA 1JH5A 1GOGA 3J7Yq 1CAXA 4NXMT 1WCSA 4COYA 4QB6A 4EWEA 3X1DA 2JD9A 3VZMA 2BG9E 1IBKT 2F42A 4CCKA 4OHFA 3SH5A 5CAZA 2YU4A 2JUNA 1OVPA 2C9AA 5KHJA 1GQPA 5CKNA 5KH9A 4U74A 3U75A 2VK9A 4WBBA 4L7XA 5AIUA 1F15A 1BBT1 5LA6E 1RUF2 4I0BA 1G73A 4V2WA 1C8M3 2WCAA 3NJVA 1XNBA 1UXXX 1CAVA 2C4XA 5FZ1A 4TN7A 2D8UA 3Q9DA 2C26A 3M3QA 3O1TA 5A70A 3HQRA 5D8AC 3HT1A 5IK5A 4HFBA 4HFSA 4QD2A 5ERLA 5C71A 2X9HA 1O3QA 5E8AA 2E7AA 1W0AA 2QDRA 3LK3B 2YHJA 3OY8B 2VXJA 1ONAA 4Z07A 4PFOA 1APNA 3MFAA 2IMLA 2XQXA 4JI5T 2XONA 3ZFGA 3AJZA 5F3CA 2UWAA 5T50A 4OYJA 2BTVC 5ABEA 4A7ZA 3BCWA 5D8AB 1V6JA 5D21A 4X5TA 1VBC3 2WZPP 1LR5A 4OFZA 5SVIB 3NJXA 1ZA4A 5C4WA 3MUY1 1EYBA 1STMA 1X50A 3H7JA 4H9RC 3T2TA 4GWMA 2RR13 3KNVA 5FZAA 5I8YA 5ACA1 2WS3A 1PO23 1I1EA 1E7PA 5JRCB 5HXMA 3H37A 5C3QA 2K3WA 3W5NA 2E7QA 2CHNA 3DWDA 3RYPA 3O9XA 2YC2A 4W6YA 4OGCA 3FHNA 1QY4A 4QXCA 4HG6B 5FMOS 1N1VA 3KF3A 4TN7B 3TLUA 1UN1A 3ZFGC 4PTBA 2NP0A 5A7WB 1NQDA 2YU2A 2RS11 4BQ1A 3AE8A 3LA2A 5C4WC 4O7XA 1HS7A 5E1RA 2WAUA 4LF8T 1H30A 5HYAA 2JWPA 5IVJA 1W05A 3I0QA 4XUPA 1ULCA 4E8CA 5A3NA 5HI0A 1R092 2HEVF 3TN93 4FT8A 3AYEA 1V6IA 4MUVA 3TYJA 4KGGA 2KR2A 2OUHA 2W1WA 3Q9OA 2QGSA 5BNPB 2I2SA 5A7SA 2DNXA 4LK6A 1WE9A 2WY2A 2JMJA 2K9AA 4JRAA 4UXAA 3UUBA 4FFFA 1WLDA 1T7SA 4N53C 4OZXA 3RIAA 4EZ4A 3LFIA 1OURA 5DQVA 3BTZA 5AQMB 4U36A 3ASLA 3VKGA 4YG3A 3HKCE 2BVVA 4K8RB 3AE9A 4UV8B 2DSMA 4N53B 2G19A 3W5MA 4YLHA 1ZYBA 2IC1A 3LEKA 2AXDS 3UGHA 3U07A 2WMNA 1F8VA 4B7KA 2RHPA 4YW2A 3KFWX 1RMU1 3NJZA 3MLKA 4JKKA 4QX0A 1QJU3 2WB5A 3PURA 3UU6A 4Q4Y3 3AZWA 4UT5A 1UY1A 1ZRCA 3I59B 2GNDA 2WFPA 1OVSA 1FIOA 2L0BA 5FMNA 2XLAA 3C2UA 1RHI1 3T09A 2OVUA 4QX1A 1KDKA 2R072 3D5OA 3HVDA 2E9XD 1NT0A 4ZXEA 1YFXA 1KRIA 4J25A 5A7OA 4Z8XA 3SOUA 3UU3A 4UW5A 1H2LA 5IHRA 2Y8KA 2XJ7A 1GWLA 2VCMA 4P9YA 3POWA 3H3UA 1BJQA 2NR4A 2KD7A 5JWPA 4AGRA 3N36A 4XFIA 4LMKA 1PO13 5IJRA 1MIYA 1LOAA 2LSIA 2W52A 3O34A 1LENA 1OPMA 2ES0A 3I2DA 2D0TA 4LK7A 4F3JA 4I3PA 2D6OX 4UF0B 4HETA 4Q4X3 2P9BA 3O12A 2W61A 1SLBA 1JU3A 3PJYA 1QKQA 1XSRA 2DFBA 1N3OA 2VMCA 2D6KA 1O91A 1YXRA 1V6KA 2AR6A 4LJNA 4NHMA 1HRV3 4CP9B 2UWBA 4YBTA 2HEWF 3IHPA 4YFZA 1W8NA 2ECIA 5FLHA 4GZ9A 1JYNA 4LUKA 2OXQC 4G2AA 3USSA 4KX6A 2CKLB 4YBMA 2B9VA 3VD7A 2ZM0A 2VJXA 3TKLB 1A8MA 3E22E 2IQJA 4I0UA 1COV3 3WW2A 1FMVA 3ZSEA 2VZTA 4LQRA 3WDTA 4JV4A 4DXRA 3AE2A 4HBNA 3C4ZA 4KWUA 4I3GA 1DP0A 2HKXA 4AEKA 2LALA 2P3IA 4IEYA 3FLRA 4CCEA 1ULEA 2YBKA 2MPKA 3LVRE 3FWEA 4IL4A 3T1HT 2I6HA 2JKBA 5I8TA 2HLEA 5DKAA 4META 3AX4A 3TNPB 1O59A 2TNFA 3JCIA 4IDNA 3T0DA 1PM4A 3CZUA 2X68A 4RHV1 2VNGA 1QJY3 4A42A 4TLGA 5LWBA 2UY8A 2O0OA 1X36A 4U2ZA 2WZR3 1OI6A 2JXAA 5J96B 2WNUA 5T5JA 3UESA 4GWJA 4XTPA 4PBOA 2HPJA 4ZI3C 3Q5WA 4LR4A 1QXRA 4FXKB 3CK6A 2CCQA 3UL2A 5BXXA 3USUA 4LO8A 4PLMA 1LHVA 4DS0A 3ATGA 3I3DA 1SPPB 3GJBA 2BOJA 1KITA 3HQUA 1UY3A 4DV0T 1W9TA 3MFCA 2EAAA 4CPBA 1ODNA 2J42A 1I94T 4H55A 3AZYA 5JLVA 3VGIA 2DCJA 1NCQB 3H0OA 4L9IA 4OVEA 4PFPA 1DGRA 4NWWA 2WNUC 2FUUA 2VNFA 4NROA 2EHOD 1OLMA 3PUYF 4AFBA 2DU1A 3KVAA 2VJFB 2LOPA 3DF0A 3M3CA 2KR4A 5KXBA 3GCWA 3VBSA 1RUI2 3LEIA 1WBLA 5FL0A 2ZAHA 1W6OB 3THDA 4U33A 2W00A 5DDJ2 2GC1A 1GZ9A 2RM22 2X09A 5H6QB 4YAXA 2ECJA 2A2FX 2BZDA 2AH2A 4O62A 3JQWA 4QQHA 3OOXA 3USUB 4DMVA 2ZX0A 2DVBA 2KKXA 4LKEA 1OUSA 4YW4A 4MADA 3UU4A 3TWIA 2VE1A 5JZGC 2V5DA 4Y1UA 3PUWF 5FEYA 2MYSA 1S0JA 3O7OA 4D3WA 4UFLA 3TB0A 4ZQLA 2WUHA 3ILFA 2PTFA 3WUDA 4QX2A 4WZ0A 3VBSC 1EV11 1CZTA 5SVYA 1YEWA 3SNMA 3T4VA 3FJUB 5JZGB 1PX4A 3OYWA 4B3TT 4IGQA 5AQRB 1RC6A 4Y4YA 1XMOT 1E5IA 4D7SA 3H50A 4GYSA 4R2YA 1QJEA 1W99A 2EA7A 2ZEZA 3VBFA 3JC6C 3VBSB 3ZXEA 1GQEA 4M1PA 1WRDA 5LBMA 4LA3A 3UJOA 5L9VA 3ZNIA 2WR9A 5EJ1B 1LOEA 2HWD2 4B4PA 1OF4A 2XUMA 2XHNA 4R52A 3NKZA 2LE8A 4NHKA 2ID4A 3GZTB 2WSUA 3VD3A 4YBSA 1XNCA 1LOCA 4OI1A 2EF6A 1DQ6A 3VR9A 4KUMB 3C6WA 4J2CA 4CU7A 3MW2A 4CA1A 1C5HA 1OQ1A 1Y64B 3ZFEC 2MA5A 5T5LA 4A4AA 4FPKA 2HBTA 2BBHA 4XCBA 2P3YA 2J1VA 4QGMA 4MOAA 2IAKA 2KLQA 1ENQA 4P5HA 2V8SV 1YQ2A 5DUVA 3N2OA 3VBFC 2RMU2 3R4DB 2VQTA 3J8F1 1QMJA 1VBB2 2VZRA 3ZFEB 2Q9QC 2WO3A 3C7OA 1W6PB 1Q8PA 2ZA9A 5I0DA 2R042 4LF4T 1WA6X 4JX0A 2YFZA 1U5IA 2VMFA 4WV8A 2ZBJA 4YTPA 2WU2A 2B45X 1RUC2 4ZEYA 5FQ0A 4R9CA 5FZ3A 3PVOA 2Q9QB 4ISQA 3ASIA 4W50A 4JUYA 2L3LA 2FJDA 2H0DA 4XCAA 4ZZBA 2WINB 4OFGA 2VZVA 1GYKA 1CAUA 1V70A 2HWC1 4X1KE 4EYYR 3MBWA 3NZPA 3PU8A 2JQ9A 4EEBA 5EJZB 1I5ZA 5FMOL 4BMBA 5KH7A 4R8PK 4Q4V2 3Q8EA 4DUXA 1YIPA 1ULPA 1HV0A 2ZGLA 3JD73 2A9UA 4CCLA 4PAGA 3B9IA 3KVBA 2Z6EA 4RS5A 1OKQA 3AC0A 1Y3TA 3VDDC 1M62A 1DQ5A 2D9DA 4KU8A 4E4HA 5CEHA 5IYYA 2GH2A 4LKSA 4AG4A 4HWCA 2P5BA 1XDOA 3NV1A 5HEJA 3OBZA 4OCTA 1DGLA 1WLTA 4NHLA 2Q8CA 1YFWA 2UZGA 2XWBB 3IM0A 1SBDA 5CYYA 4YGCA 1N1YA 3VDDB 4ET7A 4YG0A 2YUEA 1WCRA 4UXNB 1IG3A 1OH4A 5C5UA 2YOEA 5ABJA 1LB2A 3C7FA 5FFOC 2YGLA 2WDQA 4M4PA 3K2OA 3H3LA 5H9RA 3KM5A 4UVAB 3U10A 2NLRA 3AMMA 3GZUC 4G63A 5EK2A 1WGPA 1OUXA 3FN9A 5AQTB 1E2AA 2V4VA 1MS5A 5GLVA 1AYM1 3PUZF 4BQWA 1PVC2 3PHDA 1MZ6A 2YHNA 2XEUA 3ZYQA 2VOXA 2KWNA 2BBVA 1POV0 2BPA2 1SE7A 1HX6A 3A21A 1VD4A 3ZLIA 3VKMA 1JZ3A 1ASJ1 3AL6A 2IIUA 3P4QA 1S0IA 5FIXA 3RRCA 5EK3A 3P50A 1FPN3 3ZN6B 2Y6JA 1H1MA 4AXOA 4YYOA 4E2SA 3T2PA 2IW5B 2PHWA 1W2AX 2M6BA 3SOXA 1W0OA 5I0UA 2M6IA 4IW3A 1QWRA 3SHRA 1HF8A 3H1YA 2ZOEB 1H6YA 4XBNA 4BK5A 4LOTA 3U3IA 4GJYA 4F52B 4E7SA 2Y0IA 4EXTA 1K5MA 3LIGA 2MTQA 1V00A 4P0BA 5ACA2 5H9MA 3OUJA 1GZTA 4NIQA 4ZZCA 5I0SA 3DL3A 3UFEA 4Q0VA 1L3JA 4V1Av 2J7MA 2BQPA 1TVGA 2W68A 3M70A 5JI9A 4BYYA 4U3CA 3BOPA 4XUQA 4LHLA 4UVBB 3CQXC 1W6MB 4W6XA 3AE5A 3ETUA 5CFDC 4URAA 4KMCA 2A7AA 2A3DA 1JM7B 5KDMC 2CPTA 4O61A 5FB0A 4GWIA 2OYZA 2WWJA 5DAVA 5LMUT 5IK7A 1C4RA 4QQLA 1K5MC 2YPDA 2EA6A 3RDIA 5CFDB 2JMHA 5LEKA 2VCAA 2VW2A 5FLIA 3CO2A 1NOVA 2QZ3A 3FHIB 2W91A 5CVRA 3NSTA 5B4XA 1DYPA 4NR1A 2Q8OA 2QQUA 3HPNA 2ETEA 2YDEA 1X9TA 2WWVA 5A32A 4NHXA 5BNNB 1YQ5A 4YGEA 3MZHA 1TMF3 2G9ZA 4HN1A 1WMXA 5BV6A 1OFSA 2ZETC 1W8WA 3O1JA 4JDOA 3LDYA 4N9HA 5KBFA 1X8MA 1BEV1 4IDOA 3MXZA 5H9QA 2IXCA 4CTEA 2ET7A 4YFSA 4HT1T 2D44A 1IBMT 4YZ2A 1S0BA 4XYXA 2ZS6B 4XVHA 1E57A 3SXWA 2L75A 4O2AE 4RA0A 2WFF1 4LE4A 3U5NA 4V1PA 1OXCA 2FJBA 2JG9A 1BBT3 4Z0RA 3AAIA 3GA8A 1WWYA 2A1XA 3RWNA 3HR9A 3DECA 4CEWB 4DV5T 3LJCA 2DUOA 1KEXA 1F31A 1ZZBA 4BOWA 4X6RB 5LYJE 3AYAA 5J48A 2ERFA 5SV8A 5FY5A 5FZOA 4YARA 2DV9A 3K3NA 2NWBA 4Z2AA 2HWB3 3BIEA 4ZS2A 1SQ4A 1VBE1 3ZSMA 5CFCA 4GQ7A 1VBA1 3WVJA 5F32A 3U0ZA 3VZJA 3N2KE 4KBBA 1ULFA 2XJVA 1AR72 4AGGA 4OULA 3P3NA 4Y1VA 1GSLA 1RUD3 1YJKA 2I74A 4ZU7A 3UT5E 2QKDA 4XFCA 3T1YT 5C3PA 2C2LA 3ZT7A 3EMRA 5EV7A 3K8PC 1EAH1 4AIUA 3RMXA 4O8SA 4XFBA 4H7LA 1IYMA 2NW7A 4I4TE 5IVBA 2GALA 2ZGRA 4BMEA 4FPLA 3SQOA 4AFAA 4L8QA 5CFCC 5F5AA 1UYZA 4XAAA 2RS13 4UVCB 3ENRA 2LSGA 1F4HA 4EJRA 3TLSA 2KT9A 1XYOA 1LEDA 1EPZA 2WZ8A 1H8TA 4TSVA 3A7QA 2DFCA 1AL23 3U14A 4IE6A 1O4YA 2VNVA 4X6QB 4YW6A 4GH4A 1ND2B 4XDOA 4UIGA 4ISSA 3OJAA 4N4FA 2NTXA 1R1A1 5GZFA 5L3CB 2BGPA 1E5SA 2W87A 1NE6A 3J26N 2GN3A 2UUCT 4X64T 1NCRA 1PVXA 1JS9A 5ANQA 4P9XA 2GP3A 2I50A 2SPCA 1AX2A 4XF1A 4P9WA 1QF3A 3O1MA 2ECGA 3VBOA 1CZVA 4GH4C 4NPMA 3SKVA 1NAFA 1CESA 1HB1A 3AP9A 3ACHA 5AQGB 2LUWA 3IDBB 1IAPA 1Y7BA 2Z69A 3BIWE 1OLRA 4G9SB 4JI1T 1CIWA 3ZOIA 1RMU3 3NV2A 2H0VA 1NCRC 1QH6A 4LF7T 2QQPA 4QPIA 1ZBDB 1XNKA 3NW4A 4O4JE 4IE5A 4PJJA 1Q8QA 4IV3A 5H1VA 1RHI3 4YSYA 5T5OA 4CDQC 4ERRA 3HNYM 2GMEA 5EYAF 2CNAA 4OX9T 2X51A 3SITA 4R9BA 1DZRA 2X0LB 3AM2A 3AEGA 2NP9A 4MGTA 2KIZA 4YTMA 4E2QA 1ZBA1 4KGQA 3GALA 4XAEA 4JI4T 4CDQB 2WN2A 3LCPA 5JH7E 1RUOA 2WAAA 3OF1A 4YM0A 1JMUB 4GD4A 4QPIC 4CP0A 4FOVA 5FO8B 4MALA 4CCOA 3ZTGA 2PNXA 4AKIA 4AI9A 3RPGB 2R061 2JMIA 1GNZA 5J1GA 2PA7A 2LKGA 4IV3C 5HCJA 4TWTA 4CEYA 3AKRA 2OLTA 1KK7A 2KWKA 3F95A 4Y22A 3VDCA 4C91A 5IHYA 1JOBA 2IWGB 4DY3A 5JDMA 4XHXA 1XWMA 1XE8A 4AVTA 4QPGC 3VBUB 1X9BA 2VZ1A 3VN4A 2FMYA 3O14A 1AX0A 3POJA 4YLZA 3O4XE 4JEHB 2ZMLA 1Z7S1 4QQOA 2VAUA 2L8KA 2XAJB 1UY0A 4OQ9A 1SLTA 4FJCA 1ZP0A 2WT1A 5KXEA 4B86C 4A45A 3H8UA 4QPGB 1OWAA 3WAKA 3UK9A 4ANJA 3T9KA 2WDRA 3NAPC 3FAOA 4P5YA 3ZIXA 3ZYJB 3CHXA 2QQVA 1VLNA 2UXXB 1TE1B 1AXZA 4AQTA 2Y1NA 2J1DG 3LSEA 4XXAA 1IQDC 4AVAA 3SEEA 4B3NA 2VZOA 2VOTA 4DV3T 3INAA 2VZUA 3NAPB 1JOJA 1TEIA 4HSLA 2YB7A 3UETA 1XQNA 3RYKA 1HRI1 4AL9A 5LHIB 1S94A 1JNRA 1RUG1 4C0HA 1N1SA 3VD4A 4NHYA 3CJIA 4RHV3 1R082 4FJOA 1JZ5A 1FP0A 5F2WA 4MSXA 3MF9A 3HBZA 2J1TA 3W58A 4GNDA 3EABA 1V9U3 3CMGA 1UX4A 1IS3A 1W04A 5DZEA 5I3LA 2XAQB 4JHZA 5JXIA 2JX9A 4UEMA 2R1DA 1WD3A 4NIDA 1HCIA 5A33A 2X8KA 1J5WA 2AN6A 5C6CA 3SOLA 2CGPA 3OBAA 4WYVA 3CJIC 5TRBA 4UFIA 2C0ZA 5C3RA 1OH3A 4YADA 3FB2A 4K1YA 4CDWC 2HWC2 2A71A 1PK6A 2ZMNA 2R7EB 1JYCA 2XQ8A 4QQ4A 2WABA 1KS5A 3D4KA 5GALA 2DF7A 3M7KA 3RPUA 5FPUA 3CJIB 4CYDA 2BAYA 2AYHA 4XQDA 4JCKA 5F5CA 4CDWB 2IC9A 2JQQA 4MGKE 4N9IA 1FV2A 4AAPA 5FWEA 3C50A 4N90A 1OEDC 4XJZA 4LBJA 1WCQA 3V43A 2W94A 1RUH2 4ZXLA 1UY4A 2HDPA 3TEZA 1XRUA 4P09A 4WZCA 2JG8A 2M1RA 3O1PA 1XNAA 3B7MA 3TLVA 1ENXA 3NNMA 2O8QA 1POQA 1Z2QA 4S3OC 5FCCA 3ESLA 3NMBA 2Y6XA 2IFWA 3KD4A 4TWHA 5GLUA 3AEDA 1OEDB 5FMBA 3PHMA 2BVMA 1D1CA 1D4VB 4DRRA 2ZXQA 5E89A 3WG1A 4UBGA 1QNYA 2GZWA 1EV13 4S3OB 2PHLA 4MBQA 4GYRA 1L7QA 2VMDA 3LVQE 5FMCA 2J1EA 3HKEE 5CG8A 2VWAA 2NPIA 2A6VA 4B3MT 3RYHE 2O14A 1H1AA 1DCQA 2BUKA 2ARAA 5LA1A 3QB5K 5FYTA 1REDA 1QQP1 4DR5T 4XF3A 3VHOA 2JG8C 5J37A 3RYRA 3FJSA 3RZMA 4OZOA 4YW5A 3M3ZB 2PHXA 1WEEA 2VQET 2WNEA 4EWAA 2P34A 1VE0A 3ZYFA 2E9XB 1AYM2 5F5WA 1DG6A 2WDVA 5LGTB 4PJLA 2E7TA 4LLBA 5LG4A 2RR11 2QJVA 2B1EA 1MM2A 2DTWA 2Q30A 3WI3A 4ITCA 2JDZA 3A5XA 2UXNB 4M0HA 4XZUG 4QKFA 1UUSA 5TDRA 1WLWA 2GN7A 1KNZA 3SMHA 4CZSA 2XB1A 3WQ1A 2XMLA 1J1TA 3U4SA 4OGEA 3VHNA 1JHNA 3HN3A 2LRPA 3WINE 3HL6A 2JECA 2HBUA 3PNAA 3J8F3 4CRQA 1MEC2 3CBNA 3JU9A 3OGRA 5JDGA 5AVAA 2VMEA 5FUIA 1D4M2 1U6GB 2FUIA 4BU2A 2MEV3 3GCXA 1AR62 1W0BA 4MX3A 2BU9A 4F6RC 4ZOLE 2BFUS 4A98A 1CN1A 1AYN3 3AA6B 3UGGA 4D0QA 4AK3A 1XZYA 3HMYA 3L11A 1TQ5A 5AQPB 3SOWA 4HE8A 1X4UA 1GZWA 3SH4A 2Y48B 3URFA 1M4WA 3LE0A 3BQKA 5J36A 3KSCA 4U2AA 4JGYA 2YURA 1ZEEA 2DHRA 5C8CB 4OLLA 1XU1A 4GIWA 2A5ZA 5FERA 4JI8T 2EXHA 1DQ0A 5AC91 4KP3C 4CDXA 1HQNA 1W03A 2VOWA 2VTFA 5LK7B 2AENA 4DUWA 5KHKA 2JIGA 2MD7B 3N7LA 1RUJ1 4H3WA 1G8XA 3D0SA 3RQ0A 2ZM8A 3ZJ1A 3QK6A 2BW8A 5HV4A 3PJAJ 2XAGB 3E0ZA 3FFQA 4XDPA 2XJSA 4LLFA 3OSDA 4JGYC 3IMNA 3P3PA 2W95A 1XPWA 2D40A 4AEJA 2D93A 4P9LA 1SG3A 1AL0G 1R1ZA 4DQAA 1P8JA 4HN0A 1QJU1 4ZI7E 5DJQC 4XBLA 2VKOA 3BU7A 3UUXB 3AMHA 5A3MA 3E97A 2X5IC 3RH3A 2X9WA 2A3YA 2X66A 4EIWA 2YN6A 3NG2A 1VPHA 2OQ6A 4FP3A 2Q1ZB 3S4UA 5KHHA 3FZHB 1IQAA 2DVDA 5FK8A 2A6ZA 1SUMB 1Y9GA 4WZFA 2X5IB 2EHOC 3VK6A 3QOFA 1REFA 5FNVE 3LPGA 4TZ4C 2WFF2 4XF0A 2BVBA 3PDYA 1WYCA 4BHWA 3F2EA 2M85A 4ASLA 4BQ4A 3EI0A 2XL9A 3OTFA 4QF3A 1T8BA 1E1HB 1PO11 2EHOB 3V0BB 4YM3A 1AR92 4IL9A 2WYFA 5DINA 2WP9A 2QYWA 1PGL1 4HANA 1ASJ3 2V6YB 1UOFA 4HEAA 2UWCA 3EJKA 4M3CA 4Q4X1 2QZ2A 4X65T 1R8IA 3H3AA 3NJYA 2CXFA 4BQ5A 2WNVB 3RC3A 3EB7A 4QWNB 4MG2A 1PMJX 4PQ9A 4D7YA 2X05A 4H14A 3WP4A 3MDPA 3FEHA 2HWF1 1CIYA 3PUVF 3NNGA 2Z42A 1VBE2 3AXJB 5FZKA 1D0YA 2UU8A 4XJUA 1WIMA 5K7PA 1IS6A 2DWKA 4IIJE 4ASKA 1XOYA 2VZPA 2ATFA 1COV1 4OI0A 4AP4A 4Z91A 5GZGA 5C9AA 5C5TA 1BHGA 3WF1A 3ZXKA 3IIAA 2JRKA 3I54A 4QXKA 1J59A 2YV8A 5FP3A 3WNNA 3L1XA 3RNSA 5FZMA 3B69A 2FZ1A 2H7OA 1W90A 3ZPOA 3AE1A 4YRDA 2CTVA 5LA0A 5IUXA 2VASA 1WEVA 4D8MA 4UELA 2WNOA 4M3CB 3AVSA 2V26A 2RS32 5CA1E 1VBD3 3ANWA 4WW0A 1JOCA 4LBKA 4DV6T 2GMPA 3W21A 5C9AC 1QJY1 2QNKA 2D7FA 3FHQA 3CJXA 5E88A 3EVYA 5J3UA 4I2OA 4XE9A 2WZR1 5GM0A 3OVUA 1PIV2 4B4QA 1KEYA 4LFAT 3GHMA 4Q8LA 2WS91 4RFT0 2Q5TA 3FHAA 3N2GE 1SFYA 1R1A2 5HXEA 2DBNA 3OUIA 5C9AB 4LIUA 1SLAA 4ZU4A 2ZABA 5K3QA 4CCJA 2YEVC 1KJLA 2K24A 2WL1A 5KC6A 4JKLA 4QX5A 4AEDB 2KGIA 1S0EA 4PI0A 2OV9A 1AJKA 1PM7A 4K9SA 4BA9A 2LEHA 1ZHCA 4DMWA 2L9LA 3RF1A 3WV6A 3MICA 5C70A 5LBEA 2YT5A 2PHDA 1I9RA 5KXDA 2JE7A 4R4XA 3M63A 2V7LA 4J1XA 2BJSA 3VZOA 1BEV3 3LBXB 4Y26A 2WYSA 4FPOB 5A6XA 3BU0A 4YZ1A 5J2UE 5LKZA 1OBNA 2XJPA 4ZONA 4GB31 2GNMA 3I2JA 5K4LA 2LROA 3HCTA 5LRRA 3RKGA 4AKLA 3J7HA 2AZ5A 1GMMA 2W4XA 3Q5XA 1HXS1 2ZEYA 4DV2T 4N43A 1B35A 5HCAA 1XNTA 1Q56A 2YY1A 1NE4A 1RIRA 3ZT5A 1UMZA 5A7NA 3DV8A 4K8FA 3PUXF 3B57A 4YHHT 4HK8A 3E6CC 3V0AB 5EZYE 3U5MA 2W39A 2VUCA 1MZEA 2W9XA 3EYPA 2WWSA 2JB4A 5J0ZA 2P17A 2E63A 1YI7A 5FXVA 5HCMA 3ZR5A 3U5OA 1VB2A 1G9BA 2SLIA 1ZRRA 3GGLA 3M65A 4MHUA 4E4SA 5B79A 1VBA3 4ZXKA 3T7LA 2IXLA 4KNCA 4AW7A 2W2UA 3O1OA 2DI4A 1OPOA 5TAOA 5LB6A 3K75B 1B35C 3BPSA 2ZHMA 3N7MA 5FZIA 3RYIE 4FO9A 1HR0T 2R062 4OMDA 1HKDA 5KXJA 1NZIA 3QUJA 1SDWA 3RX6A 4PK5A 1WEOA 4BISA 2EALA 2PXJA 1EAH3 4IV1A 2P57A 3O36A 4KG0A 2C5JA 4M01A 4IESA 3DP7A 1QJX2 2PHRA 3HR0A 4DR1T 5FP9A 5LJNA 4X8NA 4PDWA 5B78A 1NX9A 4MXVA 3VKFC 2PLV2 4X1IE 5BYNA 3WF4A 4NN2A 1NENA 4YVWC 1IKPA 3LWCA 5H6RB 4YW3A 1CWPA 4ADZA 4D7TA 3NRYA 3RZKA 1LOFA 2JRJA 1GQGA 2LGLA 3UU5A 4HMZA 4MLKA 1V87A 3B5MA 3T8OA 1NY71 4QX7B 2XPJA 1XWHA 3FBZA 3PUSA 5FJHA 4E7ZA 1B09A 1C3HA 1VRBA 4YVWB 1Y4WA 5J3XA 3KGLA 1U5PA 1AHSA 1AR81 1RUE3 1UIJA 3TRSB 4Y20A 4Q6FA 1H2KA 3AP7A 5IK8A 3ON7A 1KNRA 1M06G 1OOPA 3AXDA 2CL2A 2O1QA 4V3LC 4U31A 2F6JA 2CDOA 2CY6A 1CZSA 3PUIA 2JIJA 1IBLT 5K0UB 4DBRA 5JTGA 3UGFA 4QMAA 2V7IA 3B9CA 4GAZA 1FX5A 4UFHA 1RUG2 4H9NC 2W1UA 4GULA 2VPBA 4NRMA 5C8WA 3FBLA 4JDNA 4XF4A 1K2FA 2SBAA 3K46A 3VHLA 3BKZA 4DUYT 1Q43A 5FK7A 1C1FA 5CFBA 3MW3A 2CBIA 3ZYBA 3O0XA 1T98A 1W9RA 1L7LA 3FM8C 2LT3A 2XM2A 3H7HA 1YQ8A 3DEMA 3CX8B 2VULA 3PMEA 1W9SA 4IDZA 4PIXA 2VH9A 1FOD2 2CRBA 4M00A 5ABFB 3PMSA 2VBDA 3H8OA 3EO6A 1UX5A 2BFUL 4Y1YA 3UULA 3WW3A 2GMMA 2ZEWA 2VXRA 1W3VA 1CR7A 2VJEB 1UU6A 2B9UA 4CXYA 1DHKB 4HWIB 1ZBA3 1GICA 4EB6E 5CZKA 3VL9A 3IPVA 5FZLA 1WESA 2V73A 4BBQA 4LNVA 3WP3A 3WG3A 2H6CA 1CAWA 4AZZA 5FXXA 4QH1A 4RSUA 3I0OA 3ZN5A 5F7UA 1J3RA 3U5PA 2WAOA 5JCTA 3DTOA 5A1AA 2FDIA 3RC8A 5IVYA 1LVKA 2C5DA 3SWHA 1QSDA 5FV3A 3WCSA 4IE4A 1C8M2 3C4XA 4ZKTB 1MM3A 5EFUA 1US3A 2XP0A 2UU9T 3BN6A 4YNIA 4TYSA 4A5XA 4FK5A 2WZEA 1Z7S3 5FYSA 4XJAA 2ORZA 1HX1B 5KXCA 4Q26A 1D0ZA 3ALQA 4W65A 5FLJA 3IPVB 3NVCA 2H6BA 2W3JA 5LB7B 3DXUA 4QAWA 4R9DA 4XACA 4YY3T 3ZKYA 5FZ0A 1VBC2 4BIOA 2M13A 1W39A 2JPFA 3QLQA 2MKEA 5LHGB