3KVAA

Structure of kiaa1718 jumonji domain in complex with alpha-ketoglutarate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvaA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvaA01
3DXTA 2YU1A 4NUBA 5FY0A 2XDVA 4AI9A 5FPVA 3PUSA 4QXHA 5FYCA 3LD8A 3UYJA 3PUAA 4CSWA 5LWBA 4D6RA 5FY8A 5IVFA 4C8DA 5FZLA 3K3OA 5A7OA 3PDQA 5FY9A 5FP4A 4LITA 4BXFA 4CCNA 4XDPA 3PTRB 5E6HA 2WWJA 5FZ9A 5FZ1A 5FZOB 4LXLA 5FYHA 5IW0A 5A7WB 2YBSA 3ZLIA 5A7QA 4V2VA 5FPUA 5FZ8A 3ZPOA 5FZAA 4GJZA 4DIQA 5FY7A 5FJKA 4E4HA 2GP3A 5FYBA 4CCOA 5FYMA 3K3NA 2XUEA 5FPAA 3AL5A 5ANQA 5FP9A 4IGOA 5F2WA 4QXCA 4GD4A 5FYTA 5A1FA 4CUGA 3KVAA 3N9NA 3N9LA 4UF0A 5F37A 5FXWA 5CEHA 5LY1A 5FV3A 2YBKA 5F3EA 5ISLA 5FYYA 5FZIA 2YPDA 2WWUA 4LIUA 5FY4A 4XDOA 5FWEA 5FYZA 5FZ0A 5A3NA 5F2SA 3N9PA 4QWNA 4DO0A 2VD7A 3DXUA 5A7NA 3PU3A 3N9OA 3U4SA 4QXBA 5FPBA 4QX7A 5FZOA 2OQ7A 5FBJA 5A7WA 2YBPA 5LY2A 4IGQA 2Q8EA 3OPTA 5IVCA 4CCLA 5FZMA 2GP5A 5FZHA 3PUQA 5IVVA 4EZ4A 5IVYA 3AVSA 5FYIA 2OS2A 3KVBA 5A7SA 5FJHA 5FZ7A 4GAZA 5A80A 2PXJA 3K2OA 5F3IA 5FZGA 5IWFA 5F32A 3NJYA 4BISA 5F5IA 3KV9A 5FZEA 5K4LA 4ASKA 3KV5A 5FY1A 3N9MA 3U78A 4CCMA 5FP3A 3PURA 2P5BA 5A3TA 3PU8A 5FZBA 5FXZA 4GJYA 4URAA 5FP8A 4QU1A 5FXVA 5IVEA 2YU2A 4UF0B 3N9QA 5FZ6A 4IGPA 5FUNA 4CCKA 2XXZA 5FYUA 2Q8CA 5A1LA 3OPWA 4V2WA 2OT7A 5FZFA 5A3WA 4D6SA 4AAPA 5IVJA 2XMLA 4LIVA 4QX8A 5FZDA 5F3CA 4Y4RA 3KV4A 5FZ4A 4D6QA 2W2IA 5F5CA 5FZKA 3AVRA 3LDBA 5KR7A 4Y3OA 5FUPA 2Q8DA 4TN7A 4EYUA 5FXXA 5FYVA 3AL6A 5FZCA 2OQ6A 5FY5A 3RVHA 5F3GA 5FP7A 5F39A 4HOOA 4EZHA 5FZ3A 5A7PA 5FPLA 2OX0A 4BU2A 5LW9A 5IVBA 5F5AA 5FYSA 4CCJA 1VRBA 3KV6A 4HONA 5A3PA 4Y33A 5FWJA
chains in the Genus database with same CATH superfamily
2IHR1 3OYZA 3PE0A 4UBGA 3AK0A 5EK4A 1DU3D 3VBSC 1NEKA 1F5FA 2OA2A 3MUZ1 5M4YA 2IUBA 4YFZA 1VBE2 4PIXA 2ATFA 5DDJ1 1QJX1 4MGKE 2R6GF 1DG6A 1H9PA 3O0VA 2J7MA 1LGCA 2E9XC 4IGOA 2XQ6A 4LBQB 4Q4Y1 1W6PA 3LA2A 1OEDE 1SG3A 3CQCB 4R9DA 4JZRA 1M4WA 2FHRA 4N9HA 3B02A 4NHMA 4IUGA 1GYKA 2TUNA 5FZHA 5I0TA 5IVVA 2IFRA 3KVBA 1RUF3 4RQPC 1QJEA 4S2DA 1CESA 4RGGA 3RZHA 4OYJA 2VG9A 5C3RA 3DV8A 4I0UA 5FZ6A 3HA4A 1CX1A 4I0AA 2GC2A 2G1MA 1Q8VA 4D6QA 1J83A 3WDYA 1KJLA 3MIHA 2I0MA 1FYUA 5IK5A 3E6DA 5L3DB 3VKOA 4Q0QA 4AQFA 4X66T 1RJ7A 2RA1A 2B42B 1KNRA 2W1QA 2ZKNA 3KD4A 2BEOA 4AGRA 4NXMT 4UV9B 2QQPA 4NPRA 4Z8XA 4QWNB 3CZUA 1XYNA 4UIGA 2AENA 1JOJA 2D44A 4EN6B 1WA6X 4H7MA 4LKFA 3GALA 2M67A 3VHRA 4YVSC 4GJZA 1Z7S3 2LSGA 2WQ4A 1UL9A 4CEYB 4E2QA 4JTNA 4Z2AA 3USUA 1OEDA 4YGEA 3N9LA 3HJRA 3VBHB 1SZBA 1DYOA 1SPPA 2BNNA 3ME2A 2RJKA 1G9BA 2UYAA 5HEGA 3IAQA 2QCSB 2PHDA 2LJLA 3A0NA 4XC9A 2QQOA 4IV1B 3UESA 3IIIA 5A70A 1TEIA 3WF4A 1DQ4A 1ULDA 1D2QA 1OOPC 2J1VA 5A3WA 2RM22 3WNLA 4X5TA 1EV13 2PAMA 5HCMA 3VBUB 4N53A 1MNEA 3ETVA 1YQ8A 2DYCA 2PG8A 2ACXA 1VBC2 3AEAA 3ONXA 1RUF1 4MHCA 1W8FA 3MPPG 2PFVA 4C91A 3KV6A 2A6ZA 1PO23 3K3QC 2C6SA 1PK6B 2XDVA 3S5QA 4E4SA 1F2NA 4QPYA 4JGZC 4INDA 3LPFA 3I49A 4L8QA 3Q9DA 1ONAA 1IG3A 2PLV3 2Q5TA 3DGTA 2OYZA 1MS0A 1AR92 1WMFA 4RFT0 3J8F2 2IXHA 4OHVA 1JYWA 1AR83 4XF1A 1IBKT 2VMGA 4TN7B 1R092 3OBTA 1RUH3 2UUAT 3BN6A 4EV6A 1AX0A 3WNOA 5DUUA 5FZ7A 2BBVA 4AF9A 1UZWA 3I2DA 2DL1A 3ATGA 1ZRRA 3ZT5A 4D0QA 4QU1A 2SBAA 1AR63 4ZPIA 5ADXL 5FZ4A 4FJOA 1L0VA 1OMIA 4I4TE 2AYHA 1G9FA 4H7LA 2FD8A 2VZRA 1HRV3 2FCVA 4XZUG 1W8NA 1NCRB 2JICA 4YM3A 3SCGA 1KFXL 2ZHLA 1FIOA 1I6XA 4PAGA 3I0QA 1V70A 5FPVA 1RUG2 5LBCA 3OGRA 3ZXDA 3G6JB 2Y48B 4IT4A 1EV11 1ODNA 5L19A 2D9DA 4EN7B 5EK2A 4ISRA 2V7JA 4NAMA 3C2UA 3KZ4C 2D5HA 4J6GA 3O7OA 2Y26A 2X9XA 1HN1A 4D7SA 1PO21 1AF9A 2NOXA 4FPCA 4PDWB 1EP0A 5FV3A 1VBE3 3NV3A 1SMVA 4CDUC 3POWA 1WKYA 2PBIA 1WD4A 3LFIA 4FCAA 4QH1A 1UYYA 1R082 3S7IA 4EZ4A 3AVSA 2VZVA 2PLV1 2GSYA 2V7MA 2VWAA 4Y22A 4JRAA 4R4ZA 5LOVE 3O1JA 3KV5A 4HLTA 1SUMB 5FBZA 1PX4A 2X0YA 1AR81 1FOD3 3T8OA 3KV4A 3RSJA 5JR9A 1FPN2 3LBXB 5CA1E 5FXXA 1RUH1 2HYXA 4AVVA 1VBD2 1WBLA 2ZACA 2R49A 3I2FA 4LLFA 1UOFA 2YOEA 2DCTA 1AR61 4YFSA 2V73A 3ZIWA 2NW9A 5GKAC 1NWMX 3BTYA 2C4XA 4B8EA 2AH2A 3JZVA 3ANWB 3WNMA 1JBCA 3ACFA 1HX1B 1OPOA 3CX8B 1BBT2 4O4HE 1HRV1 2DVAA 2BPA2 5LXTE 1F4HA 2FCTA 1RUJ2 1UNBA 4AFMA 3SXWA 4OHYA 3C3VA 1K5JA 2XQRA 3KQ4B 1LU1A 4XMAA 4BM8A 2KMFA 4AKHA 1CD3G 3H3UA 3NRXA 3Q2MA 1M62A 4CCCA 3UL2A 2WCAA 3S0MA 3NZPA 5B4NA 5L9BA 1J3PA 4KL1A 3WQ1A 2WZR2 2NMNA 2EXHA 1SEFA 2LSYA 4ZI3C 4XCAA 3AE3A 1O8SA 5K4LA 5L4EA 3MJXA 5AQKB 2LLYA 1VBE1 1ZZ9A 3RQUA 4EOZB 4NE9A 1N47A 4Z8BA 3SRZA 2JB8A 1HJFA 5C8CA 4WW0A 3EHKA 4A41A 4AHXA 2Q8DA 2JQQA 2Y38A 4IQPA 1V6MA 2JX9A 2D6KA 2XQ8A 1MS8A 1KFYA 4NRMA 4B1LA 4EZHA 5KWRA 2ZX2A 2UUCT 3EABA 2WT1A 3BKZA 2P37A 4J1XA 3DKWA 4PFPA 3V56A 1FOD1 2YK0A 2WDQA 1U0AA 2CDOA 5E6HA 4YVWC 5CNAA 2B5HA 1XXNA 3KT7A 4NN0A 2UUBT 3AKSA 2IIUA 3OUIA 2W63A 4GIWA 1HIXA 2YROA 2W4XA 4CQIA 5FXWA 2HWD2 2WNUA 4MGZE 1HFAA 2XM2A 2LHRA 4RS5A 3QOPA 3I2JA 2JDHA 5LASA 1AR93 1PVC2 5GLTA 3J8F3 4AI8A 3M1HA 1HNZT 4AQ6A 3WLUA 2X9YA 1VBA2 4ADZA 2A6XA 5E16A 4AVCA 1UN1A 1R093 3UULA 1LRZA 3UGGA 4MGYE 2XB6C 4ILBA 1Q8SA 3AAIA 2OZJA 3T4HB 1JYCA 4DBRA 4RYDA 1TQ5A 2CL2A 4YZ4A 4ZXEA 5HXMA 2WKKA 3H1WA 4GH4B 2XAHB 4KX6A 5C9AC 1DHKB 1YD8G 1UQXA 4P09A 5JRCA 2XPJA 4UFHA 4H9RC 5FP4A 2PELA 1F8VA 5H9RA 3AE1A 3ZMVB 4YARA 3B5LB 1RUG3 5LNKA 1DGRN 5FMNA 3NNJA 1OKOA 2TNFA 2XVKA 2BBHA 1WW6A 3VUOA 1UZYA 3TEYA 1LU2A 1WW5A 2ZZJA 3ZN1B 3LEIA 4CP9A 4OFGA 2C9AA 1ZP0A 2BP6A 4QPGA 2WINB 2JQ9A 1QOSA 3AE8A 1XNKA 3MKDA 4I2OA 2W00A 1PMJX 4LO8A 1WCDJ 1R083 4M3CB 3FLTA 1XNTA 1XE8A 1RUD2 5LJMA 2CBIA 4AQ2A 3P4WA 3O4XE 3LSDA 1AR91 4C1WA 1CN1A 3J8F1 4PIZA 2GALA 4QX5A 2DBNA 2I07B 2OZ6A 1QJZA 4HGAA 3D6EA 2ZGTA 4QDSA 4W65A 1VJ2A 3DXTA 1R091 4PJLA 1IPKA 3UYJA 3FZFB 2LW8A 4ZHQE 3O14A 1QJFA 5HCJA 2DUQA 3RRCA 5FPZA 4DUVA 2RHPA 1OVSA 4XBQA 2KZ7B 1LKNA 3IDEA 4BMEA 3LDQB 5AQGB 3ZFGC 2JPFA 1XNDA 3N9NA 5J98B 2LOSA 3SH4A 1BBT3 3HBKA 3D5OA 1RUJ3 5A7NA 5HWYA 1NXD1 1W8TA 2ZGQA 4ISQA 2LSIA 2DWGA 2Q9QB 4JBWF 1RUG1 4HT1T 1UX5A 4QHOA 3IDBB 3NWKA 3U11A 4HETA 4UW3A 5SV5A 1G9CA 3I1AA 1YCIA 4OFZA 2F4LA 5J2UE 2NYYA 4GMP0 5FZFA 2WZR3 5I0RA 3RIUC 1ZRCA 1JU3A 3VKLA 4XUQA 4CYDA 5EYYA 1Y43B 2KINB 2A7AA 4XE9A 2OQ6A 4KMQA 4NUVA 4NROA 3ECQA 2YC0A 1H2NA 5LEJA 3FFQA 1OD3A 3QACA 1R081 2DI4A 4FO9A 2ZX1A 1DZQA 3AXDA 3JB8A 1ND2A 3N7LA 5LA6E 3ZSKA 1MMAA 3FXDB 2BW8A 2LE8A 1UIJA 3POJA 4ILCA 1X50A 4LTAA 4LBOA 4XBLA 4KQ7A 4AWDA 4PNIA 4IERA 2OIIA 1MZFA 4K7JA 3P4PA 1W3XA 4A5XA 1UOGA 4MXWB 3VKMA 2WO3A 1GWMA 4WVMB 3GN5A 3MO4A 3NRUA 4NIQA 2CGNA 2YBPA 2ZZQA 2HWD3 3HEIA 2AGSA 3OD0A 3WG1A 4ASKA 1QJU2 3NV1A 1O7FA 3C98B 4CZSA 1BBT1 5FXZA 2P3JA 4K20A 3QOFA 4IHJE 1C8NA 1LVKA 1PVC3 3VBSB 2Q8CA 1RUJ1 2RG4A 3BOPA 2WZPP 5FUPA 4AL9A 3BB6A 1W0AA 2E9XB 1DQ2A 4BQ2A 2XHNA 4I30A 2ZXQA 3B69A 1WW7A 1T98A 2WFPA 3AYAA 5LHGB 5K9YA 5LWBA 3ABZA 4IV3C 2WZR1 3ZIXA 3MBWA 1L7LA 1DDLA 2FJDA 5FMOS 4RQPB 2ZGPA 3MV01 5JREA 1PM7A 2DCFA 4Y20A 4E4ZA 2WY2A 4A44A 1PO12 2CWSA 2BGOA 1HG2A 3E97A 3E08A 4E2GA 1G9AA 1W28A 2GNTA 4G2AA 1W6QB 1FATA 1A8MA 5A1AA 3RZJA 4L99A 2CSGA 4PFOA 2BOJA 3IM0A 3AZWA 2DV9A 4CN6A 4I02A 5IUQA 4HFEA 3CVRA 2VMEA 3PIGA 5GZEA 5ABGA 3EDVA 5CVRA 5K8SA 3AEDA 4CXYA 4YVSB 1PX3A 2HWD1 1IG0A 4XF4A 4CUBA 1RUD3 5IVBA 3NNLA 3ZN6A 3AKPA 3AP6A 1BR2A 1PVC1 1GWKA 4LK6A 3ZR6A 3RPUA 2NM1A 5FY9A 4LITA 4DXRA 2H6BA 2WWJA 4YZ1A 1H1AA 5BR8T 3ZJ2A 4B4QA 2R0HA 4CDQB 1R1ZA 4UFLA 3ZMSB 4CUAA 4BOWA 4BJMA 2WABA 1UPSA 1MS4A 1JZ3A 1NA1A 1OOPB 1W9WA 2XWBB 3ZFEA 3V0AB 4JGYC 3ZM8A 3IHRA 1H8TA 3L09A 5BNNB 1MPXA 3UFEA 1SLIA 4RN5A 4HWIB 1IPSA 4GWNA 1GICA 1ZKEA 1VCSA 4LQRA 1E5IA 2WU5A 3RF1A 5JR2A 1LOBA 2VL4A 3U0ZA 4L0PA 1OQ1A 4JGZB 1POV3 2WBLA 4GZ9A 4XJ8A 3FBLA 2JQKA 4CI1B 2BVVA 2G4IA 3I2HA 3K46A 4IDQA 1UZVA 2EAKA 1K3IA 2VTXA 2MNGA 2VY0A 2XKOA 4FPFA 5F7UA 2JRKA 2WLPA 1BYHA 1DQ5A 2VO5A 5KHGA 3PUAA 4IL4A 4NO4A 1HXS2 1NCQA 2ZM0A 3NL1A 1LKXA 4OCTA 1N3QA 3O1UA 4AI1A 1VAKA 2B8MA 3GBGA 2PA7A 3SITA 2BS2A 5FTTC 1RUD1 3HT1A 3MUY1 2JJ9A 1LENA 5JPNB 2JG8A 1KGYA 4O7XA 4DEQA 2XWJB 4A3XA 4OMCA 2JD4A 3RZLA 5IYZE 2P34A 1ZZBA 3JU9A 1JS9A 2Q8EA 4LO6B 5JQGE 1MS3A 3AXEA 4HN1A 1G86A 3T1HT 4MO3M 1AJ3A 1EZ3A 3T4VA 3FLRA 1JYIA 1OVPA 1BVP1 1JH5A 3NAPA 1KQRA 4DUWA 4CN1A 5FXVA 2UY9A 3IZOA 2ZM2A 3TEXA 4A4AA 3IMNA 1KNZA 2RMU2 4UEMA 3PMSA 2D0TA 3VR9A 4QDRA 1IAPA 2BOIA 4KG8A 1FNZA 5EFUA 3AAAB 5FY0A 4CDUB 3PVBB 1POV1 5H9QA 1H0BA 3M4FA 1S0JA 2P17A 1HG5A 3FN9A 5AQOB 2YC2A 1CIYA 2P3KA 1O59A 2R063 2BWCA 1CZVA 1EAH2 2XJSA 5F37A 4LBQD 3A21A 2GC0A 4XDQA 5FMOL 1RVF2 5DZFA 4Z90A 5LCWL 1PO13 2VB6A 4Q1PA 1YYNA 4Z82A 5LBBA 3LDKA 2WSSV 1G9DA 1GUIA 3AP9A 3S4UA 2ZTNA 1J3RA 4YM2A 3V65A 1T8BA 1CUNA 4CU7A 1D1BA 3WVJA 2X53S 3I59A 2VZ3A 3HN1A 4OMDA 2V1DB 5EJ1B 1I3HA 4I50E 4HFBA 3A7MA 4BJNA 4Y5TA 1O3QA 3QBQA 1LEDA 5F39A 4QQ2A 3QC9A 5EQUA 2GK9A 4JI0T 4Z92B 1H7CA 1NOVA 3AE6A 1ZBA2 3P7IA 2X9WA 5HWXA 5GJ6A 3TKLB 1HF8A 1DQ1A 4XDPA 4P9XA 4U31A 1ZZ8A 4GQ7A 3SFEA 4YHJA 5FPXA 5J2TE 1HV1A 4PJNA 4AEDC 4QXCA 3PJAA 3POBA 5AQRB 2L8KA 2X51A 1EY2A 2W87A 3CJIC 1Y7BA 4H55A 3LQCA 4QX8B 1WCKA 3E5QA 1LESA 1TZOA 3NV4A 4B7KA 1ACCA 3JC6C 1MIYA 3ZT7A 1K5MC 3A4UA 5ABJA 4CCEA 2R061 4HXCA 2JMHA 5FJHA 2AR6A 1WUVA 4J25A 5A33B 4YGCA 2D3PA 5A1LA 4YVWB 4F7ZA 5CKNA 3WF3A 4DV0T 1BCXA 5DUVA 3OBAA 1PO11 3LF7A 4ZI2D 2GAUA 5AFBA 2EXJA 2V5YA 1ZVFA 4BK5A 4XJUA 3VBFB 4XXAA 5T50A 2J1AA 1CX4A 1UYPA 1WZXA 4H9OC 1CPMA 1LODA 4JC1A 5FZOB 1WCQA 4EWEA 1SFPA 1XE7A 1AYM3 3I3DA 1X8MA 5FZAA 5FY7A 1UOBA 1MQTC 2EA7A 4J1WA 1HXS3 2VKHA 3VBOC 1RUE2 1T2XA 3AJZA 1UXZA 2CDPA 4Q25A 2GNMA 3RYRA 2W94A 1UY3A 1SCRA 3IA3A 1RUI1 2RJ2A 2EICA 2Y6HA 4HL0A 3U1XA 5C9AB 5GZFA 3N9MA 3KCXA 2P5BA 5H9PA 2Y8DA 1EYBA 1UD1A 3I7DA 2LROA 4B3ST 4P9JA 5FUNA 4AVTA 3Q8FA 4QPIC 3HI2A 3AM2A 4LO5B 1SBEA 3CIRA 3VZJA 1UIKA 3CL1A 1U5ZA 1BR1A 3HQXA 3UKNA 1XYPA 1MMGA 1OLME 3KHCA 3LIGA 2WL1A 5LA1A 5AVAA 5L3EB 2O8QA 2X5IA 2UU8A 4PBOA 3BTZA 3DUIA 3ES1A 2Y6GA 4G9SB 4WM7B 1BMV2 3V0BB 4XQWA 4QAWA 2JD9A 5JWPA 1H2LA 3P4RA 2WSVA 1QKQA 2HEVF 2W52A 2CY6A 1KF6A 3OYXA 1ZX5A 1LECA 3Q8BA 4JHTA 2XVGA 2A9UA 1K45A 2X05A 3OPCA 1XDOA 1EAH3 1AYM1 4LMLA 2M6IA 2FJBA 3DN7A 3H37A 3KF3A 4AYUA 5HXEA 2P6CA 2VOWA 3CZJA 3KBUA 3PURA 1R1A2 4QB2A 4YSYA 2VULA 4SLIA 1C28A 4IGPA 3W58A 1NE4A 4EQVA 4UFKA 1UYZA 2B1EA 3Q5XA 2Q4SA 5LHIB 3PNAA 1DGWA 3ZFGB 2PHTA 3BODA 4M3CF 3D0JA 4PF5A 4IEQA 3KT1A 4BU2A 1H9WA 4AQFC 1DZTA 3VDDA 1QNYA 1S55A 2YU1A 1RB8G 3BTXA 2WT0A 1FT9A 2L9LA 5A32A 4IEYA 1BXHA 2Y0IA 5IAXA 1NY72 1ZBA3 1HN0A 3LK3B 4EN9B 3QD6A 4FQZA 4UW6A 5CYYA 2ID4A 4DQAA 1YQ3A 1RMU2 3H1MA 3HL6A 1OEDC 4ES9A 1F9KA 3MGUA 2VBDA 4XBFB 4DV7T 4IGUA 5D21A 4XOGA 2QQIA 2LKGA 1DYKA 3O1RA 1KD7A 5JDQA 5L9RA 3AA0B 1W6MB 1HX8A 3JAFA 2P4EA 2X68A 1SFNA 3BTAA 3EVYA 1CR7A 2MAWA 2VZTA 4QKFA 3CMLA 4GALA 2QTWB 1CAWB 1LEMA 2CHOA 4Y1UA 1X9PA 2CGPA 5JXJA 1EAH1 5HV0A 1POQA 2N9DA 4BLIA 2HWC1 4N53C 3RLFF 2RS12 4A7ZA 3BVCA 2E8IA 3VZKA 3I3QA 2VQTA 4P9WA 3WR0A 1H2KA 2VU9A 5ANNA 3HBZA 5GLVA 3PVEA 1ASJ2 3NKGA 4C8DA 3C7GA 4ZY9A 2PAKA 5DJQC 4YTNA 5HCHA 4XUOA 4O4LE 5ABFB 2J1EA 1F31A 2QBXA 1LB2A 4BLJA 3ZDVA 3N5LA 4X8PA 2K24A 2GZWA 2VCAA 3P3NA 1BKZA 5DMYA 4EV0A 3RYIE 2WO7A 5FOBB 4B4RA 5K0UA 3N35A 3SKVA 1LNSA 1UO9A 3VGIA 3MIEA 2DUPA 2NPIA 1RUE3 1VAVA 4ANJA 5KBFA 2VVFA 2XBO1 4KGQA 4A7YA 1OFSA 4O4IE 2XZEA 1GKBA 1IPJA 5J37A 5FL0A 4IL9A 5BY5A 1UWWA 2IVIB 1Y9MA 4U7IA 1WA4A 4YPJA 2E31A 2GNBA 5AQPB 5HEOA 1W90A 1W9YA 2YYOA 1S94A 2W08A 3A0KA 4BQXA 3AMMA 4O65A 2YV8A 2V26A 3VV1A 2WNOA 4C0HA 2CEAA 1QH6A 2JDNA 4D6RA 3O0XA 4COWA 3ZJ1A 4O4JE 2JENA 1ZZ7A 2CE7A 2HPLA 3AEGA 4UELA 2IVJA 5FAXA 5LGUB 3ZN5A 2W3JA 2J62A 3MPBA 4NOTA 1W8ZA 2KWIB 2IDOB 2P6HA 3VKGA 2VK9A 2QVSB 2FDIA 1ULEA 4TUYE 1W03A 3FUOA 1MACA 5EPAA 4A6SA 2XQ3A 5EZYE 3OEBA 3UGHA 1Y01A 5HXSA 2K5BB 3TLSA 4P14A 1Y4WA 3IAPA 1W0NA 4H9PC 2VNGA 1OA2A 5BNOA 3MLJA 4LHLA 3FUQA 1OA4A 3BPZA 4PK6A 2VOKA 4N90A 3AXJA 3BOWA 2EVXA 2VW2A 5JR9C 5IK4A 1YQ6A 5JPMB 1R1A3 1RUE1 1BEV2 4BK4A 2ZHKA 2DBIA 2CCQA 3P8CD 3J7NA 3GXUA 1IBMT 5BYNA 2JXAA 3RPQA 4AG4A 5JAXA 3QUJA 4AFCA 4CXXA 4JGYB 3SCHA 3ACHA 1KS4A 5A3MA 5DG2A 4P5YA 3WQ0A 1J5WA 5FQ0A 5EJZB 4TWDA 1X8EA 4D94A 4AGGA 5ABHA 5DZEA 2CYFA 2NP0A 3BQKA 4IEWA 5FPAA 5FP9A 2XG3A 3F2ZA 1XSQA 2AZ5A 1UU5A 2Y6LA 5LYJE 3VD4A 3OGVA 1PMHX 1MNDA 5LB6A 2VJXA 2XL7A 3IMMA 3RIUA 2Q1FA 3M3CA 2BS4A 4QQHA 4DPNA 4NPLA 1H6YA 1QUUA 4GWJA 5C3JA 2XJTA 3LZZA 4AHYA 3U14A 2VOVA 5FYUA 3NNFA 2DURA 5JVDE 5C8CC 4TTGA 3SEEA 5JLVA 3HKBE 3RIFA 3P3PA 3ILFA 3B94A 3LGRA 2PJQA 2EIGA 4Y1XA 1M06G 5K7PA 3O1HA 1ZZ6A 1W2OA 1OXZA 2D3SA 2A1XA 3J9X1 2JEMA 2CWMA 2RS13 1J58A 4GOUA 2XVLA 4P9YA 1W6OB 3R05A 1YI9A 3K8PC 1R1A1 5AQQB 1W3VA 4YSFA 5IATA 2ILMA 4X1YE 2XUMA 4MV2A 3ZCJA 2WQYA 3KLSA 4G63A 2MEV2 2F6BA 3U4XA 2WNUC 3VLBB 2HKXA 2WT2A 1AYN2 4RS5C 4QGLA 1U5YA 3GMIA 3N7JA 1XZYA 2WDVA 3OPTA 5LG4A 3PL0A 1YI7A 5CFDA 4GMP3 5AC92 1ULGA 4HKOA 3U78A 4JDMA 5JMCA 4PI0A 2V5DA 1BVVA 2ZX3A 3GM8A 2VUCA 1GNHA 1VALA 4IV3A 3R84B 3KCYA 3EO6A 2A72A 5CKQA 1D4M2 4MGIE 5LBMA 4AFAA 3GDBA 5C5TA 2LUWA 2E9XD 4E2SA 4CUCA 3NVOA 4BQWA 3JUUA 3HNMA 1XNRT 2JDMA 3N7KA 1IJ5A 5IHYA 4U36A 4HWCA 1SFYA 1VIWB 3AKQA 2WZHA 4LMKA 2A71A 5C70A 2Q9QA 3ZSSA 3G7DA 4UWDA 2C9KA 5D8AA 1CAXB 1UMZA 3ROUA 3RYKA 1HS7A 2QDRA 4FOYA 5CISA 2H0BA 1PM4A 3OYWA 3CIHA 1YLLA 4QDQA 2RS11 4WBBA 4ASLA 1QWRA 3GZUC 3T0BA 2D5UA 4BA9A 4MADA 2YG0A 2ZS6B 3B7MA 1JZ5A 4DR2T 2A3DA 5B4XA 4QPGC 5IK7A 3ZXFA 1AJOA 5CBLA 4HEAA 2VZQA 3GF6A 4IEUA 2BBJA 2RS52 4M00A 5JDNA 4UV8B 2EXIA 1AXZA 3WCRA 2JB4A 3LSEA 3FC0A 3AB3B 3FMGA 4NWVA 1WBFA 1ZBE3 1W6NA 1A3KA 4IDOA 3WUCA 4JVAA 3AYEA 4AEDB 3GA8A 4GMP1 2YFZA 1JUIA 2CHHA 4ITCA 4OVEA 3HR0A 3JBG2 3AECA 1WLTA 3J26N 1ZZCA 3CJIB 4XFFA 2ARBA 3WINE 1BEV3 5BNPA 1TME2 3POYA 1G8WA 4LHKA 4CI3B 4AI6A 4JX0A 1K5MB 2OV9A 2X67A 1I94T 2NQYA 2C0SA 3P4SA 1HTJF 2B39A 1U5PA 2WB5A 1O4TA 1L7QA 5JH7E 4WVVA 1WLWA 4TXWA 2DU0A 3T2PA 4BH9A 4EJRA 1QJX2 2YDQA 2WSUA 4QX0A 1JYNA 3MF6A 3B01A 2IC6A 5A7SA 4GULA 2Y60A 1SDDB 1ZA7A 4R52A 2E5LT 2N2NA 1UY4A 2QNKA 5G04L 4QMAA 2E5VA 2KLQA 2HWF3 4Q4X3 1MQTB 2FCUA 2CAVA 1VR3A 2OPWA 3DCQA 4LBLA 3AE5A 3B57A 1VBB3 3VBOB 2OW4A 4IEVA 4AISA 1Y9QA 1ND2C 1AL0G 5A7OA 2VECA 1VP6A 3MIBA 1ZBE1 1W6QA 2TEPA 1GNYA 2D5FA 2DNXA 1COV3 5JXIA 4EGWA 2QQLA 1HKDA 2ZGMA 3H7JA 1BEV1 5HXCA 1T6GC 4YSXA 4QPIB 4YJ3E 2C26A 5A3LA 2AXDS 4QXBA 5FKYA 5FO7B 5FZMA 1V6NA 5IVYA 4W4ZA 4COUA 2CHNA 1KEXA 5A3UA 2X9HA 3R4SA 3IPVA 2UWAA 4OK0A 2QGSA 4LK7A 3ZO0B 4XAXB 1CZTA 2YFUA 4ET7A 2ZMLA 3CLPA 5AC93 3RC3A 4I3GA 1PZ8A 4YZ2A 3FB2A 4YM1A 1BR0A 4AVBA 1DU2A 5CA6A 5AQJB 1V6JA 2BERA 4DR4T 2JE8A 2DLRA 5FNVE 1W6PB 4C90A 3I97A 5BNNA 1D4M3 3OF1A 1RUF2 4P9LA 5A3OA 3WHUA 2HWF1 4B6XA 3AMPA 4Q4X1 4E4DX 3LCPA 3K4AA 2V6YA 2ZABA 2VCMA 2FUPA 1GQGA 1VBB1 3ZSMA 4FOQA 5C3SA 5JDBA 4EYYR 4N9IA 4H63H 3BQIA 3ZC1A 3Q5DA 4HK9A 2PHXA 4V1PA 3VZOA 5F8PA 3T2TA 2QA7A 4ISSA 1MMNA 1YO8A 3U4SA 3RZKA 4MGQA 1O5LA 4JI2T 4KWJA 4H9NC 1COV1 2OUHA 5FDBA 4CDWC 3SMHA 4NXNT 3UNPA 1H2MA 3A22A 2DFCA 3DEMA 4AQGA 4AAPA 2AACA 3QB5K 1QDCA 2D93A 2QQMA 4Y3OA 4BQ5A 2WJSA 5E89A 2RS53 5D1IA 3CKHA 3USUB 3MHZA 1OEDB 1S2BA 4WM8C 4X20E 2XJRA 1SPPB 2B76A 1YKHB 4YW4A 4HKLA 2D43A 5AC91 1HNWT 4IDPA 1NT0A 2VVSA 1NKGA 5FPUA 3JBG3 3SQOA 4I3PA 4GKJT 3KCCA 1LRHA 4LMJA 1TME3 5EV7A 4ZI3D 4RA0A 3LFMA 3KVAA 4HPKA 1X7NA 4QHZA 3N7MA 1LOAA 3ZFEC 4D7TA 2MPKA 1D4M1 4KBZA 1DCSA 1H8TC 3KM5A 1QMJA 4KWLA 4N53B 2W1UA 4DVDA 4QX7A 4JI7T 5IHRA 1PO22 2FDHA 1NZIA 3AEBA 1XNAA 1QJX3 1N33T 2XQ7A 4TWFA 4AGVA 4KBBA 4XHBA 4QKBA 2RR12 4E27A 5J0ZA 2W2IA 2PLV2 4XTPA 1O4ZA 4W6YA 2BVBA 4KI0F 2WLQA 4Y1VA 3UETA 2WMOA 3CMGA 4GB32 4EEDA 5F5WA 5FYCA 3KGZA 1KDKA 4Q0VA 3H9AA 5CFBA 4K1YA 1XPWA 3OB8A 4COYA 2UXCT 5I0UA 1NCQC 1HB2A 1V6IA 3IT8A 1DIWA 1N1TA 2RS51 2P3IA 4AEJA 3M8LA 3A7QA 1AR62 3KDSE 2JG8C 5A6YA 5I93A 2JDUA 5JOYA 4DZGA 2D2SA 1OC1A 5LBFA 5FMCA 4OZXA 1HRV2 4FPLA 4DO0A 4COZA 4K6BA 1A78A 3JBG1 5LMUT 4YXDA 1YW0A 2DCYA 3EXUA 1TME1 4DMWA 3WXPA 4DR7T 1NZCA 1P8JA 5FP3A 2XAFB 5E88A 3VHNA 3NAPC 2LM9A 3H3ZA 4E8DA 1MZEA 4UF0B 3ZOIA 4UT5A 4YG0A 5JXHA 4KUMB 1RJ8A 5T5JA 4IXLA 4F8HA 1RHI1 3UUBA 2QUOA 1BK0A 3WQ7A 5IJRA 2BFUS 1OFNA 1ZA4A 1VRBA 4YZ3A 4QB1A 1ENQA 2EHOA 4ZU5A 3LIHA 4AI9A 2JKBA 2XONA 4JKKA 3AAEB 2J1SA 3POGA 3PDQA 2XPKA 4AQYT 5EJ3A 3NJZA 1UPIA 5JZGA 5EHDA 4IEPA 3EMRA 1W9TA 4AQSA 4Y22B 3L9JT 2W66A 5LATA 4GD4A 1FOD2 1Q56A 2EIEA 2WIIB 5LK5A 1I5ZA 4OHZA 3RH3A 2JIWA 4YG6A 5FR3A 2LSKA 2VD7A 3RJRA 5FO9B 1US2A 2BDEA 2CA5A 4TWTA 1TMF1 4X1KE 4CCDA 5F5QA 2A3YA 4QQLA 4CCMA 1OQEA 4JI6T 2V8SV 4RR3A 3OUHA 3BCWA 2UURA 4ES8A 3VRAA 2YDRA 3O9XA 2CXFA 1YKEB 2J47A 2P9BA 3OG2A 5J96B 1GZ9A 2P2KA 4FAGA 2DCKA 1S0CA 3SCFA 2EAAA 4QU2A 3TNQA 4FTSA 4QXHA 1MS5A 3WDWA 2CWYA 3FZLB 2D6LX 1NE6A 1OH4A 1RUOA 3LK42 4OUEA 2YKSA 3ZSJA 3SISA 2CLYC 3AL5A 1GANA 4DR1T 3T1YT 5IFPA 1IZ3A 3K4ZA 2V7LA 4MXVA 3M65A 4BAYB 3JD71 4LHSA 3HKDE 3WNNA 1U5IA 2HN1A 4L2NA 5ABJC 4Y1ZA 3ES4A 4GAZA 4AKRB 4DS0A 3LOIA 2W68A 4HVOA 1W9SA 3AMHA 3VDAA 1KEYA 3ZR5A 4ZXLA 1QIQA 3ZPYA 5LRSA 3OPWA 2A3XA 4LFAT 4AW7A 2ZGRA 4JCKA 3CQXC 4WM7A 3I2IA 1Z0PA 4IETA 3F31A 4PK4A 1UK5A 3ZSEA 3DL3A 2Z42A 4NRQA 1S0DA 2RR13 1JMUB 2WNUB 2IWGB 1XDPA 4F8AA 3UU3A 3WNPA 3VDBA 1UY0A 4RS5B 5L3FB 4ZI7E 3UU4A 2WAOA 2WNVA 3HVDA 4GB33 4QPWA 3HPNA 3TRSB 4PJMA 2MTQA 1YQ2A 3D3AA 3VKNA 2HBTA 4CCOA 1A8DA 4A98A 2GC3A 5JMOA 1XQNA 2VBPA 4K0KT 3OJAA 5LY1A 3LJCA 2WUHA 2FDKA 2J22A 2W5FA 3WF0A 3AC0A 5L7OA 3MDPA 3ZFFA 4U2ZA 4IDZA 1ZRIA 4L92A 5A7WA 2JDPA 3J7HA 2QQJA 2B4KA 4TV8E 2RS31 4A42A 2LT3A 1N3OA 2A73B 3AE7A 1NLSA 5F6LB 3C4WA 4NPPA 4AHWA 2ZAAA 5JRCB 1JTZX 2WP9A 3T30A 2E26A 2Z4FA 3ZMZB 2QVAA 2YC4A 4OYUA 4FT8A 4LUKA 4CP0A 4EIWA 4E9KA 3THTA 2BUKA 3RQWA 1FXZA 1YXWA 3RWNA 1F35A 2ZMAA 4AOCA 4BQ4A 5F1RA 2LOPA 1RC6A 2BV4A 3TYJA 4CP9B 3I9YA 2BFUL 4FPOB 2ZGOA 2FJEA 2X5IC 1H4GA 4QPGB 4EWAA 4DUZT 3N2GE 3ITQA 2RDRA 4LF4T 4LKSA 3WQBA 4RGAA 5FYBA 3OEAA 3T3YA 4P00B 4BE3A 2BVMA 2RR11 2DF7A 1OUSA 5A1FA 4HSJA 4GYSA 3RI8A 2LEHA 3CF6E 4FP3A 5LJNA 2D6MA 3J7LA 3OUJA 3PJQA 5C3OA 2ZBJA 3DECA 2H88A 4GB31 1VMJA 2JE7A 3TNPB 4EWDA 5LB7B 3WCSA 4MG2A 3MIGA 4P0AA 4QHBA 1Q8PA 3MLKA 1QOOA 4Q0PA 5I0SA 2KA3A 5L36A 2PXJA 4PQ9A 4N43A 4MYEA 4AK3A 4URAA 3ST7A 2NP9A 5T5LA 5I91A 2ORZA 3R6NA 5IVJA 1VMFA 3TLWA 5DQWA 4FAHA 5C4WA 1CPNA 1DQ0A 5AQLB 5KXBA 1SLAA 1OURA 1IZNB 5KXDA 3VDDC 4MHRA 5EXOA 3ZYGA 3RC8A 1YXRA 3UK9A 3PUYF 4DUYT 3A23A 2NW7A 1YFXA 3P4QA 2VXJA 5FZLA 3ILNA 2HH9A 5IT6A 3HMYA 3B93A 4UI9L 2RV9A 4DV6T 4L0RA 3FLPA 2JG9A 5KMGP 4NHYA 5JTGA 3ZMUB 2QFEA 4GA9A 2WU2A 2VAUA 2RDQA 1V00A 4XABA 4U74A 4IL7A 1SHWB 3QB5A 2IW5B 3NKTA 1QHDA 1LHUA 3N9OA 3MEPA 1ULFA 3KQRA 1QEXA 2XAQB 5CG8A 3PUQA 2VKJA 1ALYA 4FP2A 4LJHA 3PVNA 1B7TA 3MLLA 5FY1A 2WA3A 4YGBA 2G0UA 1OXCA 3OOXA 1ND2B 1PMIA 3LE0A 4Q4W2 1UUSA 2H7VC 4LFCT 4JI3T 1FAYA 3VKHA 1UY1A 3ZYMA 2VZ1A 4TZ4C 5L47A 5GLWA 4W6XA 2WFF3 5CFCA 5J3UA 5FYVA 5JDLA 4Q29A 5F3GA 1V9DA 1J59A 1B35A 3UJOA 4OYKA 4N8MA 2EF6A 3EUHA 1LJ7A 3OY8A 2PMWB 3H8XA 3RQ0A 3UUNA 2Y33A 1XNQT 4WBOA 4M0NA 4TWHA 1S0GA 4HVQA 5L3GB 3GN5B 4YTMA 3K51A 3Q8CA 3WSOA 2HBUA 4DV1T 4LA3A 1UAIA 3KGLA 3WG4A 1JU4A 2MBGA 1YFWA 3CKDA 1BQPA 1WYBA 1WMXA 2O1QA 4Q26A 4YW3A 2X8KA 2NLRA 2D6OX 5FYZA 5K0UC 3NJVA 3EAMA 3UQ4A 2WZEA 2OQ7A 1MS1A 1UKRA 4X64T 2R043 1MVEA 2PHLA 1JHJA 3EJKA 4K8RB 4XFBA 2YDSA 3ZVXA 4ZONA 4WVWA 4Q27A 3W15B 3WDVA 2WMNA 1R64A 3GCXA 1GZCA 2WC2A 3J7MA 4D8MA 5L3BB 1LHVA 1L3JA 3CBNA 2XQYA 4H9SE 2XJVA 4Y20B 1WLXA 2DVFA 4XZPA 3O1OA 2BNOA 2GH8A 3NSTA 5C2TA 2NZ9A 1SLBA 3MFCA 1X33A 4HWFA 2H7OA 4LXLA 5T52A 1WR6A 4CU9A 2WFF1 1BHGA 2LRLA 4OQ8A 3CWZB 5I8SA 1VMHA 3SLIA 4WV8A 1YJLA 1UW8A 1IKQA 4B7EA 4UFIA 5LRRA 1IS6A 4GIQA 2IC9A 2OPKA 3ZXAC 5F9TA 3ZYKA 4YG3A 3LA7A 3AZVA 3UU6A 3NRYA 2V09A 3T2QA 3C7EA 3A5XA 3RYFE 5T3NA 1EPZA 3K2OA 4TNWA 2QRXA 3NJYA 1W8WA 3KV9A 5FZEA 3ZN6B 2XQ5A 5EYXA 2H89A 5IVEA 1GOHA 4H3WA 5BNOC 4KWKA 4XJ9A 4UVBB 2E7AA 1REEA 1CJPA 3OBZA 3SH5A 1UYXA 5KX5E 2R041 1DF0A 2LSJA 2D6NA 2KWHA 2IZWA 1GZWA 1NA1B 3ZFEB 1N1SA 2D6PA 1H8TB 4B29A 4CSWA 3IDCB 5FY8A 2JIJA 3O1SA 1C5IA 3OSDA 3ZLIA 3BU0A 3JC6D 2UXNB 5AFEA 2XJ7A 3N36A 2J1UA 3ZYPA 2W39A 4SBVA 1JOPA 3EQEA 4U3CA 3UKTA 4IE6A 1KJRA 1MS9A 4CUGA 2DWKA 3N2OA 1YIPA 4BJ0A 1D2SA 3HIFA 4A56A 4DNDA 1U5XA 1XMOT 3NO8A 3RRDA 4FSJA 4H14A 1O6UA 3QH6A 2XH6A 1I5PA 4FI5A 5FVKA 5FFOC 4Z91A 5FYIA 3FXEB 5AQUB 3WP3A 2YEVC 1O8PA 1WRDA 5JXGA 4ASMB 1O3SA 1ZRDA 3THDA 2VCBA 2UXBT 2ET1A 4OI4A 4K8FA 5DAQA 3F57A 2BG9A 3L2HA 1NCQB 4G3YC 1SLCA 2GN3A 4D6SA 2PTFA 2XJQA 2KXPB 3MZHA 5JOZA 4CP2A 1SBDA 3UT0A 4Q4W3 4QGNA 1CVNA 2JG8B 3ZCIA 3U3IA 1ODMA 1QXRA 4Y33A 3UU5A 2VUDA 1HB3A 1TG7A 2BKNA 3ZYFA 5LMNT 1UU6A 4DFSA 1CONA 1KS5A 5IW0A 3VL8A 2HN2A 5F6KA 5AQSB 4TLGA 1J3QA 2VE1A 4UXAA 3HQUA 4JI1T 3FE5A 4QM8A 4QB6A 3Q5EA 2G19A 1YC61 4LORA 2X0HA 4CEWA 4L9BA 4F3JA 3SHRA 1A34A 3HKCE 1RYYA 3RI9A 3AA1B 3N9PA 2W91A 3DYPA 4ZS2A 3WAKA 2VZPA 4AAXA 3MICA 2GP5A 2JQHA 1QOTA 4IEXA 5CFDC 2VZUA 3C7FA 2VNOA 5H9SA 1NAEA 3U37A 2F4VT 3ZKUA 4HG6B 3R0RA 1CAVA 4IIJE 2R062 1S0EA 3D0SA 4D69A 2ZEYA 2GN7A 2ZEZA 3ZYBA 5KHHA 3BUCA 2ZLYA 1QDOA 2VVEA 1Q43A 5CIRA 3O1MA 5LBQB 1GQEA 4CDXA 5FLIA 3WW2A 2J1TA 1OPMA 2IMLA 5JDFA 5CZKA 2K48A 1MEC3 2Q9QC 4Q4W1 2XR4A 4Q5OA 4ZU4A 5HAXA 4K21A 5D8AC 2F4PA 2V72A 4P0BA 5B2GB 5TAOA 4CA9A 4CDWA 3UV9A 4HWHA 3I59B 1HNXT 2Y34A 4DXZA 2Y8KA 4XMIA 4MGTA 4AHZA 4NHXA 4YRDA 1XNCA 2HWB2 3VBRA 1UKGA 1UF2C 2QZ3A 3KF5A 5DPNA 2XQ4A 4DY3A 3I3EA 1LVFA 5C7GA 4XVHA 3LK2B 5A3TA 4WM8A 2UWBA 1YRZA 4I09A 4CCKA 1FNYA 1RUI2 3KSCA 4K1ZA 3DTOA 5FVLA 1IQDC 3GHMA 3RFRA 2IXKA 4AKIA 3AEEA 4PLNA 2CLYB 5EIYB 3AE4A 5JDHA 1YIFA 4QXCB 1IQAA 1RINA 5LGNB 4CVUA 2VNRA 3EB7A 2JJ6A 2W62A 4XETA 2IXJA 1X36A 4YJ2E 2A70A 2VXRA 5BNPC 4MVTA 5FIXA 3LEMA 2UXDT 4S2GA 3JCFA 5A7QA 2BQPA 5ABJB 3WUDA 1QU0A 4QQPA 3A8YC 5J7MA 3QNUA 5KDMC 1NENA 1W06A 2RDNA 2ZAHA 2JECA 1S0FA 1AL22 4DRRA 4XIOA 1HQNA 5DZGA 3RZMA 1OI6A 5F2SA 3GYDA 5FPBA 4BA6A 3E0ZA 1MEC1 3OVUA 1FV2A 3Q5WA 3H3LA 4NIDA 1CQ9A 2KSRA 4O61A 1PZ7A 4XAEA 2BZBA 4LULA 1AYM2 1E2AA 1CAUA 1UX6A 1D1CA 3ZSLA 2MOZA 3K48A 4JHZA 4OHXA 1PGL2 1JYTA 3VN4A 3FZMB 4CZZB 3D0TA 5FWJA 5FO8B 3ZYHA 1C1FA 5KHJA 4KP3C 1UCXA 3FL7A 1YJKA 4I01A 4LFBT 4TX5A 4LOSA 3FBMA 3UT5E 3HNBM 4ZHNA 5FCCA 1FV3A 4PJYA 5FYMA 4XF3A 1Q8QA 3MIDA 4XFGA 3RI5A 2CXLA 2A6YA 3ILRA 4XXPA 3FJSA 2NR4A 1IBLT 3FZ3A 5A3NA 3PLQA 3WI3A 1ND3A 3ELNA 2K9AA 1JZ8A 2DDUA 5EP9A 1MZ6A 2WN3A 2JE9A 1REFA 4TSVA 2CPTA 1LGBA 3HNYM 2ORXA 4AEMA 3ZKRA 4H63V 5GZCA 3O5SA 1K42A 3WDUA 2QE3A 2X5IB 4LF6T 1W2AX 4CP1A 1SE7A 4CDQC 1N1VA 1JZ6A 3IKWA 5H6QB 2ACZA 2GU9A 2K0GA 2ZX0A 4NUBA 1Y9GA 4LT5A 4YWAA 1ULPA 1QJY2 1D0YA 2HWC2 5BNNC 4XEZA 1GWLA 4UBHA 4J2CA 3DKQA 3LSVA 5C33A 1C3HA 4COVA 1U4QA 4M4PA 1JNRA 2YY1A 2V4AA 1GOFA 3S30A 3W20A 2DU1A 3ZMNA 4XUTA 2K9ZA 5L9VA 2LM2A 4NIGA 4FPHA 2BJSA 3RMXA 3EHZA 3VDDB 1WCUA 2MHFA 4MGSA 3MACA 1HDKA 2HWB3 5A32B 2AREA 2VCCA 3VZNA 2PHFA 5ACA2 3BIEA 3ASIA 3KBTA 1Z7S1 2XBO2 1ZRFA 3WNKA 3TLVA 4XJZA 3PIJA 5FY5A 3POIA 4LLOA 3OPZA 2W1WA 4JEUB 4MFRA 3EYPA 1X79A 1RUI3 2QQWA 4LO4B 3DPRA 1N1YA 3ZYIB 3KT4A 3T0DA 1W0OA 3PTYA 1AZDA 3ZKYA 3L8RA 3FZKB 3KB5A 2W9XA 3WEZA 3OGSA 2FBEA 5HCFA 1XU1A 1D0HA 4BXSV 4XBNA 1D4VB 2DTWA 1AXKA 3CPZA 5ETWA 5FMBA 4BQYA 4CI2B 4MSVA 1IS4A 4UF0A 3CK6A 3PUIA 5CEHA 2HWE2 4DMIA 2BGCA 2YGMA 4UW4A 4YYOA 1GNZA 5C8YE 4LF8T 3DXUA 5HEUA 5HYAA 3AZZA 1GOGA 1ZYBA 1AL23 4N7UA 4TZDA 1C57A 5DAPA 1W9RA 3U75A 4LBQA 1W0PA 4LMFA 4JUYA 4GK0E 1JZ4A 3B00A 4TLFA 4PT6A 3NNMA 2VTXJ 2YZ4A 3GZAA 3H0OA 3HQRA 3J4UH 1ULOA 2CTVA 3WY6A 4O9EA 1RTVA 5HPOA 2C24A 4C1XA 4NHLA 2DCJA 3UGFA 1DGRA 2WYFA 1V0AA 2C5JA 3Q9OA 3PUSA 2HWB1 2VQ0A 4K0UA 2XM1A 3KWVA 1VOMA 3S6PA 5K0UB 2Z6EA 2HHHT 4DOUA 2ZCWA 1QSDA 5CU1A 4YLHA 3MW4A 4XFIA 4XTMA 4DIQA 3R4UA 3C7HA 1BZWA 2W0XA 2HYKA 1GU3A 3FX3A 4RFRB 4TYSA 2WAUA 3R4DB 3JADA 4V1Av 5BPXA 4ZU7A 1GBGA 4XAAA 1MR5A 3X1DA 4QWNA 3WNXA 2WN2A 5EK3A 1YFYA 4IGQA 4Q1RA 4ILUA 1CWPA 3IF8B 4MH0E 4CEYA 3KFWX 2XQ9A 1N34T 2NMOA 4KU7A 1VRH2 3AKTA 3VBHA 1IHMA 4ORFA 3WW4A 2ODVA 3WDXA 4KWUA 1X9TA 2CXDA 5L2LA 4IV1A 1AL21 3WP6A 4LO7A 4EEBA 2XQXA 1GP6A 4NIIA 5T54A 2ZM8A 4NHKA 1KK7A 2VZSA 2EHOC 2VQAA 3VKFC 4Q0UA 2VW0A 4OUSA 4XQDA 3L3PA 1V9U2 4X1IE 1YQ5A 3T08A 3PTRB 3IB3A 4QGMA 4KNCA 4BZ4A 3JCIA 4KMCA 3VBUA 3PUWF 2VC9A 5FZ8A 5JZGC 2RM23 3GZEA 4Z1VA 4X62T 1QJY3 2HWC3 4XFHA 3MI8A 2BYVE 3OGGA 4GWMA 4GKKT 1VBC3 1PK6A 1XMQT 5BNOB 5ISLA 3NJXA 3IN9A 2YPDA 4XDOA 3AXJB 3NKZA 2PQQA 1PGL1 2FDJA 3AE9A 2LRPA 5C6CA 3M3IA 4CU6A 4E7ZA 2D0UA 4I43B 3BU7A 4JV5T 3RHWA 5FZGA 5LBEA 4MALA 3VBFC 4NMIA 1SLTA 3FHQA 2EIBA 3PVOA 4RR3C 1N3PA 5DXDA 1UURA 4LF5T 5JCTA 4AR2A 5J09A 5FQ0B 4HTEA 4TN7A 4BQ3A 4FPJA 3SH3A 2DHRA 3ZYLA 4OZOA 5ACA3 3H3AA 3CQOA 3VL9A 3OCPA 2XBO3 1WYCA 1XNBA 3EDUA 2WDBA 3KMHA 1YUDA 5GZGA 2C5KT 4AXOA 4RL7A 2VMFA 3K4DA 3PJAJ 3J9SA 3TN92 3MA9A 5GALA 4QXKA 2D40A 2XL9A 3F95A 5LZ6A 2BU9A 1D1AA 1DYPA 1NCRA 5FLJA 2V6XA 4PJJA 4DNYA 2VQUA 4Z07A 3RG0A 4BMBA 5J1XA 4R9BA 5FZIA 5ABEA 2ES3A 5FWEA 1RUNA 5HI0A 2GNDA 2A2FX 1OBNA 2K2SA 2ADEA 2RM21 2XQAA 2HWE3 1QJY1 4QM9A 1YNAA 4FPYA 2H3RA 3H3MA 3ZXEA 4AKLA 3VRBA 2OUJA 1IS5A 1VBC1 5FP8A 4PDWA 3QLQA 3R6SA 3UUXB 4YNIA 3HR9A 2WDRA 4JKMA 1ZHCA 3WX5A 4LIVA 2KNDA 5HEHA 1HQWA 1O3RA 1SLLA 1HB1A 4BQ1A 4O2AE 4WM7C 1HB4A 4I0WB 2XKPA 4LOTA 1FMVA 4DV2T 4WZFA 4Y24A 4XCBA 1D0ZA 5FMDA 1C8M2 1KFUL 1ST8A 5A6QA 2NTYA 5FZ9A 3CU7A 2WNVC 1DGLA 3I2KA 4RSUA 3LBXA 5JOWA 4Y4YA 1FMWA 5CFDB 5JIUA 3WP5A 3WF2A 5E0OA 4JKLA 1FPN3 2A6WA 5ACA1 2YINA 5F3JA 3DF0A 1VBD3 4DIDB 5L7OC 4IV3B 5FZ0A 2C1FA 5LEKA 3ZFFC 3ANWA 1L7RA 3TEZA 1MMDA 2Y0OA 4CCLA 1CZSA 1AX2A 3DYMA 5IWAT 1QNWA 3FBYA 2ZA9A 5HCBA 1B09A 4BISA 5F5IA 1R8IA 2WNEA 2JMKA 1E7PA 5GM0A 2VVNA 4B1MA 2FZ1A 5EZWA 3VD9A 2XXZA 5JVVA 2XOMA 2W47A 2YHJA 4TNVA 3AFGA 5LA0A 1AJKA 3AVRA 1GSLA 3OBRA 1VRH3 5D8AB 2HWE1 2PAEA 1KITA 5A3PA 3OYWB 2FJAA 4BIFA 3CQGB 4AFDA 1IS3A 2JKXA 2VASA 3H7YA 5FYHA 4ONUA 1CJDA 4DY5A 1V9U3 2HLEA 5JOXA 4AZZA 3OJBA 2NW8A 4WZCA 4LBKA 1ZBE2 2B7YA 1EUTA 4KU8A 3LAGA 3WV6A 1F15A 1W6NB 3C50A 1MZ5A 4R9CA 4PLOA 3AA7B 4L11A 2ETEA 4U33A 1FPN1 3N2KE 2ZMNA 3SKJE 1VBD1 5IYYA 4N43C 1OLRA 2DUOA 3MFAA 4YW7A 5BNPB 4AEKA 1LR5A 4ZEYA 5AQVB 2ENRA 4U2YA 4NWWA 5F5CA 5C4WC 1HR0T 4L97A 4HOOA 5FPLA 2WS92 3HT2A 4YGDA 2W61A 3NQHA 4QX1A 2W95A 2VOXA 1ENSA 3THCA 4CTEA 1T7SA 5DG1A 1H30A 4O8SA 3L39A 1VBA3 5J1GA 1OKQA 2VNVA 2BNMA 4ERRA 2VL8A 1F4AA 3HAGA 4YZ5A 4DMVA 4E7SA 4IREA 4M3CE 5E8AA 1VRH1 4LBMA 1CIWA 2XSBA 2DTYA 3ZPOA 1W0BA 2KXLA 2JG9C 4PHZA 3NV2A 1K12A 2YPJA 5CJ5A 1OF4A 4I0BA 4NRPA 4GH4A 3K77A 4HFCA 4XPVA 3TN93 3EI0A 3ON7A 2HWF2 4Q4X2 4XHXA 1LTEA 3GBFA 2CM0A 3WW3A 4QH5A 3K1SA 1VBB2 4FTEA 4DBQA 2HJIA 1V9U1 2LTNA 2OXBA 1W99A 4A45A 4ZXKA 2MYSA 3CJXA 3V5SA 4BPZA 1WW4A 2PQSA 1QGLA 4JV4A 3N9QA 3ONJA 1SA0E 4FFGA 5DN2A 5FZDA 1HLCA 1LCLA 1COV2 4N7IA 4XUNA 3C64A 3J7Yq 1O3TA 5CFCC 1BJQA 5CA0E 4S2FA 5JSOA 1MVQA 1B35C 3CHXA 2GH2A 3PHMA 2VGDA 4M3CA 1MIVA 2FDGA 4QXBB 4LNVA 4F83A 3B9IA 5H6RB 4QKNA 1AX1A 3M3EA 1C8M3 4EROA 2F17A 1V6OA 1J1LA 2PHWA 3PMEA 1JNZA 2WQZC 4BB3A 1GMMA 3IPVB 3LWCA 1DQ6A 1JOBA 1GQPA 1VBA1 1FI2A 2Z69A 3FHNA 2VURA 2E7QA 1UX4A 3AP4A 3IBMA 4AVSA 1QF3A 4X6QB 2VM9A 2J42A 4L5GA 2I45A 4ILAA 5KC6A 1A6CA 4GWIA 4JQTA 4WBNE 3LPGA 5CKMA 4HKWA 2GDFA 4CN4A 1BK1A 3TN91 3POEA 4NIHA 3ZMOA 3MZKB 1V6KA 5F3CA 3SS1A 2LS6A 2G9FA 1LULA 2V6YB 4KI5M 3P5BA 4EAHA 2QDNA 5FREA 5FP7A 5A7PA 2SPCA 4YLZA 3B13A 3ESLA 2G9GA 3IDAA 1XSRA 4MUVA 3INAA 1XC6A 2E63A 3TLUA 3K3OA 3ZXGA 1W04A 5AQFB 4LHNA 5IAVA 2VPVA 3ZXKA 1J1TA 5BMVE 2ZX4A 3O12A 5L73A 4UVAB 4NR1A 2J1DG 1YEWA 3SFDA 1H8VA 4DB5A 4FQ4A 4XFAA 2CNAA 3UUMA 2K3WA 5DAWA 5LY2A 4OLLA 3O1IA 1C8M1 2DFBA 5M0TA 2OS2A 3PJYA 3AE2A 1E5HA 5FZBA 1LGNA 2UY8A 3Q8EA 4MXWA 5CADA 5DQ0A 5FZKA 4WVMA 4YTPA 1HCIA 4NJ4A 1PIV2 5J48A 4XF0A 1XBFA 3KS7A 3GNEA 2ZGLA 2VH9A 3I9WA 4HPKB 1XRUA 4UXNB 3RZGA 2IXCA 1S0IA 2EALA 3PUXF 1RHI2 2ZPXA 4I55E 5KHIA 1QJU3 3VBSA 2WS93 4QX7B 1CGPA 2UU9T 4UW5A 2C5DA 3HOBA 3JQXA 1JZ7A 1ZREA 1OD5A 4JYAT 2E9XA 3GWHA 4FXGB 3VR8A 4HBNA 4UOJA 1BLZA 4EN0A 4XUPA 1Z0HA 3AFKA 5IK8A 2FMDA 4XILA 4Z2WA 2XLFA 3QK6A 2NTXA 3RS6A 1LAJA 3BYWA 1OT5A 4Y5Z0 4RQPA 3JXSA 5BUVA 1NUKA 2Z5WA 5GLZA 4W8JA 1UZZA 3RX6A 3PUGA 2BG9C 4JTOA 2JWPA 1UMHA 1TMF2 1ZOYA 1OUXA 3I8TA 1UCUA 3TOJA 3ZXLA 4KHZF 1WFDA 2VKOA 3ONLC 1JN2P 1G7YA 4XF9A 1DLLA 3FWEA 3VD7A 4IE5A 3KHBA 1J84A 5AVPA 1X82A 4HONA 2P1BA 3AYDA 4MX3A 2H0VA 3ENRA 4YSZA 5BNQA 4CE8A 2GMEA 1HRI2 3FBZA 5FZ1A 2M6BA 2A6VA 5DUXA 1RUC2 1JHNA 3IWZA 4YVSA 4LA2A 2WR9A 2WZ8A 2XUEA 2PHUA 3AA6B 1LOFC 4OHFA 2YB7A 2JDKA 4CEWC 3VD5A 2VMCA 1TVGA 1QJU1 3W5MA 2WS91 4FPGA 3N4MA 1OF3A 5BXXA 4WZXA 4CXWA 2Z79A 3CEWA 4HANA 4CDQA 3LOBA 3FHIB 5KHKA 2EHOB 4XIKA 2VBBA 1WD3A 4AIUA 2XAJB 3JD72 1LOEA 2X10A 1OOPA 5EWSA 3V0AA 3JB4C 1W2UA 4IEOA 4AE2A 5JSRA 4CU8A 5JZGB 1HV0A 4P02B 1WCSA 2DVBA 2ZKLA 3AKRA 3C51A 5FOJB 4FVVA 3CNAA 3RDIA 4A7KA 2XJUA 4ATFA 1O91A 3VHOA 2QQKA 4UFJA 4MLOA 3E5UA 3RGBA 4TV9E 1JZ2A 2QQUA 4JGZA 1YQCA 4CDXC 1OQDA 2Q1ZB 5JI9A 4HMZA 2YGLA 4Y26A 2Y6JA 3BGAA 1PZ9A 1E5SA 1RITA 2YDEA 3AMNA 4QKDA 2XSAA 4OUMA 1N36T 4XW3A 1SQ4A 5ANQA 5I8YA 3H50A 2ZGNA 4RR3B 1SDWA 2BS3A 1VAMA 2A75A 3WW1A 1CHUA 4U7YA 2E2AA 3NVCA 2IXIA 2Z2SB 4UAPA 1VB4A 5DABA 4IE7A 4COFA 2BZDA 5FK7A 1KRIA 2BKPA 3VBRC 1MIWA 5F3IA 1EUUA 3DP7A 5FUIA 4QXHB 4DV5T 4P08A 4V2WA 5IFTA 4WNKA 3PUVF 5HV4A 2RS32 5KR7A 1VE0A 2I74A 5JR7B 5C71A 1US7B 3W59A 2RE9A 3RVHA 1RXFA 2B45X 5C8WA 5F5AA 3LEGA 3MV11 3KINB 2IFWA 3IEEA 3QH7A 3V5UA 1UGOA 1PIV3 4ARYA 1AVBA 2VL0A 1URXA 5AFUL 1DZRA 3FHAA 4R4XA 4CCNA 3TEWA 1U12A 1PGSA 2AUYA 3GZTB 3NZQA 2R0FA 5CAZA 4V2VA 1ZEEA 5CB4E 4NPMA 3C7OA 2WZIA 1W8OA 4PQQA 2OLTA 2RP4A 2RMU3 1LOGA 1RHI3 4YHHT 1C4RA 2JDAA 5KXCA 4UR9A 4IE4A 2VQET 4CDUA 3ALQA 5FYYA 1DFQA 1OH3A 3FFZA 2WWUA 2XLGA 3X29B 2VTFA 3WG2A 1QH7A 2WS3A 4AI2A 3ETUA 4ISTA 3DJBA 3AP5A 3I4IA 3URFA 3F2EA 1J5ET 2YU2A 4FXKB 1XJAA 4IDNA 2YXSA 2ZJCA 1Q3EA 1RL3A 2WNVB 2WWVA 1WWYA 4Y4RA 5CGMA 2ZEXA 3B5MA 4EYUA 1HXS1 3AL6A 1RVF3 4AKGA 3ZEFB 3C4XA 1O4YA 4RD7A 1XE0A 4OULA 4UFMA 2BRTA 4AI3A 2YUEA 1TMF3 4ZOLE 3WP4A 2FBWA 2EXKA 1QQP2 5L7OB 3LA3A 3MW2A 1VPHA 3ZFFB 1I1EA 5HBAA 5A7WB 2CV6A 4DRVA 3P50A 5JDGA 3NNGA 2HH7A 2B46X 1OLMA 4W6WA 3M3OA 2BTVC 4P1NA 2XHKA 1T6BX 3WF1A 1HRI3 1PIV1 4PF1A 1RUC3 3TWIA 3MK7C 2DWRA 1DLCA 1LHNA 5LHHB 4M1PA 1ND3C 2R1BA 4NVPA 5CG9A 3CX6B 5AQMB 1NQDA 3M3ZB 2RMU1 3LB9A 2NN8A 3AJYA 1F5JA 4X8NA 3W5NA 1LHWA 5IWFA 2Y6KA 2LRKA 1JXNA 4JQRA 4BWOA 3I3MA 4QQOA 5FRAA 4D3WA 2XMLA 3FZHB 1WGPA 4YY3T 4QX8A 3WDTA 3ZT6A 1FX5A 3RYHE 3UJQA 1ENXA 1APNA 5FZCA 4B4PA 3JD73 2X09A 5A6ZA 1RXGA 1PHMA 4CPBA 2ZGSA 3OKQA 3N3HA 5A33A 3I54A 4ZZ5A 4YVWA 1YHFA 3TAYA 2XY8B 1NLQA 1RVF1 5JR9B 3QCWA 4B3NA 5C3QA 2ARCA 2R6QA 2D98A 4N43B 3RZZA 4FI9A 3E5XA 4FFIA 4FTBA 2HEWF 3VBFA 4QT6A 3H8OA 1AHSA 1HW5A 2V7IA 2CRBA 2VZOA 3V64A 4H2AA 4PBPA 3M70A 4LKEA 5C4WB 4S2HA 4RGKA 5L4HA 1H4HA 5FZOA 1JYVA 1XYOA 1XB9A 3P1IA 1N32T 3ETPA 5F32A 1HRI1 1DBNA 4AQTA 1RUC1 2E6VA 1ZM1A 2W46A 3AEFA 5J36A 1ZBA1 4HN0A 2I2SA 4META 3ABVA 3POSA 4MBQA 5BV6A 3O1VA 2JG9B 3U07A 3NW4A 4XACA 5FZ3A 2OX0A 4K3UA 3L2YA 2BWAA 2CMRA 3JQWA 5C9AA 2X29A 4FOWA 2BBAA 2RS33 3DPRC 5GZDA 4D7YA 1D0GA 4YW2A 3HWJA 2ZOEB 1SCSA 4BXFA 4DR5T 3SOLA 3O0WA 5KC5A 2Q0AA 2PN5A 1BR4A 5C8CB 4KHPT 4C0BA 4JDOA 2H6CA 2GP3A 1XOYA 1WMDA 5AQNB 2ZEWA 4OQ9A 3D4KA 4DINB 3H1YA 2E53A 3TLTA 2WFF2 4XJAA 5KXEA 2QQVA 4LIUA 2B9UA 3RJ2X 4P9IA 5CFCB 1HQLA 3W21A 5HCAA 3LEKA 3GCWA 1B35B 4LPLA 2ZHMA 2QQNA 3WAJA 1NYWA 1Y64B 1VLNA 3OY8B 3T2OA 3V0BA 4HE8A 2ERFA 3MW3A 1QLBA 3C4ZA 2IAKA 4N78D 3OTOT 3I0OA 2K46A 3VB9A 2KR2A 5LCYA 5AQHB 4IW3A 4JI5T 1AR72 4GYRA 5CB7A 2OVUA 5LK7B 2ZHNA 3P6BA 3UKVA 4JDNA 2BVLA 1QY4A 1D0XA 1ULCA 4MOAA 1W9FA 4Q2FA 2WBKA 2E9QA 2R1DA 5L3CB 1KNPA 1TE1B 4IESA 4GXLA 4LUMA 2LALA 2ARXA 1IKPA 2R042 2RJLA 5LA9A 3SC7X 5LGTB 3ZFGA 1QQP3 4LE4A 2VMDA 1G6NA 2AE9A 4R8HA 1VCTA 3WT3A 1JODA 4DXTA 2O0OA 4YW1A 4ZZCA 3VDCA 5DQVA 3T0AA 2I59A 5IUXA 2QZ2A 4DEVA 1W2TA 3ORJA 4PI2A 5LP6E 1RGSA 4Y5SA 1OSGA 4CEYC 4FFHA 3ZX7A 1JUHA 1Y3TA 1XWMA 1RMU3 1ZNPA 3VBHC 2BKOA 2VUJA 2HEYF 4AVAA 4FBFA 1NX9A 2WAAA 1W2NA 1W6MA 2UXXB 2R7EB 1HJGA 2CWOA 2Q9QD 4IV1C 5SV8A 5FYSA 4H9QC 5C3PA 1Z78A 4BHPA 1IGOA 2EIDA 1BMV1 3PDYA 2JDZA 1CAWA 4OI2A 4HFSA 1C5HA 2IXLA 1I6ZA 1V6LA 2FDFA 1NAFA 2X0LB 3UU8A 3AP7A 5T5OA 1OLQA 2ZM6T 1KDMA 4B3RT 3VBUC 2XJPA 5APAA 3WZ1A 4ZI2C 3E6BA 4OHWA 3K3NA 2W92A 4WYVA 4XQ4A 3S5AA 2QYWA 3AYCA 4NIAA 5ERLA 1FMD2 4JEHB 1UX7A 3TBDA 1PK6C 1GFF2 1G73A 2AEZA 1PGW2 2ARAA 3G06A 3BI3A 3AZXA 2LHNA 1KXGA 3VZMA 1ASJ3 3TB0A 1W8HA 1QQP1 5ABFA 4PW8A 1PNGA 4A2UA 3OGJA 1WR0A 1GZWB 2HPJA 2IC1A 3UTKA 3PU8A 4U2AA 5AQIB 4QH4A 2ADDA 2V5CA 2AEYA 4JAAA 2Q8OA 4MZUA 1ENRA 4EE2A 3ZSTA 2MPFA 3JAEA 2N1GA 1E1HB 3T1LA 4B3MT 2CAUA 1NY71 1IOAA 4KBMB 5LW9A 3VD3A 1Z8UA 2W67A 3ZMTB 1SBFA 4UVCB 2FMYA 5HXRA 1RMU1 3GGLA 2O14A 2JDYA 5JSPA 4HKAA 4YW5A 4Q4V2 1SACA 2VW1A 4IE0A 3NWIA 4M0HA 5FJKA 2N7GA 1D7PM 1YWKA 3ZN4A 2SLIA 3MF9A 1YFUA 3GHNA 2WRAA 5F2WA 1NCRC 4A3ZA 4R9AA 3IIAA 3LG7A 1W39A 1E5RA 2ODUA 5D2AA 4HFHA 2BG9B 3BPSA 2ZGUA 3NBXX 4A97A 4Q8LA 4LEJA 2BGPA 2W2UA 2I6HA 3RKOA 4DV4T 2X66A 3I3BA 4CRQA 1SHZC 5HXVA 2VUAA 4DR6T 2WQ8A 4HFIA 5E1RA 4F6RC 5FKBA 4GJYA 2WYSA 4PDWC 2XAGB 4P9GA 1HX6A 2D3RA 1XU2A 3NMBA 3MYXA 2E7TA 3E1F1 4X65T 2D7FA 3LDBA 3SEPA 1ASJ1 4RHV2 4M4RA 1JYXA 2XASB 5FL1A 1O5UA 4CCJA 4ZKTB 3O1TA 2R072 1GLHA 4CEWB 4G4FA 1LHOA 1NG0A 2OA5A 4ATEA 3LD8A 4HK8A 1AR73 3HKEE 5IVFA 4XURA 1TNFA 3HD8B 4UYBA 5AQTB 4EXTA 3PUHA 2YBSA 2IUWA 1WCRA 3PV0F 3VHPA 4K40A 2VMHA 4YT0A 3RYCE 5LA2A 4DXSA 1TNRA 2FZ2A 2J1RA 5LG3A 4JGYA 1CAVB 3CO2A 5FY4A 4O2BE 4LF7T 2Q1MA 4BDVB 3M3QA 3GBWA 4WVZA 1T72A 4YW6A 4Q0SA 5FBJA 4FPKA 3SNMA 3AB0A 5IVCA 3OD4A 2OKXA 2B9VA 1UOJA 4U72A 1AUYA 2L3LA 4LR4A 3T09A 2J4GA 2YMZA 5DDJ2 4CDXB 1QXJA 1MEC2 4HSLA 4MHUA 3RGLA 2OT7A 3MIFA 1US3A 4EB6E 1Q8OA 4Q4Y2 1W8UA 2NWBA 1Q5OA 5G05L 3D82A 1H1MA 3APBA 1S2EA 3CDZB 3T1MA 4CDWB 2C5IT 4M01A 2CGOA 2PTMA 5JIAA 4PLMA 2LM3A 1UZ0A 3LKJA 4PCRA 2V4VA 3HN3A 4MLKA 4LF9T 1GZTA 3B3QE 3VBRB 5C5UA 3EBRA 5FKCA 3ZYRA 2A3WA 1E57A 1W09A 1I9RA 4EN8B 2GC1A 1W05A 1H6XA 2WO2A 2ZGKA 2FQPA 2A5ZA 2Y64A 4WM8B 4JLEA 1AR71 2DVGA 2YBKA 2VVDA 2PFWA 2VQFT 2D97A 3SWHA 3I2GA 3S7EA 3PU3A 4NAOA 1QXPA 1W6OA 1FMD3 3W9AA 3AZYA 2BG9E 1J1JA 4E8CA 5FLHA 1S35A 4KGGA 4LE3A 1S1AA 2XLAA 1OHFA 4GK5E 4IEZA 2R32A 3ETQA 2W1SA 5T55A 4GKXA 2WWSA 5GLUA 2VR4A 2MEV3 3PUZF 4AFBA 4X6RB 2Y6XA 4B3TT 1GP4A 3UFGA 1WLCA 5I0DA 1AYN3 1S2KA 4FPEA 1UU4A 2R30A 3THPA 4JI4T 2RVAA 2TBVA 3RKGA 3H8UA 3BIWE 4ZZBA 1PNFA 2XGXA 3ZXJA 2GMPA 3USSA 5TSWA 2ES0A 4QD2A 4QX3A 4W50A 1G8XA 2C0ZA 3ACIA 4HVRA 2LKHA 1WLDA 1YQ4A 3OTFA 3VZLA 3BALA 4Q4V3 2YN6A 5FYTA 2W0GA 4GH4C 4Y1YA 1NLRA 4KH9A 1CAUB 3WHTA 3CX7B 2KT9A 4DV3T 2BDRA 1S0BA 2DCZA 2KD7A 1GR3A 4HFDA 1UY2A 4L9IA 1EPWA 4AXPA 3OBVE 1CAXA 5A6XA 1GQHA 2QJVA 3ACLA 2E33A 3RMYA 2V7KA 3ACGA 4ARXA 4DUXA 2XHEB 4URTA 4JRLA 1NQJA 4PIYA 3UQ7A 4HFVA 4HN9A 1FMD1 1DGWX 1POV0 4P5HA 4AI0A 3RNSA 1PGW1 1GP5A 3ZC0A 2O8OA 3NAPB 1Z7S2 4RHV3 1LOFA 3IBPA 4NUUA 1STMA 1FJGT 1LOCA 2MEV1 1ND3B 2R073 4LKDA 2WM9A 3BQLA 1AYN1 2E32A 4XJWA 2WO1A 4E4HA 1M7KA 1JW6A 1ZV4X 1AXYA 4AEDA 4HWDA 3C8XA 4LBJA 3DYOA 2ZMKA 2RDSA 1S4CA 4A6OA 5F3EA 3CJIA 1WMEA 4K9SA 1H1IA 1IJ6A 2UYBA 3K75B 1X9BA 4OX9T 3WG3A 1K5MA 2VKDA 5HXHA 2JIGA 4Q4V1 5HEJA 1EV12 3E22E 5A80A 2CBJA 1NA1C 3ZDSA 3RYPA 3ZN0B 2EHOD 4JI8T 5GONE 5JUVA 2AC1A 3U10A 3WD5A 1NXMA 2ET7A 3BK9A 4XZCA 1OWAA 3RRWA 4BIOA 2CU5A 4PK5A 2Q30A 1O3XA 4BCUA 3Q8AA 4YM0A 2VOTA 2P3YA 5DAXA 4YFWA 5DDJ3 4CPBD 4GKYA 4Q8KA 1REDA 3H42B 4HZFA 3E6CC 1DP0A 3D8CA 2XTLA 1OA3A 4Q4Y3 2RPAA 2QKDA 5T5PA 4KG0A 3AX4A 4XYXA 3ZYJB 2GMMA 3M2MA 5FK8A 4FOVA 2Y6FA 1AR82 1MQTA 5JDMA 3GJAA 3VU7H 3MXZA 3LDRA 2DVDA 3VBOA 2VMIA 1RUH2 5DUWA 4RHV1 4OI0A 4XFCA 2PHRA 1VB2A 4QX2A 4O9GA 5KXJA 4DR3T 2R071 4LBNA 1GV9A 4FFFA 4BYYA 3S57A 4ZZ8A 2G9ZA 2R16A 2KM2A 5JI7A 2E51A 1FEWA 3DPRB 4ZS3A 2PYTA 3H8RA 1JI6A 3I2OA 1PVXA 5I8TA 3O1PA 4OI1A 1UXXX 3M7AA 3GJBA 4QPIA 2L9QA 1UMIA 3WOGA 2UWCA 3B9CA 5DAVA 1RIRA 3RIAA 1C1LA 3POFA 3VHLA 3AMQA 2WA4A 3RWKX
chains in the Genus database with same CATH topology
3OYZA 2YU1A 5FY0A 4C90A 3IEEA 2DI4A 1D0ZA 3PE0A 3V5UA 4QXHA 5LBQB 3UUNA 3O1HA 2CWYA 4WBOA 1OXZA 4YFSA 5LA6E 2NW9A 1NWMX 5AFUL 3J9X1 5L3CB 3K3OA 5EK4A 4CCNA 5L3GB 1HG5A 2NTYA 3GN5B 3ANWB 5FZ9A 4GOUA 4MLKA 5M4YA 5JDFA 1MMAA 3NZQA 3CX8B 3K8PC 3LK42 3LK3B 4O4HE 1ZEEA 4V2VA 2K48A 3FXDB 5CB4E 4B6XA 3LBXA 2Q9QC 1FMWA 5LXTE 5BMVE 2RP4A 5HAXA 5LGTB 2LE8A 2MBGA 4X1YE 4UVAB 3CKDA 2CLYC 5E0OA 3CPZA 5ETWA 2E9XC 3ZCJA 3AL5A 1WYBA 4P0BA 4CI2B 4IGOA 5TAOA 3HL6A 2J1DG 2YINA 4IE4A 4EYYR 2KMFA 4G63A 5F3JA 4UF0A 4H63H 4AKHA 5F37A 3BQIA 4JLEA 5CEHA 4XBFB 3NRXA 4IGUA 3ZC1A 4PNIA 3Q2MA 2YBKA 5FYYA 3CQCB 2V7LA 2WWUA 3SWHA 5DQVA 5F8PA 2I59A 5C8YE 5FYZA 5FZ0A 3M65A 2QA7A 4ISSA 4BAYB 5JDQA 3DXUA 1MMNA 3PU3A 3U4SA 3HKDE 3AA0B 3GN5A 3GMIA 3ANWA 3NZPA 3UUMA 1HX8A 5HYAA 2OQ7A 2YBPA 5LY2A 2X68A 3OPTA 5LG4A 1MMDA 3EVYA 3O1IA 4CCLA 2VB6A 5FZHA 5IVVA 3ETUA 4ISTA 5LP6E 4H9NC 3KVBA 2OS2A 3DJBA 4GAZA 1S35A 2LSYA 4ZI3C 4AKRB 3CMLA 4BISA 5F5IA 4ASKA 5K4LA 2WSSV 3C98B 3U78A 2JMKA 3S4UA 1LVFA 3MJXA 4OYJA 3LK2B 5A3TA 5FZBA 5FXZA 4GK5E 4JUYA 3F2EA 1CUNA 2YU2A 1D1BA 4GK0E 4EOZB 4IHJE 5FZ6A 1LVKA 3HA4A 2V1DB 3W15B 2XXZA 3SRZA 2Q8CA 4CCKA 2WMNA 3OPWA 4AQGA 4AAPA 4I50E 3DTOA 4WW0A 4Y4RA 4BJNA 4D6QA 5FZKA 3AVRA 3R84B 3CQXC 2Y6XA 1HCIA 2N9DA 4Y3OA 5FUPA 2Q8DA 2JQQA 2UXXB 4EYUA 5L3BB 4AKIA 3AL6A 2A72A 2CWOA 2Q9QD 3ZEFB 4AKGA 3C4XA 1Z0PA 2CLYB 3F31A 2XQYA 2E9XB 4PK4A 5JDHA 5L3DB 4EZHA 5F39A 3QC9A 5LBMA 2GK9A 4H9SE 4QXCB 4AQFA 5FYSA 1WLXA 4H9QC 2RA1A 2E9XD 3I9WA 1H7CA 2E8IA 5A3PA 1T98A 4X20E 3P7IA 4ZOLE 4UXNB 2X9WA 5LGNB 5HWXA 2C5JA 3PDYA 3PUSA 4UV9B 2W62A 4K0UA 4PFPA 3CQGB 5LHGB 1VOMA 5LWBA 4Z8XA 3TKLB 5L3FB 1YKHB 4C8DA 2YK0A 1HF8A 4ZI7E 4QWNB 2Z6EA 4I55E 2ES0A 4YJ2E 4UIGA 1NAFA 1IJ5A 4XDPA 5IHYA 2X0LB 5E6HA 2H7OA 2VASA 4QX7B 5DJQC 4LXLA 5FYHA 1QSDA 5A7WB 5FZOB 1G8XA 1WR6A 5A7QA 4YLHA 5JDGA 4PJMA 5FPUA 2MTQA 2M67A 2Q9QA 3CWZB 4O4LE 4YHJA 2HH7A 5J2TE 4GJZA 4DIQA 2LSGA 5JREA 4ZI2C 1HS7A 4CCOA 3K3NA 2W63A 2E9XA 3GWHA 4GIWA 2DCFA 4ZI3D 4PJNA 3N5LA 4QXCA 5FYTA 2W0GA 5KDMC 3LFMA 3KVAA 4CQIA 2K24A 3N9LA 2NW8A 2WAUA 3OJAA 2L8KA 2IC9A 2X51A 4JEHB 5FXWA 3LJCA 5LY1A 4V1Av 1HG2A 1HFAA 3CX7B 2KT9A 3RYIE 3MK7C 2LHRA 1G73A 4QX8B 3ZYKA 5F2SA 3E08A 4QWNA 2LJLA 5LHHB 3C50A 2D5UA 4M1PA 4BA9A 2LHNA 5FPBA 4DVDA 4QX7A 4IDZA 4L9IA 3JC6C 3QK6A 5EK3A 5A7WA 3E0ZA 2NTXA 3CX6B 4IGQA 4G2AA 1MIYA 4ILUA 2A3DA 3AA7B 3NRYA 3IF8B 4TV8E 3Q5WA 2JMHA 4PW8A 4AXPA 4ANJA 3A5XA 3OBVE 2LT3A 3RYFE 5FJHA 2X9YA 3K2OA 4HEAA 3KFWX 5IWFA 4PFOA 3N2KE 4ADZA 3NJYA 5FZEA 3KV9A 2HPJA 4O4IE 3UTKA 3C4WA 3PU8A 2BZBA 3CVRA 2V7KA 5JRCB 5IVEA 5JDNA 2XHEB 4UV8B 3RX6A 3PUGA 2ODVA 3UULA 5A1LA 1LRZA 3AB3B 5A3WA 3EDVA 2XMLA 4QX8A 3ZMZB 4UVBB 4CXYA 1UCUA 2W2IA 3RYHE 5F5CA 2VKOA 4HFVA 1D1CA 2CXDA 4HN9A 3AAIA 1MNEA 4EIWA 2N1GA 2MOZA 3ETVA 5L2LA 1E1HB 1S94A 5FZCA 4DBRA 2PG8A 5KX5E 4IE5A 2ACXA 3ONXA 4HOOA 4ZI2D 4MHCA 2WMOA 3GA8A 5FPLA 2LSJA 4KBMB 5IVBA 5LW9A 2PFVA 4C91A 2ZM8A 3KV6A 2KWHA 4HONA 1KK7A 2W61A 3ZMTB 2XAHB 4CZZB 3HR0A 2V26A 3D0TA 3K3QC 2EHOC 3ZC0A 5FWJA 4UVCB 2XDVA 2ZMAA 3OKQA 1YD8G 1BR2A 2CEAA 5FYCA 5HXRA 2LOPA 4P09A 4KP3C 3IBPA 3L3PA 4NUUA 4O8SA 5JRCA 3RPUA 4CSWA 4D6RA 4HKAA 5FY8A 5J1GA 4H9RC 5FY9A 5FP4A 4LITA 4H9OC 4ERRA 4X1IE 2VL8A 3I9YA 3PTRB 2WWJA 3FBZA 4TX5A 3ZJ1A 4CI3B 4AI6A 4O4JE 3ZLIA 5FZ1A 4DMVA 4E7SA 3ZMVB 3ZJ2A 4IE0A 3UT5E 4KMCA 2WM9A 2X67A 2CE7A 3JC6D 3N2GE 2UXNB 2HPLA 5JR9B 3BQLA 4UELA 5FZ8A 3ZPOA 5FZAA 5FY7A 2C0SA 5LGUB 5FJKA 4E4HA 5FYBA 1HTJF 3ZMSB 5FYMA 1U5PA 2XUEA 1ZV4X 5LNKA 3Q9DA 5FMNA 3KDSE 2BVMA 5F2WA 4IE6A 3AA6B 4BJMA 2VKHA 3LG7A 5A1FA 4CUGA 2DWKA 2ODUA 4GYSA 4OHFA 3N2OA 2CXLA 5JH7E 2KWIB 2LEHA 5F3EA 5LJNA 5ISLA 2V7IA 3VKGA 2D2SA 3IHRA 1IJ6A 3NBXX 2VK9A 4A56A 2YPDA 4XDOA 4DNDA 5A3NA 3L09A 4TUYE 4DO0A 3ZN1B 3WI3A 3UFEA 2CM0A 4TN7B 2K9AA 5FZOA 3RKOA 4CXWA 5EZYE 2X66A 4DBQA 4P0AA 2VKDA 4FI5A 4E7ZA 2D0UA 1YW0A 5HXHA 4I43B 5HXSA 1SHZC 5FYIA 2IC6A 2K5BB 3FXEB 4DMWA 5A7SA 1ZKEA 5FZ7A 3E22E 2PXJA 5A80A 2YEVC 5FZGA 3MKDA 1WRDA 2EHOB 2MYSA 5F32A 2W00A 4MALA 3N9MA 5FP3A 2XAFB 3V5SA 3ZN0B 2EHOD 2P5BA 2LM9A 5GONE 4F6RC 4H9PC 2XAJB 4GJYA 2Y8DA 4URAA 4QU1A 2NP9A 4H63V 4UF0B 3N9QA 3F57A 5FUNA 2WBLA 2XAGB 1SA0E 3R6NA 5LJMA 3BK9A 2N2NA 5IVJA 4PK6A 5ADXL 4D6SA 4KUMB 3FBLA 4XZCA 5FZDA 1OWAA 3RRWA 2KXPB 5FZ4A 4PK5A 3HI2A 4CI1B 5DQWA 2KLQA 3O4XE 4FJOA 4MBQA 1O3XA 5JR9C 3LDBA 4HTEA 3C64A 4I4TE 3J7Yq 4TN7A 2XASB 3C51A 5CA0E 5H6QB 2CCQA 2DHRA 5FZ3A 3ZYLA 3P8CD 3ZCIA 2OX0A 4HGAA 3U3IA 4CCJA 2JRKA