3KVAA

Structure of kiaa1718 jumonji domain in complex with alpha-ketoglutarate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
366
structure length
366
Chain Sequence
PVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGFDVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMTLHNYVKYFMNPNRPKVLNVISLEFSDTKMSELVEVPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFHIDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSVTQSEVFFGDKVDKCYKCVVKQGHTLFVPTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords JmjC domain-containing histone demethylation protein 1D
publication title Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags H3k4me3 binding protein, transferase
total genus 116
structure length 366
sequence length 366
ec nomenclature ec 2.-.-.-:
pdb deposition date 2009-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02373 JmjC JmjC domain, hydroxylase
A PF17811 JHD Jumonji helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1360 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3kvaA02
2.60.120.650 Mainly Beta Sandwich Jelly Rolls Cupin 3kvaA01
5A7WB 3AVRA 2XUEA 5F5IA 2YU2A 2OQ6A 5FJHA 5ANQA 5FZIA 5LWBA 5F3EA 5IVBA 5FYMA 5FY1A 5IW0A 5A7WA 2Q8DA 5FZGA 4E4HA 2YBPA 5CEHA 5FYHA 4EZ4A 3N9NA 5FZ4A 4IGOA 2P5BA 3PUQA 3KVAA 5FXVA 5FY7A 1VRBA 4URAA 5F5AA 2YU1A 5FPLA 5IVEA 5FZHA 3N9QA 2XDVA 3KV6A 5A7NA 4CSWA 5FXXA 4CCNA 5A80A 2WWUA 2GP3A 5F2SA 5A3NA 5FY5A 5A7PA 3KV9A 5LW9A 5K4LA 3NJYA 3PURA 3KV4A 5FZBA 5FXZA 5FZ6A 5FZ0A 5FPVA 5A7SA 2VD7A 4QU1A 3U4SA 4XDOA 5FYYA 2PXJA 5F3GA 5A7OA 4CCJA 5LY2A 5IVFA 4DO0A 4QX8A 5FZKA 5F2WA 4LIUA 4Y4RA 5FUNA 5FZOB 5FZ8A 4CCOA 5IVJA 4Y33A 5FJKA 5F3IA 5IVYA 5FYSA 2OX0A 5LY1A 5FUPA 5FZOA 3N9LA 4CCLA 3PU3A 3PDQA 5FZ3A 2W2IA 4QXCA 5E6HA 5FBJA 3ZPOA 4BISA 5A3PA 5FP3A 3ZLIA 5A1LA 4V2WA 4LITA 5IVVA 4EYUA 4IGQA 5FYBA 3N9PA 4D6SA 3N9MA 3K3OA 4CCKA 5F37A 2OS2A 4V2VA 5F5CA 5FY9A 2GP5A 5FV3A 5F32A 2YPDA 4QXBA 5FP4A 3PUAA 4GJYA 5F39A 2Q8EA 5IVCA 3N9OA 4GJZA 3RVHA 4GAZA 5FZ9A 3DXTA 4QXHA 3PTRB 4AAPA 5FXWA 4C8DA 3LD8A 5FYIA 5FY0A 5FZLA 5IWFA 3KV5A 4CUGA 4CCMA 4D6QA 5FY8A 3DXUA 4HONA 3AVSA 5A3TA 4QX7A 4GD4A 4BU2A 3LDBA 5A7QA 3K2OA 5FPBA 5FZDA 4LIVA 5FP7A 2Q8CA 5FWJA 2WWJA 2YBKA 5FZ7A 5FZMA 3U78A 3OPTA 5FZCA 4D6RA 4TN7A 5A1FA 3PU8A 4NUBA 5FZAA 2OQ7A 5FP9A 2OT7A 4XDPA 5FYVA 4EZHA 5FPAA 3K3NA 5FZFA 4QWNA 3AL5A 4ASKA 5F3CA 2YBSA 3PUSA 2XXZA 5A3WA 5FZEA 4IGPA 5FZ1A 5KR7A 4UF0B 5FYCA 5FYTA 4HOOA 4BXFA 5ISLA 3KVBA 5FY4A 2XMLA 3UYJA 4DIQA 3AL6A 5FYZA 4UF0A 4LXLA 4AI9A 5FWEA 5FPUA 4Y3OA 5FP8A 5FYUA 3OPWA
chains in the Genus database with same CATH superfamily
3NNFA 3AE4A 2X5IA 5HEOA 4DIDB 5KXBA 3N9NA 2XTLA 2IIUA 1SBDA 1UAIA 4D94A 5KHHA 2WZPP 4PBOA 3VZNA 2B7YA 4FOWA 3T1MA 1V0AA 1HNZT 3ESLA 2R042 3H0OA 2VPVA 1BEV2 4XBFB 3HT1A 2VH9A 4CZZB 2QA7A 3OKQA 3PVNA 5HEGA 1HX1B 1QEXA 3SFEA 1QXJA 3N2OA 1UMHA 1QJY3 4OI4A 1UU5A 1UZYA 4LFBT 4H9NC 2BNMA 3MACA 3OSDA 4RQPA 4XAEA 4FCAA 4JCKA 4Z2AA 4CEWB 4DY3A 1HRI2 1HCIA 3EVYA 4DR6T 4AWDA 3PU8A 5FP9A 1BK0A 3B9IA 2PELA 4KBZA 1PK6C 1Y9MA 3LFIA 5BR8T 2R063 4ZZ8A 1R1A2 5FOBB 4E8DA 1V6MA 2K2SA 5A3UA 5C4WA 1H2NA 2C5IT 4ISQA 3GBWA 1O3TA 5GLTA 3RH3A 1WCKA 5FZHA 2N1GA 5DUUA 4DS0A 2XUMA 3CQGB 4JKLA 4YW5A 1MMAA 2W68A 3U4SA 5B2GB 3JD71 4HN0A 2NW7A 4B3RT 4Q8LA 3TAYA 3ZN0B 1RMU1 2JQQA 4C0HA 1XRUA 1LTEA 2X05A 1ND3B 3R4UA 2Q8EA 3RVHA 1O4TA 3Q5WA 3WF0A 1AYM1 1JYVA 4A97A 2JDUA 2JIWA 4SLIA 1W9RA 3AJYA 1HIXA 3S0MA 1XWMA 3H7YA 3KBUA 1ZZ9A 3LDKA 1OBNA 1UYYA 1BR2A 2E5LT 1OI6A 3N3HA 1HXS2 2AR6A 4PFOA 1BR1A 4JI6T 2V5DA 4C1XA 3T09A 4OMDA 1YXRA 1DZQA 2ODUA 1W6NB 1GZTA 3L3PA 4DV3T 5JUVA 1MZ6A 3I3BA 1YO8A 2BVMA 4XXPA 5HCBA 5FPVA 2WAOA 3AECA 2WNOA 4CEYA 3J26N 2OUHA 4LMKA 3T30A 1N32T 3PDQA 3OG2A 5E6HA 2Q9QD 3O1JA 4GB32 3O1HA 3N9MA 3HVDA 1OH4A 2YFZA 2DWGA 5FV3A 2IWGB 3KWVA 3ZXGA 4O65A 2LSGA 3AFGA 5A7QA 3WG4A 3RI9A 1VP6A 3UQ4A 2GALA 4WZFA 4J2CA 1G9BA 3CIRA 4S2HA 2FJAA 4AEDB 3ABZA 4W4ZA 4O2AE 2W1WA 1CAUB 2DCZA 4QD2A 1QY4A 5IAXA 4IEOA 4WVZA 2K46A 4UF0A 4BPZA 4HLTA 2NMOA 1AR63 3AE3A 1O59A 2B9VA 2UUAT 5K9YA 4XILA 5JDGA 1K5MB 4S2GA 3MIDA 2L3LA 4YY3T 3J8F1 3TNQA 5A3NA 2CGOA 1PVC3 2GMMA 4XEZA 2VD7A 5BUVA 2CE7A 3HQXA 3NRUA 4MFRA 3O1MA 5DMYA 3UU3A 2X0LB 1W90A 2LALA 1F31A 1F35A 5AVPA 3BQKA 4QU2A 1YQ6A 1K42A 4IQPA 1XNTA 3RYCE 5LGNB 3I2DA 3POWA 5AQQB 4HN1A 2A70A 1A78A 3VDAA 3NVCA 2VUJA 3OEBA 2ID4A 2LT3A 3BU7A 1RUH3 2R49A 4JTNA 5JSOA 2NW8A 1LECA 5JI9A 4LBQD 4WZCA 2OW4A 1Z8UA 4YLHA 4JDNA 4XUNA 1RVF1 4LOSA 4GALA 2HWE2 1S1AA 4XC9A 1HB4A 1Y7BA 4Q0UA 2IHR1 5LJNA 4P5HA 1O7FA 4WBBA 4ZU4A 3POFA 1KNRA 4PI2A 4QB2A 4DB5A 2XASB 2HN2A 2X10A 3VZJA 3K51A 5JCTA 3BQLA 4DNYA 3KM5A 3PE0A 4N7IA 5FXXA 3USUB 2CSGA 5L2LA 4PIZA 3OTOT 4ILCA 1QJU1 2KM2A 1RHI1 5FZKA 4BQ4A 1WWYA 1ZBA1 4E7ZA 2A75A 4XMAA 3NV3A 2PHXA 1RL3A 2F17A 4XFCA 5LJMA 4URTA 2A6ZA 2J1SA 4N43B 4LMJA 4XJAA 3UT0A 3H7JA 3FBLA 4QXBB 4AFAA 2JJ9A 1ZA4A 5D8AA 5I93A 4DXRA 5AC93 1I5PA 1QLBA 4GWIA 5L47A 4U36A 4UI9L 3ILNA 1SLIA 2B8MA 3HR9A 4WVMA 2HH9A 3H8XA 3L09A 1LOBA 5FY8A 5HXSA 1J83A 3C8XA 4E2QA 4I0WB 3SLIA 3MDPA 3C3VA 1JMUB 3I3MA 2HWF1 1V6KA 4AI3A 4AEKA 4DV4T 3ZMOA 3C7FA 4I0UA 1ZV4X 2TBVA 5ABGA 2HWC1 4DUWA 1C1FA 1W0AA 2GU9A 3QC9A 1LOAA 1RITA 3BK9A 2VNGA 5I0TA 4B29A 3I2OA 3WDYA 1HJFA 3ACLA 5KHKA 1GQGA 4Q4X2 3UUMA 3QBQA 4BYYA 4IEWA 3FJSA 1GICA 1Y9QA 1PO13 3NL1A 4DV5T 5F9TA 1JZ7A 2OYZA 4LLFA 2DI4A 4QM8A 1A3KA 1DGRA 5FZLA 3OY8B 1FAYA 2PAEA 2WDBA 4XHXA 2F4VT 4U72A 5JMOA 3AYDA 4PQQA 2DCJA 2ZAAA 1YUDA 4Q29A 1OEDA 5DG1A 2Y8KA 4CCDA 5J09A 5ABFA 3OD4A 4YHJA 4SBVA 1DCSA 4Z8BA 5FPUA 1CAXA 4AFDA 2GMEA 3BQIA 5M4YA 1NY71 4B4RA 2UYAA 1LU1A 3P4QA 2OPWA 1NCQA 4AHZA 4COYA 4XPVA 1OXCA 1MS8A 4DRVA 3JCFA 3NNGA 1YEWA 1UXXX 1FNZA 2BQPA 5CG9A 3FLTA 2VW2A 1C4RA 2M6IA 1UZWA 3RZHA 2CDOA 3PVEA 5J37A 2ZX3A 2VUCA 4AOCA 4KWLA 5K0UC 3AKPA 3AE6A 4HG6B 5FUPA 3VBSA 3N9LA 3ZXDA 5L19A 1NLSA 3ORJA 3PUXF 5A1LA 3H3ZA 3ZFFB 1GUIA 5FL1A 3ZMUB 4EYUA 4WM8A 3KGZA 4HFVA 3IEEA 2E7QA 4EV6A 1YJLA 1IS3A 1X9PA 1XXNA 1ULGA 3F95A 4HN9A 4E8CA 1WD3A 3B00A 3ZSTA 1YKEB 1AYN3 3OYWB 1PIV3 5LBBA 4BU2A 3M2MA 1H2LA 4U7YA 3M3CA 4YGCA 1S94A 1VRH3 3U78A 2E33A 4Z8XA 4R9DA 4XUOA 2BDEA 5FZAA 4TXWA 1UZVA 4F83A 2CRBA 3OPZA 4HPKB 4GKJT 1RUF2 4XUQA 5HAXA 3OPCA 1CONA 2LSYA 3VBHA 1POV1 3AZXA 1ALYA 1AR83 4JRAA 4Q4Y2 3MICA 3NV4A 1B35B 5G04L 3RJ2X 4W65A 5CFDC 2D6LX 2B76A 5FY5A 4QPGC 3KV9A 2XB6C 2KMFA 2JE9A 3CQXC 1MIVA 4AVCA 1Z7S1 4GH4C 3ZIXA 3GA8A 1DQ6A 1UX6A 2CU5A 1QH7A 2EIGA 1KRIA 1RUJ3 3GCWA 2ES3A 5JZGA 3DXTA 4C8DA 2CY6A 3AJZA 3RHWA 3EJKA 5AVAA 1XU1A 2WT0A 3HNYM 5T5PA 4XFAA 4GYRA 2A71A 1MS5A 1YWKA 2VMDA 3AZWA 1DGWX 4PLOA 4P02B 3PMSA 2WFF3 1WW7A 1US2A 1W6QA 3VZLA 1ASJ3 5DQWA 1RJ8A 2XMLA 1T6GC 3AMHA 2W08A 2D6KA 1W2AX 4Q4W3 2X9WA 3UKTA 4GKYA 3PJAJ 1W28A 1VPHA 1KF6A 3NKZA 4PDWC 1CD3G 4OHVA 3VBHC 5F5AA 5IHYA 3GZUC 4JGZC 2W62A 4CSWA 3SITA 5A33A 5F2SA 5A7PA 1W2UA 2BDRA 3VN4A 1SFYA 1PGL1 2WO1A 4E4SA 2YYOA 4TWHA 5FUNA 1D1AA 4XXAA 3LG7A 3WUCA 2VZQA 3MJXA 1JYXA 2D0TA 1GSLA 3NAPB 1MQTA 3TOJA 4KGQA 1J1TA 4MG2A 4MO3M 4HSLA 3IPVB 4OI2A 3VV1A 2CWSA 2LHRA 3PUGA 2P17A 1IPSA 2D6PA 3AXEA 3SEPA 3C50A 1HQWA 2XQYA 4PJLA 4QQOA 4J1WA 2VB6A 3MUZ1 5BMVE 4UR9A 1XQNA 4F6RC 4AL9A 3GBGA 2AREA 2BRTA 1DYPA 3AZZA 3WUDA 1HNXT 3Q5EA 3WCRA 2WR9A 2R072 4X1KE 4Y1VA 1Y01A 1XDPA 4K0UA 1HRV3 1H1IA 4KUMB 2YB7A 1N1SA 2NN8A 5JXIA 1HTJF 4L99A 3APBA 4QH1A 4YW7A 3ZPYA 3ZKUA 1YC61 4AFMA 1UZ0A 4WM7B 2QQLA 4XJWA 4DR5T 3DYMA 2BS2A 2DU0A 1KEYA 4E9KA 1MR5A 3MW2A 3OBTA 1CZSA 3UU4A 1VBC3 2CBJA 4CI1B 4QX3A 2FDKA 4Z90A 4M4RA 2BGPA 2R061 5JOWA 3R05A 2PLV2 4CCLA 1VCSA 4HFSA 4EEDA 3LJCA 1WCSA 3ZFEA 1ENSA 3I2GA 1L7RA 1OFNA 2YC2A 4MXWB 1WLXA 2F4PA 2WNUC 3CKHA 2X0HA 5LA6E 3IN9A 4AAPA 4NUUA 5C3JA 2WU5A 5F6KA 2HLEA 2DBNA 2JEMA 1SE7A 4W6YA 2DUPA 2VBDA 5CFCA 4TUYE 1XSRA 2YBKA 2W95A 4D69A 4UFMA 3A7MA 2JECA 1K45A 2C0ZA 4ZZ5A 4K8FA 4Z07A 1DQ1A 2VMIA 2VOWA 4FQ4A 4RS5A 5FYTA 1SG3A 3K3QC 2RR13 2UXCT 3J7HA 4LE4A 3JQWA 1W3VA 2Q9QA 5FYUA 3IF8B 3AKSA 5HXVA 3K48A 3MEPA 5IVBA 2J62A 2WNVA 4QKFA 1HB2A 2ZS6B 3WW4A 2BWAA 3BN6A 4XUTA 1YD8G 2H88A 4ISTA 3BIEA 4M1PA 1Q8OA 5IYYA 3OYZA 1YKHB 2HWD3 1SPPA 3ZC1A 3Q2MA 1GP4A 2PHRA 2WO7A 3UK9A 1QGLA 3A5XA 4PCRA 4X8PA 3ETUA 1SACA 2JMKA 3EYPA 2VL4A 4FOVA 3ZFEC 3NV2A 4IETA 5L7OC 4NRQA 3C7HA 4D3WA 1LOFA 3J7Yq 1IQDC 4D8MA 3EHKA 5FQ0B 4PK6A 2WCAA 2XL7A 2VL0A 3KDSE 5ABHA 4QHZA 2CGPA 2XLAA 4NUBA 1FV2A 3OCPA 4YFWA 2ACZA 4AGGA 2AACA 4EYYR 3GJAA 4IV3A 3BPZA 4DPNA 3QOPA 4DMIA 4HWIB 2Y38A 2LKHA 5A7WA 2RMU3 1F5FA 4E4HA 5FO7B 1JOBA 5ACA2 4YJ3E 2XR4A 4XQWA 1UKGA 4LOTA 4EN8B 2D44A 4B1LA 5DAWA 2JE7A 1LHOA 1OUXA 3K4AA 5CIRA 4JV5T 5K7PA 2RS33 4A7KA 5GZCA 4ZI3D 4LBQA 4GZ9A 5FZBA 5EFUA 3B02A 4HBNA 3WQ0A 5LCWL 1X50A 3UUXB 3FZ3A 2X9XA 2ZGTA 3GM8A 5FP3A 1O5UA 3UKVA 2R0FA 4C91A 3B9CA 5LZ6A 4A42A 3ZN5A 3WNXA 1CGPA 4MGSA 3CKDA 1PVC1 2ARCA 4H63H 4Q1RA 4L97A 1POV0 3M4FA 2MBGA 4CU8A 2VXJA 2PA7A 2J22A 2DVAA 2XGXA 4KI0F 2A72A 2GZWA 4JYAT 4NIHA 3E6CC 4H9RC 4X62T 2FBWA 4ES8A 3LIGA 2GSYA 3IKWA 4IV3C 4EWEA 1TZOA 2D3PA 2JQ9A 1BXHA 2WYSA 4P9IA 2R043 4AI1A 3ZM8A 3Q9DA 3GBFA 3N2KE 1C5HA 4WNKA 1A6CA 4IXLA 3V0BB 3PUVF 2VQTA 5JRCA 4LBOA 3AB3B 5IJRA 3R4SA 2VUDA 5L3BB 1H8VA 3GZTB 5ADXL 4Q0QA 1ND3C 3ZYGA 4L2NA 1E5IA 2RS12 2Y60A 5GJ6A 1RUG1 1GP5A 3IDCB 2RE9A 4ZI2D 5LHIB 2ZGPA 2P3KA 4CI2B 4P9YA 1SCRA 1CPMA 1UO9A 3N36A 5AQIB 3IAQA 1JBCA 1OF3A 3ZDVA 1H4HA 4BK5A 1BYHA 4NVPA 3CU7A 3ZN6A 3EQEA 5E1RA 1SFPA 3T0AA 4DIQA 2JE8A 2B39A 2PQQA 5AC91 1Q5OA 1G9CA 1COV3 1WMEA 2YU2A 2OQ6A 1ZVFA 1J3PA 1G86A 1REDA 2XBO3 4I55E 2J4GA 2DNXA 4OHWA 3KCCA 5A7NA 5F3JA 4FI5A 2WWUA 1DG6A 4CDWA 5LW9A 3BPSA 1F5JA 3BVCA 2JB8A 4EWAA 3ECQA 4F3JA 5HEJA 3Q8BA 1D0GA 4XYXA 3H3UA 4Y1YA 1T7SA 2K48A 1WLDA 3HJRA 2D5HA 1WW5A 1EAH2 1OA2A 2W2IA 4CQIA 2VZOA 2ZM2A 3K46A 2JENA 2IC9A 4E4DX 3CK6A 1BK1A 4AGRA 2EHOA 2ERFA 2YOEA 3IWZA 4KWJA 1ULOA 3HBKA 5ANNA 5JREA 5E89A 3ZC0A 5T5JA 1XOYA 3LQCA 1X79A 2Y6LA 5I8YA 3SWHA 2OV9A 4AEDC 3C4XA 1BLZA 4QAWA 4HFBA 1ZKEA 2JKBA 1HXS3 2YBSA 3NWIA 2BS4A 1N1TA 2LEHA 4N78D 1CAWB 1K5MC 3OD0A 3UUBA 3FHQA 2YG0A 2P4EA 4B1MA 4KGGA 5GONE 1HN0A 3KF3A 2CXFA 4CN1A 4N9HA 5L3GB 3ZFGB 3VD7A 1V9U2 2OLTA 2W66A 2LW8A 4LO4B 1E2AA 2XPJA 1RUE1 1QJX3 4GWNA 2JQKA 3RYPA 2WZR3 4TWDA 1GKBA 2BOIA 1PZ7A 4LKEA 1F4HA 2WS93 4GB33 1GU3A 2A3DA 1OQ1A 2ZM6T 1RUD3 1TNRA 1YQ8A 4C90A 2WZHA 1FXZA 2WUHA 4FPCA 1QF3A 1TEIA 3MKDA 1LOCA 1DYKA 1DIWA 2WB5A 4ILAA 3HN3A 5T5OA 1UW8A 3AEFA 4I2OA 4JC1A 4M0NA 2V6XA 3LEIA 4Q4V3 4DUXA 1AJKA 3ABVA 2ZACA 3H42B 4PLMA 3AXJB 5JR2A 2JDPA 1ZZCA 4NPPA 2R0HA 4CDUB 2ZZJA 1UOFA 3K4ZA 3N7JA 3VBUA 3P4SA 1YNAA 3FZLB 1WD4A 5F5IA 4UW6A 5C8CA 4PF5A 3WW1A 4KX6A 1EV13 1IPJA 4LNVA 4I09A 4MGTA 3KBTA 4Q0PA 1PIV1 3IBPA 1NYWA 4NWVA 4LORA 3HNBM 1FMWA 4G4FA 1PGSA 2VMFA 3PUZF 3C7OA 4NHYA 2WSSV 3AX4A 3MF9A 4N43C 2VCCA 4RL7A 3O5SA 3NO8A 4YVWA 1WMXA 1ULCA 3BODA 2PHLA 4PW8A 3U14A 2ZGKA 5AQKB 1KNPA 1MEC1 1ODMA 3D8CA 3D5OA 2UU9T 2YN6A 3H3LA 1ZA7A 1RUOA 1YFUA 2XAFB 5IWFA 4HE8A 3ZKYA 3CPZA 4GD4A 2RS51 3A0KA 2VOVA 5J2TE 3K3NA 5FZFA 3I4IA 3AEGA 2W87A 1NA1B 4A98A 2YK0A 4JI3T 1T8BA 1NCRA 5LXTE 2QZ2A 4UV8B 2JD9A 4KNCA 4XAAA 3GDBA 1TE1B 5H9SA 5JR9A 4LF5T 1PX3A 3HBZA 4EZ4A 3KMHA 4PHZA 3CNAA 2M67A 3KS7A 1ZYBA 3VKNA 5HCHA 4OUMA 4O4HE 5FFOC 3KV6A 1GNZA 3AKQA 3RRDA 3CX6B 4H14A 4UBGA 3VL9A 3BALA 3DKQA 2WFF1 4Y33A 5FJKA 3ZXLA 4NHMA 2ZGLA 2MAWA 2NTYA 4M3CA 2DL1A 1RUC1 1WZXA 2ZHKA 5EK3A 2B46X 2GNDA 4P08A 4YJ2E 3WSOA 4YNIA 2H3RA 2VQAA 4A44A 1UY0A 4FPLA 1Y3TA 4R9BA 5I91A 2K9AA 2XVLA 2JG9B 5A3TA 1WMDA 2QJVA 5CYYA 2DCFA 5HXRA 4UVBB 3B69A 2YZ4A 3IDAA 2JWPA 1V9DA 1FOD2 3MK7C 5BXXA 4ZKTB 5CB7A 3GN5A 2X9YA 4TLGA 1JYTA 3FLRA 4AI9A 3DJBA 1UXZA 4LKDA 2Y6FA 1IOAA 2X5IB 1XPWA 1VBB2 3FZHB 1GR3A 4FOYA 1AX1A 4JQTA 3UL2A 3U10A 2D3RA 1IBMT 4I3PA 4XQDA 3C98B 1ZBE2 4BWOA 1LVFA 3LSDA 5LMNT 2AZ5A 4Q4X3 4XDOA 1AL21 2PTMA 1N36T 3E0ZA 3ZFFC 2ARXA 1SFNA 1Y64B 3VDCA 2W5FA 4KG0A 2X29A 4IGQA 2EXIA 3F2ZA 2ZLYA 4RQPB 5F39A 5I0UA 1CPNA 4AKRB 5LMUT 1MZEA 4I30A 2VK9A 2FZ1A 4UW4A 2YC0A 2D9DA 4ZY9A 3LK42 5BNQA 4IE5A 3ST7A 1U5ZA 3FZFB 2FDJA 3BOWA 5KC6A 2V26A 3KF5A 5JTGA 2I6HA 2HBTA 4KQ7A 5J0ZA 4CDQA 3RZGA 4HETA 5C4WB 1B35C 1GWKA 3I0QA 5IW0A 4YRDA 4OQ9A 1MACA 3ZYIB 2Q1MA 3UU6A 2VW0A 5IVEA 4KG8A 3WEZA 2KWHA 1VBE3 1ZRIA 2E9XD 3DF0A 1X33A 2BU9A 4ILUA 1O8PA 1C8M2 1JS9A 1AVBA 1Q8QA 2DVDA 4GMP1 3B3QE 1R081 2RR11 3ZSEA 2WYFA 3DEMA 4NPMA 5FYSA 2BKNA 1IS5A 2FMYA 4M0HA 4LLOA 5IVVA 1LRZA 4ORFA 4QMAA 4B7KA 4AF9A 2VNVA 1XSQA 3DYPA 4BJ0A 1S2EA 4XJ8A 4AZZA 1LEMA 1LGNA 2A9UA 2IVJA 3T3YA 3HKCE 3QCWA 3FBYA 1DFQA 2VMCA 5JR7B 2HWD1 3H1MA 5FZMA 5B4NA 5GZEA 2YROA 3C7GA 3LA7A 1JNZA 2WRAA 2DHRA 1RUF3 2CL2A 4JKKA 3VD3A 3N7KA 5JH7E 4MXVA 1TVGA 1LHNA 3PUWF 4YT0A 2BNOA 4MHUA 4Y3OA 2IXLA 1RUG2 4K8RB 1Z78A 5LWBA 1I94T 4TTGA 1ZP0A 1RINA 3KFWX 1DP0A 3K1SA 3WQBA 4LHLA 2PBIA 1S35A 2UXBT 1RUI2 2Y0OA 3WLUA 2EALA 3P5BA 4NPLA 3P7IA 1GOFA 2HBUA 5IYZE 4CEYB 2A6YA 4Y5Z0 1TME1 4ASMB 3NAPC 1HV1A 4Y20A 4MLOA 1R64A 4KBBA 1BCXA 3I3DA 3K3OA 2AEZA 5F5CA 2V7IA 4A7YA 4GJZA 3TEWA 2P3JA 3KHBA 3MYXA 4P9LA 1UU4A 1SA0E 3JD73 2DVBA 2VOTA 1RMU3 4AAXA 4ASLA 5A1FA 4NHXA 5F3CA 3QD6A 1H6XA 1HKDA 4UF0B 1S0JA 3LDQB 4K20A 5FIXA 1AYM3 4XMIA 3ZMZB 4D0QA 2VQFT 2DLRA 4WBOA 4WM7C 2R1BA 3CO2A 4JI8T 4CP9A 1C57A 3I8TA 3TLVA 1G9DA 3PUYF 5DUWA 2UY8A 5JDLA 5EIYB 4D7TA 1LR5A 2WQYA 2XPKA 3VHRA 2ACXA 1HF8A 3AXDA 4WVVA 4HFHA 2O1QA 1N47A 4X1YE 4AW7A 3PVOA 1BZWA 1D1BA 3EO6A 3RMYA 1WR0A 5L9RA 2BV4A 2JKXA 1HG5A 2ET1A 3WF1A 5F37A 4DBQA 4ZU5A 4LF7T 2R041 1BEV1 4FPFA 2H7VC 4K1YA 4CP2A 1QQP2 1A34A 3RZLA 2C6SA 2DF7A 1WBLA 5I0RA 5FAXA 3R84B 2XHEB 5EK2A 2FQPA 5KXCA 1BVVA 4OQ8A 1FEWA 2GAUA 5LBQB 4GWJA 4EZHA 2IMLA 1RJ7A 4QWNA 4XJZA 1JH5A 3HIFA 1AXYA 3JXSA 4CEWA 5EV7A 3ES4A 5ABJA 4P0AA 2X09A 5FKCA 1HRI1 2XJ7A 2ZEYA 5A32A 1GV9A 2VBBA 1NZCA 3DP7A 4AG4A 1IKPA 3OB8A 1DU3D 1OSGA 3OF1A 1NAEA 2X0YA 1DHKB 2XQ5A 3WHUA 1W6OA 1GWMA 3RKOA 2N7GA 2RDQA 3WDTA 1H30A 4QH4A 2WQ4A 3I3QA 3KV4A 2DVGA 2PLV3 1R1A1 4IEXA 3MPPG 2HKXA 5AQVB 2Z42A 1NEKA 2I07B 3MZHA 2QQNA 2J42A 2QDRA 5IUXA 4MX3A 3ZLIA 3UKNA 3WP5A 3OYXA 5D8AB 3DUIA 4DOUA 3J8F3 4WVMB 3AE2A 2V1DB 1UX5A 4QXHA 1JYNA 1DU2A 2C0SA 5HXEA 4JI2T 4N9IA 1W3XA 2UWCA 3LZZA 4FBFA 3OOXA 1GQEA 5JXHA 4BJMA 3MZKB 5DQ0A 2OQ7A 3GJBA 1ULFA 1BMV2 4OI0A 3VD4A 3NNMA 3POJA 5FMNA 4YFZA 3SXWA 1OEDE 4LUMA 1YRZA 4XBNA 3OPWA 2XG3A 1K5JA 2PN5A 2DCKA 4JDOA 3EDUA 5ABJC 1XMQT 5DUXA 3AZVA 2YDQA 1RVF3 1SDDB 2C24A 3EDVA 5GLWA 3J7MA 1E1HB 1ULEA 3LFMA 1W9YA 1HXS1 3PV0F 3F57A 1Q3EA 4CP1A 4AK3A 5F3GA 1J58A 1V70A 4KWKA 3NMBA 5IVJA 1T98A 2CA5A 4LFCT 4AXOA 2JDNA 3UV9A 1FMD2 3GHNA 2SBAA 1MVQA 4LKSA 2W1UA 4V2VA 2BZBA 5FY9A 2YKSA 2FHRA 2V4VA 3RIAA 1QJU3 4FAHA 4LJHA 1D0ZA 1KDMA 1U5PA 1LVKA 1RHI3 3RZJA 2MEV2 1URXA 3INAA 3RNSA 2E9QA 2Q4SA 1JOJA 4GB31 2ADDA 5FZ7A 3RIUA 3U07A 1OEDB 1BBT2 4COFA 5ABFB 3AKRA 3NJVA 1O3RA 5HWYA 1KFXL 2XJVA 1CAXB 2ZAHA 3MI8A 3WDUA 2QQMA 4KBMB 2XUEA 4ZZBA 1NCQB 3AKTA 1REEA 1I5ZA 4FPHA 3M70A 4ES9A 1NAFA 1OVPA 2QGSA 4A4AA 1VMHA 2CHOA 2BG9A 2HWF3 1TMF2 4L92A 1W8OA 3KQRA 1X82A 1N1VA 1O4YA 1OQDA 2A7AA 1J1JA 4LO8A 1OPOA 4FP3A 3VBSB 3RQUA 1WCUA 4RR3A 1I6ZA 4IEZA 2HWC3 3UNPA 3FLPA 4CN6A 5FZ3A 3P50A 4EQVA 3DCQA 2NR4A 1UL9A 2LRPA 1W39A 5DDJ2 3LPGA 2XAQB 3C4ZA 2VVFA 5IUQA 2ES0A 4JI1T 5T55A 4BLIA 4DR2T 1CUNA 3ZEFB 1DZTA 3BB6A 1AXZA 3U1XA 2WQ8A 4DV2T 3S30A 4XTPA 1VALA 1WYBA 1W0BA 1WW4A 1CESA 1W8WA 5FVLA 3RQ0A 3TN92 4LF6T 3CJIA 3VBHB 4CCMA 3AYAA 4JGZB 3DL3A 2JG8A 4YGDA 3UT5E 4D7SA 2A2FX 3FC0A 5FL0A 5C3PA 4OFZA 4FFIA 1QDOA 4YWAA 3J7LA 4YG0A 2HWE1 3E22E 2ZEWA 3S6PA 5LY2A 1LODA 4CCOA 4YVSC 2VECA 2ODVA 2XQ6A 2RS13 2CPTA 1FMVA 4XJUA 3RMXA 2Y26A 2W63A 3USUA 2KA3A 1QKQA 4M00A 5JZGB 3SH5A 2XH6A 4Q26A 5I0DA 2E8IA 3NVOA 3EI0A 2HWB2 4P9XA 1UCUA 3P4RA 4LF8T 4RA0A 2Q1FA 4CXWA 2JX9A 3LA3A 4LK7A 1BR0A 3FWEA 4QX2A 5FKBA 1WCRA 1W6QB 3CX8B 4IV1A 4IL4A 4Q0VA 2ZABA 5ISLA 3WG1A 1OURA 4V1PA 2P9BA 4UFJA 3ETVA 2YMZA 3WW3A 1ZRDA 5IK8A 1D4M2 2J47A 1UYXA 3SFDA 5JAXA 3CJIC 3DV8A 5JOYA 1IPKA 4DVDA 5A33B 4DRRA 2A3XA 3GHMA 1VBA2 1PNFA 1Z0HA 4L0RA 3U4XA 3O1OA 4E2SA 2IUWA 5DAVA 1EAH3 2Y33A 2K3WA 4EB6E 2E5VA 5FMBA 5HYAA 2WLQA 3VR8A 1POV3 4KHZF 2CLYB 1MQTB 3DPRA 4AISA 5EZWA 1MMDA 4Y5SA 1PMHX 5FYBA 1I9RA 2WY2A 2Q8OA 3ZSKA 3POIA 2Y8DA 2RPAA 4ATEA 2VMGA 2YPDA 5FP4A 4DV1T 2V09A 3MGUA 1Q56A 4BB3A 2IC6A 1HFAA 2G0UA 4AHYA 3OBVE 5DZFA 2ZM8A 4Q4X1 2Z69A 3I49A 2UU8A 2E9XA 5BNPA 1FX5A 4DNDA 5BNNA 4CDUC 3I97A 4LF9T 4MGIE 3KB5A 2VCBA 3P8CD 2VAUA 1QJY2 1WCQA 3WXPA 1R091 5C9AA 5CA1E 4LEJA 2K0GA 2JQHA 2XQ7A 3IDEA 3OY8A 2DVFA 4FPKA 5EZYE 4QPIC 3RWKX 2JRKA 1SZBA 5DG2A 1V9U3 4PIXA 3A8YC 4NIAA 2EIEA 4QQHA 3MXZA 2ZA9A 3ZKRA 5A6ZA 4XBLA 3QLQA 3I7DA 5FPLA 1OXZA 4TYSA 2OIIA 2WO2A 4QQLA 2RM21 3E08A 1W0NA 1XJAA 4FSJA 3D0SA 3ZFEB 3USSA 5KHIA 5LNKA 2GMPA 4FAGA 2VVNA 4CU9A 1TNFA 3L8RA 5FNVE 1JYCA 1LGCA 2D6MA 4DBRA 5L3CB 2WT2A 1JODA 2E32A 5CFCB 4X66T 4YHHT 2Q8CA 1VAKA 5FK7A 2G19A 4UAPA 4DR3T 4HFEA 1OFSA 1NA1C 4CUCA 5BNPC 4RS5B 3CVRA 4LUKA 5FZ1A 3R0RA 2Q9QB 5E16A 4EV0A 3ZCIA 3ZSMA 4BM8A 1SHZC 5C9AC 3BCWA 2E2AA 2XONA 4IT4A 2WNVB 1GNYA 3GF6A 1H1MA 4XFFA 3IT8A 1CN1A 1QWRA 4UFLA 5FY7A 3JU9A 4MHRA 1ACCA 4YG6A 4BIFA 4Q5OA 3GMIA 1EPWA 4A41A 3CHXA 3RYKA 3WZ1A 1RUF1 1ZZBA 3ACHA 1XE8A 2VOXA 5C8WA 4Q4Y1 3RF1A 1ZZ6A 1IBKT 2SPCA 2FJEA 3VUOA 1QUUA 1VAMA 4IERA 2SLIA 1X8MA 4CCKA 1SCSA 1GZCA 2JG9C 3WQ7A 2VGDA 4HFDA 4WV8A 5FXWA 3JAFA 3TNPB 4NJ4A 1W9TA 1WLWA 1LKXA 5AQSB 3LDBA 4R4XA 4JKMA 2J7MA 5FZDA 2WWJA 4BDVB 2ZX1A 5FBZA 2ET7A 2X5IC 2ZGQA 4IV3B 1TG7A 2J1EA 4DXTA 1JOPA 3UESA 1NG0A 5LEKA 1W0OA 5A7WB 1MZ5A 1RIRA 5KBFA 4U3CA 2BVLA 4KHPT 2QNKA 1YI7A 4IDPA 3AM2A 4LBQB 3M8LA 5L4EA 3MIGA 2ADEA 4LO5B 4I0AA 4QB1A 5HV0A 3MIHA 1AR62 5IVYA 4Y24A 5CKQA 4RQPC 1O3SA 4Y4YA 2J1AA 1H4GA 1RGSA 3O4XE 3PJAA 4PLNA 3H3MA 5GKAC 3CX7B 1OH3A 1SLAA 2MNGA 5M0TA 1XNKA 5FUIA 4YFSA 3WCSA 2AXDS 4YPJA 3OJAA 2JMHA 4NXMT 4AQFA 4NIGA 1FOD3 5F1RA 3FB2A 5IK7A 2PAMA 4QX7A 4GKKT 3BTYA 5FPBA 3RI8A 2FJBA 4ZEYA 2VVSA 4C1WA 1BR4A 5LGTB 3ZT5A 1W8NA 3A23A 4X5TA 4JUYA 2QQPA 1J5ET 4XVHA 5DAPA 3KVBA 5C4WC 1NE4A 4AFBA 5JIAA 5J1XA 3VDDA 3TLWA 4HFIA 2D7FA 4P14A 1KFUL 3QACA 3B5MA 1OLMA 1RUH2 5EP9A 3IMMA 4FP2A 3FHNA 1O8SA 3VBRA 3WF4A 4CVUA 5JRCB 2R071 2ZGRA 1SLBA 4YZ1A 2VQ0A 2K24A 4XABA 1DGRN 2DTYA 5HEHA 5CVRA 1GNHA 2W61A 2PHWA 3RFRA 5J1GA 5GALA 4UEMA 3T2PA 2E6VA 5GZGA 1M62A 1CQ9A 4CUAA 1AZDA 4AGVA 2D3SA 2D98A 1OA3A 2ZMKA 1OT5A 4XIKA 1CAVA 4MADA 2EIDA 2N2NA 4JI7T 2PLV1 3I2KA 1B7TA 2E7TA 5IATA 4GKXA 4FOQA 4BLJA 2VZUA 1XC6A 3ZN6B 1LRHA 1IJ6A 2VL8A 3X29B 1HB1A 4OX9T 2YGLA 3PNAA 3HWJA 3I54A 3BYWA 2FBEA 1GFF2 5FMOL 3H50A 2BWCA 1QOTA 1EP0A 1H0BA 3PUQA 5DJQC 1W06A 4X65T 4CDWB 4DFSA 1MMGA 1VB4A 1YXWA 1YQ3A 2YFUA 4CEYC 1QOOA 3ONJA 2E51A 5A3OA 5K4LA 1S0GA 5FZ0A 5CAZA 1OLRA 2HHHT 3AAAB 3S5AA 1AJOA 3M3QA 4RGAA 2IFWA 3ZPOA 1EY2A 2AENA 3LKJA 5CBLA 1JHJA 1NE6A 1I1EA 2XSAA 2EHOB 2GNMA 1DQ0A 5DZGA 2VKDA 3AP5A 2B9UA 1FPN1 3H1WA 3M1HA 5IVCA 4LBMA 4K1ZA 1L7QA 1S0CA 5DUVA 4LTAA 5AQPB 1HQLA 4IEUA 4OHFA 4HVQA 4A5XA 5EQUA 4HZFA 1OQEA 3RYHE 1C3HA 4X64T 3QB5K 3EABA 2HN1A 1UOBA 3ZO0B 3TLUA 1RUG3 3CLPA 5JXJA 2KLQA 2R30A 1A8DA 3ZXJA 1PO12 3ILRA 2L9LA 5D21A 1NOVA 1US7B 2H0BA 2A5ZA 2QBXA 2TUNA 4K7JA 5FZIA 3UJOA 4QXKA 1J59A 2XKPA 2ZKLA 3FUOA 1T2XA 3HOBA 3FX3A 1JI6A 1W2TA 1UUSA 4TSVA 2Y6XA 4AR2A 3IIIA 5LHGB 2WWVA 4Z1VA 3ZSJA 2LM2A 5JSPA 4DV0T 4XJ9A 4EJRA 2P6HA 1UYPA 2CXDA 5BY5A 3SCHA 4PK5A 3ZR6A 5ACA1 3D0TA 2ORZA 3MO4A 4TWFA 4BISA 4IL9A 4YSXA 3N9PA 4AQTA 3IMNA 3E1F1 3NW4A 4DR1T 4CU7A 5JDMA 1UZZA 2D6NA 2KR2A 3E5QA 1LENA 5HEUA 3RSJA 2C5KT 4OYJA 4XF9A 2VASA 5KX5E 1QSDA 2OT7A 4ZPIA 4F7ZA 3WDWA 1PVXA 3I2HA 4QDSA 1N1YA 3VBUB 3T4HB 4LF4T 1T6BX 3PJYA 5C8CB 1IS4A 4K6BA 1VBD2 2WWSA 2FUPA 1AYN2 4LHSA 2LOPA 4PNIA 1VRH2 2BNNA 4A6SA 4LKFA 1IZ3A 4O2BE 2XHKA 4CXXA 2DV9A 1UWWA 1R092 5FYYA 2PXJA 4H3WA 4DO0A 4YVWB 4JGYA 5D8AC 3B01A 1LOEA 2BKOA 4V2WA 1AR82 4M3CE 1UX4A 5BNOA 4J1XA 1QQP3 1UMZA 1RUE3 3J9X1 3ZYPA 1XZYA 2WL1A 3VRAA 1S0BA 1AR72 4UXNB 4MGZE 5FYIA 3AYCA 2VTFA 3FHIB 2RM22 1UF2C 3O7OA 4O4IE 4OCTA 3PUHA 4HKWA 2RS11 4JHZA 4OVEA 4RN5A 2XQAA 4RFT0 3RGLA 2J1VA 1S55A 4AKLA 3JC6C 3FHAA 2UWAA 1DYOA 2ZKNA 1NCRB 4COUA 3IHRA 3AK0A 4BQ5A 3O1SA 2XQRA 1RUJ2 1KEXA 3R6NA 3V5UA 5JR9B 3VBFA 1JYIA 4H9PC 5C2TA 3V0AA 2R7EB 1ND2A 4IGOA 1V6LA 2BBJA 3ROUA 1U5XA 2H6BA 1HB3A 3RRWA 2WZIA 5LOVE 5FCCA 2WIIB 4MSVA 3PURA 3O1RA 4AQ2A 5A7SA 4U2AA 1O5LA 4BXSV 1US3A 1ASJ2 4IUGA 5A7OA 4M3CB 4Z91A 4Q4W2 2EAAA 4BJNA 2RA1A 4TNWA 3JBG2 3MPBA 5T54A 5T3NA 4QXCA 2IC1A 3BOPA 2G9FA 4LQRA 3OGSA 4IE7A 3O0XA 4U31A 5KWRA 3KLSA 4PI0A 4B3ST 4EGWA 5D1IA 4U7IA 3AYEA 2EXHA 3M7AA 3POBA 1OEDC 3ZVXA 1EAH1 1OKOA 1W9SA 3PUIA 4EOZB 1QXPA 3T2QA 5J48A 2MYSA 5F7UA 2CAVA 3GN5B 4NIQA 1MEC3 4RFRB 1BJQA 4FPGA 3E97A 4HOOA 1NCQC 4CDXA 1OOPA 2H89A 1D2SA 4AQGA 2RS53 3O0WA 4HGAA 2LROA 2ZGNA 4EEBA 3LDRA 2LRKA 3VHOA 3U75A 3TLTA 2P1BA 5JVDE 2YHJA 2WDRA 4CTEA 1D0HA 2WS3A 3OUJA 2XQ9A 4BCUA 3PTYA 4CI3B 4AKHA 2JDAA 3VBSC 2VZTA 4W6XA 4WM8C 3BU0A 4LO7A 4YW6A 5DAQA 5J2UE 3GWHA 1LHUA 3M65A 2J1TA 5EYYA 1HRV2 4NO4A 3TEZA 5KXEA 5JDFA 2AEYA 4A3ZA 5H9PA 4MVTA 4HFCA 1GQHA 1V9U1 3P1IA 3QH7A 3VD5A 5C8YE 2MEV3 2XJSA 2GP5A 2VZ1A 5GM0A 3BGAA 1U5IA 4GAZA 3RDIA 2W67A 3I9YA 1OF4A 3ANWA 3U11A 3UTKA 3LEMA 2QQVA 4CUGA 1JU3A 1LHWA 1VBC2 1NWMX 2LRLA 3ZCJA 2WMOA 3OGJA 1RUC3 2P6CA 3OJBA 1W05A 5A6XA 1W8FA 2XZEA 2PHDA 2D2SA 3E5UA 2JPFA 2XQ8A 3AA1B 4BQ3A 3L2YA 3V56A 1HX8A 5KXJA 4CDQB 3KD4A 4LXLA 3GCXA 3UGFA 4AI0A 3NJZA 2VTXJ 2PFWA 1OOPC 4IIJE 2IXHA 3AMMA 3DECA 2KINB 4XETA 5SV8A 3G06A 1SHWB 3P3PA 2YXSA 4COVA 3ALQA 4YARA 2K5BB 1AR92 2HYKA 3HMYA 4BQ2A 3NBXX 3ZYRA 5JZGC 3RQWA 3WNOA 5FLHA 2V5CA 3S5QA 2BFUL 5KC5A 4EN9B 3NRYA 4X8NA 4N53A 4AEMA 4M3CF 1AL23 3NV1A 5CKNA 2BUKA 2I74A 5DZEA 3RLFF 3RG0A 5C71A 3ZYLA 3FXDB 5JVVA 4OYUA 4XFBA 1LULA 4XUPA 2XKOA 4LR4A 3WV6A 4ZZCA 1XE0A 3PUSA 3TB0A 5C3OA 1UGOA 2CYFA 5FRAA 3DN7A 1GZ9A 1NENA 1AX0A 3BTXA 2BERA 3FMGA 4X1IE 4K9SA 3RC8A 4CCEA 5FYMA 2Q8DA 2VQUA 4XTMA 2JD4A 5KXDA 2CWYA 1M4WA 3HA4A 1AUYA 2KT9A 4OZXA 3VKOA 3N9QA 2QFEA 1CIWA 3C64A 4P09A 3ZXFA 1DGLA 5FXZA 2CLYC 2L9QA 2BKPA 1MQTC 3WR0A 2P37A 4CZSA 4Y20B 1DQ2A 4QDRA 4M01A 4O9GA 3ZJ2A 5J96B 5FZOA 2XJTA 2B4KA 5CISA 2RMU2 4L0PA 5DAXA 3BIWE 2W9XA 3ZYKA 5HCAA 2YDRA 3CZUA 1HV0A 1UX7A 4KMQA 2GDFA 3AE8A 4Q27A 2RS32 4GMP3 4LBLA 5EHDA 1R083 3ZN4A 3IB3A 5C5UA 2MPKA 3E6DA 4HSJA 3LF7A 1W6PA 1YQ4A 4ZOLE 3AA7B 4XZCA 4OZOA 2MHFA 5L9BA 4XW3A 4AHXA 5FZEA 2PHTA 4BXFA 1ZRCA 1D4M3 2NMNA 2X66A 1GMMA 3JAEA 3VHPA 3VBOA 1FPN2 2E26A 4CP9B 4UW5A 5FY1A 4U74A 4N7UA 1PK6A 4FXKB 1FOD1 1VBA3 5DQVA 3THTA 3VKHA 1YJKA 1ZRFA 2J1RA 1G6NA 3LBXB 3VL8A 4HWFA 2WFPA 2YY1A 5GLVA 3B57A 3PIGA 1S0EA 4U2YA 1VBB1 4A7ZA 3KGLA 2GC3A 4I02A 2V6YA 1QMJA 4FI9A 1JZ2A 1V6JA 4MGQA 2VMEA 4K0KT 1ZBE1 4ZHNA 1MZFA 3ZMNA 4LA2A 5CFCC 1ONAA 5JOZA 1XNDA 2RJ2A 3T0BA 1TME3 1SLCA 4P5YA 2XAGB 2ZGSA 4NN0A 3WINE 4RS5C 5L3EB 1H8TA 1VR3A 4QWNB 4WW0A 2Q9QC 5FO8B 2ZGOA 4FPJA 2WDQA 3HAGA 3O12A 1H7CA 2WNVC 5ABJB 5CB4E 4LBNA 3F31A 4XQ4A 5EJZB 2AGSA 4ZHQE 5A32B 4AVBA 1HNWT 3MIEA 3POGA 3AEEA 2E31A 5HWXA 2W94A 2WN2A 3VBOC 3ZX7A 2UXXB 3I59A 3LK3B 1I6XA 2XWBB 1W6OB 2GNBA 3I2IA 2GP3A 3ZYMA 1KS5A 3Q8FA 3CJXA 1YQ5A 3RC3A 4NR1A 1FV3A 4L5GA 5JMCA 4HKOA 1XYOA 3L9JT 1COV2 4IL7A 1UOGA 3RYIE 2A3YA 3WHTA 2WBLA 5IHRA 1LOFC 2XBO2 2DWRA 2ZMAA 1C8M1 4QXHB 3N9OA 1M06G 3ONXA 5KDMC 3WP6A 5FY0A 3KV5A 1RUNA 3MIFA 2W2UA 4W8JA 4P1NA 2EIBA 2UY9A 2XM2A 1N3OA 1H8TC 1IAPA 1XNRT 4NIIA 4A3XA 1BEV3 1CR7A 1W8HA 4HMZA 5BV6A 2CGNA 4K21A 4EN7B 4RGKA 3UUNA 1UD1A 4YTNA 4QQ2A 5ANQA 1WYCA 3NZPA 3U3IA 1D1CA 4ONUA 1UCXA 5AQJB 2XDVA 1W03A 1J3QA 4Y22A 4F8HA 1DDLA 1X9TA 4XE9A 1MS4A 4IESA 2BG9E 4CCJA 3MA9A 1HRI3 4FPOB 4L8QA 4H9SE 1JZ5A 3GYDA 3TEYA 4XHBA 1W8TA 4I4TE 2P3YA 2KNDA 1RUI1 4Q1PA 3NQHA 4YZ4A 1F8VA 3RYFE 1STMA 4CE8A 1VAVA 1PGW2 3POSA 3WG3A 4E7SA 1U12A 4Q8KA 3OEAA 1R1A3 5I8TA 4ILBA 1QJX2 2WZR2 4YM1A 2FCTA 3AVSA 3KINB 1Q43A 2WS92 2V7LA 2W0XA 2CXLA 1G8WA 3A21A 1WFDA 3OTFA 1RUD2 4DV6T 1H9WA 2WLPA 3N7LA 4YYOA 2Z6EA 2VM9A 4OMCA 3AL5A 1D4VB 5A6YA 5LB6A 2W91A 3KZ4C 3F2EA 1GP6A 3LWCA 4JRLA 4UW3A 4MLKA 1LB2A 3ZSSA 4B7EA 5JLVA 4YM3A 5EK4A 1UPSA 2UXDT 3TEXA 1J3RA 1NKGA 3K77A 3W59A 3SC7X 1EUTA 2XAJB 4Q4V2 1FYUA 1JYWA 2BG9B 2DURA 4UOJA 4EWDA 4YVSB 3WG2A 5JPNB 1UQXA 1UY2A 3BKZA 4CU6A 5CFBA 3IZOA 4QU1A 4JDMA 4RR3B 3W9AA 3D0JA 2ENRA 1P8JA 5F2WA 4DXSA 4QHOA 3HEIA 5C3QA 2OX0A 3FBMA 3OBZA 1EV12 4LITA 3A4UA 5FTTC 5LBFA 3PHMA 3MLKA 2PTFA 5AFEA 4G2AA 1ZX5A 2QE3A 1W6MA 1Y43B 1MS9A 2P34A 1CZTA 4TN7A 3URFA 3VHNA 5FYVA 3G7DA 3ZYFA 1MPXA 3NZQA 5FYCA 3CJIB 5T50A 4X6RB 5FY4A 3A7QA 4EROA 4RSUA 3LEGA 1QQP1 5JDHA 2JG8B 2XHNA 2Y48B 3VD9A 4LA3A 2A6WA 3ZIWA 1REFA 4CDWC 2WAUA 2D43A 1W0PA 2BBHA 1PO22 4QX5A 2YU1A 5L36A 1UNBA 4YTPA 4ISRA 1E57A 1GOGA 4W50A 1QOSA 2CWOA 3FBZA 4NAOA 4GXLA 4E4ZA 4OI1A 1SLLA 2EHOC 4HTEA 1O6UA 3OGVA 2ZGUA 1PZ9A 5LA1A 3THCA 4X20E 2HEWF 4UYBA 4UFKA 2HPLA 3WP3A 3V64A 2VE1A 3CZJA 4E27A 1KD7A 3ILFA 1F9KA 2KWIB 5F5QA 2NOXA 3VR9A 4HVOA 3KCXA 4E2GA 4HKAA 4JEHB 2WQZC 4CYDA 1SBFA 4D6RA 3UU5A 4IV1B 1MS1A 4QPIB 2XXZA 3KT4A 3CEWA 2IXIA 4DZGA 4QGMA 4H55A 3AEBA 2ZHNA 4JEUB 4MUVA 1YI9A 4UV9B 4XF1A 1EZ3A 3T4VA 2QQWA 3TLSA 2W0GA 3C4WA 4YM2A 2WNEA 1BMV1 4XF0A 1IBLT 3NKTA 5LRRA 4YLZA 2RDRA 3Q8AA 4OK0A 3SISA 3AA6B 1L7LA 2MOZA 3AE1A 4ZS3A 3KHCA 3WDXA 2GN7A 1OA4A 4TZDA 4DQAA 1MS0A 3DPRB 1V00A 3KT1A 1QDCA 5A3LA 3IAPA 2HH7A 2M6BA 5K0UA 4MBQA 3HKDE 2KSRA 1PMIA 2HWE3 4HXCA 1JUIA 2ZXQA 2XJQA 4LO6B 1VB2A 2E9XB 5BNPB 1CX4A 3OBRA 5BNNB 1FMD1 4O8SA 3MV01 1UPIA 2JJ6A 2IW5B 1PM7A 2IXCA 3VBUC 5C9AB 3AE5A 3ZMVB 5AFUL 2XOMA 1D7PM 3RZZA 3SKVA 1OKQA 5C8CC 2DU1A 2NLRA 2X67A 4XIOA 2WO3A 2MEV1 3VKFC 2JDKA 3ZN1B 2MPFA 2UXNB 2QKDA 1ZREA 1GZWA 5J7MA 3LOIA 3MV11 3SCGA 2LJLA 1BBT1 2EA7A 1VRBA 4YZ2A 2YEVC 2BVBA 2CV6A 1APNA 2WA3A 2AH2A 2Z5WA 3ONLC 2RJKA 2V4AA 5A80A 3ENRA 3A0NA 4YVWC 3SNMA 3WVJA 2EHOD 1RC6A 5G05L 3CQCB 4IE0A 2CM0A 2O0OA 4MV2A 3B93A 5CFDA 3MIBA 5DPNA 5IT6A 4QPGA 5LP6E 2C9AA 4YSYA 1C5IA 5FBJA 3S7IA 2FD8A 2B42B 4RHV2 1TMF1 4GH4A 1T72A 3VZOA 2OVUA 3UQ7A 1VBE2 1UKRA 3Q5DA 3O1VA 1C1LA 4L9IA 5HXMA 5HCFA 4AKIA 2HYXA 1MNEA 2MTQA 4PJYA 4QB6A 2AE9A 2Y6GA 5LHHB 3OPTA 2WINB 3POEA 1Q8SA 1QH6A 1UOJA 1NCRC 5DDJ1 2CHNA 2D6OX 3ZT6A 4BQYA 2JIGA 3N7MA 4ARYA 5CADA 1VBD3 5JR9C 3D3AA 4QKBA 3UYJA 2VZVA 4R9AA 4H7LA 1UK5A 2WU2A 4AI6A 4S2DA 4IGUA 3RS6A 4IDQA 3W5NA 2O8OA 1HR0T 1H6YA 2EICA 2NWBA 1DF0A 1KGYA 5FXVA 2VVEA 3RX6A 1R093 5I8SA 1Q8PA 5AQLB 3VRBA 3Q8EA 4N8MA 4PDWA 2OA2A 4EN6B 3TN91 3HI2A 2UUCT 2NW9A 4MOAA 1IGOA 1JU4A 4JGZA 1W8ZA 1D2QA 2W46A 3V5SA 1RTVA 1SUMB 3SRZA 1N34T 3H37A 5FMOS 1SQ4A 4BA9A 2W00A 1AR73 1SBEA 4GIQA 2A73B 2RM23 4IDZA 2N9DA 1W2NA 2KZ7B 3ZMSB 3AZYA 1YHFA 1SMVA 4HL0A 3NNJA 1ZOYA 5JDBA 1PMJX 4PFPA 4ATFA 5CNAA 4AI2A 4KP3C 3LAGA 4WZXA 4LFAT 5E8AA 5A6QA 4YW4A 1DZRA 1CJDA 4UXAA 3HNMA 2HWB1 5H9QA 3RPQA 5LA0A 5TSWA 2HEVF 5CEHA 3WNMA 1VOMA 3JD72 1MVEA 4XZUG 4BH9A 2TEPA 1RMU2 1OLME 5JDNA 3UULA 2BW8A 5DABA 3AEDA 1WW6A 5JIUA 4CN4A 3AA0B 4KH9A 1CZVA 2Y0IA 4MHCA 3JBG3 2QDNA 4OHXA 3QK6A 2VCAA 1AYM2 1D4M1 2ATFA 1W99A 4CUBA 1OPMA 2PAKA 4BHPA 4HK9A 1FATA 4J25A 5K8SA 2VKOA 2RG4A 5C70A 1VBA1 4AQSA 2O8QA 3B5LB 1UMIA 2K9ZA 1ZNPA 4Y1XA 4FTSA 1M7KA 4QX7B 2A3WA 3DXUA 2A1XA 4Q4Y3 1QU0A 2FMDA 4WYVA 3HT2A 3C51A 1L0VA 4IREA 1C28A 2ZBJA 2WNUA 3ASIA 5LK7B 4UWDA 1DLLA 3WNPA 4CDQC 1FJGT 5A1AA 2ZPXA 3JB4C 1HS7A 1O91A 3VDDB 3FN9A 2W39A 5F8PA 1YIFA 1NQDA 5C7GA 4LULA 4XCBA 3WP4A 4IE6A 2WN3A 3VBRB 1QJY1 4P0BA 1K3IA 2LKGA 4MZUA 2GK9A 2GC1A 2IXKA 1EYBA 4UFIA 2VNOA 5HCJA 2XM1A 1JXNA 5AQUB 2WZ8A 2Q0AA 2BYVE 4QX8A 3KSCA 2FZ2A 1V6NA 4U2ZA 2X53S 1Y9GA 5LA2A 1V6OA 3OUHA 2VG9A 2CMRA 4INDA 1W04A 5F6LB 3R6SA 2OXBA 4JHTA 1PNGA 3EMRA 1CAVB 4HKLA 5C33A 4OYKA 2BOJA 4ZI3C 3SOLA 4NHKA 2BBAA 4Y1ZA 2QTWB 4FPEA 5IFTA 1OMIA 1GLHA 2IZWA 5L7OA 5C3RA 4FQZA 3SH3A 3VLBB 2JB4A 1YQ2A 2Q5TA 4IGPA 5JI7A 2C4XA 3J8F2 3HN1A 5FYZA 2CNAA 2EVXA 5HCMA 4LMFA 2ZZQA 1Y4WA 5F3EA 3ETPA 4K40A 4PT6A 2R6GF 5E88A 4DINB 1AR93 3JCIA 1WCDJ 3QH6A 4CCNA 2LOSA 4PBPA 1F2NA 4WVWA 3ITQA 4NHLA 3M3OA 1NT0A 2XQ3A 3LB9A 2NZ9A 2AUYA 2QCSB 4PK4A 3G6JB 1POQA 5BPXA 1WKYA 2P3IA 2R073 2OS2A 4QX0A 1RVF2 4DMWA 4GJYA 1X8EA 2H6CA 3WNKA 3S4UA 2VNRA 4PQ9A 4I0BA 1JN2P 2YDEA 2LM3A 1WBFA 2LHNA 1Q8VA 3X1DA 4XDPA 1XYNA 3OGRA 3J9SA 3AC0A 4CPBD 1QIQA 5LGUB 1XU2A 2XLGA 2F4LA 5L3FB 5EPAA 1JNRA 2HJIA 1QJU2 4AVAA 5FREA 2VMHA 4ZI2C 2B45X 1RHI2 1XNQT 5LCYA 5IFPA 2RVAA 1CHUA 1ZBA2 2X9HA 3UETA 4BOWA 5FZ4A 1L3JA 1A8MA 3H9AA 3K75B 2YUEA 2W52A 3BI3A 4AXPA 4YW3A 3JB8A 1XBFA 2V7MA 4C0BA 3ON7A 3AE9A 2YV8A 3AP9A 1ST8A 2ARAA 5F3IA 1HDKA 1HLCA 3EBRA 3FFQA 2DYCA 4K3UA 2NPIA 3ELNA 1F15A 4QKDA 1UY1A 5J3UA 3SHRA 4LK6A 2BGCA 5A70A 4LBJA 3PUAA 4D7YA 3WNLA 2HWF2 5FZ9A 1ND3A 1AR61 1ENRA 4JI0T 3VDBA 5H9RA 3CMGA 2G9ZA 5FP7A 2C5DA 4OUSA 4RGGA 2DFCA 5FZCA 5JPMB 2HWC2 4CEWC 2NP9A 1FPN3 3NNLA 5LEJA 2RDNA 4YSFA 2EAKA 1H9PA 1H2MA 2XQ4A 1PX4A 3THDA 2OUJA 1EPZA 2WAAA 3RIFA 3T1LA 2V73A 3O1UA 3AFKA 4ISSA 1W6NA 3I3EA 1G8XA 2J1UA 2WBKA 1W09A 4JGYB 2BJSA 2BPA2 2PMWB 5CG8A 2PYTA 5FK8A 3O1IA 5FZ8A 4NE9A 1RUH1 2PG8A 3L2HA 4AI8A 5LRSA 5BNOB 4KU7A 3NWKA 4NOTA 4LPLA 3CF6E 3UFEA 5F32A 4R52A 3I0OA 2VZPA 1ZEEA 1UIJA 2ILMA 3RYRA 5FMDA 4ZI7E 3WT3A 2C9KA 2WT1A 5ACA3 2VY0A 5FLIA 3UU8A 3ZJ1A 1NY72 2ZHLA 2VULA 1N3QA 4GMP0 3BUCA 2YINA 2W47A 3ZT7A 2BEOA 3M3EA 4NRPA 2I45A 3MLJA 4P9JA 3ME2A 2BFUS 2FCUA 1CX1A 1GQPA 2DTWA 4AEDA 3D6EA 1CAUA 5FPXA 3VBFB 2D40A 4TWTA 3V0AB 5C3SA 1ND2B 4NROA 4ZS2A 4Z2WA 5TAOA 4LE3A 2BP6A 3H8RA 1JUHA 1XNBA 4WM8B 1K5MA 4LHKA 4XZPA 1QNWA 4JVAA 4PJMA 1W9FA 2EF6A 3DKWA 4MH0E 3ZMTB 1IG0A 4LIUA 4QXCB 3PU3A 3JZVA 5IK5A 3VKGA 1UY4A 2WP9A 4ZXKA 2ZHMA 4EIWA 2LE8A 4QHBA 3TWIA 3PJQA 4PF1A 3RIUC 4JV4A 2W1QA 5IK4A 3SS1A 3N4MA 1G9FA 1KITA 3QUJA 3MLLA 3CDZB 4B3TT 5AQTB 4DUVA 1MIWA 3AAEB 4ASKA 3TYJA 2WMNA 5BYNA 4CDXB 1OOPB 2V72A 4XCAA 1RXFA 2LTNA 3W21A 2VQET 4UFHA 2FDGA 2BG9C 1Z7S2 2KXLA 2ZGMA 1QJEA 4IEVA 1PO11 4RR3C 5HPOA 5SV5A 3K8PC 3SCFA 1Z0PA 4MALA 5GZFA 4ZXLA 5ERLA 1LCLA 1PZ8A 4EAHA 3DYOA 2JIJA 1R1ZA 4N43A 1W2OA 3AP4A 4QXBA 1OD5A 3ANWB 1SEFA 4PIYA 2XLFA 3KQ4B 3HR0A 3LEKA 2VU9A 2VURA 4QH5A 2LLYA 1GOHA 4LIVA 2YC4A 3OUIA 2Q30A 4RYDA 5CA0E 3QOFA 1V6IA 3AAIA 3K4DA 4AFCA 5CU1A 4CP0A 1NLQA 5CGMA 2JG8C 2OKXA 3TKLB 2DBIA 2LSJA 2PJQA 3AL6A 1PGL2 1JHNA 2GN3A 5EJ1B 4AQ6A 4JZRA 3P3NA 3CMLA 2R6QA 4W6WA 3RKGA 1XNAA 1UURA 4R8HA 1RYYA 3PVBB 3AP6A 2Q1ZB 4ZU7A 1OUSA 4ITCA 1GBGA 1VBD1 1YYNA 1BQPA 2HPJA 5C6CA 4B8EA 5FO9B 1AYN1 5LY1A 4BE3A 4J6GA 4GWMA 1VRH1 1PM4A 2BVVA 4MYEA 5HBAA 1XYPA 5FPZA 1E5RA 1LESA 5EXOA 5ABEA 4N53B 2KXPB 3LK2B 4AE2A 5FLJA 3WOGA 2PHFA 5FR3A 3EAMA 3LD8A 4BA6A 1NZIA 2ZX2A 2HEYF 3N5LA 5LA9A 4IV1C 3WNNA 2X51A 2H7OA 2WJSA 3O1TA 4JBWF 1AR81 2ZCWA 2LM9A 3R4DB 4GA9A 5AQFB 4A2UA 3VGIA 1B09A 3W5MA 4Q25A 5ETWA 1AR71 5APAA 3OGGA 2JXAA 2IFRA 1PO23 1ODNA 2Z79A 1BHGA 4CA9A 1G7YA 1YLLA 3M3ZB 3D4KA 4XDQA 4Y26A 2IDOB 2R062 5FYHA 1XDOA 3T1HT 2W1SA 1JZ8A 3LOBA 5LG4A 4OFGA 3SKJE 1BVP1 3DPRC 1RUJ1 2V8SV 2D0UA 2VR4A 1HG2A 2A6VA 5FZOB 2VZ3A 4AVSA 2FDHA 1D0YA 3ZXKA 1ENXA 2Y6HA 4B3MT 4ANJA 2W4XA 3W15B 4NRMA 1J84A 5DN2A 3TBDA 3ZFFA 1YW0A 4DUYT 3WX5A 4XACA 5IAVA 1I3HA 3FXEB 2E9XC 2WDVA 2G1MA 1ASJ1 1OVSA 5BNNC 1ZHCA 4JQRA 1IZNB 4AKGA 4Q4W1 4ERRA 2XJRA 2D5UA 1C8NA 1W6PB 3HPNA 3JBG1 4AVVA 3B94A 2NYYA 2FCVA 3FE5A 3OYWA 5FWJA 4I50E 3W20A 1FIOA 4ET7A 4CRQA 2XJUA 3VBOB 4FVVA 2CBIA 1EUUA 4HPKA 4OUEA 1PK6B 2DDUA 1QJFA 3CBNA 1SPPB 3AEAA 4O4JE 3IDBB 2ZX4A 5A3MA 3OBAA 4IE4A 3M3IA 5D2AA 3EXUA 3HKEE 3ATGA 4I43B 1BKZA 2BS3A 1B35A 4FJOA 1AJ3A 2VCMA 2BTVC 5IVFA 1KQRA 3MF6A 2V6YB 2L8KA 4Z82A 3LPFA 5T5LA 4JLEA 3LIHA 2CHHA 3H8OA 1LJ7A 3T8OA 2QQUA 3ACIA 1IHMA 1ZM1A 3VKMA 3MHZA 2UWBA 5T52A 3ES1A 1HRV1 2JDZA 4GYSA 3CQOA 2B1EA 2XSBA 1RXGA 1H8TB 5C5TA 4BQXA 1AX2A 1KK7A 3I9WA 3RZKA 2PFVA 1FNYA 4COZA 3OVUA 3JQXA 1VE0A 4HWDA 4ADZA 1QHDA 2ZX0A 3ZYJB 4DV7T 2W3JA 1HX6A 4IDNA 2BBVA 5FWEA 3WI3A 3SQOA 1VBC1 1MMNA 2C5JA 5FJHA 2UUBT 2VKJA 1YCIA 4WBNE 4PJNA 3I59B 1GYKA 4XF3A 3ACGA 3KVAA 4DMVA 3MW3A 4XFHA 2QQJA 3S7EA 4XOGA 3WF3A 4B4PA 3VKLA 4G63A 5LATA 4GOUA 1PHMA 3UJQA 4EXTA 1PVC2 3RGBA 4RHV3 1DBNA 3A22A 4CPBA 1U4QA 3DTOA 1OD3A 1O3QA 1WA4A 1NUKA 1H2KA 2VTXA 4IEYA 3NAPA 5FMCA 3H8UA 3N35A 3W58A 4FO9A 2PHUA 1HJGA 1NXMA 2CCQA 1AR91 4H7MA 4L11A 4LBKA 3IPVA 5L3DB 3O0VA 1VBB3 3WDVA 2G9GA 3B13A 1WUVA 1WA6X 4FTBA 3RWNA 2VZSA 4A45A 2PQSA 1AXKA 1ZBE3 4BMEA 1QJZA 1UIKA 1MS3A 4P9GA 1YFWA 4XBQA 4DR7T 4QPYA 4O4LE 3ZYBA 3AVRA 5AQMB 2Z2SB 5LYJE 2VUAA 5CKMA 2WABA 3EB7A 4XF4A 5DXDA 4OHZA 4Q2FA 3WW2A 4URAA 2JICA 3SH4A 4BAYB 4Y22B 2VXRA 4WM7A 4TV9E 2I59A 2EXJA 1MIYA 2J1DG 4R4ZA 2UURA 3ZDSA 3AMPA 1HW5A 4UIGA 4XURA 5FOJB 2NQYA 3HQUA 3UGHA 4P00B 2ARBA 4YZ3A 3TRSB 3GALA 4AQFC 3CIHA 4FT8A 5AQGB 1CJPA 1S0FA 3GNEA 5LG3A 2QQKA 4FPYA 3U0ZA 4DUZT 1VCTA 1JZ3A 4MXWA 3PTRB 1VMJA 5KMGP 5AC92 2BZDA 4HONA 4AIUA 2GH8A 2RMU1 3PIJA 3ZXAC 2NP0A 4M4PA 4NXNT 3MUY1 3VDDC 1C8M3 4YW1A 5JOXA 3FUQA 4QGNA 2RS31 2LSKA 1JW6A 3LGRA 4RD7A 5FP8A 3ZOIA 3EUHA 4YGEA 4BQ1A 2RP4A 3VBRC 2XJPA 3JUUA 4FXGB 2CDPA 4P9WA 5CZKA 3WQ1A 3IM0A 4DEQA 2WSUA 4YW2A 2QRXA 2GH2A 5FZ6A 2Y64A 2YDSA 2DUOA 2V5YA 5FKYA 3L39A 4F8AA 3LCPA 1UU6A 5EYXA 3RZMA 1O3XA 1KS4A 3THPA 1WR6A 3VHLA 2O14A 3LBXA 2ZMLA 4N90A 1LOGA 1CWPA 1W8UA 4HK8A 2R1DA 3GXUA 4XFGA 1VMFA 3JADA 4YM0A 3SEEA 2ETEA 4NWWA 1W6MB 1CVNA 1XMOT 5FQ0A 4TN7B 4QX1A 3CWZB 1RUI3 1YFXA 2GC0A 1XB9A 4B4QA 2ZOEB 3LSVA 5AQRB 3ETQA 3ZYHA 2E7AA 4Y5TA 2RV9A 4EE2A 4Y1UA 2EXKA 4PJJA 1RUE2 2AYHA 2R16A 3PLQA 3IA3A 5HV4A 3O1PA 1SLTA 4JTOA 5HXHA 1X7NA 4QM9A 3GZAA 1LNSA 3O14A 3I2FA 4AEJA 3I1AA 2VBPA 5FVKA 1OC1A 3BTAA 2IVIB 5L9VA 4GK5E 4HT1T 3POYA 4H9OC 3D82A 2DCTA 2XVGA 5A3PA 1VJ2A 5JWPA 4CXYA 2P2KA 1WGPA 4X6QB 2QVSB 1KFYA 4O9EA 4A6OA 1NX9A 4G9SB 5AFBA 3C2UA 5LBMA 4HWCA 1COV1 1WLTA 3WAKA 3MFAA 2XBO1 4NUVA 2DFBA 3EHZA 1PIV2 2H0VA 2ZJCA 3MBWA 3T2OA 2QQOA 5L73A 2WM9A 4CCCA 1IG3A 3WD5A 1AL0G 1ZRRA 3SMHA 2I0MA 3P4WA 3ACFA 2QVAA 2JDHA 4MGYE 4UELA 5GZDA 1GWLA 2YPJA 4TV8E 2DUQA 2FDIA 1YQCA 3H1YA 2WKKA 1E7PA 3AMNA 4DXZA 3I2JA 1X36A 4S2FA 5EJ3A 4NAMA 2XWJB 5JQGE 1MEC2 3V0BA 1ULPA 2QQIA 4QPWA 1VIWB 4QGLA 1J5WA 2GNTA 5KHGA 5F5WA 2KD7A 3LA2A 3VZMA 4EN0A 2RS52 1WLCA 5LBCA 3U37A 5K0UB 1LEDA 1S4CA 4DEVA 4ZXEA 4BK4A 4O61A 1DQ4A 3T1YT 5H6QB 5LB7B 4YZ5A 1DQ5A 3T08A 1CIYA 4LHNA 4JI4T 3PDYA 4KMCA 2ZEZA 2LUWA 4MGKE 5J98B 3T0DA 4H2AA 1OWAA 4UVCB 1E5SA 4TZ4C 1W9WA 5LBEA 2I2SA 1F4AA 1S2KA 2NM1A 2VVDA 4Q0SA 3HKBE 1R8IA 4JAAA 5I0SA 1PGW1 1IS6A 4OHYA 3O9XA 2NTXA 4LMLA 5KR7A 2RJLA 2YGMA 2E63A 1QJX1 4GULA 1LU2A 2WZR1 1LKNA 1ZBA3 3Q9OA 3N2GE 3AMQA 4R9CA 2WFF2 2WS91 1GZWB 2DWKA 4IHJE 1ZZ7A 3E6BA 1OHFA 1RUD1 2OA5A 1MNDA 4HVRA 4NPRA 1RUC2 4UVAB 4JGYC 2D93A 5JXGA 4OLLA 2UYBA 2FJDA 2VZRA 4U33A 2OZJA 4KU8A 5CFDB 3PL0A 4QPGB 1NLRA 5BNOC 4Q4V1 1KJLA 1LGBA 5HXCA 2D5FA 2RDSA 2VJXA 2JDYA 4GH4B 4D6SA 2VOKA 4YVSA 1N33T 4GK0E 2W92A 2VW1A 1VLNA 1J1LA 1FI2A 1ULDA 1N3PA 4AYUA 4META 1GANA 4B6XA 2WC2A 3IBMA 5KHJA 2IUBA 1EV11 4BIOA 3IIAA 1NXD1 4IEQA 3P6BA 5FPAA 1WMFA 1YIPA 1X9BA 3VBFC 4ZONA 3LSEA 1JTZX 4KL1A 1ZZ8A 3FZKB 4AVTA 4NIDA 2IAKA 2CAUA 5B4XA 1ND2C 4BQWA 3KT7A 2WZEA 1H1AA 3E5XA 5IWAT 4GIWA 1LAJA 1YFYA 1KNZA 1AL22 4KWUA 1FMD3 3LE0A 1XE7A 1CAWA 2V7JA 1JZ6A 5FZGA 3VZKA 3NRXA 1UY3A 2CEAA 5CJ5A 2P5BA 4I01A 3RJRA 2ZM0A 4PDWB 2VWAA 4FFFA 1IQAA 3ZFGA 5JSRA 2G4IA 3ZSLA 3NSTA 2CWMA 1K12A 2C26A 4FTEA 3HL6A 1PO21 2IXJA 1RB8G 2QZ3A 3T2TA 4YXDA 3HQRA 2B5HA 1BBT3 3BTZA 4YSZA 2R32A 1XNCA 2V7KA 4PAGA 4JX0A 3VB9A 3JC6D 3VU7H 3WF2A 3AE7A 4OULA 2XQXA 4XFIA 1IJ5A 4D6QA 1G9AA 4FFHA 5AQHB 3P4PA 3RRCA 2TNFA 4KI5M 2LSIA 5HI0A 4I3GA 3QB5A 1NQJA 4LT5A 5GLZA 4CDXC 4G3YC 3AXJA 2WSVA 2AC1A 1TMF3 4IDOA 3FZMB 1AHSA 4YG3A 5A3WA 1DLCA 1S0DA 4TNVA 5E0OA 2ZTNA 4CDUA 2Y6KA 2JDMA 3J4UH 3GZEA 1TQ5A 1R082 3AP7A 1OLQA 2RR12 2D97A 4V1Av 2YBPA 4HANA 1G73A 5CA6A 4FFGA 5DDJ3 4HWHA 1U5YA 4IEPA 4QPIA 3Q5XA 3KCYA 4B3NA 1O4ZA 4YTMA 3ZXEA 1S2BA 5GLUA 3S57A 4HEAA 3ZFGC 2DCYA 2X68A 4Y4RA 4XAXB 5L4HA 1AF9A 3GGLA 2ORXA 2CTVA 3MFCA 5EWSA 2HWD2 1WRDA 2XY8B 1U0AA 4QT6A 3ZR5A 4BZ4A 4QKNA 4QQPA 4AQYT 3TN93 2A6XA 3MW4A 1E5HA 2C1FA 2ZEXA 3Q8CA 3B7MA 4H9QC 2WNUB 2Y6JA 5LASA 2XL9A 3HD8B 2ZMNA 4IW3A 1UYZA 1SDWA 3RI5A 3FL7A 5H6RB 1Z7S3 2FDFA 2GC2A 3UGGA 1NA1A 4TLFA 4DY5A 5JDQA 1QNYA 2RHPA 4GQ7A 5AQOB 1UN1A 1JZ4A 4A56A 4COWA 1TME2 3V65A 4DR4T 4H63V 4UBHA 3WY6A 4BMBA 1LHVA 2F6BA 2XVKA 4O7XA 3NKGA 4TX5A 3AB0A 1HN1A 2HWB3 3NJYA 4QX8B 3DGTA 2QUOA 1KJRA 3RPUA 2X8KA 4Z92B 3WAJA 4N53C 4JI5T 2Z4FA 3C7EA 1HQNA 2Y34A 4AHWA 1S0IA 2OPKA 5AQNB 1IKQA 4NMIA 5LK5A 1D0XA 2BGOA 2QYWA 2VO5A 4QDQA 4UT5A 3QNUA 3J7NA 2OZ6A 1DGWA 2XAHB 5FDBA 5L7OB 1KDKA 1ENQA 3K2OA 3CL1A 2JG9A 2VC9A 2LS6A 3H3AA 1FT9A 3FFZA 3PMEA 2WA4A 4RHV1 2VKHA 1VBE1 1QXRA 4ARXA 5J36A 4L9BA 1KXGA 3UFGA 2E53A 3NJXA 4YGBA
chains in the Genus database with same CATH topology
5A7WB 4IGUA 3AVRA 4UV8B 4X1IE 4WBOA 5LXTE 2DWKA 4IHJE 5EK4A 3RC8A 2XASB 5LCYA 2BVLA 5LYJE 5FYMA 2Q8DA 5JR9A 2X9HA 2OA5A 3CMLA 2XAJB 3UT5E 4EZ4A 2CWYA 3BQLA 3N9NA 5FZ4A 1MNDA 2A2FX 2NWBA 5JDLA 3HA4A 2M67A 2LOPA 2XTLA 4PNIA 5FXVA 4URAA 4O4HE 4OFZA 5IHYA 2KT9A 3PE0A 5F5AA 3Q9DA 4UVAB 4BAYB 2W62A 3N2KE 3N9QA 3RX6A 4TV9E 2I59A 3KV6A 4WNKA 2ACXA 5FXXA 4AXPA 4CSWA 1HF8A 5F2SA 4O2BE 3C64A 3CX6B 4P09A 5L2LA 5A7PA 1MIYA 2J1DG 4CXXA 3ESLA 2V7MA 3HI2A 4X1YE 5JRCA 5FXZA 3E22E 4QU1A 4XBFB 2CLYC 2L9QA 4UIGA 3AB3B 1D1BA 5FYYA 2PXJA 2NW9A 5LY2A 4DO0A 5FZKA 4CZZB 5L3BB 5F2WA 5FUNA 2HPJA 4CCOA 3V5SA 2ODVA 1D1AA 2QA7A 4QHOA 4Y33A 5F3IA 5FJKA 3LG7A 3OKQA 3SRZA 5IVYA 2OX0A 2NTYA 4E7ZA 5LY1A 3ZJ2A 3H37A 5FZOA 3MJXA 5LJMA 5HXCA 2D0TA 5ADXL 3N2OA 5EK3A 1HG5A 4BA9A 4V2WA 1FMVA 4AQFC 3O4XE 4LITA 1UX4A 2W00A 4D6SA 3FBLA 4QXBB 2W63A 3CX7B 4YJ2E 4H9NC 5F37A 4DBQA 2H3RA 2JJ9A 4GK0E 3ZYKA 3J9X1 3MACA 4IDZA 2KXPB 2N9DA 4YFSA 3LK2B 3PUAA 3OJAA 2H7VC 2JMHA 2LHRA 3PUGA 5FZ9A 2E8IA 3PTRB 2KZ7B 4AQFA 4UXNB 3ZMSB 4ZI2D 5KMGP 5LHIB 3LD8A 5FYIA 3C50A 3L09A 3FB2A 2K9AA 2XQYA 5FY8A 4HONA 3N5LA 5A3TA 4PJLA 4O4IE 5HXSA 4QX7A 1UCUA 2X51A 4CI2B 2VB6A 1HCIA 2H7OA 3EVYA 4G2AA 4B6XA 2DCFA 5HXRA 3R84B 5BMVE 4UVBB 5FPBA 5FP7A 4ZOLE 3AA7B 2XHEB 4CXWA 1V9DA 4F6RC 5EK2A 1BR0A 4PFPA 4XZCA 5FZCA 1FEWA 2LM9A 5LBQB 4TN7A 3MK7C 3PU8A 1BR4A 5LGTB 5FP9A 4EZHA 5FYVA 3CX8B 5FPAA 2NP9A 4QWNA 4KP3C 5FZEA 4JUYA 4AKLA 3NZQA 5FYCA 3JC6C 4BXFA 5ISLA 3GN5A 2IAKA 5ETWA 3KVBA 5FY4A 2LSKA 2X9YA 4X1KE 2X66A 4DIQA 2P9BA 3IHRA 4P0AA 4AI9A 3DJBA 5JDHA 5FP8A 4GIWA 3ETVA 2Y48B 3EUHA 4K0UA 1KNZA 4KUMB 3R6NA 3V5UA 5JR9B 2YU2A 2OQ6A 1ZV4X 2RP4A 4H9PC 1HTJF 5FY1A 2V7JA 4U74A 5FZGA 2WAUA 5CEHA 5DQVA 3NRXA 3DP7A 1VOMA 5FYHA 2CEAA 4I55E 3VKHA 4IGOA 2P5BA 2C5IT 4DVDA 2DNXA 2ZM0A 2YU1A 2VWAA 3RH3A 5JDNA 5FZHA 2N1GA 4ISSA 3FHNA 3UULA 5A7NA 3C98B 5F3JA 4FI5A 5LG4A 5DABA 3RRWA 3LBXB 2WWUA 5JRCB 3CQGB 5LOVE 3QC9A 1LVFA 4L0RA 2CWOA 3FBZA 1G8XA 3AA0B 1MMAA 3RKOA 3BK9A 5LW9A 3PURA 3KV4A 3B57A 4MHCA 5FZ6A 5A7SA 3U4SA 2D0UA 4XDOA 3QK6A 2K24A 4CI1B 1HG2A 5A7OA 4EB6E 3E0ZA 3O1IA 5HYAA 5FZ8A 5FZOB 3HL6A 4BJNA 2EHOC 2K48A 2RA1A 1Y64B 1D0YA 2CLYB 2PG8A 2NW7A 4CCLA 4HTEA 3ZN0B 2W2IA 3UUMA 4QXCA 2JQQA 4ANJA 2W61A 3ZLIA 4CQIA 3LJCA 3OYXA 1O3XA 2ZM2A 1MMDA 1WR6A 4IGQA 5FYBA 4ZI2C 3W15B 5J1GA 3VHLA 4UEMA 2V7KA 2VKOA 2IC9A 4PAGA 4X20E 4IE7A 2ZLYA 1YW0A 3LBXA 3JC6D 2Y8DA 2EHOA 3UFEA 5F32A 2DI4A 2YPDA 3I0OA 5FP4A 3FXEB 5F39A 2E9XC 3VU7H 2Q8EA 1ZEEA 2V1DB 3RVHA 3Q5WA 1WLXA 5LA6E 1UX5A 4QXHA 2HPLA 1ZHCA 4AAPA 4NUUA 4AKRB 4QX7B 4ZI7E 1IJ5A 1IZNB 2IC6A 5FZLA 2C0SA 4AKGA 5HXEA 1HFAA 2G0UA 4ERRA 5JREA 4D6QA 3DXUA 2D5UA 2XAGB 3ZC0A 2N2NA 2KWIB 2VK9A 3OBVE 3ZJ1A 2NOXA 2ZM8A 1X79A 1B7TA 3C51A 4U72A 2E9XA 4TN7B 2YINA 3SWHA 5FWJA 3C4XA 4HKAA 4JEHB 4TUYE 3RRCA 4BJMA 4DNDA 5L3EB 2YBKA 3CWZB 4I50E 2LSIA 4EOZB 4QWNB 4D6RA 3MZKB 4WW0A 1FIOA 2Q9QC 2OQ7A 2MYSA 1ZKEA 3LK42 3P8CD 1IJ6A 2VL8A 4IE5A 3GN5B 2YBSA 3KBUA 2XXZA 1HS7A 5A3WA 5CA1E 1H7CA 5FMNA 5FYTA 4HOOA 5CB4E 3K3QC 2V26A 3F31A 1BR2A 4PJJA 4YHJA 5E0OA 2LEHA 5FPUA 2Q9QA 5F8PA 5FYUA 3OPWA 4ZHQE 4PFOA 4N78D 5EZYE 3IF8B 1BR1A 4JEUB 4AQGA 3BQIA 5M4YA 2JRKA 4UV9B 4HGAA 5IVBA 1EZ3A 3EDUA 3I0QA 4O4JE 5IW0A 4V1Av 5GONE 5HWXA 2YBPA 3MXZA 5HXHA 4ZS2A 1G73A 5TAOA 2CXFA 4IE4A 4IE6A 2W0GA 3PUQA 2ODUA 3C4WA 2UXXB 5L3GB 5DJQC 3HKEE 4P0BA 5JVDE 5FPLA 3LK3B 3L3PA 5IVEA 4I43B 3Q5XA 2GK9A 1OXZA 2KWHA 1MMGA 3EDVA 3I1AA 1YD8G 4FJOA 4ISTA 2E9XD 2GP3A 1E1HB 3ZYMA 4OK0A 4CI3B 1AJ3A 4AKHA 3E08A 4ILUA 3AA6B 5K4LA 4PJMA 2MOZA 2BVMA 3LFMA 4M1PA 5FZ0A 5FPVA 3RC3A 3F57A 3OYZA 4ZS3A 5F3GA 4HEAA 3ZMTB 4L5GA 1YKHB 2X68A 5IVFA 4QX8A 4GK5E 2A3DA 4LIUA 4Y4RA 5IVJA 5J2UE 4XAXB 2L8KA 3GWHA 3AAAB 4QXCB 5FYSA 1T98A 2CA5A 3ZC1A 3M65A 3Q2MA 4H9OC 5FUPA 3N9LA 4JLEA 3PU3A 5JDFA 3PDQA 5A3PA 5E6HA 3RYIE 3ZPOA 3A5XA 2Q9QD 2WBLA 4C90A 5A1LA 3O1JA 3ZMUB 5IVVA 3ETUA 1WRDA 2CMRA 4EYUA 1LRZA 4CXYA 5LNKA 3O1HA 2EHOB 3N9MA 2HH7A 3VKGA 4QKNA 4HFVA 2JMKA 2VKDA 4MBQA 3HKDE 2DWGA 5C8YE 3IEEA 4V2VA 2BZBA 2ZMAA 5FY9A 3T8OA 3MKDA 2GP5A 5FV3A 4QXHB 5IVCA 4EIWA 3N9OA 2LE8A 4OYKA 4GAZA 1D0ZA 3ONXA 5FNVE 1U5PA 1LVKA 3ANWA 3I9YA 4ZI3C 5KDMC 4HN9A 3J7Yq 5FY0A 3UTKA 4DBRA 5LBMA 3SOLA 5L3CB 3KV5A 4CUGA 1YKEB 4H9QC 2E9XB 4PK6A 2LSGA 4GYSA 3SS1A 2B1EA 3HKCE 1NWMX 4BU2A 5A7QA 3ZCJA 3QUJA 2WMOA 3KDSE 4O8SA 4OHFA 1S94A 2Q8CA 5FZ7A 3WAKA 4J2CA 5FZMA 2IW5B 3U78A 1KK7A 3RYHE 1MIWA 3I9WA 4Z8XA 4NUVA 2BDEA 3ZMVB 5AFUL 2PFVA 4NUBA 3AAEB