3KVOA

Crystal structure of the catalytic domain of human hydroxysteroid dehydrogenase like 2 (hsdl2)
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
275
structure length
273
Chain Sequence
MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYLKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the catalytic domain of human Hydroxysteroid dehydrogenase like 2 (HSDL2)
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Hydroxysteroid dehydrogenase-like protein 2
total genus 93
structure length 273
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2009-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kvoA00
1SEPA 3L07A 1CEQA 2EP7A 2QZZA 1PWZA 3ZU5A 2Q3EA 3N7UA 4RQUA 4CLRB 1RPNA 1XR3A 1DRUA 2HMWA 4FFPA 4O0LA 1AGNA 4Z9XA 3ZNNA 3JQFA 4XJSA 3EYWA 4B7UA 3QHAA 1R4MA 2C0CA 5CDUA 5BNIA 1OFGA 3OJOA 5F5LA 1ULSA 4NFHA 5ILOA 2FZEA 5KTKA 1HE2A 3UFXA 3VH4A 1DFHA 1KERA 3TZQA 3KLPX 2FOIA 4LMPA 1HZJA 3GR6A 3BMNB 5JNLA 4YAGA 4TZTA 2GRAA 4XYGA 4FJ1A 4CM5A 4BNVA 1H6DA 2I66A 2RHCA 2ZJ0A 3V1UA 4E12A 2GZ3A 2O3JA 1VSUA 5JAZA 3ZU2A 3H6KA 2C59A 1U4SA 2VHYA 2NU6A 3P7MA 1R16A 2I9PA 3ETDA 5L9AA 4AJKA 4S3MA 3ZWCA 2VRCA 3M6IA 1BXGB 4YJHA 3VKUA 1JKIA 4E4YA 3BTVA 2DFDA 5TNXA 4NU5A 3F1LA 3GGOA 3P2YA 1R4MB 3TQHA 3WMWA 3WOHA 3AUUA 3RC2A 4BNXA 4YTEA 1KIFA 5L53A 4YCAA 5FYDA 4B8WA 4JK3A 4N5MA 4OQYA 5L7WA 4NI5A 4XR9A 4K28A 2RCYA 3MJEA 4TKLA 2DFVA 1SOVA 3GRPA 3NTRA 1KOLA 2OUIA 4XQGA 4ZVVA 3DZBA 4PN3A 1MP0A 3HB5X 5EQDA 3ZGYA 5C37A 4AG3A 3IJRA 3INTA 3WGTA 4B4UA 1R0LA 3AI2A 3DBRA 3LVFO 1AXGA 2Q45A 4GX2A 2F1KA 3WS7A 1HZZA 5CDTA 3D3WB 1ZEJA 4DIOA 4CMIB 4BOYA 1ZXBA 4Z3DA 3C7DB 4GBJA 2R00A 2Q46A 3LLVA 2WTBA 1R12A 4TVOA 4GMFA 1E1LA 4AL4A 5F5NA 3GGGA 1K6IA 1H2BA 1DIRA 1RWBA 3F5QA 3FWNA 1E1MA 4GH5A 5IZ4A 1MX3A 3HB4X 1GYQA 2E49A 5KKAA 1DPGA 1FXSA 6ADHA 4QEDA 4CM8A 4KUHA 4BO4A 3ANNA 5AQ1A 2J3KA 2D2IA 2VYND 4BO2A 2D4AA 3TRIA 1JKFA 5ENDA 5GMOA 5DF1A 3DFZA 3DOCA 3V2HA 1KVSA 3ZI0A 4CMJA 2O3SA 3INGA 4ZRNA 4BNNA 1WNTA 4A5OA 4A03A 1X0VA 4BNKA 6LDHA 3JYNA 1KS9A 1R4NB 2DPGA 4BGEA 1K0UA 5KVCA 2Z1NA 1TXGA 5T6BA 3KSUA 3ST7A 1WZIA 3OQBA 1QYXA 3MJTA 4LVCA 5KJCA 1BG6A 4D42A 3GNSA 3Q2IA 1YQGA 4AJJA 1JTVA 3GVHA 5T57A 3VVCA 1NTOA 4IDGA 3RSHA 1MFZA 1NWHA 2A94A 4EYEA 4XQEA 1FDTA 2EGGA 2Y1CA 1XELA 1G1AA 1Z82A 1UDCA 4CM9A 1NQTA 2ZB8A 3OM9A 4L74A 2CF5A 5A5FA 1GZ6A 3H9JA 3AM3A 1GV1A 2OL4A 1V3VA 4A73A 5GZ6A 2CFCA 3V2UA 4ND1A 2ET6A 4CMAA 1E3EA 3AI3A 1V3UA 2EEZA 1M2WA 1IPFA 3M2TA 4Z6KA 3SC4A 3IIEA 3UN1A 2PR2A 4CMGA 2YY7A 1NAHA 1CETA 3KYDA 2RH4A 1ADFA 4AJIA 4A26A 3LC2O 3TOZA 1HL3A 2HLPA 3GK3A 4ND3A 3ICPA 4BUCA 5KNLA 1IYZA 1HWYA 2DKNA 3QE3A 1DC5A 5DZSA 1U8FO 4IZHA 3GFBA 4GSLA 3AFNA 4BKRA 4PLFA 5I9NA 3GDGA 4WLNA 4O1MA 3JQCA 1D1SA 4M54A 5EQFA 3H5AA 5TC4A 1SO8A 2JKVA 3E8XA 3FNFA 4E33A 3UF0A 5B4VA 3PDUA 2GPTA 2AW5A 4E2XA 1P1JA 3O8QA 4FBGA 2J6IA 4OH1A 3RJ5A 2X8LA 3FNHA 1PR3A 3NTOA 1RJWA 1O9BA 1YL5A 4G2NA 4EJ6A 2E82A 4OOFA 3ZHZA 3TDKA 4E31A 5G0WA 1UXJA 4GL4A 4J0FA 3GA0A 1MG0A 1IE3A 3JQ6A 4WLEA 3WYCA 1TT7A 1H6BA 1QLJA 3WIEA 3RWBA 2A9FA 1N1GA 1NP3A 1ISGA 4RORA 3WJ7A 1UZMA 2CMDA 4FC6A 2DAPA 3E18A 2PFGA 4Z0HO 2GLXA 5A03A 3O38A 1ENOA 1W0CA 2WD7B 2CVOA 1XA0A 2IZ0A 2Q1SA 3MJ4A 2HRBA 4W99A 1SMKA 1J6UA 1SPXA 4PVCA 4CPDA 4ESOA 5IDXA 1LLQA 2Y1DA 2BRUA 2J5QA 1IULA 3S8MA 4BO7A 4BNYA 3ZWWA 4IM7A 4TWRA 3T4EA 5LDHA 1A7AA 4GWGA 4D3FA 4RPGA 1UXHA 1YOVA 4RPLA 3TWOA 4BO8A 1IZ0A 1D7OA 3W8DA 1G0OA 1E3SA 1EEHA 1GAEO 4O59O 2FR1A 3DTTA 2J3JA 1EE2A 1D4FA 4CM6A 4INAA 1ENYA 4FFLA 3W8EA 5CAEA 3JQGB 5F3RA 2BFMA 1O8CA 5T8KC 4XJTA 1C0KA 1T25A 2YDYA 1PL6A 1RM4A 3F1KA 3K6JA 1HDRA 4R41A 1WPQA 1DO8A 3DTYA 4CMKA 2TMDA 2ZYAA 4NFSA 2X0RA 1JN0A 1B8PA 3ETEA 4DQUA 1HSZA 2FSSA 3WFIA 3QIVA 3E48A 4J91A 1NR7A 1LRJA 2EW8A 1QYDA 1YVEI 4YAEA 1FJHA 5CP8A 4XIJA 4CMIA 1BRMA 5I7FA 4TMFA 1GUYA 3S1LA 4FB5A 2CSUA 3HDQA 4EEXA 2VWPA 5L95A 4ID9A 1JWBB 5L7TA 3K73O 3SLKA 1A9YA 3ON5A 1ISIA 2QRLA 1TI7A 1NAIA 4OXYA 5A4DA 2Q4EA 4MVJE 2AMFA 1Q2XA 3AY3A 1DRVA 4MVJD 2YHUA 9LDBA 2VWGA 2C82A 3FHLA 5JE8A 3RAJA 2EIHA 4MPDA 3ZWMA 1Z6ZA 2BFPA 2BH9A 5JO9A 3RUFA 5MDHA 2X5OA 1V3TA 2OORA 2GF2A 4Y6SA 4J7CA 3OJ0A 4JQCA 3D64A 3WJAA 2RAFA 1ENZA 3JQ9C 3KB6A 2IE0A 4RLSA 1LQUA 3O03A 4QO7A 1Y5MA 3DQPA 1Q7GA 1MG5A 3G17A 1PJTA 2PZKA 4U5QA 3UW3A 3RVDA 4RL6A 1BMDA 3WLFA 4IZIA 1N9GB 3OF2A 4H16A 3VTZA 1RM0A 4XZ3A 3F47A 1WMAA 4PIVA 3RC7A 4HFJA 4XB2A 4PG7A 4ALKA 2OXIA 4EUHA 1AE1A 4F6CA 1K2WA 2YJZA 1GDHA 1KVTA 2Y93A 1EUCA 1UAGA 3WGHA 4I9HA 1UP6A 2JFGA 4MIYA 4DYVA 1I30A 1S6YA 1PZFA 1Q0HA 5G4KB 3KOUA 4LK3A 4TRMA 1E3WA 2VYVD 3PPIA 4HY3A 4JBGA 4ND4A 3BTOA 3QWBA 1L7DA 5KVSA 3FBTA 3JQDA 4WLVA 4KDEA 2B4TO 4OAQA 4HUJA 2C07A 4W6ZA 1DAOA 4FOOA 2X1HA 2GN4A 5AVOA 1LXCA 3QRWA 4R51A 5IN5A 4CM4B 3OICA 4YT5A 2NU9A 1SOWA 2Q50A 3GVPA 3WGZA 1YXMA 1Y81A 1FK8A 3OFSA 5T8KA 3S2FA 2Y1GA 3HUDA 3GNQA 1PJ2A 1LLDA 3ZHXA 2WE8A 4RDHA 1N7GA 3OHSX 3RUHA 3ZW8A 3K92A 3NGXA 5IG2A 3CINA 4E5NA 1RKXA 4KDFA 1TT5B 3EK2A 4DLAA 2IDZA 5GY7A 1GZ3A 4N7RA 3ZV6A 4WUVA 2WEKA 2Y0CA 1C0PA 1ZW1A 1N8KA 2JJYA 1F14A 2DM6A 4MKZA 4BO5A 3IL2A 5ITVA 1YDEA 4E5PA 1YB1A 1BGVA 1YGYA 5HS6A 3KYDB 3OA0A 1B15A 4I5DA 4YBZA 1M76A 2WD8A 2PKQP 1I8TA 4ALIA 1B3BA 1D3AA 2J5RA 5DOVA 3KXDA 2FPGA 1MC5A 3CEAA 4RPKA 4R5HA 1Y6JA 2F00A 1ML3A 1Y9AA 3MOGA 5TIIA 4WLOA 1DB3A 4LRSB 2Z95A 2QRJA 1T2CA 4ZQBA 1GCOA 4FS3A 2HK7A 4L76A 1B8UA 1L1FA 1EFKA 5DBFA 1H9BA 5BSFA 2W2LA 4Y9DA 1KBZA 3WG9A 1Y8QA 1XKQA 2QX7A 4CLDA 4CMEA 3B1JA 3V5NA 4A7PA 1YH3A 4UUOA 3FCOA 1R66A 3B70A 3VDQA 1J4AA 2Q4BA 1VPDA 2AE1A 3L6OO 4XDZA 3TZ6A 4HKTA 4UEKA 3LC1O 4XYEA 3I9OA 1H6AA 3KSZO 2J8ZA 3GG9A 3GFGA 2CDBA 3PZBA 4MVJP 1ZBQA 4B4VA 4IJUA 3D5QA 2ZCVA 1LDNA 1X1EA 4E2YA 1HYEA 3RUEA 2CD9A 3VZSA 2JCYA 4PZEA 3Q3CA 1DIGA 2NLOA 3AWDA 2QYTA 4DUPA 2GZ2A 1LLCA 2YW9A 3OIGA 3TPCA 4WCDA 1PWXA 1LC0A 4E5MA 1A4UA 4AJ2A 1YJQA 2UV8A 4YR9A 4IIVA 2Q1TA 1UUFA 3DBRB 1NVTA 3LT2A 4YT4A 1W6UA 1XLTA 1LTHR 4K9DA 1X15A 3GEMA 2I5PO 1IHXA 3OIFA 3PXXA 4IGFA 1LSJA 3EAGA 4FPXA 3DDNA 4JX8A 1K6JA 1WW8A 3JCZA 3G1TA 4Z0TA 4G65A 4BIIA 1UH5A 1JW9B 3LSYA 4XR4A 4RPHA 1QV7A 3NX4A 4HV4A 1T2EA 2C54A 2O4CA 3B6ZA 2VUUA 3UXYA 3F4BA 3QVOA 1P77A 3H9GA 3K9QO 2B69A 2P5UA 2FRDA 3JQFC 3DMTA 4CUZA 1NR1A 5A3JA 3NRCA 5G0UA 2O48X 3KRTA 3CH6A 1U3WA 3F6YA 2Q49A 4ALNA 1M6WA 5EJ2A 2GASA 4J9VA 1J49A 5CEJA 3GDFA 5H83A 5C7IO 2C7GA 3PZRA 1U5CA 3WICA 3ROKA 4NPCA 1X1TA 4XYLA 3CTMA 2HMVA 3WYEA 5L4LA 2C20A 3VH2A 1ZEMA 3LU1A 1Z75A 3DB2A 4TZKA 3QW2A 4XWYA 3WGQA 1ZNQO 1B26A 1HE4A 2Y0DA 3D1LA 2ZK7A 2W8ZA 3JYOA 4IXTA 1N5DA 2YUTA 2YHIA 4L0QA 4ZQHA 3PLNA 5TF4A 2ZTLA 3GNTA 4RPJA 1IB6A 4KQWA 4XQCA 1SCUA 4QQRA 3M1LA 4G81A 1T2DA 4I8XA 4YJDA 4Q3CA 4U0KA 3ZWOA 3FWZA 1PS9A 1HETA 3TOXA 3S2GA 1E77A 4CM9D 1BDMA 1FMCA 3HSKA 1VJ0A 3UICA 4QXMA 4YYZA 4J1NA 1V35A 2BKAA 4ZHSA 4EEZA 3S55A 1GYPA 4JXKA 4W7HA 1A4IA 4BB6A 3KLMX 4R1SA 2LDBA 1PQPA 3GG2A 2W98A 4EUFA 2I65A 1XSEA 3SX2A 2JHGA 4D0RA 2HSDA 2GZ1A 2NVUA 4BNFA 4II3A 1P1HA 1ZCJA 1Z73A 1HDCA 1YS4A 4IINA 4Y67A 2H9IA 4BNUA 3ZHBA 3Q11A 2E48A 5JLAA 2VTEA 3KEOA 2DVMA 4O6VA 3O4RA 2FSVA 3PVZA 1F17A 3GAFA 3GVIA 2DTEA 2D8AA 4GKVA 3ITDA 1ZO8A 3DHYA 4AVYA 5C3MA 4NMHA 3U49A 3PFWO 1PL7A 3GVXA 4DQVA 3VPSA 3QP9A 1A9ZA 1E3WB 1KEVA 4Q3EA 1PGOA 3PHIA 3A14A 4A0SA 4HWKA 5B37A 5ENVA 4BKOA 1EUDA 1MB4A 1F0YA 3KZVA 5L51A 2ZTMA 3VZRA 4TSKA 3KVOA 1WP4A 2CVQA 3H3FA 3G3EA 2VOEA 3IMFA 3BZUA 4U7WA 3K5PA 3U4IA 4NBTA 4WNIA 2GR9A 2X9GA 3HDJA 5HWSA 3PJEA 1P0FA 4FFOA 3DBLB 1GQQA 2VRCD 3GMDA 3HE3A 3VZQA 1ARZA 4XQ9A 3E5RA 4D46A 5L4SA 1PS0A 1E1NA 2Q1WA 3NT5A 5KJ6A 5A5EA 2BHLA 3ONDA 4N5NA 2FMUA 1E3IA 3AY6A 3WQRA 2Y05A 4Z3KA 4KTVE 3V2GA 1I24A 1M67A 3R3JA 4FR5A 4J4HA 3PYLA 4DPMA 1PJ3A 1WWKA 1I3MA 3IS3A 4WEOA 4CUKA 3W4IA 2HMSA 4ALMA 4PCVA 1EVZA 3FNEA 3ONFA 4J3FA 4R4JA 1MXFA 4RF2A 1T26A 1P0CA 3AJRA 2Q2VA 4Y6PA 4WECA 1GUZA 3GEDA 3EW7A 3GN2A 5TRTA 4WCFA 3RKRA 4MVJF 4D3DA 3CSDA 3JD3A 1F12A 4IMRA 1XIVA 1Y1PA 4CLEA 1P45A 2W2KB 4BB5A 2WMDA 3FTNA 3GMSA 1EK6A 3NEPX 4RZHA 3ZWNA 2O2YA 3OEWA 3AOEA 5IZCC 3EZLA 1CIVA 1RM3A 3LT4A 2YV3A 3G1UA 3WBFA 1EQ2A 2NV6A 3GZNA 4LMRA 3NJ4A 4MKXA 1DIBA 3GY0A 4M55A 5JSFA 3HN7A 3JYPA 3NYWA 3OBBA 2HK9A 2FR0A 3DEYX 2Y66A 4ALLA 5DBIA 3QVTA 1B0AA 5JMPA 3GUCA 5I8WA 2Q99A 2X0JA 2XF8A 5U1PA 2CVZA 3S2EA 2AA3A 1WXDA 4OKIA 3JQ8A 5BSHA 4PLTA 1WAMA 2W2LD 4FFNA 4GLLA 3V1YA 4B3HA 5I9LA 4DGSA 1B2LA 1PIWA 4MIEA 3DBHB 3C1OA 1LSSA 3RROA 1JKJA 3GPDG 4YA6A 1LBEA 3VPFA 1XHLA 3WYBA 1HKUA 3ZCXA 1FF9A 4OOEA 1OC2A 4BKQA 1B8VA 2W4QA 3PIDA 1GTMA 1R37A 1MLDA 4XCVA 2PNFA 4Q3AA 4BNZA 4WCFC 4Q9NA 1KETA 4D41A 3GQVA 3X2EA 3I6IA 3MJCA 1Y8RA 3RFTA 3IKTA 4CV0A 4GSKA 2YV2A 3ZNPA 1UP7A 1W73A 3A28A 3QWIA 2G5CA 3D3EA 5EERA 2X0IA 3ZZNA 2I99A 4E3ZA 2O7QA 2P9EA 3PQFA 3OETA 5LC1A 3RASA 3N58A 4IY1A 3RCBA 4CLOA 2E37A 3JQBA 3I9NA 1SC6A 4OHUA 4YAKA 3H8VA 4OQZA 4RZIA 3UAGA 1SB8A 3EVNA 3A4VA 2P2SA 5JDIC 1R6DA 3AM4A 1E3LA 4UEJA 3IAHA 4L75A 5CHEA 2P4QA 4K6FA 3DL2A 4EW6A 3P5SA 4IS2A 3WQQA 4H7PA 5L3ZA 4BV8A 3D0OA 3RI3A 4AFNA 4BGUA 5JC8A 3LK7A 4YRBA 2ZIZA 5KJ1A 4IJVA 2EJVA 1H9AA 3D4OA 1I5RA 3OA2A 3WTCA 4B7CA 1ORRA 3QV1A 3TSCA 4R3WA 1DSSG 3JQAB 4CQLB 5KOIA 2DUUA 3E03A 1WLYA 3ZNOA 3UGKA 1O0SA 1C3VA 2CUKA 4W82A 2EJWA 1JQBA 4IBOA 4RVGA 2JCXA 2WWRA 4ZICA 1H2HA 2IZZA 2NQTA 3DZJA 4WLUA 3I5MA 4KWHA 2EGHA 3GC6A 5JW6A 1ZSYA 3Q6IA 3OH8A 4R9RA 3ABIA 1NPTO 1ID1A 1Y5RA 3JSAA 5DCUA 5IAAA 1B14A 4JIGA 4DBZA 1KVRA 2HJRA 2NVBA 4KP7A 2PKRA 4JJIA 2C2YA 1SEVA 4RVHA 1ADGA 4BL5A 4HFMA 3BXXA 2B36A 2EKLA 2WM3A 4R5MA 1GD1O 1SZJG 4NK4A 4RQTA 3DHNA 3ZU3A 4U0JA 2DPHA 4KWIA 4CM8B 3TL2A 1NBOA 1LSUA 4BNWA 2B4QA 2X5KO 2PD4A 3AY7A 5BQFA 2VOJA 3T7CA 1Q0LA 2H63A 5JCJD 3NJ8A 3EY4A 4BO0A 4WLFA 1Y9EA 2LDXA 3AUTA 3FR7A 4P4LA 9LDTA 5GZ3A 5COQA 1OOEA 1U7TA 3MOIA 4I9NA 2V6BA 3KETA 3O9ZA 2HAEA 3KBOA 4WOJA 4PLVA 4E0BA 1NM5A 1I3LA 1Y7TA 5JFOA 1E1KA 5FWNA 4R9SA 4LSMA 4Q3DA 4AJEA 3ULKA 4B4WA 4BNGA 3LDHA 4D45A 5C7OO 5JPIA 2PV7A 5AXCA 3GRKA 4RF4A 3TFOA 4GAEA 1M6HA 4LCEA 1DIAA 2X4GA 3HNPA 4KTTE 3R1IA 1QLHA 5DP2A 3UCXA 3SBOA 1ULUA 2DC1A 4CMCA 3LLSA 4F45A 2BMAA 5I7SA 1BXZA 1T1SA 4OGWA 5DNAA 4CMEC 2CDAA 3RUDA 5B4UA 3WMXA 3ANMA 1FDWA 4A2CA 4DXHA 4IQ0A 2X58A 1E0DA 2DT5A 4CODB 5JC1A 2FP4A 2D5AA 3NDJA 4J1TA 1LRKA 1GZ4A 2CY0A 2Y99A 5TS3A 1YJ8A 3ZHYA 3PWKA 2X9VA 3NTQA 1BDBA 1EDZA 1NWCA 4ND2A 4DTIA 1MC4A 1JDJA 2XXBA 1YL6A 2EG9A 4TRRA 2AEJA 1ZH8A 3ETGA 4JBHA 1H0KA 5KKCA 1PJLA 2X6TA 3BTSA 3SVTA 4FJ2A 4JGBA 5KIAA 1VRWA 1V8BA 3R0IA 4YRDA 4J49A 4F46A 4EJMA 4BQRA 4OXKA 4NIMA 1PQUA 3RBVA 1LSOA 1Y8QB 2FR8A 3AU9A 5G2OA 4ZQFA 3GOHA 1EVIA 3F4LA 2X23A 3PHHA 4DPKA 2W90A 3RKUA 1KEUA 3RC1A 1IY8A 4Q39A 3PYMA 1O95A 5A04A 3GH3A 5FEUA 2AQIA 3DONA 1ZK1A 2VUTA 2PKQO 2ILTA 2UUOA 2V65A 3JTMA 1ZK0A 4YAJA 5I8ZA 4CR6A 3U4HA 3KV3O 4OSPA 4J2OA 1ISHA 1MV8A 1F8FA 1VJTA 5EESA 4C7JA 3EDMA 1P3DA 5LDGA 8LDHA 2WDZA 4YXFA 2P68A 3FD8A 1CYDA 3F46A 3SJ7A 1IPEA 5TX7A 4DMLA 4MIOA 1Q7CA 1KC1A 3A9WA 1HYHA 4NBWA 5K0ZA 2VNSA 4CV1A 5L7YA 1HF3A 1DLJA 1OAAA 4PZCA 1UJMA 2NQ8A 2SCUA 4YT8A 2JHFA 2FN7A 3W1VA 2O3UA 1E5LA 2UDPA 3ZWVA 3GT0A 1AN9A 1ZKMA 2PH3A 3DOJA 5TSDA 4R16A 5HA5A 3EZYA 2O23A 2BGKA 3V8BA 3WGGA 3I4FA 2PZLA 4YJFA 2VRBA 2NSDA 4Q3BA 2Y1OA 4DREA 5L4NA 4NBVA 1ZSVA 1ZK2A 3OJEA 3ROQA 3GVCA 1KVUA 4IDCA 3BMNA 1XQ1A 1E6WA 4YT2A 1B7GO 2Y1FA 4ZRMA 1OI7A 2P9GA 3QVWA 5TGDA 4DIBA 1QR6A 1Y8RB 2GYYA 4XX0A 3KYCB 2YV1A 3KO8A 2I3AA 4J4TA 3I83A 1E5QA 4FD3A 1T1RA 4A27A 1IZ9A 1VL6A 3DBVO 4H3VA 4IDBA 4W4TA 1E6EA 3EHEA 4K6CA 4KUGA 3OECA 4OM8A 4JP2A 2H1SA 2YZ7A 4FW8A 2XAAA 4RF5A 4KZPA 4UUNA 3QQPA 2GD1O 5JXWA 1KY5A 4OXNA 3AI1A 1A71A 2CNBA 4PLHA 4B79A 2YQ5A 1QMGA 5DN9A 3JD4A 2P9CA 3OEYA 2VWHA 1AUPA 5TT1A 2C29D 2O7SA 5IXYA 3AOGA 2WSBA 4D3SA 1H94A 4YAIA 5K9ZA 2C7VA 5G0VA 5T5QA 1DC3A 2D5CA 1U3TA 3TZKA 4GWKA 5F1KA 4CMBA 3L4BC 3F9IA 3ADOA 3R3SA 1YWGO 1QP8A 2OP1A 3H9UA 2OFPA 3FSRA 4CV2A 1GPJA 4QFCA 2HJSA 3I23A 1O6ZA 3K8ZA 3DWFA 3HDYA 3PI7A 5U4QA 5LCXA 1DOHA 5KJFA 3PQDA 5FI5A 1JA9A 2QG4A 4TQGA 3PHJA 3QLJA 3UH1A 1HRDA 3VH1A 3ZWXA 1U3VA 1WVGA 4Y8VA 4I08A 1GY8A 4RVUA 4CMHA 4XKJA 3GHYA 3U9LA 4HADA 3G49A 3LT0A 3NDIA 2DBZA 3RU7A 4P8RA 2CF6A 1PJCA 2E4AA 2O4UX 3HFGA 4DYDA 1QG6A 1FDVA 2IODA 2V6MA 1UR5A 7ADHA 1I33A 4HFRA 1KY4A 1BW9A 3U4DA 3OP4A 2IYPA 3DZKA 1O94A 5JYEA 3OJFA 4AJNA 1ISMA 2HKIA 3UVEA 5A9SA 4AJLA 1EQUA 2V6FA 4ROSA 1EE9A 4Z9YA 1YB4A 2O3RA 2AG8A 1NFFA 3MWEB 5HTOA 1NHWA 4D7AA 3DR3A 3PEFA 1NPDA 1PZGA 1T2FA 2VYVA 1CRWG 4MVJM 4DIFA 1NFRA 1GPDG 5B4TA 1V9LA 2Z1MA 4RVDA 1NFQA 3WSVA 2Y0EA 5KJEA 4M1QA 4LISA 4YWJA 1LDBA 1LEHA 3C3XA 3TFQA 2WD7A 3NV9A 4IIUA 1GR0A 4P38A 1MUUA 1SBYA 4M49A 2YFHA 4W7IA 2A35A 4URFA 3C24A 4FQ8A 1LA2A 3D5TA 4E5KA 1EVJA 4IDDA 2ZB3A 5AYVA 5IDWA 1B16A 2B5VA 5A3VA 3VVBA 4R3NA 4YRAA 1NXQA 1BHSA 1E6UA 2RH8A 1XU7A 2D3TA 1DC6A 4BMSA 3WTBA 4R69A 4BO6A 1I3NA 3HWRA 1I3KA 1YOVB 1FDUA 3BYZA 4PLZA 1P1KA 4JLWA 2VHXA 2O3QA 4XRRA 1E7SA 1E7RA 2W2KA 4DBVO 5DT9A 4J9UE 3C7AA 1ZK4A 4YACA 1I2BA 3ZV5A 2FWMX 2JD1A 3ZU4A 3I9MA 1HDGO 1V0JA 4E2ZA 1PL8A 4RO0A 5COBA 3CKYA 1JWAB 3PGXA 3TNLA 1VKOA 4YPOA 3WNVA 2OBYA 1WDKA 4K1LA 4NBUA 1KEWA 4ZQGA 3ZW9A 1ZVMA 1NASA 2OZPA 4N5LA 3WGOA 4B3JA 3PJFA 3H2SA 3F5SA 4HNGA 4MP3A 4UVGA 4WJZA 3PHGA 5G0TA 2NVUB 1I10A 1U7HA 4BNJA 1XQ6A 4L4RA 1HDYA 4DRYA 5K6AC 4P22A 4YDRA 2NNLD 3FPLA 5DCWA 1YE3A 3OJLA 3QWHA 4NDNE 4PLWA 5TJ9A 1T2AA 5CEEA 5U9CA 4PRKA 2NM0A 3STHA 4J4BA 3ROPA 4CLOB 1TA4A 1ONOA 4WEQA 3P2OA 2HU2A 2VWQA 3ITKA 2HRZA 5KWEA 2NUAA 2BELA 4OJNA 1GEGA 2XPCA 3KM0A 4XRGA 1HYGA 2VN8A 2EXXA 1TB4A 1YONA 1YQDA 2YYYA 1YL7A 3DZGA 3G79A 1R4NA 2ZB4A 4FSHA 4PG5A 2PLAA 5ER9A 1PJSA 4YEDA 2PGJA 4E5YA 2QQ5A 3WB9A 1ZMTA 4FCCA 1XWFA 1GADO 4FGWA 3JD2A 4OMUA 4HFNA 4MVJG 3W6ZA 3DZFA 4ZU3A 4RVFA 4CJXA 2A4KA 4ILKA 3F3SA 1C0LA 4IPTA 2QZ9A 1GU7A 2ZYDA 4BNIA 3H9QA 3IUPA 4R54A 5K6AA 1EDOA 4R68A 4RVSA 4WASA 3ASUA 2DTXA 4IDEA 4WE3A 2HO5A 1E3JA 3L4SO 4D79A 5JAIA 3Q9UA 4WCFB 8ADHA 2JAPA 1O89A 4XA8A 4JJGA 1PGJA 4TKMA 4D0SA 1E7WA 4BMNA 3BMOA 3ENNA 3LZ6A 3WXBA 5DDIP 4M89A 4FOSA 2IEDA 4BKPA 3LT1A 1YBAA 1LU9A 2BLLA 3PQEA 1IUKA 4P4NA 4CL8A 4XD2A 2VTDA 4WGGA 1ZFNA 2GO1A 1ZMOA 1KYQA 3MJVA 4UUMA 1QYWA 1X7DA 2RIRA 2ZKLA 3U4CA 4U8GA 1PZHA 4B8ZA 1JAYA 2VHVA 3H2ZA 3VH3A 3VAZA 3ZN2A 1D8AA 4J1QA 2XXJA 3GZ4A 4ZGWA 3FRJA 4PLPA 2X7HA 4AJOA 5THKA 3RD5A 3CIFA 5I7VA 1LJ8A 3ROMA 1H5QA 3L9XA 3I4CA 3ZH2A 2UYYA 1DJNA 3VKVA 3RU9A 4J6FA 1C1DB 1CDOA 1N2SA 4CLHA 1A72A 1HLDA 5G4LA 2OGUA 5DBGA 4WNCA 5FFFA 3E5MA 3IKVA 4PZDA 2Y1EA 1PEDA 5A1TA 5L45A 1MFPA 1T24A 2FPIA 2OP0A 3FR8A 4I5EA 1UXGA 2B0JA 3RUCA 1YRLA 2EP5A 5A02A 3VPXA 1QORA 3UCFA 2G17A 4PG4A 3NT4A 4CM3A 4W9NC 3BIOA 1UDBA 3DZIA 4XYBA 1VM6A 2B37A 3OMLA 4AJHA 4G5HA 3PIIA 3NT2A 2G82A 2TMGA 4JNKA 1Z45A 3OQ1A 4TVBA 2H5LA 3CMMA 1EVYA 4FFRA 1HE3A 5J23A 1CQJA 5IDYA 4MO2A 3SJUA 4XEHA 1U28A 3UOGA 2Q1UA 4IXWA 1TT5A 2JAHA 5KVQA 2CDCA 3CZMA 4H15A 4UVIA 3Q9NA 4CQMB 2VT2A 5JDIA 2FZWA 5JBIA 4BNTA 1KC3A 4LRTB 5JAQA 4DA9A 3Q1LA 2WYUA 4GGPA 4CM1A 4YJGB 2VT3A 4X54A 4HP8A 3DBLA 3M2PA 2J3IA 3H7AA 4IDFA 4B4OA 4YJFB 3I9JA 3GN1A 1RM5A 3QY9A 4GLOA 4AJPA 4M86A 1PU2A 2OO5A 1PJBA 4FFMA 1DIHA 2UAGA 5C7LO 5IF3A 1R0KA 1E7YA 3TF5A 1Q0QA 1Z74A 5JS6A 4RDIA 4XIYA 3RFXA 1XDWA 4RJTA 3GGPA 3TZHA 2BFOA 1VKNA 2ZTVA 5CG1A 2ZJ1A 3WBBA 4CL3A 5EPOA 2PZMA 4MKRA 3L77A 4PVDA 3MCVA 5JDCC 4QT0A 4DLBA 3IUSA 5T67A 4JN6B 4QO8A 1ZSNA 3WNQA 2GGSA 2ZQYA 1N7HA 3QWAA 3LYLA 3EMKA 3PJDA 3L0DA 2O3TA 3NAQA 1CWUA 3QVXA 5I7EA 1GQYA 2AG5A 2NWQA 2ZATA 3B1KA 4IGEA 1GCUA 4UAGA 1HE5A 3PGJA 2NU8A 3RBXA 1OBFO 5EN4A 1N1EA 1NQAO 2IXAA 3DMTC 4ZQEA 1O5IA 3TN7A 2GCGA 5ICSA 4QX6A 3KUXA 5CFZA 1HLPA 1A7KA 1PS8A 2FHSA 1EFLA 2HDHA 4MP6A 4PG6A 1QYCA 1NNUA 1CERA 5I9MA 5ADHA 3AUSA 3DO5A 5CPBA 3KYBA 2DBRA 5ILGA 3WGIA 5EIOA 1MGOA 1Z7BA 4PGFA 4FDAA 4YQYA 1LX6A 1BXKA 3VHRA 2C2XA 2PGDA 4AICA 1LDEA 1X14A 4RCVA 1I36A 4B7XA 5F21A 3DC2A 3H9EO 2JD2A 5H82A 4BO3A 3COSA 2BI8A 4MDHA 3D4NA 5C5IA 2PD6A 1HTBA 1K6XA 2R00C 2DLDA 3DBHA 4PLGA 2GERA 3PJGA 4KQXA 4TRNA 1EUZA 1ONNA 3B1FA 4BO9A 4OKNA 4EGFA 1BWSA 3DAFA 3HADA 1PTJA 4R01A 1PQWA 4MVJH 2GUGA 1PGQA 3DFUA 1EBFA 5DCYA 3EVTA 3CMCO 3I3OA 3ZWYA 5IN4A 4MINA 2V7PA 1XCBA 4LGVA 1Z7EA 2VQ3A 4J90A 3SXPA 1Q7BA 3K2BA 1YBVA 3FTPA 2ZB7A 1VC2A 4ZN6A 2POQX 4LVUA 4ONEA 3PTZA 5AOVA 4OYRA 2EHDA 2HQ1A 5HM8A 3HDHA 3H65A 3IDSA 5ITWA 2E6UX 4CLXA 5FF9A 1PX0A 3VC7A 2WYVA 4O63O 3RUIA 3GHHA 1D1TA 4BKUA 2X5JO 1RYDA 1VE9A 2EW2A 4NR0A 3UHAA 3H4VA 4II2A 4EITA 3C1AA 2VZ8A 4GVLA 4IQ8A 4DC0A 3X2FA 1HEUA 3ORFA 3IQDB 4EZBA 3TL3A 4EUEA 3ZNQA 3CUKA 2HMUA 2OOSA 4JROA 1P74A 4XGIA 5AXBA 3RUAA 3PWSA 4PFJA 3WWYA 3WSWA 3W4JA 2PK3A 4IMPA 1UP4A 1IL0A 1DXYA 4NFYA 2IEBA 1DLIA 4YJGA 3PDJA 4BV9A 1KVQA 3W6UA 1C1XB 4GX5A 5FI3A 4NQZA 3UUWA 4FJ0A 2Y67A 1UXIA 1UAYA 1H93A 1M66A 1P9LA 3JQAA 4YVFA 3CXRA 4Q3NA 1C0IA 4E2WA 5IFLA 1J0XO 2B83A 1G0NA 5JDCA 4UVDA 2ZTUA 4J43A 2P5YA 3E82A 3S2IA 5TJHA 1GEEA 4BNLA 2D59A 1EMDA 1GYRA 3WR5A 5ER6A 3OQ6A 2YQ4A 3HG7A 3PHLA 4Z0PA 5T64A 3JQAD 5H81A 4EDFA 1QKIA 2YFQA 3RFVA 1R0SA 4J0EA 3QWFA 4PLCA 5DOZA 2ZQZA 2PY6A 5G4KA 4YJHB 4ITUA 4LCJA 5COAA 1I2ZA 1PJ4A 3WIDA 1LC3A 3JQ7A 4N54A 3WWZA 1TVEA 2AQKA 2BI7A 3B20A 2JFFA 1I2CA 4PLYA 1ZK3A 3G0OA 2NTJA 1CQIA 1EZ4A 1N9GA 2EKPA 4XGNA 2R2GA 1JVSA 3JQGA 3JYLA 3GPIA 3HQ4O 4R1TA 1MXHA 4GGOA 5A9SB 3H5RA 4UEOA 4U6SA 3K30A 3KEQA 3ADPA 4LSWA 3RQSA 4AJ1A 1BXGA 1P31A 3BMCB 3BHIA 3U3XA 4OO3A 4LN1A 4O5OA 3O26A 4HXYA 4UREA 3IOYA 3D7LA 5ICMA 3L9WA 4HBGA 3ZV4A 4GMGA 3GF4A 4DWVA 3WLEA 1C14A 1PGNA 5CEFA 7MDHA 5HBRA 4GVXA 4M8SA 1ZJYA 4JJFA 5B1YA 4EJ0A 2FY8A 3FF4A 1WDLA 1X13A 3T4XA 3JQ7B 1HDXA 4FGSA 4FIZA 4NU6A 1P33A 1PSDA 4IS3A 2YHIB 2I76A 3QA9A 3AU8A 3MJSA 3BHMA 2X0NA 3ZV3A 4QSMA 1H6CA 4IJWA 3CE6A 3PRJA 2O50A 2IXBA 4Y6RA 4J1SA 1P1FA 4IDAA 4JCOA 1YB5A 1Q1NA 3IP1A 1ISFA 5KCZA 4NZ9A 5AXDA 1GV0A 3L4BA 5KVVA 1VLLA 2EWMA 5B12A 1WMBA 1KEPA 4R1NA 2J3HA 1HSOA 3ASVA 3PK0A 4EBFA 4F3YA 4ZD6A 1ZJZA 1BW9B 1LNQA 2NVWA 4FN4A 5HS4A 3JQEA 1U3UA 2P91A 2BGLA 4DMMA 4E30A 3A06A 1LDMA 1DHTA 3CZRA 1AHIA 2PTGA 2D1YA 3ZWAA 3LQFA 3VZPA 2I67A 1DHRA 4CQMD 2GNAA 1I0ZA 5CPFA 2BFAA 1X7HA 4E32A 2QW8A 3GEGA 1B3RA 4TROA 4WOKA 4CV3A 1P1IA 2OMEA 3JV7A 1ADCA 4HNHA 3N74A 1M75A 2AQHA 3GZNB 3WDSA 2B35A 4XB1A 2P4HX 3JYQA 1UZLA 1SNYA 3AOEC 5IZCA 5BNTA 4HX5A 2JFHA 4ZA2A 1QRRA 4CR8A 2GN9A 4P4GA 5IXSA 2NTNA 4A10A 3DAGA 4MOWA 3I52A 3PP8A 3EUWA 3RJ9A 3KSDO 1N92A 3LF2A 1U9JA 1BSVA 1NQ5A 1GFSA 1XG5A 2PWZA 3PFFA 3H5NA 4WK6A 1RYEA 1W4ZA 2YDXA 4NJMB 3IP3A 3BAZA 2BD0A 3E6AA 3OIDA 3AFMA 1U2GA 3Q2KA 1DBVO 1BVRA 4NBRA 2C5AA 2G0TA 2NADA 1PZEA 2QYSA 1YBMA 1U5AA 4UVEA 5AXAA 4OIMA 3PLRA 4RF3A 1DRWA 3T7EA 2OBNA 1C1DA 1NQOA 3AUAA 4QTZA 2CZCA 4NG5A 1U4OA 3EGOA 1EBUA 1QXSA 4RV9A 3E9QA 3SC6A 1ONPA 2RBEA 1VL0A 1T4DA 2DQ4A 2HCTA 4GX0A 4NJMA 3UKOA 3U5TA 1QYVA 5HRUA 4WPGA 1A5ZA 1C1XA 5A9TA 3W8FA 3PYXA 2BF7A 2GSDA 3LF1A 4J7XA 2JD0A 2JCVA 4NH4A 1CF2O 1PGPA 2AQ8A 1P44A 4QFDA 2AE2A 3C7CB 2NTVA 2EF1A 2D0IA 3ZDFA 4KUEA 4MVJA 3U0BA 3AW9A 3TJRA 3FBGA 4DC1A 4E21A 4BNMA 2PZJA 4IQGA 2G1UA 1OC4A 4ZJUA 1LUAA 2EV9A 3JQBC 2IYOA 4DVJA 1LQTA 4CUJA 3NKLA 1LLUA 5F1PA 2X22A 1NX6A 2GDZA 2WE7A 2C5EA 4MP8A 1BTOA 2AHRA 1ZXLA 2VHZA 1NPYA 1HDZA 2I3GA 4UUPA 5TT0A 4MVJI 1J5PA 4J7UA 2PA3A 4CQLA 3HZZA 3VPHA 4PG8A 3DHEA 1AXEA 1NYTA 1JVBA 1K5HA 1U2DA 1ZIDA 3PWZA 2Q2QA 3HJAA 3CPSA 3I1JA 1FDSA 4CR7A 2GN6A 3KTDA 5EINA 4W9NA 4BS9A 4I1IA 2J5KA 3NGLA 2HK8A 2DUWA 3ZWBA 1ISJA 1VJ1A 2NU7A 3HFSA 4R1UA 4S1VA 1DC4A 1TEHA 5CG2A 4L9RA 1YO6A 4EI2A 4C7KA 1YKFA 2VHWA 3E9NA 1DFIA 1UXKA 1IOLA 2O2SA 2WYWA 1S7CA 1HT0A 2VUSA 1X0XA 3C8MA 3LC7O 2Z5LA 3UCEA 2QRKA 2V6GA 1P1RA 1XGKA 4KMSA 2FPPA 2AEFA 3BMQA 5A06A 4KOAA 1DAPA 1LI4A 3EC7A 3DZHA 1PJQA 3GDOA 3K96A 1ZUD1 4RGBA 3SEFA 3SLGA 4MJLA 3ZWPA 2VYNA 4BMVA 3FI9A 1I32A 1WZEA 3I9KA 3TZCA 1DFGA 1GL3A 3GLQA 3FN4A 1LDYA 4CLRA 2R6JA 1QV6A 1L7EA 4NNJA 3FNGA 4L4SA 4WKGA 2QHXA 4GPD1 3IJPA 3WQSB 1GUFA 4BVAA 1TLTA 1V6AA 1DJQA 1G6KA 3ONEA 4TRJA 1YDWA 3BMQB 4DPLA 3AK4A 1XYGA 1LDGA 5MGBA 2DBVO 1PR9A 3BHJA 2VNAA 3NUGA 3OSUA 2VCYA 4B3IA 5THQA 5JCJA 4ND5A 5CDSA 4M87A 3HN2A 1I01A 4YQZA 3K2EA 4JP3A 1DEHA 1U1IA 3C85A 3C1TA 3H3JA 2BGMA 3BMCA 1SAYA 2EKQA 3MZ0A 4NJOA 3IC5A 2I6TA 3KHUA 5EL0A 3L6EA 1NHGA 3MTGA 3U62A 3E1KA 1QSGA 4OL9A 3RC9A 2IRWA 4Y98A 4BHTA 4GI2A 5BT9A 3BA1A 4BQPA 5IDQA 4IUYA 3Q0EA 2DU8A 2NACA 5BNFA 3DMYA 2A92A 3BTUA 2X9NA 1OMOA 5A05A 5JCXA 2DBQA 3RBZA 5GZ1A 2VZ0A 4RLHA 4BGVA 2Q2WA 4UVHA 1UDAA 3FPCA 1ZZEA 1SB9A 1E7MA 3D4PA 3RIHA 3R6DA 2ZCUA 1UZNA 4U6QA 1JAXA 2EERA 3WGYA 3VTFA 4I9UA 3MWDB 1HDOA 5A9RA 3JD0A 1CJCA 5BR7A 4N18A 3ICCA 4BO1A 3VPGA 3GAZA 4E6PA 4NK5A 1OZAA 4XDYA 3JQ9A 4QUKA 3AM5A 1U8XX 2AXQA 4AJ4A 4JBIA 5L40A 1NVGA 4CM7A 2VZ9A 4DQXA 3VDRA 3I9LA 3W4KA 3WX0A 4XYMA 2RHRA 1F8GA 3JQ8B 3MEQA 4CQMA 4C4OA 2UUPA 2XOXA 3INRA 3WFJA 3A1NA 4I5GA 4J16A 1JU9A 4GQAA 1ENPA 1BVUA 4XGKA 4ALJA 5JMWA 1F06A 2JL1A 1R15A 1W8DA 2QIOA 1E7QA 1X7GA 4NHEA 4QECA 4UULA 5JAMA 1GQ2A 3L6DA 4BNHA 3P19A 5IJZA 4D43A 2PH5A 1K3TA 3JD1A 4OSOA 4L4XA 1ADBA 2G76A 2H6EA 1VSVA 3DOOA 5JY6A 3I6QA 3VOSA 2X86A 3M1AA 3ANLA 3GUYA 5BSGA 1A27A 2HMTA 1VI2A 2WJPA 3QJ5A 5JY1A 5JYDA 2UVDA 5BSEA 4L8VA 3O8QB 4D44A 4E13A 4Z9FA 1T4BA 1NVMB 1VL8A 4FC7A 4L73A 5EMHA 4BGIA 4F6LA 1EK5A 5TLSA 3MTJA 4PRLA 1XEAA 3DAPA 3QSGA 1HXHA 1IHYA 2AEMA 3D3WA 2OHXA 4YB8A 5CDYA 1XU9A 3NDRA 4J2HA 1DDOA 2GN8A 4GKBA 5CDGA 3HHPA 5DP1A 3KYCA 2HUNA 4IJKA 3ENKA 4LW8A 3U09A 2DTDA 2IZ1A 3V1TC 4GX1A 5JO0A 4K26A 1AHHA 1E92A 2B5WA 3BMOB 1MA0A 1YQXA 2B4RO 5DULA 3DXFA 1JLLA 1K89A 3QVSA 4I5FA 2PGLA 5ES3A 1WDMA 4DLLA 2PD3A 2Y68A 4CM4A 3K31A 1LRLA 3E9MA 5TQVA 5G0SA 4DL9A 2ZYGA 5F1OA
chains in the Genus database with same CATH superfamily
1J0DA 2HL6A 3Q87B 4Z4EA 2EP7A 3CCBA 1VFNA 1Z4NA 3ZU5A 3N7UA 3NBUA 4RQUA 1CJSA 5ADVA 1O0BA 3MT9A 1XR3A 2J7KA 2LCIA 3ES9A 4BBZA 2CVPA 2WBLC 1A69A 3JXEA 4KXUA 3TVTA 1J70A 4LE0A 3ZIAA 1JHAA 4BX8A 3QHAA 3PEUA 1F6DA 1H5UA 1RAIA 3PIRA 3UENA 4JEUA 2C2KA 3WA6A 1OFGA 3OJOA 3QKSA 4YHHB 3LUPA 4X71A 4NFHA 4Q02A 5ILOA 2J7PD 2OHFA 1CU1A 1GG2A 2DG2A 3ZG6A 3UFXA 3VH4A 1D7AA 2REOA 1M7GA 1DFHA 1OIXA 1TVMA 1CIJA 1FFEA 1WCWA 1W6RA 2J6HA 1RI1A 1YMVA 3GR6A 4YAGA 4IV0A 2BKVA 4GPZA 1Y3FE 2BKUA 2GJKA 4D5GA 3KYJB 2I66A 3PFGA 2FUKA 3LVBA 4BNVA 4P3PA 3V1UA 4E12A 1NRWA 4RMJA 2WI8A 1MO4A 2ZAGA 4KVZA 1TCCA 1TM7E 1IOZA 2XITA 3AIOA 3M6WA 5DW0A 3ZU2A 1AGPA 1P8JA 4JI5B 2VHYA 1IHDA 3H3XA 3NHMA 1TKCA 1KI3A 5L9AA 1CQWA 1T8YA 3P0IA 4FI3F 2AZTA 3M6IA 3H75A 1H42A 4ZOCA 2UYQA 3VR5H 1JKIA 1GL9B 3BTVA 4OQQA 3P2YA 1R4MB 4KLNA 3TQHA 4FYIA 3I6MA 2OKCA 3AL2A 3EHDA 1JXAA 1C8VB 1HQCA 2IXEA 2YN2A 3L1VA 4NNPA 4U4AA 3RC2A 3WK6A 6REQA 5L53A 3S8EA 4UNPA 1VMEA 3FZYA 4OQYA 1JQLB 1QCYA 3QMMA 4QULA 4Z99A 1VJCA 5LP6B 4U3JA 1Z18A 3TQQA 1G3RA 1NN1A 4RK1A 1NBWB 2HPZA 1N0VC 1YIOA 2RH9B 2P6NA 1DQRA 1PK9A 1SOVA 4DDKA 4LJ5A 4PN3A 2NAFA 4QDKA 2I1LA 3KUKA 5DNDA 2BFBB 4AG3A 5L3SA 3NYIA 1P0MA 2W8BB 4JAVC 4MUIA 1JT2A 1XXHE 1TVKB 1JI3A 1XF9A 2F1KA 4JBNA 2Z3WA 1TZMA 1Z0UA 3OUZA 3JAWA 2DHQA 3VV3A 1ZXXA 4LYHA 2OCAA 4EO9A 2XOKA 1G8HA 2WAXA 3QITA 1UJ4A 2ON6A 5AHXA 3N2KA 4K81B 4KU4A 1JU3A 1LW7A 1T0JB 1L6IA 2O2ZA 2Q3LA 1ZXBA 4H27A 4AUEA 1FNBA 5K01A 2XDWA 5FQOA 2Q46A 3F71A 3HYRA 4GR5A 2O1SA 4GMFA 3A1UA 1E1LA 5DX8A 1KFEB 3TW4A 2A6PA 2KX7A 3RIMA 4ER0A 1IK4A 3F73A 1U8EA 2ZKIA 1Z2OX 3CEHA 3EZ6A 4N47A 4DV7B 1NOIA 4LJ8A 3DKRA 4Z1OA 5LZ2A 1MEEA 3D0QA 1S5PA 1GL7A 1MX3A 2YZKA 1EWKA 5K0EA 2AN9A 1EB9A 3KE9A 4FZJA 4QGSA 1Z37A 5FPSA 1XZEA 4KUHA 2QBYB 3RM3A 3ANNA 5FJJA 5AQ1A 1K4KA 2FK8A 5LB2A 3DYIA 2D4AA 4FFBA 4HQFA 4UPDA 1Z3IX 1YRAA 5HP4A 4P35A 3EA0A 5C46F 5DYWA 1G66A 1P2GA 3DOCA 1DXHA 2WTEA 4PE5B 4LY0A 4MKHA 3TJZA 2YWDA 3UK7A 4YCJA 2QZSA 2O3SA 2QN9A 3N5KA 1IATA 2O2IA 3QG1A 1EFRD 3K1AB 4CYMA 3L8GA 1R8XA 1NW4A 4A5OA 1MQAA 5HZGA 3IURA 1L7BA 3TKLA 4BNKA 2ICAA 3LYUA 2VDWA 2DPGA 2YWFA 3D8HA 4BGEA 5C8DA 1I9GA 3RW9A 5GONA 3TSYA 5HUJA 3HSSA 5KVCA 5DTEA 2P6MA 2ST1A 4MVXA 3ST7A 1WZIA 4X6LA 1QYXA 1XZGA 4LVCA 5K0NA 4GL2A 1BG6A 5JV5A 3AF0A 4K40A 3GNSA 3KKMA 1Q3KA 3Q2IA 2WHYA 1JQEA 2VYCA 3CLRD 1A77A 2QTBA 4GRAA 3THRA 2VJYA 1MFZA 1W4CA 3MWFA 4HDMA 4XQEA 1Z3CA 4Q03A 2Y4OA 3E3AA 5EFZA 3BOSA 4OHRA 5EP3A 3T3MB 1ZUIA 5FKJA 1ISRA 1YS6A 3BWXA 4FOLA 1G1AA 4H7EA 3ZWDA 1N2CE 2L19A 2WK1A 1UBLS 1UDCA 4Q1VA 3TM5A 1I1OA 2G7MC 2ZB8A 3A31A 4RACA 1X1SA 3RSOA 3QPUA 2P3SA 5BMVF 5LM3A 3FBWA 4NP6A 3PBKA 1PNOA 1V3VA 4TV9F 5GZ6A 2QTHA 4PM4A 4BLUA 4ND1A 3CVOA 2CMFA 1XTPA 2B78A 3M2TA 3IIEA 4GR4A 1YS2X 2ZRMA 1E9CA 2IOFA 4EVRA 4HPXB 1EFCA 4PPFA 5EFOA 5ALDA 1P80A 1VE3A 4V1CB 1YFKA 2QPLA 4AJIA 4A26A 3TOZA 1B6GA 1R7RA 4O4LF 5FOXA 1HRKA 3HBJA 4P7JA 2HLPA 2J6BA 3W04A 1RHRA 3GK3A 2H1WA 4V0LA 3IDQA 4BUCA 3IBCA 1Z39A 3JWIA 2KE5A 2DKNA 1DC5A 3AHIA 3L7JA 3EIOA 2PPLA 4JZYA 3IEMA 3IO5A 4JD5A 5A0VA 1U7UA 1M5RA 1TU3A 1UK6A 1MW9X 4PO9A 1V5IA 1OF1A 5EQFA 5JI2E 3DV0B 4ZT2A 3TLGB 3W5SA 5GWXA 3IAS6 4F97A 1N2JA 4UD2A 2P8JA 2ZT8A 3E8XA 1NUTA 3GROA 2JLWA 4TYWA 2GPTA 3IDZA 4ZTUB 1Z16A 3DDWA 2FZVA 1LH0A 1IBSA 2ZR9A 4H7DA 1T0PA 1RRGA 2ZUSA 1VMIA 4RZ3A 2BHTA 2AMJA 5KNBD 1YL5A 5DNWA 2COEA 3QEMB 1ML4A 2OBXA 2PVPA 3CUSA 3K15A 4MUXA 4Y7CA 2VSXA 4LJ9A 5G0WA 1UXJA 1A9QA 2AF4C 3IAFA 3L5KA 2DPXA 3LS2A 1E6KA 2RGCA 3EWIA 4JY7A 4KQ9A 4AS3A 2WIKA 4CKEB 1QKJA 3JQ6A 5BNWA 1ZISA 1TT7A 1H6BA 2BEVB 2F64A 3DMDA 4MYTA 3WIEA 4A6PA 5JQGB 3HFJA 4RV4A 2NZ2A 1FNNA 2NAPA 4ZAWA 5EXSA 3VX3A 1UZMA 4QFMA 5EJ5A 3IHLA 1TCAA 4FC6A 3E18A 2PFGA 4QUEA 4Z0HO 1KYZA 2IIBA 4LYYA 2ZOSA 4WZAA 5A03A 4YK7A 3KOOA 3O38A 4PZZA 1EIWA 4CT5A 1JTEA 2CVOA 4JI2B 3AB7A 2IZ0A 1P8AA 2Q1SA 3MJ4A 5J4VA 3B1VA 3B3GA 3I30X 4RNCA 3UAXA 1R9NA 1SMKA 1ZI8A 1Z6PA 2J9ZB 2NNWB 3F2IA 3SIRA 3K6RA 2V6IA 4ESVA 3HPQA 4CPDA 4XTRA 4ESOA 4HLNA 4K0RA 4OQXA 2WWGA 1OZHA 3GMTA 4BNYA 1XZDA 4PANA 3ZWWA 1E0KA 1T8TA 1DAGA 4IM7A 5HBGA 3T4EA 2OGSA 2XUJA 3A6JA 5LDHA 4GWGA 3LOQA 4RPGA 4UKDA 4RPLA 1BQ3A 4BO8A 1TFUA 1TO6A 4NEQA 3D6JA 2OR3A 4KIGA 1NR5A 2WVGA 3G7SA 1GAEO 2J0EA 3IA2A 3EG5A 1CZNA 4O59O 2X0DA 5EJEA 4JXZA 5KYVA 4Q7QA 1IVSA 2ETXA 4R1PA 1D4FA 2Y9PB 1RS0A 3DKPA 4INAA 1Y3DE 2W9XA 5IK2A 4FFLA 5NULA 3USCS 1QX3A 4ZZ1A 5CAEA 2R8RA 3OU6A 1ECGA 4GYJA 5T8KC 4GE3A 2O20A 4I4NA 4W5WA 1NATA 4FEEA 1HDRA 4B9AA 2GJ9A 3W5VA 1D5CA 3C6KA 2Q5JA 1YU9A 1VXOA 5GOZA 3TCKA 1YK1A 2XWQA 1VRVA 2FW8A 1QWOA 1AIPA 3MMPA 4PO8A 2FSSA 3WFIA 3QIVA 4XASA 1PEAA 2QE7D 1JAIA 4XPIB 4FINA 1RYFA 1HFKA 4REQA 2PWAA 2VP5A 3O2QB 1MQSA 1PBTA 2FMHA 1MA3A 3MTIA 1N2HA 3O0TA 5E4JA 1FSSA 1QCDA 3C74A 3FUVA 1K8YB 3S1LA 5F9HA 1Y6RA 2VT7A 3FUTA 2CSUA 3SD7A 4S0XA 4TTVA 5L95A 4IHQA 5K7SA 4ID9A 3PL1A 4MGIR 1UIMA 2QG6A 2REQA 4TTSA 1S9DA 1W48A 2VQSA 5C4MA 5L7TA 5KPJA 4RTLA 3LH5A 5AVRA 1QHHB 2H3HA 1VL2A 1C2YA 3B48A 3LWBA 3KTOA 5L4LA 4LCBA 1FFBA 3PNYA 2AMFA 4EO7A 3AY3A 4J0KA 3QXHA 4MVJD 4CEIA 2YHUA 5D3ZA 9LDBA 1M7HA 4N5DA 3I62A 3JAKB 2R1ZA 3KQVA 5E7MA 4IJ6A 1VKHA 4MPDA 4AMVA 2H18A 3QENA 3ZE7A 3HXQA 4Q7JB 2BFPA 3C6YA 3AJAA 3BIFA 4NV1A 3AJ9A 3RUFA 3S4YA 4YRKA 4BDTA 3TB4A 1G2PA 2OORA 4GXNA 2GF2A 3R2JA 2I2WA 5JEEA 1Y4SA 3OJ0A 2N1MA 4FHCA 3P9KA 1ENZA 3OZDA 2RSLA 2HF9A 3RHSA 3NOOA 2B6NA 2OENG 2O2CA 2QAGB 4M0FA 1MG5A 1Q19A 1L5GB 1E2DA 1I3CA 4B82A 1OXVA 3HB0A 2YV5A 1PJTA 2PPVA 1SCKA 1T1JA 2H9YA 4YRTA 5IULC 2N3ZA 4U5QA 4QARA 1BMDA 4HAYA 4JVSB 1VHWA 1R8JA 1JECA 1QFYA 1U31A 1QF7A 5F9MA 3PE6A 4ALKA 2BPOA 2ZJ4A 1CCWA 1RPJA 1OLSA 2ZU0C 1AE1A 1JQDA 1TZ2A 3FF1A 3IMCA 4PTYA 1RWNA 2KW5A 5JS1A 1KOFA 1UMBB 1GDHA 2DGDA 3FCAA 3JPYA 4RKRA 3HR7A 5IDVA 4B5KA 1W5EA 3PUJA 4XJXA 2FPUA 1PHRA 4DYVA 4IGAA 5EJIA 1D4OA 4X7PA 1HNZB 1S6YA 1ZP6A 2XVYA 1FTYA 1LZLA 3VR5A 2PL1A 4E5SA 1K92A 2BDUA 1K4MA 1CUAA 4RXUA 4ISBA 1PW7A 5D7BA 2VYVD 5E6RB 4OSEA 2HCJB 4ROTA 4J29A 3TAHA 5KVSA 4DLVA 1L7XA 3L0IB 2HWYA 3UK2A 3I2YX 1QS0B 4HUJA 5C7YA 4DARA 4EJSB 2ZSKA 2C07A 1WXIA 2Y77A 3GEIA 2QMQA 2X1HA 2GN4A 3UO8B 2ZCJA 1CR4A 3CBQA 2GA8A 3BGDA 3NXSA 5EKUA 4CM4B 1OGYA 1XKTA 1KSHA 5K3EA 2Y9MB 1PNTA 1VJRA 3GCGA 4YT5A 1QE3A 2Q50A 4IEIA 3GVPA 2BP7A 1VCIA 2YXNA 3ILYA 3AR4A 3OI7A 4WIAA 4LV8B 1YXMA 3WGZA 4DBLC 3S2FA 2Z6VA 2ZJ6A 5AKIA 3R8CA 3AFOA 1XPUA 3S7TA 4EA7A 4YJ3F 2W2VA 3E8SA 3TLZA 5DIZA 3P2IA 1LLDA 1L4GA 5I9TA 3M9WA 3OHSX 4JSRA 2IU0A 5IG2A 3RIYA 1Z68A 1XTSA 2OWDA 1RKXA 1BN6A 1RAAA 1TT5B 1ZUWA 4KDFA 4DLAA 2VH5R 5GY7A 1G21E 5F2KA 4N7RA 3TCNA 3KSMA 3OPXA 5AW3A 4FYXA 2PRIA 3HLYA 1Z6AA 1O96B 2XNDA 3ONVA 1UMDA 5CXQA 3HKBB 1PYDA 3JWJA 1CT9A 3EOBI 1OI4A 1ZL2A 4BO5A 2FZ5A 1RRMA 1HEIA 5ITVA 4HB0A 4B46A 1YGYA 1EGQA 4BZPA 4IHKA 1GUAA 1N0HA 1B15A 3WL3A 4DJEC 1GIAA 1O58A 2QX6A 3WJ2A 4DIMA 4EB6B 1M1YA 1S0UA 3ORQA 5CITA 1BCSA 1D3AA 2J5RA 3DMRA 4HWSA 1D2AA 2QD2A 4UBIA 1MC5A 1RHQA 5DT2A 3VSDA 4R5HA 3QMVA 521PA 1UOEA 2JGDB 3C3JA 1R9GA 4Q6BA 4JC8A 3OZRA 3EVGA 1A9PA 2WAYA 3INNA 3U40A 4C88A 1DB3A 2F7SA 4GM1A 3OZEA 2LTAA 4QJ4A 3UBTA 4QDUA 4NYIQ 1HY3A 3CQ9A 1OX6A 4KYTA 1B8UA 1MD9A 2DQYA 5CH3A 5B7QA 1H9BA 1NXXA 2IYRA 4POAA 2ONCA 3RSCA 1NVVQ 1ORIA 4CLDA 5IHXA 3STYA 3FCOA 4FYKA 1RCFA 1BROA 4MQUA 1RTTA 5JMOA 3N5CA 1A2KC 4UJ5A 1SCNE 2P5SA 1VIAA 3G7NA 2I8AA 3BL6A 3HCAA 5E0OA 3OPNA 2UYOA 3MRXA 4A23A 2V1UA 3TOCA 1E8NA 3HYNA 3L6OO 2CXHA 3TZ6A 4BLPA 3BWYA 3ZQKA 4B73A 5CFMA 1RXIA 1U11A 3BJMA 1N32B 3DB1A 1P9NA 2AJ8A 3KSZO 5KZMB 4FYYA 4WDQA 4KHPB 5LD2B 2J8ZA 1QIFA 1O6BA 5HJ2A 4LHSA 2P2CA 5EIBC 2CDBA 3E3OA 3TGLA 4LX0A 3ZDAA 4TV8A 3PZBA 2IYNA 1ZBQA 4MIKA 5ELLA 1BX3A 3T7IA 3UJPA 4IJUA 4LZPA 2IC5A 2WWVD 1LDNA 3BCHA 3YASA 4G37A 4J8PA 3G0GA 5EWMA 1X9HA 1PK8A 4E2YA 1HYEA 2WU8A 3GBVA 3LQ4A 4PZEA 1PKXA 3WO0A 1TCUA 2G1KA 5FUVA 2L69A 3P45A 1GR1A 1GTVA 1WV0A 3BBPA 1LLCA 1OXBB 5REQA 1OI2A 5J4HA 1MC1A 1WB6A 1PWXA 1LC0A 2GBFA 3MMXA 4AJ2A 2JLZA 1NQWA 4JVMA 5E4TA 1S4QA 4FIDA 2Q1TA 4UTVA 2FDCA 3AVXA 2DWQA 1T10A 3AHFA 2H4FA 1T9ZA 3AIIA 4GVPA 1UBUS 3PHCA 4L5BA 4I6JA 2R6ZA 5CCXA 3RRYA 3OIFA 2M2IA 4DNPA 1VLZA 4DDVA 4H1HA 3DDNA 1MU0A 1QGZA 4PC7A 3UJAA 1ZDMA 5JPCA 2V4UA 3EZGA 3G8YA 1KJIA 2AV6A 4I1UA 1N6OA 1U2SA 2PBFA 1EX9A 1UH5A 1XB2A 2C61A 1QQTA 3F6BX 3Q85A 4HH3C 2ZIFA 4NCHA 1QV7A 4L5YA 5EE3A 1VIYA 1RZ3A 2NXJA 2XMSA 2VUUA 5JSUA 1VKJA 1P77A 3H9GA 4RYLA 5AJWA 1GILA 2Y1KA 1EUQA 3DHVA 1CDEA 1KJZA 5EHGA 3MM4A 1BNCA 3OEHA 4CKEA 5LUAA 3QLUA 1NR1A 3TRKA 4E51A 1FSGA 4HS9A 1T9GR 2O48X 2B1RA 2QUKA 2N46A 3F6YA 1U3WA 1C9MA 2AFIA 2Q3CA 1GKUB 3KR1A 3KRTA 3OLQA 1T8SA 5BW6B 3WK4A 4BVKA 1M2JA 5EPUA 2GASA 3ZEAA 4DCPA 4F2HA 1AMNA 3AVYA 1J49A 3IQWA 4ZOAA 3GDFA 4TUYB 2WA1A 3CTPA 1WKBA 3A0UA 3PZRA 5FO0A 5C7IO 1U5CA 4FQ5A 2H1RA 3AFHA 2GLTA 3G8BA 2OK8A 4NPCA 3D3QA 3JU3A 3BAFA 4HYQA 3U3JA 2OZVA 1UMKA 4EL5A 1H3EA 2R6R1 4XYLA 4GNKA 2H2FA 3FMPB 2ZS9A 3IESA 4FSDA 3KOMA 1GGJA 3VC3A 2AD5A 3D4LA 3DB2A 3UY4A 5JIBA 5JI3E 4P92A 1QGUB 4GE0A 3SM9A 4RL4A 2ACEA 4H60A 3P52A 4IYRA 3E9RA 3D1LA 4KX3A 2NO1A 1VLVA 4NABA 4J0HA 3VR3D 3EEOA 3TBFA 1SIOA 1D0IA 4L0QA 3PLNA 1VCMA 3OFVA 2KYRA 3C6MA 4U7GA 5EJAA 3UJCA 2H1CA 1KZGB 2GCNA 2JJ2A 1LW6E 4QQRA 4GOJA 5JLJA 5GTDA 1QRTA 2VJNA 4DJ5X 2PUGA 5DBHX 4U0KA 3GRZA 3IALA 2A1TR 3FKJA 3FSEA 2W11A 3FWZA 4HEJA 2OV1A 1CYEA 2PVSA 4KCGA 3HSKA 2IT1A 1VJ0A 3I64A 4P3OA 2DY0A 5E1OA 3DJFA 2Q6TA 1NYRA 1FFGA 2WJJA 2BKAA 1NSYA 4J1NA 1GPBA 3HB9A 4M1WA 1GYPA 4S1TA 2A0XA 4UUBA 1A4IA 4BB6A 1IXRC 3KLMX 2LDBA 4YJ3A 2OCDA 3KBBA 2I65A 4NICA 3VPDA 4EUFA 3C7KA 5DRYA 2MCFA 3M34A 4D0RA 4RJLA 2C8KA 2YRXA 4MHTA 3X43A 4EDHA 2RGGA 5AI6A 4BEBA 5JATA 1YS4A 2HCBA 5G1NA 4Y2XA 4BLRA 2H9IA 4BNUA 3ZHBA 4WKOA 1D2NA 1O2DA 2JIZA 2H29A 4Y2YA 4C4TA 1W93A 2VJLA 3W9SA 2Z3ZA 3E05A 5FADA 4PWYA 1PVOA 1SXQA 3FPFA 1KF0A 3ITDA 3QHPA 2C78A 1ZO8A 3DHYA 1CY4A 3FFWA 4AVYA 2I2DA 5C3MA 3VAAA 5CFPA 4F3TA 4PXYA 4MMZB 1A8SA 5FPQA 3T5BA 2HHCA 3AF4A 3GVXA 3VPSA 1A9ZA 3KVNA 1N2BA 5EIWA 4DQVA 4F3NA 3I0NA 3M0EA 5AHOA 1X80A 3R5TA 2OV8A 1JAHA 2QGZA 2ZP1A 2YJ3A 3A6GA 5JH7A 2IEYA 1IWOA 3DLTA 4YXWA 3ZBPA 3BH0A 1FQWA 1KH2A 1J0EA 1X42A 4JHXA 2R8OA 2NV2B 4L78A 5ENVA 1MB4A 5L51A 3QXGA 4TSKA 2RMKA 3TGPA 3RRXA 4CCYA 2XVMA 3DP7A 4WNIA 3F6RA 1G20B 1QHIA 2G6BA 3AG5A 3HDJA 3PJEA 3B7WA 2BMEA 3GCZA 5EJFA 4W5QA 2QBYA 5EIEA 2IUTA 4WQMA 3KL4A 3B8EA 2VRCD 3U7GA 4MUAA 1CZLA 3HE3A 3VZQA 2Y1WA 4K6KA 2J1LA 4D46A 3MB8A 3VR0A 4EBBA 3NONA 2I7DA 3U37A 1UKZA 2XWPA 2ORVA 1ZGCA 4HF7A 3RAEC 1L5HB 1RBZA 2YMQA 1DX4A 1DTEA 1R6XA 3V2GA 1TMGE 1W44A 4A91A 3EGDB 4B45A 3PYLA 2OA0A 2V58A 4U2GA 1GKYA 3THOA 1GVNB 4PR3A 4YP9A 3SHQA 3T7DA 4CUKA 4CXMA 4ALMA 4PCVA 4PQYA 4D4JA 1RHUA 3LQKA 1U8AA 4IMIB 4DSUA 4J3FA 3DLBA 2JANA 5KMGB 1SZDA 2JFNA 3AJRA 3SU8A 2Q2VA 1M0EA 2ACWA 4O4IA 1P61B 2Q4DA 3EW7A 3FCCA 3T12A 4BV2A 1FSFA 4WCFA 4PYOA 1TVKA 2HSWA 4DR6B 4TXHA 3TJMA 3CSDA 4D3DA 5LSAA 3TRDA 1XIVA 4EGAA 1TAQA 3FVVA 1P45A 4RFVA 4X90A 5HFAA 2W2KB 3MLBA 3T8YA 4XTCS 1SUCA 4NENA 2ZT6A 3FTNA 3GMSA 2C1XA 3PF9A 1EK6A 1YQTA 2G0NA 1E9AA 1G291 1WCYA 3GJ6A 2EP8A 3NHYA 3NJRA 3CXUA 4KWEA 4M98A 1GLGA 1CIVA 1PG2A 2WVJA 2YXLA 3CF6R 2B3TA 2QJFA 3KX2A 1P7PA 1CE8B 5K3CA 1NKVA 3G1UA 4I36A 1EQ2A 2GJ4A 2KHZA 2NV6A 2WYIA 2YJNA 1G5HA 3WBFA 4KG7A 4AO8A 4P54A 5DEIA 3URMA 5TQ0A 4YRJA 4LTMA 3D8BA 2FR0A 4BATA 2WPNA 4LC9A 3W6NA 3QVTA 2DWUA 3I58A 3L04A 1SA0A 5DM4A 2X0JA 5EIFA 4GYKA 3WLTA 2C3PA 2FMIA 4CRWB 3IV6A 5C34B 3A25A 2QM3A 4US1R 3HVJA 4OLBA 5IRCD 1WXDA 3LLMA 1ZX1A 5DXFA 1WAMA 3ZLUA 5JG7A 3ITNA 3RF7A 4MIEA 4PYIA 1S2MA 4BAZA 3C1OA 4MPTA 1MEOA 2DULA 1JKJA 2IUFA 3SKVA 2M1XA 1KO7A 3O1HB 4KN5A 5LMCA 1VIDA 3VPFA 2VTBA 3O4IA 2O5VA 4EG0A 1OC2A 2HJHA 4BKQA 1B8VA 3H2HA 1ZYUA 1L5YA 1GPMA 1GTMA 3PIDA 4XB6B 1YDFA 2LCFA 2Q0XA 3C4VA 4XCVA 4JLJA 4F9FA 3EISA 5KI6A 5HM6A 1DUIA 5HKOA 2Z1DA 3NMUF 2B7LA 1KETA 4XAQA 4ETMA 4MI9A 2Q5IA 5IVPA 5BPFA 4HAWA 2CVHA 3L01A 5E7JA 2FSPA 3R4CA 2YS6A 4TLLB 5BOSB 4C14A 1WBJB 1EP3B 3TL6A 3I6IA 3MJCA 2ZI7A 3UZUA 1XROA 3U1BA 3AMVA 3GIDA 3P97A 1QWSA 4YJ2B 5T3UA 3U26A 3L1HA 2E4VA 5HGXA 2VKQA 1SHKA 2IZ7A 1UP7A 2V5AA 5DTRA 1QHEA 2ZRBA 4OJQA 2XE6A 1EJ2A 3QWIA 1SD1A 3D3EA 3DDUA 5EERA 5I7HA 1NG9A 5K8VA 4EG5A 2FK7A 4LZAA 4OXIA 2HRRA 4JQSA 4C2TA 2QX4A 3HNRA 3PQFA 2ZZKA 1UBKS 2YVQA 3OJWA 5IMSA 3GLFE 4CLOA 1NVWQ 4M1TA 3I9NA 4DKJA 4RE6A 5GM2A 2NN3C 4YAKA 4IHJA 4FHEA 3LK6A 5I51A 4OQZA 4BPBA 4RZIA 3UAGA 1KYYA 1C7JA 2PZBA 2NOAA 1W2GA 2Q5FA 3DL7A 2PO7A 4KNYA 1L5SA 4LGMA 4V0MA 3N76A 3AM4A 4Y6LA 4A36A 1E3LA 2AJLI 1D1PA 1Q0RA 1BC5A 1MJNA 2QR5A 4I4TF 4JEMA 3DL2A 2QLTA 4TVKA 3RT9A 1VHQA 5CFRA 4OHOA 2LR0A 3IVRA 4C0LA 3PS9A 1NL3A 1OT5A 3W0LB 3HCWA 4YMSA 4XJVA 5EVJA 2OAQ1 4LZNA 1UBJS 3BVPA 2IEAA 3HCNA 3EGWA 2OZLB 3T4UA 1JALA 1ZNZA 3EXG2 2R4TA 1M54A 3QXSA 1H9AA 1J2YA 1TCVA 2X9QA 3D4OA 4LV5B 3WTCA 4RUKA 4G0VA 3QV1A 2D7CA 3BB3A 5HKLA 3CZCA 3E03A 4F96A 4K9LA 2VJKA 1T3SA 1VBFA 1W88B 2EJWA 3DOIA 1ZVQA 2C4WA 4F3RA 5A4AA 1JQBA 4XIGS 2JCXA 2JFYA 1AKRA 1H2HA 2IZZA 2NPIA 2NQTA 2XZDA 4NAVA 4ILEA 1WL8A 5AKYA 1TO1E 2CJXA 1UBEA 1NMQA 1E4VA 2QN6A 5JW6A 3Q6IA 4U9HS 3ICOA 3JSAA 2VYFA 1CIPA 1F8UA 3LVQE 4LJ6A 1MF7A 3AHDA 4Q4LA 1W5SA 3QJGA 1KVRA 4KP7A 4U7JA 2PUDA 4ZIRB 5LA6A 3PUVA 1QH8B 3BXGA 3JZDA 1ZJWA 2F55A 1NW7A 2C4MA 3O4FA 4HFMA 4Q24A 2B36A 1SFRA 3B9RA 1GD1O 1HPLA 1SZJG 2WZDA 3BE8A 1IIRA 1RP1A 2BP7B 2IA5A 3MLAA 4JYCA 4OEHA 4RQTA 4U0JA 4E5VA 4E5DA 5C1OA 4AURA 5K0CA 1WXXA 5E3HA 1TVCA 1U81A 2VK8A 2D7JA 4FGUA 1RI3A 3HXTA 2PD4A 3QW4B 2OCXA 4M1YA 5F7ZA 4A8JC 2BJHA 3I09A 3JQRA 4CU2A 5CBPB 1Q0LA 2H63A 1UEXC 5FLXA 4R8SA 1LGYA 3MIIA 2H7XA 4X61A 3OIWA 1HFJA 2C5HA 3FR7A 3NW9A 1FS5A 1U7TA 2ORIA 3F5MA 3NU1A 4KB5A 3MT0A 4I9NA 4AQ7A 3Q5GA 4F5DA 4UMFA 3ZIDA 1E9EA 5BN5B 1FS6A 1KFBB 4PFQA 1JR3E 4WOJA 2CV2A 1ODIA 2AOVA 4RHTA 1T5TA 1YZHA 2DQSA 2PX2A 4Q3DA 4R9SA 3ZYZA 4H0NA 2ODTX 3SXUA 2DCMA 4B4WA 4QODA 4BNGA 3LDHA 5JPIA 1D2EA 2FEKA 2PV7A 5KQPA 4KQJA 2VTBB 4JI0B 3ZHZA 1USKA 4URXR 5BO5A 4RMGA 4LCEA 1AGXA 3DT6A 1NRXA 3BWDD 3ELUA 4RFSB 5DM2A 1PUJA 1UODA 2WFZA 3SBOA 2XCRB 2DC1A 3RS7A 4F45A 3P4XA 1DCKA 2O8FA 1SXIA 3EVEA 3OTWA 1G9SA 1QRDA 3OAAA 2GPYA 5ALKA 2P5TB 5DNAA 3KQQA 5BQ5A 2ZRLA 5EUBA 4L8GA 1IB0A 3ANMA 4NV3A 4OLJA 4DXHA 2H4WA 2Z09A 5JC1A 3DCNA 2G6TA 5ILQA 2HZBA 4FNMA 5E95A 2XWBF 3W1WA 2CY0A 2VPZA 2Y99A 1YJ8A 1MH1A 3W2EA 1WRBA 1R6BX 1DQZA 3N1UA 1SCBA 1CVRA 1GT6A 1NWCA 1TX4B 4X00A 3TLCA 4R2KA 2N1BA 4L6AA 4L72A 5IKMA 1JDJA 4ZVMA 4XFJA 1Z2AA 2WAMA 4KYIB 2WV9A 1L9KA 3ETGA 2P9FA 4JBHA 2C2MA 4WFJA 2X6TA 1C5KA 1VKRA 4G5FA 3TXAA 1MJFA 2I2XB 4JGBA 4P2GA 3FRHA 4QDZA 2FEAA 4HO1X 5IM5A 2VSOA 1XDSA 2ZTSA 4J49A 1E20A 3FYUB 4BQRA 7YASA 2BAGA 2HPHA 3KWFA 4OXKA 1NDHA 4PGHA 1T5IA 3UGTA 1PQUA 3RBVA 2F3QA 3NCHA 2A3RA 2AXEA 1DRKA 1Y8QB 1CVLA 3IQEA 5G2OA 1F4VA 1ODLA 1T4CA 4Z2YA 3IOEA 2C5GA 4HNUA 1MAWA 3IKLA 3RADC 2UVPB 2QNBA 3L8DA 1BD3A 1NY6A 1T3HA 3W5JA 1FYWA 2W90A 2ZTHA 4TMXA 3RKUA 1FX0A 3IEXA 4KYVA 3RC1A 4EAAA 1I2MA 4QYXA 3TQCA 3QF7A 3PYMA 3AT1A 1O95A 2KLHA 3GH3A 4JLDA 4TSRA 4PAMA 3C39A 4D99A 3IX7A 2PKQO 5H1YA 3S2SA 2ZWPA 3SHWA 3DDHA 5IHPA 3K4HA 2RG1A 4WOPA 1GNQA 4AG6A 2HRQA 5AM4A 1M8PA 5CIQA 3SHTA 2REBA 1A95A 4A92A 2WIDA 2V9ZA 1HQDA 3NASA 2VQDA 1DG1G 1GZDA 1L5VA 3EDMA 1ZIYA 1NUSA 1P3DA 1Z15A 3MRVA 5AKXA 2I7XA 3EXFB 4OL0A 4BUJA 3FD8A 1OWOA 1HNWB 1GL6A 3CLSC 4P34A 1IPEA 5D86A 4YP7A 1Z7YA 1MH9A 2XJ9A 3UFXB 3CVUA 2FEWB 4MV7A 3UT0A 4BFLA 5FTNA 4EFKA 1I3OA 2ZJFA 3V55A 3W6PA 1R5JA 1X80B 1KC1A 3GUHA 2G70A 1PWYE 5L7YA 1HF3A 4AF7A 5BW4A 5HHTA 2IVZA 1NNLA 4HLCA 1QZUA 3MBOA 4A2WA 4C0JA 3ZWVA 1QIMA 1U0JA 2WKSA 3DM5A 2QY9A 5FA6A 4RXMA 1KKMA 5LYYA 1MZVA 4A0GA 1LJUA 1LS1A 4KXFB 4XWAA 2A0KA 2JGAA 2PZLA 3IPAA 1DJOA 4Q3BA 3LTEA 5IX8A 3I76A 5AVYA 3ROQA 3GVCA 1Y6FA 1V2GA 2HI0A 1JQKA 4IDCA 1Q1AA 2TECE 3BMNA 4OJYA 2Y1FA 1SXJC 2HV8A 1OI7A 4KPUB 2OHJA 1KIAA 2FLKA 3EDQA 3QPCA 5EP2A 1XMJA 1QR6A 3SX4A 1W7AA 2AUNA 2BR3A 4AZ0A 3H13A 4YJ3B 1QHYA 5JWRA 3KO8A 2Z08A 4J4TA 4FD2A 5D5PA 3P71T 1ESEA 2H0RA 1E5QA 4V3CA 3MSXA 3WB1A 3K0BA 4C3VA 4DCOA 5KOHA 4W4TA 1E6EA 2HWUA 1E1RD 4HWTA 5EMNA 1VPTA 3CZPA 1L3IA 2IY8A 2HA7A 4B7AA 2H1SA 2YZ7A 1VBMA 3G82C 3HV0A 3KAJA 4HGNA 4MTLA 4RF5A 4UMEA 1KY5A 2PRJA 2PN1A 2VUIB 3FPHA 3AI1A 2GJ8A 2XMCA 3FB1A 3L5OA 3BXZA 4OXNA 3QX7A 4E1VA 3PR1A 5H02A 3FNBA 2D1TA 1T8WA 2XEXA 5TT1A 1BD4A 2C29D 3B13B 4FT2A 4IO1A 3RJZA 3CW9A 3FWYA 2C7VA 5G0VA 2PIAA 3NYQA 4Q6WA 1JE0A 3TZKA 3TLGA 3HHEA 4GWKA 1VLQA 2OBLA 2J3QA 3L4BC 4EG7A 3ZC3A 3OURA 1U3DA 1QP8A 2VT6A 3H11B 3H9UA 3IIJA 1YU6A 4OMFG 4WK0B 4DJAA 2WR8A 1ZL0A 1OHHA 5CDFE 3UPTA 2CL6X 4Y1GA 2MSNA 3DWFA 3DZ8A 4P1ZA 5JXJA 1JLSA 1HTTA 3KVRA 4Q4AA 4KGDA 4UBNA 5E8JA 3F8WA 1KYXA 4TKUB 5FI5A 1JA9A 1NGSA 4W1RA 2O0LA 4LFCB 3VH1A 1WU8A 1O95D 1X1CA 1J7JA 1WVGA 4O4HA 4Y8VA 5ED4A 1JXOA 2QXUA 4RVUA 4I1SA 3GHYA 3ISVA 3DTVD 3SR4A 5JZVA 1N8NA 2JGLA 3LT0A 2I2BA 3RB8A 3WAJA 3RYTC 3GDHA 1Q3TA 4W63A 3RU7A 4RCYA 1S8NA 1CZRA 3FPAA 2BCEA 3B12A 4PINA 3QE2A 1JMVA 5F23A 3L41A 5DB4A 4CNQA 2PGOA 3HFGA 4DYDA 3OOWA 1FDVA 4MHOA 4OHBA 1UR5A 4QXRA 1I33A 1E6LA 1VMKA 2GN0A 1Z9BA 3DBOB 1KY4A 3FSGA 1PR5A 4BLOA 1KMHA 2Q9BA 1AQYA 3CNNA 3DZKA 1RIFA 5LXTA 5H70A 3R6GA 1BE6A 3S68A 5CB6A 4O1IA 1E0JA 5A9SA 5ALGA 4HWRA 4C7OB 4D82A 1M1NA 5JRDS 2V6FA 4Y2TA 1PW5A 1R0YA 2VJOA 4M7OA 4GXQA 4PYMA 4R9VA 4ROSA 5HK9A 4GKJB 4FYWA 4D0GA 4UAVA 2O3RA 4WFQA 3UC9A 2GUWA 3IAAA 3ZXYA 5DNUA 3S5UA 1NHWA 1ELOA 3WBJA 3M33A 3WYDA 3VOAA 1PZGA 1KOGA 1T2FA 4B5LA 4NENB 5DYGA 1PLJA 4PFKA 1GPDG 3F6EX 1ZIPA 4JC0A 1V9LA 1RJEA 5AK5A 2FFBA 1NFQA 2GZDA 2FLWA 4M0UA 4DLRA 2W7TA 3BEDA 2RGBA 4FCWA 4LISA 3HJHA 1KSJA 2FQWA 3DE4X 1GR0A 4P38A 1C4XA 2RKBA 5EXTA 3DAYA 5FQNA 3B52X 4E5KA 2EYUA 1LA2A 3D5TA 5AM5A 4GDMA 4LF6B 4RGQA 1J0AA 5CTJA 1YRBA 2XXAA 1KAQA 1S2NA 3UJ8A 1NXQA 5KTRA 4D25A 1DCTA 4NARA 1EPUA 4UQOA 4R69A 4V2IA 2IHYA 3NBXX 4M0LA 3WTBA 2H59A 3X3HA 2GXUA 3GYGA 1KQOA 5ESWA 2OMKA 1FDUA 1HC7A 1TUBB 1IMOA 2IITA 2PCJA 4JLWA 4M3NA 4L16A 1GCAA 3ZE0B 2NX2A 2RHLA 5D87A 4K8RB 3QY0A 2BMVA 4DBVO 4DQLA 3EODA 4KI0A 4QREA 5DT9A 4YRMA 2J87A 4ZYWA 2P69A 1RNLA 5D3QA 3WO1A 2H17A 3K1YA 4RA9A 3ZK7A 1I2BA 3ZV5A 7REQB 4HLQB 4YALA 4PTZA 2JD1A 4ECEA 1R5NA 3H5VA 3HN6A 3I9MA 5AKZA 1V0JA 4E2ZA 4QJBA 1PL8A 1DWUA 4TWBA 1CQPA 1H1DA 3B5EA 1M10A 4TMZA 1JWAB 1DCFA 2IYQA 3FUUA 3PGXA 3QKIA 4KXXA 4JMLA 4WMLA 5EE9A 1KARA 1ZINA 4H6XA 4YPOA 5ICFA 2XH8A 1Z0KA 4IG9A 4L5CA 1LLFA 2BR4A 1Z6TA 2NVOA 3SLRA 5BSWA 1X9GA 4N5LA 4NQRA 4P83A 2QUBA 3MS7A 4XUEA 4MV4A 1UWVA 1Y0BA 3AYXB 1Z4OA 2WHPA 4XXHA 4L4UA 3BCRA 1M2EA 5SY9A 1G3QA 1RLOA 2HMAA 3O7MA 5DRTA 4H59A 3TPFA 3TSOA 5TPWB 4NRDA 4V39A 1RP7A 5TJ9A 2P1DA 1X6VA 3STHA 4GZ5A 3CF0A 4ZZ0A 1HG1A 1QJ4A 4CLOB 3G0CA 3QVJA 1HE1C 4FDVA 5EE0A 3TBKA 4DW8A 4EEKA 5KEIA 4WKBA 4HNRA 1JB9A 1JPNA 3CR7A 1KO5A 1Q77A 3AHGA 2OK7A 3EFBA 4EGQA 4LQDA 5A5GA 1U28C 2NUAA 2BELA 3PQ6A 3KM0A 2OGTA 3Q0IA 3G5MA 2DFNA 4OJNA 3JR3A 5HQJA 3M6FA 2G04A 4LBWA 4XRGA 3UANA 3G79A 1YONA 1EFVA 1YQDA 1YL7A 3NHRA 5H0IA 4JC5A 1V5FA 4X7RA 3S2YA 4YJ2A 2RI6A 2OM2A 5FH9A 3UJ9A 4N5IX 5KNDD 3NP9A 4DCGA 2QQ5A 3IV9A 2O0MA 3ZHOA 3OCWA 2Y6UA 2JHAA 1J1IA 4FGWA 1ZCZA 2NO4A 1ZIXA 1GFWA 5E2IA 6GPBA 4TMWA 3DZFA 3W6ZA 2I6QA 2QN8A 1FYDA 2EQ5A 1KBOA 2A4KA 2O8FB 5IVHA 2XNJA 3UAWA 5K05A 1UC8A 3E22B 4AYXA 4CFSA 3I45A 3TG8A 3R74A 4AKIA 4KFRA 1Z17A 3I5AA 1GU7A 3WK9A 3ND6A 2ZYDA 2H4YA 1SUIA 3FNRA 2OG2A 1TK3A 2I2AA 4BNIA 2VXOA 1EDOA 3PC2A 1T35A 1UPTA 4AIIA