3KWCA

Oxidized, active structure of the beta-carboxysomal gamma-carbonic anhydrase, ccmm
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
205
structure length
205
Chain Sequence
QSYAAPPTPWSRDLAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVVGINEALLSGYQCAENIACIAPIRNEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon dioxide concentrating mechanism protein
publication title Structural basis of the oxidative activation of the carboxysomal {gamma}-carbonic anhydrase, CcmM.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Lyase, protein binding, photosynthesis
total genus 77
structure length 205
sequence length 205
chains with identical sequence B, C, D, E, F
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3kwcA00
4K6RA 3R1WA 2V0IA 2IUAA 1QREA 5F42A 4J18A 2NPOA 3VBLA 4E6UA 1J2ZA 4HURA 5ADXV 1QQ0A 1XHDA 2JF3A 4N27A 3I3AA 2V0KA 3OW5A 4HZDA 2V0LA 1OCXA 4EAAA 1KK5A 2OEFA 2IC7A 3ST8A 2WLDA 2W0VA 3BFPA 3D8VA 4KQLA 3BXYA 3R3IA 4HUSA 5AFUU 3TISA 3VBMA 3FSYA 3V4EA 4AA7A 4G3PA 2ICXA 3SRTA 3TDTA 3GVDA 1YP2A 4IHHA 4EA9A 2VHEA 3MC4A 1YP4A 2W0WA 1SSTA 3FOQA 4FCEA 2TDTA 1Z90A 2ICYA 3IGJA 3T57A 3OTZA 4ISXA 1V67A 2WLCA 5DG3A 3D98A 3HJJA 1MRLA 4KNXA 4EQYA 3IXCA 2AQ9A 1KQAA 3EEVA 2Q4JA 4IHFA 3DK5A 1QRGA 4KNRA 2QIVX 2OI5A 4M2AA 2WLEA 3TWDA 3VBPA 3MQHA 4N6BA 3VNPA 2V0HA 3DHOA 3FSXA 4KPZA 1HM0A 1THJA 3OU9A 1QRFA 4MYOA 5AFUV 4M98A 3HSQA 4R37A 1QRMA 4E79A 3R5BA 3TIOA 3VBNA 4M9CA 1XATA 1KHRA 3KWEA 1QRLA 4N69A 1S80A 1MR9A 1YP3A 3FSCA 2QKXA 3R8YA 3OTMA 4M2BA 1KRRA 2GGOA 3CJ8A 2GGQA 3VBIA 4E6TA 1KRVA 3VBKA 2QIAA 4EA7A 1KRUA 3R5DA 5E3PA 5DEMA 3Q1XA 4E75A 1KK4A 3I3XA 4M28A 3BSYA 1T3DA 2JF2A 2V0JA 3FSBA 4EABA 3P47A 3EH0A 4MFGA 3R5CA 4G3QA 4DCLA 3P1BA 4EA8A 3FWWA 3TK8A 4HZCA 3R0SA 4G87A 2I5KA 2IU8A 1LXAA 3R5AA 4HCQA 4J09A 3KWCA 4E1KA 2P2OA 1G97A 5L6SA 2XATA 1FWYA 1G95A 5E3QA 1HV9A 4R36A 3TV0A 3OUPA 3JQYA 4G3SA 4R7PA 5ADXU 4H7OA 2WLGA 3DJ4A 4AAWA 3ECTA 2FKOA 5U2KA 3C8VA 3FS8A 3KWDA 2VD4A 2WLFA 3BSSA 3R3RA 3SPTA 1KK6A 1SSQA 2OI6A 3R2WA 4AC3A 1SSMA 1KGTA 3BRKX 3F1XA 4KPXA 5E3RA 3VBJA 3FTTA 5L6VA 2OEGA 4EGGA 2IU9A 2RIJA 3GOSA 4MZUA 3PMOA 4M99A 3NZ2A 3BSWA 2OI7A 3GUEA 4N6AA 1TDTA 1FXJA 5DEPA 3EG4A 1V3WA 1HM8A 3MQGA 1MR7A 1HM9A 1KGQA 4IHGA
chains in the Genus database with same CATH superfamily
4K6RA 3R1WA 2V0IA 2IUAA 1QREA 5F42A 4J18A 2NPOA 3OH1A 3VBLA 4E6UA 1J2ZA 4HURA 5ADXV 1QQ0A 1XHDA 2JF3A 4N27A 3I3AA 2V0KA 3OW5A 4HZDA 2V0LA 1OCXA 4EAAA 1KK5A 2OEFA 2IC7A 3ST8A 2WLDA 2W0VA 3BFPA 3D8VA 4KQLA 3BXYA 3R3IA 4HUSA 5AFUU 3TISA 3VBMA 3FSYA 3V4EA 4AA7A 4G3PA 2ICXA 3SRTA 3TDTA 3OH0A 3GVDA 1YP2A 4IHHA 4EA9A 2VHEA 3MC4A 1YP4A 2W0WA 1SSTA 3FOQA 4FCEA 2TDTA 1Z90A 2ICYA 3IGJA 3T57A 3OTZA 4ISXA 1V67A 2WLCA 5DG3A 3D98A 3HJJA 1MRLA 4KNXA 4EQYA 3IXCA 2AQ9A 1KQAA 3EEVA 2Q4JA 4IHFA 3DK5A 3GQ7A 1QRGA 4KNRA 2QIVX 2OI5A 4M2AA 2WLEA 3TWDA 3VBPA 3MQHA 4N6BA 3VNPA 2V0HA 3OGZA 3DHOA 3FSXA 4KPZA 1HM0A 1THJA 3OU9A 1QRFA 3OH3A 4MYOA 5AFUV 4M98A 3SUCA 3HSQA 4R37A 1QRMA 3OH4A 4E79A 3R5BA 1N4IA 3TIOA 3OH2A 3VBNA 4M9CA 1XATA 1KHRA 3KWEA 1QRLA 4N69A 1S80A 1MR9A 1YP3A 3FSCA 2QKXA 3R8YA 3OTMA 4M2BA 1KRRA 2GGOA 3CJ8A 2GGQA 3VBIA 4E6TA 1KRVA 3VBKA 2QIAA 4EA7A 1KRUA 3R5DA 5E3PA 5DEMA 3Q1XA 4E75A 1KK4A 3I3XA 4M28A 3BSYA 1T3DA 2JF2A 2V0JA 3FSBA 3GQ8A 4EABA 3P47A 3EH0A 4MFGA 3GQ9A 3R5CA 4G3QA 4DCLA 3P1BA 4EA8A 3FWWA 3TK8A 4HZCA 3R0SA 4G87A 2I5KA 2IU8A 1LXAA 1Z2FA 3R5AA 4HCQA 4J09A 3KWCA 4E1KA 2P2OA 1G97A 5L6SA 2XATA 1FWYA 1G95A 5E3QA 1HV9A 4R36A 3TV0A 3OUPA 1M8NA 3JQYA 4G3SA 4R7PA 5ADXU 4H7OA 2WLGA 3DJ4A 4AAWA 3ECTA 2FKOA 5U2KA 3C8VA 3FS8A 3KWDA 2VD4A 2WLFA 1L0SA 3BSSA 3R3RA 1KK6A 3SPTA 1SSQA 2OI6A 3R2WA 4AC3A 1SSMA 1KGTA 3BRKX 3F1XA 3GQAA 4KPXA 5E3RA 3VBJA 3FTTA 5L6VA 2OEGA 4EGGA 2IU9A 2RIJA 3GOSA 4MZUA 3PMOA 4M99A 3NZ2A 1EWWA 3BSWA 2OI7A 3GUEA 4N6AA 1TDTA 1FXJA 5DEPA 3EG4A 1V3WA 1HM8A 3MQGA 1MR7A 1HM9A 1KGQA 4IHGA
chains in the Genus database with same CATH topology
4K6RA 3R1WA 2V0IA 2IUAA 1QREA 5F42A 4J18A 2NPOA 3VBLA 4E6UA 1J2ZA 4HURA 5ADXV 1QQ0A 1XHDA 2JF3A 4N27A 3I3AA 2V0KA 3OW5A 4HZDA 2V0LA 1OCXA 4EAAA 1KK5A 2OEFA 2IC7A 3ST8A 2WLDA 2W0VA 3BFPA 3D8VA 4KQLA 3BXYA 3R3IA 4HUSA 5AFUU 3TISA 3VBMA 3FSYA 3V4EA 4AA7A 4G3PA 2ICXA 3SRTA 3TDTA 3GVDA 1YP2A 4IHHA 4EA9A 2VHEA 3MC4A 1YP4A 2W0WA 1SSTA 3FOQA 4FCEA 2TDTA 1Z90A 2ICYA 3IGJA 3T57A 3OTZA 4ISXA 1V67A 2WLCA 5DG3A 3D98A 3HJJA 1MRLA 4KNXA 4EQYA 3IXCA 2AQ9A 1KQAA 3EEVA 2Q4JA 4IHFA 3DK5A 1QRGA 4KNRA 2QIVX 2OI5A 4M2AA 2WLEA 3TWDA 3VBPA 3MQHA 4N6BA 3VNPA 2V0HA 3DHOA 3FSXA 4KPZA 1HM0A 1THJA 3OU9A 1QRFA 4MYOA 5AFUV 4M98A 3HSQA 4R37A 1QRMA 4E79A 3R5BA 3TIOA 3VBNA 4M9CA 1XATA 1KHRA 3KWEA 1QRLA 4N69A 1S80A 1MR9A 1YP3A 3FSCA 2QKXA 3R8YA 3OTMA 4M2BA 1KRRA 2GGOA 3CJ8A 2GGQA 3VBIA 4E6TA 1KRVA 3VBKA 2QIAA 4EA7A 1KRUA 3R5DA 5E3PA 5DEMA 3Q1XA 4E75A 1KK4A 3I3XA 4M28A 3BSYA 1T3DA 2JF2A 2V0JA 3FSBA 4EABA 3P47A 3EH0A 4MFGA 3R5CA 4G3QA 4DCLA 3P1BA 4EA8A 3FWWA 3TK8A 4HZCA 3R0SA 4G87A 2I5KA 2IU8A 1LXAA 3R5AA 4HCQA 4J09A 3KWCA 4E1KA 2P2OA 1G97A 5L6SA 2XATA 1FWYA 1G95A 5E3QA 1HV9A 4R36A 3TV0A 3OUPA 3JQYA 4G3SA 4R7PA 5ADXU 4H7OA 2WLGA 3DJ4A 4AAWA 3ECTA 2FKOA 5U2KA 3C8VA 3FS8A 3KWDA 2VD4A 2WLFA 3BSSA 3R3RA 3SPTA 1KK6A 1SSQA 2OI6A 3R2WA 4AC3A 1SSMA 1KGTA 3BRKX 3F1XA 4KPXA 5E3RA 3VBJA 3FTTA 5L6VA 2OEGA 4EGGA 2IU9A 2RIJA 3GOSA 4MZUA 3PMOA 4M99A 3NZ2A 3BSWA 2OI7A 3GUEA 4N6AA 1TDTA 1FXJA 5DEPA 3EG4A 1V3WA 1HM8A 3MQGA 1MR7A 1HM9A 1KGQA 4IHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K6R A;  3R1W A;  2V0I A;  2IUA A;  1QRE A;  5F42 A;  4J18 A;  2NPO A;  3VBL A;  4E6U A;  1J2Z A;  4HUR A;  5ADX V;  1QQ0 A;  1XHD A;  2JF3 A;  4N27 A;  3I3A A;  2V0K A;  3OW5 A;  4HZD A;  2V0L A;  1OCX A;  4EAA A;  1KK5 A;  2OEF A;  2IC7 A;  3ST8 A;  2WLD A;  2W0V A;  3BFP A;  3D8V A;  4KQL A;  3BXY A;  3R3I A;  4HUS A;  5AFU U;  3TIS A;  3VBM A;  3FSY A;  3V4E A;  4AA7 A;  4G3P A;  2ICX A;  3SRT A;  3TDT A;  3GVD A;  1YP2 A;  4IHH A;  4EA9 A;  2VHE A;  3MC4 A;  1YP4 A;  2W0W A;  1SST A;  3FOQ A;  4FCE A;  2TDT A;  1Z90 A;  2ICY A;  3IGJ A;  3T57 A;  3OTZ A;  4ISX A;  1V67 A;  2WLC A;  5DG3 A;  3D98 A;  3HJJ A;  1MRL A;  4KNX A;  4EQY A;  3IXC A;  2AQ9 A;  1KQA A;  3EEV A;  2Q4J A;  4IHF A;  3DK5 A;  1QRG A;  4KNR A;  2QIV X;  2OI5 A;  4M2A A;  2WLE A;  3TWD A;  3VBP A;  3MQH A;  4N6B A;  3VNP A;  2V0H A;  3DHO A;  3FSX A;  4KPZ A;  1HM0 A;  1THJ A;  3OU9 A;  1QRF A;  4MYO A;  5AFU V;  4M98 A;  3HSQ A;  4R37 A;  1QRM A;  4E79 A;  3R5B A;  3TIO A;  3VBN A;  4M9C A;  1XAT A;  1KHR A;  3KWE A;  1QRL A;  4N69 A;  1S80 A;  1MR9 A;  1YP3 A;  3FSC A;  2QKX A;  3R8Y A;  3OTM A;  4M2B A;  1KRR A;  2GGO A;  3CJ8 A;  2GGQ A;  3VBI A;  4E6T A;  1KRV A;  3VBK A;  2QIA A;  4EA7 A;  1KRU A;  3R5D A;  5E3P A;  5DEM A;  3Q1X A;  4E75 A;  1KK4 A;  3I3X A;  4M28 A;  3BSY A;  1T3D A;  2JF2 A;  2V0J A;  3FSB A;  4EAB A;  3P47 A;  3EH0 A;  4MFG A;  3R5C A;  4G3Q A;  4DCL A;  3P1B A;  4EA8 A;  3FWW A;  3TK8 A;  4HZC A;  3R0S A;  4G87 A;  2I5K A;  2IU8 A;  1LXA A;  3R5A A;  4HCQ A;  4J09 A;  3KWC A;  4E1K A;  2P2O A;  1G97 A;  5L6S A;  2XAT A;  1FWY A;  1G95 A;  5E3Q A;  1HV9 A;  4R36 A;  3TV0 A;  3OUP A;  3JQY A;  4G3S A;  4R7P A;  5ADX U;  4H7O A;  2WLG A;  3DJ4 A;  4AAW A;  3ECT A;  2FKO A;  5U2K A;  3C8V A;  3FS8 A;  3KWD A;  2VD4 A;  2WLF A;  3BSS A;  3R3R A;  3SPT A;  1KK6 A;  1SSQ A;  2OI6 A;  3R2W A;  4AC3 A;  1SSM A;  1KGT A;  3BRK X;  3F1X A;  4KPX A;  5E3R A;  3VBJ A;  3FTT A;  5L6V A;  2OEG A;  4EGG A;  2IU9 A;  2RIJ A;  3GOS A;  4MZU A;  3PMO A;  4M99 A;  3NZ2 A;  3BSW A;  2OI7 A;  3GUE A;  4N6A A;  1TDT A;  1FXJ A;  5DEP A;  3EG4 A;  1V3W A;  1HM8 A;  3MQG A;  1MR7 A;  1HM9 A;  1KGQ A;  4IHG A; 
#chains in the Genus database with same CATH topology
 4K6R A;  3R1W A;  2V0I A;  2IUA A;  1QRE A;  5F42 A;  4J18 A;  2NPO A;  3OH1 A;  3VBL A;  4E6U A;  1J2Z A;  4HUR A;  5ADX V;  1QQ0 A;  1XHD A;  2JF3 A;  4N27 A;  3I3A A;  2V0K A;  3OW5 A;  4HZD A;  2V0L A;  1OCX A;  4EAA A;  1KK5 A;  2OEF A;  2IC7 A;  3ST8 A;  2WLD A;  2W0V A;  3BFP A;  3D8V A;  4KQL A;  3BXY A;  3R3I A;  4HUS A;  5AFU U;  3TIS A;  3VBM A;  3FSY A;  3V4E A;  4AA7 A;  4G3P A;  2ICX A;  3SRT A;  3TDT A;  3OH0 A;  3GVD A;  1YP2 A;  4IHH A;  4EA9 A;  2VHE A;  3MC4 A;  1YP4 A;  2W0W A;  1SST A;  3FOQ A;  4FCE A;  2TDT A;  1Z90 A;  2ICY A;  3IGJ A;  3T57 A;  3OTZ A;  4ISX A;  1V67 A;  2WLC A;  5DG3 A;  3D98 A;  3HJJ A;  1MRL A;  4KNX A;  4EQY A;  3IXC A;  2AQ9 A;  1KQA A;  3EEV A;  2Q4J A;  4IHF A;  3DK5 A;  3GQ7 A;  1QRG A;  4KNR A;  2QIV X;  2OI5 A;  4M2A A;  2WLE A;  3TWD A;  3VBP A;  3MQH A;  4N6B A;  3VNP A;  2V0H A;  3OGZ A;  3DHO A;  3FSX A;  4KPZ A;  1HM0 A;  1THJ A;  3OU9 A;  1QRF A;  3OH3 A;  4MYO A;  5AFU V;  4M98 A;  3SUC A;  3HSQ A;  4R37 A;  1QRM A;  3OH4 A;  4E79 A;  3R5B A;  1N4I A;  3TIO A;  3OH2 A;  3VBN A;  4M9C A;  1XAT A;  1KHR A;  3KWE A;  1QRL A;  4N69 A;  1S80 A;  1MR9 A;  1YP3 A;  3FSC A;  2QKX A;  3R8Y A;  3OTM A;  4M2B A;  1KRR A;  2GGO A;  3CJ8 A;  2GGQ A;  3VBI A;  4E6T A;  1KRV A;  3VBK A;  2QIA A;  4EA7 A;  1KRU A;  3R5D A;  5E3P A;  5DEM A;  3Q1X A;  4E75 A;  1KK4 A;  3I3X A;  4M28 A;  3BSY A;  1T3D A;  2JF2 A;  2V0J A;  3FSB A;  3GQ8 A;  4EAB A;  3P47 A;  3EH0 A;  4MFG A;  3GQ9 A;  3R5C A;  4G3Q A;  4DCL A;  3P1B A;  4EA8 A;  3FWW A;  3TK8 A;  4HZC A;  3R0S A;  4G87 A;  2I5K A;  2IU8 A;  1LXA A;  1Z2F A;  3R5A A;  4HCQ A;  4J09 A;  3KWC A;  4E1K A;  2P2O A;  1G97 A;  5L6S A;  2XAT A;  1FWY A;  1G95 A;  5E3Q A;  1HV9 A;  4R36 A;  3TV0 A;  3OUP A;  1M8N A;  3JQY A;  4G3S A;  4R7P A;  5ADX U;  4H7O A;  2WLG A;  3DJ4 A;  4AAW A;  3ECT A;  2FKO A;  5U2K A;  3C8V A;  3FS8 A;  3KWD A;  2VD4 A;  2WLF A;  1L0S A;  3BSS A;  3R3R A;  1KK6 A;  3SPT A;  1SSQ A;  2OI6 A;  3R2W A;  4AC3 A;  1SSM A;  1KGT A;  3BRK X;  3F1X A;  3GQA A;  4KPX A;  5E3R A;  3VBJ A;  3FTT A;  5L6V A;  2OEG A;  4EGG A;  2IU9 A;  2RIJ A;  3GOS A;  4MZU A;  3PMO A;  4M99 A;  3NZ2 A;  1EWW A;  3BSW A;  2OI7 A;  3GUE A;  4N6A A;  1TDT A;  1FXJ A;  5DEP A;  3EG4 A;  1V3W A;  1HM8 A;  3MQG A;  1MR7 A;  1HM9 A;  1KGQ A;  4IHG A; 
#chains in the Genus database with same CATH homology
 4K6R A;  3R1W A;  2V0I A;  2IUA A;  1QRE A;  5F42 A;  4J18 A;  2NPO A;  3VBL A;  4E6U A;  1J2Z A;  4HUR A;  5ADX V;  1QQ0 A;  1XHD A;  2JF3 A;  4N27 A;  3I3A A;  2V0K A;  3OW5 A;  4HZD A;  2V0L A;  1OCX A;  4EAA A;  1KK5 A;  2OEF A;  2IC7 A;  3ST8 A;  2WLD A;  2W0V A;  3BFP A;  3D8V A;  4KQL A;  3BXY A;  3R3I A;  4HUS A;  5AFU U;  3TIS A;  3VBM A;  3FSY A;  3V4E A;  4AA7 A;  4G3P A;  2ICX A;  3SRT A;  3TDT A;  3GVD A;  1YP2 A;  4IHH A;  4EA9 A;  2VHE A;  3MC4 A;  1YP4 A;  2W0W A;  1SST A;  3FOQ A;  4FCE A;  2TDT A;  1Z90 A;  2ICY A;  3IGJ A;  3T57 A;  3OTZ A;  4ISX A;  1V67 A;  2WLC A;  5DG3 A;  3D98 A;  3HJJ A;  1MRL A;  4KNX A;  4EQY A;  3IXC A;  2AQ9 A;  1KQA A;  3EEV A;  2Q4J A;  4IHF A;  3DK5 A;  1QRG A;  4KNR A;  2QIV X;  2OI5 A;  4M2A A;  2WLE A;  3TWD A;  3VBP A;  3MQH A;  4N6B A;  3VNP A;  2V0H A;  3DHO A;  3FSX A;  4KPZ A;  1HM0 A;  1THJ A;  3OU9 A;  1QRF A;  4MYO A;  5AFU V;  4M98 A;  3HSQ A;  4R37 A;  1QRM A;  4E79 A;  3R5B A;  3TIO A;  3VBN A;  4M9C A;  1XAT A;  1KHR A;  3KWE A;  1QRL A;  4N69 A;  1S80 A;  1MR9 A;  1YP3 A;  3FSC A;  2QKX A;  3R8Y A;  3OTM A;  4M2B A;  1KRR A;  2GGO A;  3CJ8 A;  2GGQ A;  3VBI A;  4E6T A;  1KRV A;  3VBK A;  2QIA A;  4EA7 A;  1KRU A;  3R5D A;  5E3P A;  5DEM A;  3Q1X A;  4E75 A;  1KK4 A;  3I3X A;  4M28 A;  3BSY A;  1T3D A;  2JF2 A;  2V0J A;  3FSB A;  4EAB A;  3P47 A;  3EH0 A;  4MFG A;  3R5C A;  4G3Q A;  4DCL A;  3P1B A;  4EA8 A;  3FWW A;  3TK8 A;  4HZC A;  3R0S A;  4G87 A;  2I5K A;  2IU8 A;  1LXA A;  3R5A A;  4HCQ A;  4J09 A;  3KWC A;  4E1K A;  2P2O A;  1G97 A;  5L6S A;  2XAT A;  1FWY A;  1G95 A;  5E3Q A;  1HV9 A;  4R36 A;  3TV0 A;  3OUP A;  3JQY A;  4G3S A;  4R7P A;  5ADX U;  4H7O A;  2WLG A;  3DJ4 A;  4AAW A;  3ECT A;  2FKO A;  5U2K A;  3C8V A;  3FS8 A;  3KWD A;  2VD4 A;  2WLF A;  3BSS A;  3R3R A;  3SPT A;  1KK6 A;  1SSQ A;  2OI6 A;  3R2W A;  4AC3 A;  1SSM A;  1KGT A;  3BRK X;  3F1X A;  4KPX A;  5E3R A;  3VBJ A;  3FTT A;  5L6V A;  2OEG A;  4EGG A;  2IU9 A;  2RIJ A;  3GOS A;  4MZU A;  3PMO A;  4M99 A;  3NZ2 A;  3BSW A;  2OI7 A;  3GUE A;  4N6A A;  1TDT A;  1FXJ A;  5DEP A;  3EG4 A;  1V3W A;  1HM8 A;  3MQG A;  1MR7 A;  1HM9 A;  1KGQ A;  4IHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...