3KWEA

Inactive truncation of the beta-carboxysomal gamma-carbonic anhydrase, ccmm, form 2
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
LAEPEIAPTAYVHSFSNLIGDVRIKDYVHIAPGTSIRADEGTPFHIGSRTNIQDGVVIHGLQQGRVIGDDGQEYSVWIGDNVSITHMALIHGPAYIGDGCFIGFRSTVFNARVGAGCVVMMHVLIQDVEIPPGKYVPSGMVITTQQQADRLPNVEESDIHFAQHVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the oxidative activation of the carboxysomal {gamma}-carbonic anhydrase, CcmM.
pubmed doi rcsb
source organism Thermosynechococcus elongatus
molecule tags Lyase, protein binding, photosynthesis
molecule keywords Carbon dioxide concentrating mechanism protein
total genus 64
structure length 166
sequence length 166
ec nomenclature ec 4.2.1.1: Carbonic anhydrase.
pdb deposition date 2009-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3kweA00
5AFUV 1QRGA 4M28A 3DHOA 4EABA 1QRFA 3T57A 3TV0A 5E3QA 4AC3A 1YP4A 1LXAA 4J09A 3BSYA 4IHHA 3VBLA 2W0VA 3BRKX 4EQYA 1QQ0A 4E75A 2RIJA 2WLEA 2I5KA 1MR7A 3D8VA 4MZUA 4J18A 3FWWA 3MC4A 2TDTA 4HZDA 1HM0A 2WLGA 1SSTA 3EH0A 4E79A 2VHEA 1HV9A 2IC7A 3OW5A 2OEGA 1KQAA 3FTTA 3SPTA 4E6UA 3FS8A 4HURA 2IU8A 1SSMA 4N69A 2WLDA 4KPZA 4M2AA 3OTMA 1QRLA 3R2WA 1G97A 3CJ8A 3TISA 1YP2A 5ADXV 5L6VA 4EA7A 2GGOA 2GGQA 1V67A 3MQGA 1KGQA 2ICXA 3Q1XA 4R37A 4DCLA 2WLFA 4H7OA 4E6TA 2IUAA 1QRMA 2P2OA 3D98A 4AAWA 3FSXA 3NZ2A 3TK8A 3R3RA 5L6SA 5E3RA 2V0LA 3V4EA 3KWCA 3VBJA 1SSQA 4E1KA 4HUSA 1FWYA 4EA9A 1S80A 3R5DA 4IHGA 3JQYA 4R36A 4EA8A 1KRRA 3PMOA 4HZCA 4KPXA 3P1BA 2XATA 4EGGA 4IHFA 4R7PA 3VBPA 3BFPA 4N27A 5AFUU 3I3AA 1HM8A 3GVDA 4K6RA 2AQ9A 3TWDA 5F42A 4ISXA 3VNPA 1KHRA 2OI5A 1OCXA 1QREA 3BSWA 1XATA 2V0KA 2QIAA 3GOSA 4M98A 3GUEA 3FSYA 2IU9A 5E3PA 2OEFA 2Q4JA 3ST8A 4KNRA 2QKXA 3IXCA 4KQLA 4N6AA 3I3XA 3FSCA 5DEPA 1Z90A 1KRUA 4M9CA 4AA7A 4G3PA 3R1WA 3OTZA 4HCQA 3F1XA 3HJJA 2QIVX 3C8VA 3R5BA 2FKOA 2OI7A 3OUPA 2V0HA 1J2ZA 3VBIA 5ADXU 2WLCA 3BXYA 3P47A 3R8YA 4M2BA 3FOQA 5DEMA 1FXJA 1TDTA 3TIOA 1T3DA 3OU9A 3R3IA 3TDTA 1MR9A 1XHDA 2W0WA 3HSQA 5DG3A 1KRVA 5U2KA 1V3WA 3SRTA 3KWDA 1HM9A 2JF3A 2V0JA 3VBNA 1MRLA 2JF2A 1G95A 1KK5A 1THJA 3ECTA 4FCEA 2VD4A 3IGJA 4G87A 3FSBA 4KNXA 1KGTA 3MQHA 3VBMA 3DJ4A 3VBKA 2OI6A 4N6BA 2V0IA 3R5CA 1YP3A 3DK5A 3EG4A 2ICYA 4MFGA 1KK4A 4G3SA 1KK6A 2NPOA 3EEVA 3R5AA 4M99A 3KWEA 4MYOA 4EAAA 3R0SA 4G3QA 3BSSA
chains in the Genus database with same CATH superfamily
5AFUV 1QRGA 4M28A 3DHOA 4EABA 1QRFA 3T57A 3TV0A 5E3QA 4AC3A 1YP4A 1LXAA 4J09A 3BSYA 4IHHA 3VBLA 2W0VA 3BRKX 4EQYA 1QQ0A 4E75A 2RIJA 2WLEA 2I5KA 1MR7A 3D8VA 4MZUA 4J18A 3FWWA 3MC4A 2TDTA 4HZDA 3OH3A 1HM0A 2WLGA 1SSTA 3EH0A 4E79A 2VHEA 1HV9A 2IC7A 3OW5A 2OEGA 1KQAA 3FTTA 3SPTA 4E6UA 3FS8A 4HURA 2IU8A 1SSMA 1L0SA 4N69A 2WLDA 4KPZA 4M2AA 3OTMA 1QRLA 3R2WA 1G97A 3CJ8A 3OH0A 3TISA 1YP2A 5ADXV 5L6VA 4EA7A 2GGOA 2GGQA 1V67A 3MQGA 1KGQA 2ICXA 3Q1XA 4R37A 4DCLA 2WLFA 4H7OA 4E6TA 2IUAA 1QRMA 2P2OA 1N4IA 3D98A 4AAWA 3FSXA 3NZ2A 3GQ9A 3TK8A 3R3RA 5L6SA 5E3RA 2V0LA 3V4EA 3KWCA 3VBJA 1SSQA 4E1KA 4HUSA 1FWYA 4EA9A 1S80A 3R5DA 4IHGA 3JQYA 4R36A 4EA8A 1KRRA 3PMOA 4HZCA 1M8NA 4KPXA 3P1BA 2XATA 4EGGA 4IHFA 3GQAA 3GQ7A 4R7PA 1Z2FA 3VBPA 3BFPA 4N27A 5AFUU 3I3AA 1HM8A 3GVDA 4K6RA 2AQ9A 3TWDA 5F42A 4ISXA 3VNPA 1KHRA 2OI5A 1OCXA 1QREA 3BSWA 1XATA 2V0KA 2QIAA 3GOSA 4M98A 3SUCA 3GUEA 3FSYA 2IU9A 5E3PA 2OEFA 2Q4JA 3ST8A 4KNRA 2QKXA 3IXCA 4KQLA 3OH2A 3I3XA 4N6AA 3FSCA 5DEPA 1Z90A 1KRUA 4M9CA 4AA7A 4G3PA 3R1WA 3OTZA 3OH4A 4HCQA 3F1XA 3HJJA 2QIVX 3C8VA 3R5BA 2FKOA 2OI7A 3OUPA 2V0HA 1J2ZA 3VBIA 5ADXU 2WLCA 3BXYA 3OH1A 3P47A 3R8YA 4M2BA 1EWWA 3FOQA 5DEMA 1FXJA 1TDTA 3TIOA 3GQ8A 1T3DA 3OU9A 3R3IA 3TDTA 1MR9A 1XHDA 2W0WA 3HSQA 5DG3A 1KRVA 5U2KA 1V3WA 3SRTA 3KWDA 1HM9A 2JF3A 2V0JA 3VBNA 1MRLA 2JF2A 1G95A 1KK5A 1THJA 3ECTA 4FCEA 2VD4A 3IGJA 4G87A 3FSBA 4KNXA 1KGTA 3MQHA 3VBMA 3DJ4A 3VBKA 2OI6A 4N6BA 2V0IA 3R5CA 1YP3A 3DK5A 3EG4A 3OGZA 2ICYA 4MFGA 1KK4A 4G3SA 1KK6A 2NPOA 3EEVA 3R5AA 4M99A 3KWEA 4MYOA 4EAAA 3R0SA 4G3QA 3BSSA
chains in the Genus database with same CATH topology
5AFUV 1QRGA 4M28A 3DHOA 4EABA 1QRFA 3T57A 3TV0A 5E3QA 4AC3A 1YP4A 1LXAA 4J09A 3BSYA 4IHHA 3VBLA 2W0VA 3BRKX 4EQYA 1QQ0A 4E75A 2RIJA 2WLEA 2I5KA 1MR7A 3D8VA 4MZUA 4J18A 3FWWA 3MC4A 2TDTA 4HZDA 1HM0A 2WLGA 1SSTA 3EH0A 4E79A 2VHEA 1HV9A 2IC7A 3OW5A 2OEGA 1KQAA 3FTTA 3SPTA 4E6UA 3FS8A 4HURA 2IU8A 1SSMA 4N69A 2WLDA 4KPZA 4M2AA 3OTMA 1QRLA 3R2WA 1G97A 3CJ8A 3TISA 1YP2A 5ADXV 5L6VA 4EA7A 2GGOA 2GGQA 1V67A 3MQGA 1KGQA 2ICXA 3Q1XA 4R37A 4DCLA 2WLFA 4H7OA 4E6TA 2IUAA 1QRMA 2P2OA 3D98A 4AAWA 3FSXA 3NZ2A 3TK8A 3R3RA 5L6SA 5E3RA 2V0LA 3V4EA 3KWCA 3VBJA 1SSQA 4E1KA 4HUSA 1FWYA 4EA9A 1S80A 3R5DA 4IHGA 3JQYA 4R36A 4EA8A 1KRRA 3PMOA 4HZCA 4KPXA 3P1BA 2XATA 4EGGA 4IHFA 4R7PA 3VBPA 3BFPA 4N27A 5AFUU 3I3AA 1HM8A 3GVDA 4K6RA 2AQ9A 3TWDA 5F42A 4ISXA 3VNPA 1KHRA 2OI5A 1OCXA 1QREA 3BSWA 1XATA 2V0KA 2QIAA 3GOSA 4M98A 3GUEA 3FSYA 2IU9A 5E3PA 2OEFA 2Q4JA 3ST8A 4KNRA 2QKXA 3IXCA 4KQLA 4N6AA 3I3XA 3FSCA 5DEPA 1Z90A 1KRUA 4M9CA 4AA7A 4G3PA 3R1WA 3OTZA 4HCQA 3F1XA 3HJJA 2QIVX 3C8VA 3R5BA 2FKOA 2OI7A 3OUPA 2V0HA 1J2ZA 3VBIA 5ADXU 2WLCA 3BXYA 3P47A 3R8YA 4M2BA 3FOQA 5DEMA 1FXJA 1TDTA 3TIOA 1T3DA 3OU9A 3R3IA 3TDTA 1MR9A 1XHDA 2W0WA 3HSQA 5DG3A 1KRVA 5U2KA 1V3WA 3SRTA 3KWDA 1HM9A 2JF3A 2V0JA 3VBNA 1MRLA 2JF2A 1G95A 1KK5A 1THJA 3ECTA 4FCEA 2VD4A 3IGJA 4G87A 3FSBA 4KNXA 1KGTA 3MQHA 3VBMA 3DJ4A 3VBKA 2OI6A 4N6BA 2V0IA 3R5CA 1YP3A 3DK5A 3EG4A 2ICYA 4MFGA 1KK4A 4G3SA 1KK6A 2NPOA 3EEVA 3R5AA 4M99A 3KWEA 4MYOA 4EAAA 3R0SA 4G3QA 3BSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU V;  1QRG A;  4M28 A;  3DHO A;  4EAB A;  1QRF A;  3T57 A;  3TV0 A;  5E3Q A;  4AC3 A;  1YP4 A;  1LXA A;  4J09 A;  3BSY A;  4IHH A;  3VBL A;  2W0V A;  3BRK X;  4EQY A;  1QQ0 A;  4E75 A;  2RIJ A;  2WLE A;  2I5K A;  1MR7 A;  3D8V A;  4MZU A;  4J18 A;  3FWW A;  3MC4 A;  2TDT A;  4HZD A;  1HM0 A;  2WLG A;  1SST A;  3EH0 A;  4E79 A;  2VHE A;  1HV9 A;  2IC7 A;  3OW5 A;  2OEG A;  1KQA A;  3FTT A;  3SPT A;  4E6U A;  3FS8 A;  4HUR A;  2IU8 A;  1SSM A;  4N69 A;  2WLD A;  4KPZ A;  4M2A A;  3OTM A;  1QRL A;  3R2W A;  1G97 A;  3CJ8 A;  3TIS A;  1YP2 A;  5ADX V;  5L6V A;  4EA7 A;  2GGO A;  2GGQ A;  1V67 A;  3MQG A;  1KGQ A;  2ICX A;  3Q1X A;  4R37 A;  4DCL A;  2WLF A;  4H7O A;  4E6T A;  2IUA A;  1QRM A;  2P2O A;  3D98 A;  4AAW A;  3FSX A;  3NZ2 A;  3TK8 A;  3R3R A;  5L6S A;  5E3R A;  2V0L A;  3V4E A;  3KWC A;  3VBJ A;  1SSQ A;  4E1K A;  4HUS A;  1FWY A;  4EA9 A;  1S80 A;  3R5D A;  4IHG A;  3JQY A;  4R36 A;  4EA8 A;  1KRR A;  3PMO A;  4HZC A;  4KPX A;  3P1B A;  2XAT A;  4EGG A;  4IHF A;  4R7P A;  3VBP A;  3BFP A;  4N27 A;  5AFU U;  3I3A A;  1HM8 A;  3GVD A;  4K6R A;  2AQ9 A;  3TWD A;  5F42 A;  4ISX A;  3VNP A;  1KHR A;  2OI5 A;  1OCX A;  1QRE A;  3BSW A;  1XAT A;  2V0K A;  2QIA A;  3GOS A;  4M98 A;  3GUE A;  3FSY A;  2IU9 A;  5E3P A;  2OEF A;  2Q4J A;  3ST8 A;  4KNR A;  2QKX A;  3IXC A;  4KQL A;  4N6A A;  3I3X A;  3FSC A;  5DEP A;  1Z90 A;  1KRU A;  4M9C A;  4AA7 A;  4G3P A;  3R1W A;  3OTZ A;  4HCQ A;  3F1X A;  3HJJ A;  2QIV X;  3C8V A;  3R5B A;  2FKO A;  2OI7 A;  3OUP A;  2V0H A;  1J2Z A;  3VBI A;  5ADX U;  2WLC A;  3BXY A;  3P47 A;  3R8Y A;  4M2B A;  3FOQ A;  5DEM A;  1FXJ A;  1TDT A;  3TIO A;  1T3D A;  3OU9 A;  3R3I A;  3TDT A;  1MR9 A;  1XHD A;  2W0W A;  3HSQ A;  5DG3 A;  1KRV A;  5U2K A;  1V3W A;  3SRT A;  3KWD A;  1HM9 A;  2JF3 A;  2V0J A;  3VBN A;  1MRL A;  2JF2 A;  1G95 A;  1KK5 A;  1THJ A;  3ECT A;  4FCE A;  2VD4 A;  3IGJ A;  4G87 A;  3FSB A;  4KNX A;  1KGT A;  3MQH A;  3VBM A;  3DJ4 A;  3VBK A;  2OI6 A;  4N6B A;  2V0I A;  3R5C A;  1YP3 A;  3DK5 A;  3EG4 A;  2ICY A;  4MFG A;  1KK4 A;  4G3S A;  1KK6 A;  2NPO A;  3EEV A;  3R5A A;  4M99 A;  3KWE A;  4MYO A;  4EAA A;  3R0S A;  4G3Q A;  3BSS A; 
#chains in the Genus database with same CATH topology
 5AFU V;  1QRG A;  4M28 A;  3DHO A;  4EAB A;  1QRF A;  3T57 A;  3TV0 A;  5E3Q A;  4AC3 A;  1YP4 A;  1LXA A;  4J09 A;  3BSY A;  4IHH A;  3VBL A;  2W0V A;  3BRK X;  4EQY A;  1QQ0 A;  4E75 A;  2RIJ A;  2WLE A;  2I5K A;  1MR7 A;  3D8V A;  4MZU A;  4J18 A;  3FWW A;  3MC4 A;  2TDT A;  4HZD A;  3OH3 A;  1HM0 A;  2WLG A;  1SST A;  3EH0 A;  4E79 A;  2VHE A;  1HV9 A;  2IC7 A;  3OW5 A;  2OEG A;  1KQA A;  3FTT A;  3SPT A;  4E6U A;  3FS8 A;  4HUR A;  2IU8 A;  1SSM A;  1L0S A;  4N69 A;  2WLD A;  4KPZ A;  4M2A A;  3OTM A;  1QRL A;  3R2W A;  1G97 A;  3CJ8 A;  3OH0 A;  3TIS A;  1YP2 A;  5ADX V;  5L6V A;  4EA7 A;  2GGO A;  2GGQ A;  1V67 A;  3MQG A;  1KGQ A;  2ICX A;  3Q1X A;  4R37 A;  4DCL A;  2WLF A;  4H7O A;  4E6T A;  2IUA A;  1QRM A;  2P2O A;  1N4I A;  3D98 A;  4AAW A;  3FSX A;  3NZ2 A;  3GQ9 A;  3TK8 A;  3R3R A;  5L6S A;  5E3R A;  2V0L A;  3V4E A;  3KWC A;  3VBJ A;  1SSQ A;  4E1K A;  4HUS A;  1FWY A;  4EA9 A;  1S80 A;  3R5D A;  4IHG A;  3JQY A;  4R36 A;  4EA8 A;  1KRR A;  3PMO A;  4HZC A;  1M8N A;  4KPX A;  3P1B A;  2XAT A;  4EGG A;  4IHF A;  3GQA A;  3GQ7 A;  4R7P A;  1Z2F A;  3VBP A;  3BFP A;  4N27 A;  5AFU U;  3I3A A;  1HM8 A;  3GVD A;  4K6R A;  2AQ9 A;  3TWD A;  5F42 A;  4ISX A;  3VNP A;  1KHR A;  2OI5 A;  1OCX A;  1QRE A;  3BSW A;  1XAT A;  2V0K A;  2QIA A;  3GOS A;  4M98 A;  3SUC A;  3GUE A;  3FSY A;  2IU9 A;  5E3P A;  2OEF A;  2Q4J A;  3ST8 A;  4KNR A;  2QKX A;  3IXC A;  4KQL A;  3OH2 A;  3I3X A;  4N6A A;  3FSC A;  5DEP A;  1Z90 A;  1KRU A;  4M9C A;  4AA7 A;  4G3P A;  3R1W A;  3OTZ A;  3OH4 A;  4HCQ A;  3F1X A;  3HJJ A;  2QIV X;  3C8V A;  3R5B A;  2FKO A;  2OI7 A;  3OUP A;  2V0H A;  1J2Z A;  3VBI A;  5ADX U;  2WLC A;  3BXY A;  3OH1 A;  3P47 A;  3R8Y A;  4M2B A;  1EWW A;  3FOQ A;  5DEM A;  1FXJ A;  1TDT A;  3TIO A;  3GQ8 A;  1T3D A;  3OU9 A;  3R3I A;  3TDT A;  1MR9 A;  1XHD A;  2W0W A;  3HSQ A;  5DG3 A;  1KRV A;  5U2K A;  1V3W A;  3SRT A;  3KWD A;  1HM9 A;  2JF3 A;  2V0J A;  3VBN A;  1MRL A;  2JF2 A;  1G95 A;  1KK5 A;  1THJ A;  3ECT A;  4FCE A;  2VD4 A;  3IGJ A;  4G87 A;  3FSB A;  4KNX A;  1KGT A;  3MQH A;  3VBM A;  3DJ4 A;  3VBK A;  2OI6 A;  4N6B A;  2V0I A;  3R5C A;  1YP3 A;  3DK5 A;  3EG4 A;  3OGZ A;  2ICY A;  4MFG A;  1KK4 A;  4G3S A;  1KK6 A;  2NPO A;  3EEV A;  3R5A A;  4M99 A;  3KWE A;  4MYO A;  4EAA A;  3R0S A;  4G3Q A;  3BSS A; 
#chains in the Genus database with same CATH homology
 5AFU V;  1QRG A;  4M28 A;  3DHO A;  4EAB A;  1QRF A;  3T57 A;  3TV0 A;  5E3Q A;  4AC3 A;  1YP4 A;  1LXA A;  4J09 A;  3BSY A;  4IHH A;  3VBL A;  2W0V A;  3BRK X;  4EQY A;  1QQ0 A;  4E75 A;  2RIJ A;  2WLE A;  2I5K A;  1MR7 A;  3D8V A;  4MZU A;  4J18 A;  3FWW A;  3MC4 A;  2TDT A;  4HZD A;  1HM0 A;  2WLG A;  1SST A;  3EH0 A;  4E79 A;  2VHE A;  1HV9 A;  2IC7 A;  3OW5 A;  2OEG A;  1KQA A;  3FTT A;  3SPT A;  4E6U A;  3FS8 A;  4HUR A;  2IU8 A;  1SSM A;  4N69 A;  2WLD A;  4KPZ A;  4M2A A;  3OTM A;  1QRL A;  3R2W A;  1G97 A;  3CJ8 A;  3TIS A;  1YP2 A;  5ADX V;  5L6V A;  4EA7 A;  2GGO A;  2GGQ A;  1V67 A;  3MQG A;  1KGQ A;  2ICX A;  3Q1X A;  4R37 A;  4DCL A;  2WLF A;  4H7O A;  4E6T A;  2IUA A;  1QRM A;  2P2O A;  3D98 A;  4AAW A;  3FSX A;  3NZ2 A;  3TK8 A;  3R3R A;  5L6S A;  5E3R A;  2V0L A;  3V4E A;  3KWC A;  3VBJ A;  1SSQ A;  4E1K A;  4HUS A;  1FWY A;  4EA9 A;  1S80 A;  3R5D A;  4IHG A;  3JQY A;  4R36 A;  4EA8 A;  1KRR A;  3PMO A;  4HZC A;  4KPX A;  3P1B A;  2XAT A;  4EGG A;  4IHF A;  4R7P A;  3VBP A;  3BFP A;  4N27 A;  5AFU U;  3I3A A;  1HM8 A;  3GVD A;  4K6R A;  2AQ9 A;  3TWD A;  5F42 A;  4ISX A;  3VNP A;  1KHR A;  2OI5 A;  1OCX A;  1QRE A;  3BSW A;  1XAT A;  2V0K A;  2QIA A;  3GOS A;  4M98 A;  3GUE A;  3FSY A;  2IU9 A;  5E3P A;  2OEF A;  2Q4J A;  3ST8 A;  4KNR A;  2QKX A;  3IXC A;  4KQL A;  4N6A A;  3I3X A;  3FSC A;  5DEP A;  1Z90 A;  1KRU A;  4M9C A;  4AA7 A;  4G3P A;  3R1W A;  3OTZ A;  4HCQ A;  3F1X A;  3HJJ A;  2QIV X;  3C8V A;  3R5B A;  2FKO A;  2OI7 A;  3OUP A;  2V0H A;  1J2Z A;  3VBI A;  5ADX U;  2WLC A;  3BXY A;  3P47 A;  3R8Y A;  4M2B A;  3FOQ A;  5DEM A;  1FXJ A;  1TDT A;  3TIO A;  1T3D A;  3OU9 A;  3R3I A;  3TDT A;  1MR9 A;  1XHD A;  2W0W A;  3HSQ A;  5DG3 A;  1KRV A;  5U2K A;  1V3W A;  3SRT A;  3KWD A;  1HM9 A;  2JF3 A;  2V0J A;  3VBN A;  1MRL A;  2JF2 A;  1G95 A;  1KK5 A;  1THJ A;  3ECT A;  4FCE A;  2VD4 A;  3IGJ A;  4G87 A;  3FSB A;  4KNX A;  1KGT A;  3MQH A;  3VBM A;  3DJ4 A;  3VBK A;  2OI6 A;  4N6B A;  2V0I A;  3R5C A;  1YP3 A;  3DK5 A;  3EG4 A;  2ICY A;  4MFG A;  1KK4 A;  4G3S A;  1KK6 A;  2NPO A;  3EEV A;  3R5A A;  4M99 A;  3KWE A;  4MYO A;  4EAA A;  3R0S A;  4G3Q A;  3BSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...