3KXEC

A conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
NTSVVLGDHFQAFIDSQVADGRYGSASEVIRAGLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFIEERSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin protein parE-1
publication title A Conserved Mode of Protein Recognition and Binding in a ParD-ParE Toxin-Antitoxin Complex.
pubmed doi rcsb
source organism Caulobacter crescentus na1000
molecule tags Protein binding
total genus 24
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03693 ParD_antitoxin Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1250 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kxeC01
3KXEC
chains in the Genus database with same CATH superfamily
3LQRA 2XZUA 1W5SA 1K3XA 3TWLA 4X64M 5FTKA 2O5RA 2CV0A 2ZM6M 3A46A 2VQEM 4OW0A 2Z3XA 1IY2A 1ZV1A 2W82A 1IXRC 1TDHA 2MGWA 2UU9M 2FH0A 4EIWA 3AOEA 4S12A 3JAMS 1S3SA 3J81S 3DA1A 4LG2A 4R3DA 1QDTA 4X65M 3SAUA 2RRUA 2X49A 2QZ4A 4QHSA 2CV2A 2CHGA 4LRSA 1IBKM 1AUAA 2VDBB 3L28A 2KHHA 4OVZA 4IBGA 3W0FA 2LTUA 1JR3E 5IREB 3KS4A 2FS1A 5A2QS 4XBOA 4NL4H 5FSWA 2CEAA 3HHWA 3U6CA 1DV0A 3KSXA 1DGHA 4D82A 3KS8A 1QAQA 1DGGA 1OKSA 2G8LA 3GLFE 1PM5A 4FD2A 3SBJA 5C18A 2FOIC 3KP0E 4II7A 3TL4X 1GJTA 3FUXA 4Z8XA 1HNZM 2R4EA 1QZEA 4JI6M 3GRRA 4JI5M 3B74A 4P17A 4AKGA 2Q2EB 1XNQM 2DNAA 1R5LA 3LCUA 1Y8GA 3QAUA 4DR7M 1YLAA 4L6V6 5DYGA 2L4EA 4KHPM 1WGLA 1L2BA 2LVPC 2UXBM 4NXNM 3DOAA 2DHYA 3MHVC 4B7HA 1NNJA 4M9XA 2QQ8A 1TR8A 2JZ1A 4JI1M 1BVSA 2L7IA 4NC6A 2LNHC 3VK7A 3FRIA 3U6MA 4KODA 3IECA 1ZQ9A 3A45A 3GRYA 3I4VA 3GLFB 4DBGB 1PJJA 3CF6E 5DNYA 3JR4A 5ITRA 4PDGA 4JI8M 1I4WA 2BJWA 1OAOC 2ZANA 3GLIB 3DZDA 4ANRA 4MGYE 1J7KA 4L4UA 1E9RA 3FRHA 5FLXS 4Q7JA 2F5NA 5DFLA 3HX3A 1K82A 3SC3A 2R65A 2MR9A 2L6OA 1IQPA 4WURA 1D0MA 2YFQA 3RGPA 4PDIA 2VF8A 3SAWA 3H4JA 1XMQM 4FWDA 4MGZE 3LQQA 1Z5BA 4LFCM 3CF0A 2DWMA 2WSCF 2NQ8C 1NY6A 3E46A 1DO0A 3HJSA 5ITXA 1PJTA 2V6ZM 2OPFA 2ZAOA 4DR3M 4HL4A 3TQSA 4L16A 4QNRA 2R18A 5GKNA 3CGWA 1DGBA 4LJAA 2JA2A 2OOAA 3MK6A 2LVNC 3RE8A 3VLFB 3GLHB 4LF5M 5F3WA 1LTMA 1E32A 2JY7A 3EIEA 3QWLA 2QSFX 3M6AA 3B7NA 3U6SA 2C99A 3A42A 3ILKA 4DV6M 1NJFA 4MH0E 3V76A 4Y28F 3TPZA 4IBDA 1MJGM 1OTRA 1NV9A 4NRVA 1NY5A 1HJPA 4I8OA 1ZAEA 2AHMA 3MMPA 2L4FA 2M5ZA 1GKIA 4FCVA 3KSJA 1L2DA 2EJSA 3WHLA 1OIZA 2DKLA 2EKFA 1JR3A 3KOYE 1XWIA 4TUWA 1Q3CA 2UXDM 1L2CA 4NXMM 3J27B 4L78A 3VKHA 2J7OA 3K9OA 1QZMA 1ZMWA 4IBKA 4F2LA 3GLFA 2C5RA 2XF3A 3PNVA 1SXJD 1TH3A 3KDSE 3FE3A 3OTOM 1W5TA 1IN6A 1T6OA 2DAIA 2G5GX 2JP7A 4K0KM 1T43A 3B9PA 1GL7A 4FCTA 4WP2A 2JWSA 1NO1A 4IBBA 1XNRM 4BB9A 4P16A 4I4LA 5KO3A 2CHVA 4LF6M 2LBCA 1OQYA 2LHGA 3T15A 4M9SA 2R6FA 1VEGA 3R8FA 3HJQA 2V1UA 3AKZA 2OO9A 4WW0A 5EXTA 8CATA 2XSZA 1IY1A 2DZNB 2K0BX 1J5EM 1EE8A 3RGSA 2O25A 3GRVA 4MGHA 1FJGM 2Y0QA 3FTEA 2LXEA 3L27A 2Y21A 1R4GA 3U6OA 4QNMA 1E94E 1QQWA 3THGA 3ZCBB 3GLHA 1Z5AA 2RKOA 3HU1A 4KO8A 4OU7A 3C9PA 3K2LA 1JQJC 2K9DA 2YR0A 3HGIA 3TWMA 3L25A 4B08A 2CFOA 4DV4M 1GVNA 1TTEA 1UM8A 1J09A 1OJLA 1EIJA 1OFHA 3GRUA 4LCBA 3L26A 4CIZA 2VQFM 2QCUA 4GRIA 3SFZA 2DENA 1FNNA 4DV1M 3A98B 4GC9A 1VEKA 1VDDA 1YUBA 2Z4RA 3PVSA 4QOZC 2F5PA 1X37A 4DV5M 1E9SA 2CWBA 1WGNA 2O01F 1GLNA 2D7EA 2X8AA 3HWSA 3SARA 4CISA 1L1ZA 1T3TA 2BWEA 1HT2E 1MX0A 1SXJB 3E9SA 4G6ZA 4LFBM 2ERCA 1G8PA 2LVAA 1QAOA 2KDLA 4RF0A 5IZ7D 4DR2M 3HKPA 2R0IA 4HEOA 1K3WA 3GLIE 2DWLA 4GHLA 2JXNA 2XH9A 2RGOA 4XGIA 2QPAA 1N78A 1QDRA 5E6JA 4QHTA 1KYIA 4DV2M 3K92A 2G3QA 4JI4M 1XMOM 3BOSA 3NBXX 5KPRA 3CF2A 4YHHM 4GC5A 2FE8A 5EQTA 3U6QA 3LMMA 3U61B 1TH2A 2OQ4A 3AL0C 4NOOB 2K6BA 2DAMA 4RNAA 3SHGB 4AG5A 4FW9A 4F1IA 1TF0B 2DVWB 3HZJA 3GLHE 3HU2A 4GKKM 3CTWB 3FUVA 1Z59A 2HL7A 4FWHA 1H6UA 4AQYM 3FUUA 1IBMM 1GO5A 5BPVA 4DUYM 3I51A 2E5LM 4MGIE 2QNJA 3I01M 1NV8A 1WJ7A 2DWZB 3SATA 2LWXA 5EXSA 2H1RA 3UK6A 4NRWA 3FUTA 4NSRA 3GQ3A 4DR4M 3BXWA 2CV1A 4DR1M 4B3TM 4JI3M 3W67A 4PCZA 4AW4A 2RGHA 5EP4A 5KQ8A 1WR1B 2I7PA 3FD9A 4D81A 2EA0A 1IXSB 2CRUA 1V33A 1RU3A 2J5YA 4IBJA 2R4JA 1P3QQ 1R2YA 4DR5M 1G41A 1OFIA 1D0LA 4G4RA 3TE6A 2MROB 3AV0A 1IN8A 4KT0F 4LJ7A 3FTFA 2X4AA 2MJ5B 4LJ4A 1G3IA 3ZC7B 3GLGB 1EFUB 5KPZA 1VQ1A 1NJGA 2P5TA 2Y20A 2R45A 2Z7JA 3UMMA 2DZOB 2DZLA 5ITUA 3GQ5A 5LMNM 3T1YM 4IJFA 3VKGA 3K8ZA 4GKJM 4W5WA 3SMSA 4IBEA 4JI2M 1IN4A 2KNAA 5KPTA 3SYKA 3U61A 1IBLM 2F5SA 2Y0TA 2Z8YM 3FYDA 3VFDA 3U60B 1QANA 2LHCA 2WSFF 3IG5A 5BR8M 3J80S 2DAGA 1A5TA 4LZZA 3D8LA 3FUWA 2L09A 4QOSA 2KXEA 3D8BA 5EP2A 2HWJA 4AKHA 2KZSA 1OAIA 1TDZA 1VG5A 4AKIA 2WZJA 4IBCA 5JI3E 2ZAMA 2LVOC 3MJ5A 1C1KA 1NNUC 4FWGA 2HHHM 3H4MA 3AFHA 3ZH9B 2JNHA 4GITA 2XFSA 5FTMA 3W68A 1PJQA 4LZJA 3GLIA 1F4IA 2CE7A 2D7HA 2DAEA 4JV5M 4RF1A 2V1CA 3SHFA 1Q3BA 1DGFA 1VDLA 2H5XA 1VEJA 4I81A 5LMUM 4B3MM 4LF8M 2YNMD 1ORYB 3K9PA 4B7FA 3U5ZB 1NHGC 4I5SA 2B3TA 2KNZA 1QVRA 5L8RF 2XGNA 1SXJE 2DHRA 3KOZE 3SMPA 4AG6A 2HAKA 2KEBA 3J7AS 1IXSA 4NSOB 1HNWM 2JUJA 4ZPXA 4G4NA 2GNOA 5EP3A 1NSFA 1HR0M 2R62A 2KA6B 4JN6A 3T38A 1IFYA 2EO2A 5DYIA 2MH8A 3UJNA 2ZTDA 3LVWA 1XHBA 2CUZA 5FTLA 3LCVB 1WIVA 3GLGA 1NVMA 2CHQA 4R7GA 3NBIA 1YE9A 4GMQA 5EXPA 2C9OA 1IN5A 2FNAA 3IHPA 1JR3D 4DV3M 2KRUA 3HY5A 3QYEA 4FCWA 4MGKE 4JYAM 1N75A 3U60A 1LV7A 3F92A 3KOXE 5JI2E 3IG8A 1G59A 4AI6A 4MM3B 3PXGA 3FKEA 4DV7M 3FYCA 3Q8GA 2XEPA 4UN2B 4M0WA 4IIWA 1N32M 1QAMA 3L29A 2LVQD 2YQZA 3C3EA 3VDUA 3VK8A 3ZQJA 2HKJA 4JXJA 1KSFX 2QENA 4LF9M 1JB0F 3KFUG 1V92A 4FVMA 2XZFA 3FTDA 1HNXM 1N33M 4DV0M 1Q02A 1XXHB 3U6LA 2Z4SA 4JI0M 4L8RC 4LGMA 4LJ9A 1CUKA 1ZMVA 1I94M 2XSZD 3I04M 3NWLA 2VIIA 3W0LB 3U5ZA 3KP1E 5FTJA 5ITYA 4DUZM 3U6EA 3KW6A 2R44A 2R46A 2DXIA 1YSYA 1SXJC 1D2NA 4B7GA 1GJSA 1D0KA 4BBAA 1Q39A 3KVWA 1G4AE 4B3SM 1QUSA 4GIPA 4LFAM 1N36M 3HU3A 5IT9S 4X66M 1TGUA 1WHCA 3SASA 2OOBA 4LY6A 3GPXA 2KZUA 4IBIA 1V34A 2QBYB 1MN3A 1QYRA 2K47A 2EUCA 3UGJA 1L8QA 4GEWA 4LF7M 1IY0A 1XB2B 4GH9A 2J7NA 3GLGE 2M60A 4LJ6A 4M0DA 3LW5F 2BWBA 5H37D 3U6PA 3HHXA 1PGYA 3R9XB 2XFTA 2ZTCA 3C3DA 3B7ZA 2DAKA 4KLNA 1ZMUA 3LVVA 2F5OA 4DR6M 1IN7A 2UUCM 3GP1A 4AZFA 3J2PB 3J7BA 2BJVA 3M0EA 3RFWA 1Z6TA 3T6PA 1SG9A 4CHTB 2L2DA 1G71A 3M7GA 1L1TA 3HHZA 2A5YB 2ZBKB 5C1BA 1SXJA 2CP8A 1IM2A 1N77A 3GQ4A 1KFVA 4L15A 4A3VB 3KXEC 5IWAM 4HLQA 4D80A 1PJIA 1QUTA 2F5QA 1MU5A 4PT5A 2BNKA 3GPPA 1R2ZA 2JY6B 3K1JA 3HJ8A 2QHOB 2KNVA 2LH0A 2F4VM 3SAVA 5EXXA 1GABA 3WHKA 5EP1A 2VF7A 2C9CA 4LGYA 5KQDA 1N34M 1GL6A 3I4YA 1TH4A 1WXQA 4Z6YA 4M9ZA 3PNYA 1IXZA 4PD2A 4CGYB 1XXHA 3Q8XA 4RKUF 7CATA 1HT1E 4CJ6A 4G3OA 3PFIA 4R71A 5EJCA 3JR5A 4GHAA 1R7RA 2APLA 3KOWE 5FTNA 5ITQA 1PJSA 3L2AA 4XK8F 4X62M 2L7HA 4G4OA 3T1HM 3E21A 4G4QA 1OIPA 3GO8A 2N35A 4IJEA 2C96A 3DFZA 1C7YA 3GPUA 2KW0A 3EIHA 4OVZB 3UZUA 2WSEF 3U6DA 1Z5CA 4MB7A 2DWNA 2UUAM 1NHWC 1XC8A 1UFZA 4B3RM 2QBYA 3SYLA 2D7GA 2UUBM 3GPYA 4LRTA 1DO2A 3HHYA 3C58A 4LJ5A 1DGHB 1PRBA 2DI0A 4REZA 4ITQA 3BBZA 2I7NA 1R6BX 3AJIB 2GQFA 3AOEC 4LJ8A 3VDPA 4IBFA 2XLJA 4JI7M 4LF4M 5ITTA 2QP9X 1HQCA 3B7QA 2C98A 2JY5A 2JZ0A 3B89A 1AIPC 2JY8A 3TWKA 3AOGA 3FTCA 4BLCA 5E26A 2HCBA 1HQYE 2EKKA 5ITXE 2FFJA 4YY3M 2UXCM 2KRKA 3QYBA 4OX9M 1XXHE 3E4RA
chains in the Genus database with same CATH topology
3LQRA 2XZUA 1W5SA 1K3XA 3TWLA 4X64M 5FTKA 2O5RA 2CV0A 2ZM6M 3A46A 2VQEM 4OW0A 2Z3XA 1IY2A 2W82A 1IXRC 1TDHA 2UU9M 4EIWA 3AOEA 4S12A 3JAMS 1S3SA 3J81S 3DA1A 4LG2A 4R3DA 4X65M 3SAUA 2X49A 2QZ4A 4QHSA 2CV2A 2CHGA 4LRSA 1IBKM 3L28A 4OVZA 4IBGA 3W0FA 5IREB 3KS4A 5A2QS 4XBOA 4NL4H 5FSWA 2CEAA 3HHWA 3U6CA 3KSXA 1DGHA 4D82A 3KS8A 1QAQA 1DGGA 2G8LA 1PM5A 4FD2A 3SBJA 5C18A 2FOIC 3KP0E 4II7A 3TL4X 3FUXA 4Z8XA 1HNZM 2R4EA 4JI6M 3GRRA 4JI5M 4AKGA 2Q2EB 1XNQM 3QAUA 4DR7M 5DYGA 4KHPM 1L2BA 2UXBM 4NXNM 3DOAA 3MHVC 4B7HA 1NNJA 4M9XA 4JI1M 2L7IA 2LNHC 3VK7A 3U6MA 4KODA 1ZQ9A 3A45A 3GRYA 3I4VA 3GLFB 1PJJA 3CF6E 5DNYA 3JR4A 5ITRA 4PDGA 4JI8M 1I4WA 2BJWA 2ZANA 3GLIB 3DZDA 4MGYE 1J7KA 4L4UA 1E9RA 5FLXS 2F5NA 1K82A 3SC3A 2R65A 2L6OA 1IQPA 4WURA 3RGPA 2YFQA 4PDIA 3SAWA 1XMQM 4FWDA 4MGZE 3LQQA 1Z5BA 4LFCM 3CF0A 2DWMA 2NQ8C 1NY6A 3HJSA 1DO0A 5ITXA 2OPFA 2V6ZM 4DR3M 2ZAOA 4HL4A 3TQSA 4L16A 4QNRA 2R18A 5GKNA 1DGBA 4LJAA 2JA2A 3MK6A 3RE8A 3VLFB 3GLHB 4LF5M 5F3WA 3EIEA 1E32A 3QWLA 3M6AA 3U6SA 2C99A 3A42A 3ILKA 4DV6M 1NJFA 4MH0E 3TPZA 4IBDA 4NRVA 1NY5A 4I8OA 1ZAEA 2AHMA 2M5ZA 1GKIA 4FCVA 3KSJA 1L2DA 3WHLA 1JR3A 3KOYE 1XWIA 4TUWA 1Q3CA 2UXDM 1L2CA 4NXMM 3J27B 4L78A 3VKHA 2J7OA 1QZMA 4IBKA 3GLFA 2C5RA 2XF3A 3PNVA 1SXJD 1TH3A 3KDSE 3OTOM 1W5TA 1IN6A 2G5GX 4K0KM 3B9PA 1GL7A 4FCTA 1XNRM 4IBBA 4BB9A 4P16A 4I4LA 5KO3A 2CHVA 4LF6M 3T15A 4M9SA 3R8FA 2V1UA 3HJQA 3AKZA 5EXTA 4WW0A 8CATA 2XSZA 1IY1A 2DZNB 1J5EM 1EE8A 3RGSA 1FJGM 3GRVA 4MGHA 2Y0QA 3FTEA 2LXEA 3L27A 2Y21A 3U6OA 4QNMA 1E94E 1QQWA 3THGA 3ZCBB 3GLHA 1Z5AA 2RKOA 3HU1A 4KO8A 4OU7A 3K2LA 1JQJC 2YR0A 3HGIA 3TWMA 3L25A 4B08A 2CFOA 4DV4M 1GVNA 1UM8A 1J09A 1OJLA 1OFHA 3GRUA 4LCBA 3L26A 2VQFM 4DV1M 2QCUA 4GRIA 3SFZA 3VK8A 1FNNA 3A98B 4GC9A 1VDDA 1YUBA 2Z4RA 3PVSA 4QOZC 2F5PA 1X37A 4DV5M 1E9SA 1GLNA 2D7EA 2X8AA 3HWSA 3SARA 4CISA 1L1ZA 1T3TA 1HT2E 1MX0A 1SXJB 3E9SA 4G6ZA 4LFBM 2ERCA 1G8PA 1QAOA 4RF0A 5IZ7D 4DR2M 3HKPA 1K3WA 2DWLA 4GHLA 2XH9A 2RGOA 4XGIA 2QPAA 1N78A 5E6JA 4QHTA 1KYIA 4DV2M 3K92A 4JI4M 1XMOM 3BOSA 5KPRA 3CF2A 4YHHM 4GC5A 2FE8A 5EQTA 3U6QA 3LMMA 3U61B 1TH2A 2OQ4A 3AL0C 4NOOB 4RNAA 3SHGB 4AG5A 4FW9A 2DVWB 3HU2A 4GKKM 3CTWB 3FUVA 1Z59A 2HL7A 4FWHA 1H6UA 4AQYM 3FUUA 1IBMM 5BPVA 4DUYM 3I51A 2E5LM 4MGIE 2DWZB 3SATA 2LWXA 5EXSA 2H1RA 3UK6A 4NRWA 3FUTA 4NSRA 3GQ3A 4DR4M 2CV1A 4DR1M 4JI3M 4PCZA 4AW4A 2RGHA 5EP4A 5KQ8A 2I7PA 3FD9A 4D81A 2EA0A 1IXSB 4IBJA 2R4JA 1R2YA 4DR5M 1G41A 1OFIA 4G4RA 3TE6A 3FTFA 3AV0A 1IN8A 4LJ7A 2X4AA 4LJ4A 1G3IA 3ZC7B 3GLGB 5KPZA 2P5TA 1NJGA 2Y20A 2Z7JA 2R45A 3UMMA 2DZOB 5ITUA 3GQ5A 5LMNM 3T1YM 4IJFA 3VKGA 3K8ZA 4GKJM 4W5WA 3SMSA 4IBEA 4JI2M 1IN4A 5KPTA 3U61A 3SYKA 1IBLM 2F5SA 4B3TM 2Y0TA 3FYDA 3VFDA 3U60B 1QANA 3IG5A 5BR8M 3J80S 4LZZA 3D8LA 3FUWA 2L09A 4QOSA 2KXEA 3D8BA 5EP2A 4AKHA 2KZSA 1TDZA 4AKIA 4IBCA 5JI3E 2ZAMA 2HHHM 3MJ5A 1C1KA 1NNUC 4FWGA 3H4MA 3AFHA 3ZH9B 4GITA 2XFSA 5FTMA 3GLIA 4LZJA 2CE7A 2D7HA 4JV5M 4RF1A 2V1CA 3SHFA 1Q3BA 1DGFA 4I81A 5LMUM 4B3MM 4LF8M 2YNMD 1ORYB 4B7FA 3U5ZB 1NHGC 4I5SA 1QVRA 2XGNA 1SXJE 2DHRA 3KOZE 3SMPA 4AG6A 3J7AS 2KEBA 4NSOB 1HNWM 4ZPXA 4G4NA 5EP3A 1NSFA 1HR0M 2R62A 2KA6B 4JN6A 3T38A 2EO2A 5DYIA 3UJNA 3LVWA 1XHBA 2CUZA 5FTLA 3GLGA 1NVMA 2CHQA 4R7GA 3NBIA 1YE9A 4GMQA 5EXPA 2C9OA 1IN5A 2FNAA 1JR3D 4DV3M 2KRUA 4FCWA 4MGKE 4JYAM 1N75A 3U60A 1LV7A 3KOXE 5JI2E 3IG8A 1G59A 4AI6A 4MM3B 3PXGA 3FKEA 4DV7M 3FYCA 2XEPA 4M0WA 4IIWA 1N32M 1QAMA 3L29A 2YQZA 3VDUA 2HKJA 4JXJA 1KSFX 2QENA 4LF9M 3KFUG 4FVMA 2XZFA 3FTDA 1HNXM 1N33M 4DV0M 1XXHB 3U6LA 2Z4SA 4JI0M 4L8RC 4LGMA 4LJ9A 1I94M 2XSZD 3NWLA 2VIIA 3W0LB 3U5ZA 3KP1E 5FTJA 5ITYA 4DUZM 3U6EA 3KW6A 2R46A 2DXIA 1YSYA 1SXJC 1D2NA 4B7GA 4BBAA 1Q39A 3KVWA 1G4AE 4B3SM 4GIPA 4LFAM 1N36M 3HU3A 5IT9S 4X66M 1TGUA 3SASA 4LY6A 3GPXA 2KZUA 4IBIA 2QBYB 1QYRA 2K47A 3UGJA 2EUCA 1L8QA 4LF7M 1IY0A 4GH9A 2J7NA 2M60A 4LJ6A 4M0DA 5H37D 3U6PA 3HHXA 3R9XB 2XFTA 4KLNA 3LVVA 2F5OA 4DR6M 1IN7A 2UUCM 3GP1A 4AZFA 3J2PB 3J7BA 2BJVA 3M0EA 3RFWA 1Z6TA 4CHTB 3M7GA 1L1TA 3HHZA 2A5YB 2ZBKB 5C1BA 1SXJA 1N77A 1IM2A 3GQ4A 1KFVA 4L15A 4A3VB 3KXEC 5IWAM 4HLQA 4D80A 1PJIA 2F5QA 1MU5A 4PT5A 2BNKA 3GPPA 1R2ZA 3K1JA 3HJ8A 2LH0A 2F4VM 3SAVA 5EXXA 3WHKA 5EP1A 4LGYA 2C9CA 5KQDA 1N34M 1GL6A 3I4YA 1TH4A 1WXQA 4Z6YA 4M9ZA 3PNYA 1IXZA 4PD2A 4CGYB 1XXHA 3Q8XA 7CATA 1HT1E 3PFIA 3JR5A 5EJCA 4GHAA 1R7RA 3KOWE 5FTNA 5ITQA 3L2AA 4X62M 2L7HA 4G4OA 3T1HM 4G4QA 3GO8A 4IJEA 2C96A 3DFZA 3GPUA 2KW0A 3EIHA 4OVZB 3UZUA 3U6DA 2DWNA 1Z5CA 4MB7A 2UUAM 1NHWC 1XC8A 4B3RM 2QBYA 3SYLA 2D7GA 2UUBM 3GPYA 4LRTA 1DO2A 3HHYA 3C58A 4LJ5A 1DGHB 4REZA 4ITQA 2I7NA 1R6BX 3AJIB 3AOEC 4LJ8A 3VDPA 4IBFA 2XLJA 4JI7M 4LF4M 5ITTA 2QP9X 1HQCA 2C98A 3TWKA 3AOGA 3FTCA 4BLCA 5E26A 2HCBA 1HQYE 5ITXE 2FFJA 4YY3M 2UXCM 2KRKA 4OX9M 3E4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXE C; 
#chains in the Genus database with same CATH topology
 3LQR A;  2XZU A;  1W5S A;  1K3X A;  3TWL A;  4X64 M;  5FTK A;  2O5R A;  2CV0 A;  2ZM6 M;  3A46 A;  2VQE M;  4OW0 A;  2Z3X A;  1IY2 A;  1ZV1 A;  2W82 A;  1IXR C;  1TDH A;  2MGW A;  2UU9 M;  2FH0 A;  4EIW A;  3AOE A;  4S12 A;  3JAM S;  1S3S A;  3J81 S;  3DA1 A;  4LG2 A;  4R3D A;  1QDT A;  4X65 M;  3SAU A;  2RRU A;  2X49 A;  2QZ4 A;  4QHS A;  2CV2 A;  2CHG A;  4LRS A;  1IBK M;  1AUA A;  2VDB B;  3L28 A;  2KHH A;  4OVZ A;  4IBG A;  3W0F A;  2LTU A;  1JR3 E;  5IRE B;  3KS4 A;  2FS1 A;  5A2Q S;  4XBO A;  4NL4 H;  5FSW A;  2CEA A;  3HHW A;  3U6C A;  1DV0 A;  3KSX A;  1DGH A;  4D82 A;  3KS8 A;  1QAQ A;  1DGG A;  1OKS A;  2G8L A;  3GLF E;  1PM5 A;  4FD2 A;  3SBJ A;  5C18 A;  2FOI C;  3KP0 E;  4II7 A;  3TL4 X;  1GJT A;  3FUX A;  4Z8X A;  1HNZ M;  2R4E A;  1QZE A;  4JI6 M;  3GRR A;  4JI5 M;  3B74 A;  4P17 A;  4AKG A;  2Q2E B;  1XNQ M;  2DNA A;  1R5L A;  3LCU A;  1Y8G A;  3QAU A;  4DR7 M;  1YLA A;  4L6V 6;  5DYG A;  2L4E A;  4KHP M;  1WGL A;  1L2B A;  2LVP C;  2UXB M;  4NXN M;  3DOA A;  2DHY A;  3MHV C;  4B7H A;  1NNJ A;  4M9X A;  2QQ8 A;  1TR8 A;  2JZ1 A;  4JI1 M;  1BVS A;  2L7I A;  4NC6 A;  2LNH C;  3VK7 A;  3FRI A;  3U6M A;  4KOD A;  3IEC A;  1ZQ9 A;  3A45 A;  3GRY A;  3I4V A;  3GLF B;  4DBG B;  1PJJ A;  3CF6 E;  5DNY A;  3JR4 A;  5ITR A;  4PDG A;  4JI8 M;  1I4W A;  2BJW A;  1OAO C;  2ZAN A;  3GLI B;  3DZD A;  4ANR A;  4MGY E;  1J7K A;  4L4U A;  1E9R A;  3FRH A;  5FLX S;  4Q7J A;  2F5N A;  5DFL A;  3HX3 A;  1K82 A;  3SC3 A;  2R65 A;  2MR9 A;  2L6O A;  1IQP A;  4WUR A;  1D0M A;  2YFQ A;  3RGP A;  4PDI A;  2VF8 A;  3SAW A;  3H4J A;  1XMQ M;  4FWD A;  4MGZ E;  3LQQ A;  1Z5B A;  4LFC M;  3CF0 A;  2DWM A;  2WSC F;  2NQ8 C;  1NY6 A;  3E46 A;  1DO0 A;  3HJS A;  5ITX A;  1PJT A;  2V6Z M;  2OPF A;  2ZAO A;  4DR3 M;  4HL4 A;  3TQS A;  4L16 A;  4QNR A;  2R18 A;  5GKN A;  3CGW A;  1DGB A;  4LJA A;  2JA2 A;  2OOA A;  3MK6 A;  2LVN C;  3RE8 A;  3VLF B;  3GLH B;  4LF5 M;  5F3W A;  1LTM A;  1E32 A;  2JY7 A;  3EIE A;  3QWL A;  2QSF X;  3M6A A;  3B7N A;  3U6S A;  2C99 A;  3A42 A;  3ILK A;  4DV6 M;  1NJF A;  4MH0 E;  3V76 A;  4Y28 F;  3TPZ A;  4IBD A;  1MJG M;  1OTR A;  1NV9 A;  4NRV A;  1NY5 A;  1HJP A;  4I8O A;  1ZAE A;  2AHM A;  3MMP A;  2L4F A;  2M5Z A;  1GKI A;  4FCV A;  3KSJ A;  1L2D A;  2EJS A;  3WHL A;  1OIZ A;  2DKL A;  2EKF A;  1JR3 A;  3KOY E;  1XWI A;  4TUW A;  1Q3C A;  2UXD M;  1L2C A;  4NXM M;  3J27 B;  4L78 A;  3VKH A;  2J7O A;  3K9O A;  1QZM A;  1ZMW A;  4IBK A;  4F2L A;  3GLF A;  2C5R A;  2XF3 A;  3PNV A;  1SXJ D;  1TH3 A;  3KDS E;  3FE3 A;  3OTO M;  1W5T A;  1IN6 A;  1T6O A;  2DAI A;  2G5G X;  2JP7 A;  4K0K M;  1T43 A;  3B9P A;  1GL7 A;  4FCT A;  4WP2 A;  2JWS A;  1NO1 A;  4IBB A;  1XNR M;  4BB9 A;  4P16 A;  4I4L A;  5KO3 A;  2CHV A;  4LF6 M;  2LBC A;  1OQY A;  2LHG A;  3T15 A;  4M9S A;  2R6F A;  1VEG A;  3R8F A;  3HJQ A;  2V1U A;  3AKZ A;  2OO9 A;  4WW0 A;  5EXT A;  8CAT A;  2XSZ A;  1IY1 A;  2DZN B;  2K0B X;  1J5E M;  1EE8 A;  3RGS A;  2O25 A;  3GRV A;  4MGH A;  1FJG M;  2Y0Q A;  3FTE A;  2LXE A;  3L27 A;  2Y21 A;  1R4G A;  3U6O A;  4QNM A;  1E94 E;  1QQW A;  3THG A;  3ZCB B;  3GLH A;  1Z5A A;  2RKO A;  3HU1 A;  4KO8 A;  4OU7 A;  3C9P A;  3K2L A;  1JQJ C;  2K9D A;  2YR0 A;  3HGI A;  3TWM A;  3L25 A;  4B08 A;  2CFO A;  4DV4 M;  1GVN A;  1TTE A;  1UM8 A;  1J09 A;  1OJL A;  1EIJ A;  1OFH A;  3GRU A;  4LCB A;  3L26 A;  4CIZ A;  2VQF M;  2QCU A;  4GRI A;  3SFZ A;  2DEN A;  1FNN A;  4DV1 M;  3A98 B;  4GC9 A;  1VEK A;  1VDD A;  1YUB A;  2Z4R A;  3PVS A;  4QOZ C;  2F5P A;  1X37 A;  4DV5 M;  1E9S A;  2CWB A;  1WGN A;  2O01 F;  1GLN A;  2D7E A;  2X8A A;  3HWS A;  3SAR A;  4CIS A;  1L1Z A;  1T3T A;  2BWE A;  1HT2 E;  1MX0 A;  1SXJ B;  3E9S A;  4G6Z A;  4LFB M;  2ERC A;  1G8P A;  2LVA A;  1QAO A;  2KDL A;  4RF0 A;  5IZ7 D;  4DR2 M;  3HKP A;  2R0I A;  4HEO A;  1K3W A;  3GLI E;  2DWL A;  4GHL A;  2JXN A;  2XH9 A;  2RGO A;  4XGI A;  2QPA A;  1N78 A;  1QDR A;  5E6J A;  4QHT A;  1KYI A;  4DV2 M;  3K92 A;  2G3Q A;  4JI4 M;  1XMO M;  3BOS A;  3NBX X;  5KPR A;  3CF2 A;  4YHH M;  4GC5 A;  2FE8 A;  5EQT A;  3U6Q A;  3LMM A;  3U61 B;  1TH2 A;  2OQ4 A;  3AL0 C;  4NOO B;  2K6B A;  2DAM A;  4RNA A;  3SHG B;  4AG5 A;  4FW9 A;  4F1I A;  1TF0 B;  2DVW B;  3HZJ A;  3GLH E;  3HU2 A;  4GKK M;  3CTW B;  3FUV A;  1Z59 A;  2HL7 A;  4FWH A;  1H6U A;  4AQY M;  3FUU A;  1IBM M;  1GO5 A;  5BPV A;  4DUY M;  3I51 A;  2E5L M;  4MGI E;  2QNJ A;  3I01 M;  1NV8 A;  1WJ7 A;  2DWZ B;  3SAT A;  2LWX A;  5EXS A;  2H1R A;  3UK6 A;  4NRW A;  3FUT A;  4NSR A;  3GQ3 A;  4DR4 M;  3BXW A;  2CV1 A;  4DR1 M;  4B3T M;  4JI3 M;  3W67 A;  4PCZ A;  4AW4 A;  2RGH A;  5EP4 A;  5KQ8 A;  1WR1 B;  2I7P A;  3FD9 A;  4D81 A;  2EA0 A;  1IXS B;  2CRU A;  1V33 A;  1RU3 A;  2J5Y A;  4IBJ A;  2R4J A;  1P3Q Q;  1R2Y A;  4DR5 M;  1G41 A;  1OFI A;  1D0L A;  4G4R A;  3TE6 A;  2MRO B;  3AV0 A;  1IN8 A;  4KT0 F;  4LJ7 A;  3FTF A;  2X4A A;  2MJ5 B;  4LJ4 A;  1G3I A;  3ZC7 B;  3GLG B;  1EFU B;  5KPZ A;  1VQ1 A;  1NJG A;  2P5T A;  2Y20 A;  2R45 A;  2Z7J A;  3UMM A;  2DZO B;  2DZL A;  5ITU A;  3GQ5 A;  5LMN M;  3T1Y M;  4IJF A;  3VKG A;  3K8Z A;  4GKJ M;  4W5W A;  3SMS A;  4IBE A;  4JI2 M;  1IN4 A;  2KNA A;  5KPT A;  3SYK A;  3U61 A;  1IBL M;  2F5S A;  2Y0T A;  2Z8Y M;  3FYD A;  3VFD A;  3U60 B;  1QAN A;  2LHC A;  2WSF F;  3IG5 A;  5BR8 M;  3J80 S;  2DAG A;  1A5T A;  4LZZ A;  3D8L A;  3FUW A;  2L09 A;  4QOS A;  2KXE A;  3D8B A;  5EP2 A;  2HWJ A;  4AKH A;  2KZS A;  1OAI A;  1TDZ A;  1VG5 A;  4AKI A;  2WZJ A;  4IBC A;  5JI3 E;  2ZAM A;  2LVO C;  3MJ5 A;  1C1K A;  1NNU C;  4FWG A;  2HHH M;  3H4M A;  3AFH A;  3ZH9 B;  2JNH A;  4GIT A;  2XFS A;  5FTM A;  3W68 A;  1PJQ A;  4LZJ A;  3GLI A;  1F4I A;  2CE7 A;  2D7H A;  2DAE A;  4JV5 M;  4RF1 A;  2V1C A;  3SHF A;  1Q3B A;  1DGF A;  1VDL A;  2H5X A;  1VEJ A;  4I81 A;  5LMU M;  4B3M M;  4LF8 M;  2YNM D;  1ORY B;  3K9P A;  4B7F A;  3U5Z B;  1NHG C;  4I5S A;  2B3T A;  2KNZ A;  1QVR A;  5L8R F;  2XGN A;  1SXJ E;  2DHR A;  3KOZ E;  3SMP A;  4AG6 A;  2HAK A;  2KEB A;  3J7A S;  1IXS A;  4NSO B;  1HNW M;  2JUJ A;  4ZPX A;  4G4N A;  2GNO A;  5EP3 A;  1NSF A;  1HR0 M;  2R62 A;  2KA6 B;  4JN6 A;  3T38 A;  1IFY A;  2EO2 A;  5DYI A;  2MH8 A;  3UJN A;  2ZTD A;  3LVW A;  1XHB A;  2CUZ A;  5FTL A;  3LCV B;  1WIV A;  3GLG A;  1NVM A;  2CHQ A;  4R7G A;  3NBI A;  1YE9 A;  4GMQ A;  5EXP A;  2C9O A;  1IN5 A;  2FNA A;  3IHP A;  1JR3 D;  4DV3 M;  2KRU A;  3HY5 A;  3QYE A;  4FCW A;  4MGK E;  4JYA M;  1N75 A;  3U60 A;  1LV7 A;  3F92 A;  3KOX E;  5JI2 E;  3IG8 A;  1G59 A;  4AI6 A;  4MM3 B;  3PXG A;  3FKE A;  4DV7 M;  3FYC A;  3Q8G A;  2XEP A;  4UN2 B;  4M0W A;  4IIW A;  1N32 M;  1QAM A;  3L29 A;  2LVQ D;  2YQZ A;  3C3E A;  3VDU A;  3VK8 A;  3ZQJ A;  2HKJ A;  4JXJ A;  1KSF X;  2QEN A;  4LF9 M;  1JB0 F;  3KFU G;  1V92 A;  4FVM A;  2XZF A;  3FTD A;  1HNX M;  1N33 M;  4DV0 M;  1Q02 A;  1XXH B;  3U6L A;  2Z4S A;  4JI0 M;  4L8R C;  4LGM A;  4LJ9 A;  1CUK A;  1ZMV A;  1I94 M;  2XSZ D;  3I04 M;  3NWL A;  2VII A;  3W0L B;  3U5Z A;  3KP1 E;  5FTJ A;  5ITY A;  4DUZ M;  3U6E A;  3KW6 A;  2R44 A;  2R46 A;  2DXI A;  1YSY A;  1SXJ C;  1D2N A;  4B7G A;  1GJS A;  1D0K A;  4BBA A;  1Q39 A;  3KVW A;  1G4A E;  4B3S M;  1QUS A;  4GIP A;  4LFA M;  1N36 M;  3HU3 A;  5IT9 S;  4X66 M;  1TGU A;  1WHC A;  3SAS A;  2OOB A;  4LY6 A;  3GPX A;  2KZU A;  4IBI A;  1V34 A;  2QBY B;  1MN3 A;  1QYR A;  2K47 A;  2EUC A;  3UGJ A;  1L8Q A;  4GEW A;  4LF7 M;  1IY0 A;  1XB2 B;  4GH9 A;  2J7N A;  3GLG E;  2M60 A;  4LJ6 A;  4M0D A;  3LW5 F;  2BWB A;  5H37 D;  3U6P A;  3HHX A;  1PGY A;  3R9X B;  2XFT A;  2ZTC A;  3C3D A;  3B7Z A;  2DAK A;  4KLN A;  1ZMU A;  3LVV A;  2F5O A;  4DR6 M;  1IN7 A;  2UUC M;  3GP1 A;  4AZF A;  3J2P B;  3J7B A;  2BJV A;  3M0E A;  3RFW A;  1Z6T A;  3T6P A;  1SG9 A;  4CHT B;  2L2D A;  1G71 A;  3M7G A;  1L1T A;  3HHZ A;  2A5Y B;  2ZBK B;  5C1B A;  1SXJ A;  2CP8 A;  1IM2 A;  1N77 A;  3GQ4 A;  1KFV A;  4L15 A;  4A3V B;  3KXE C;  5IWA M;  4HLQ A;  4D80 A;  1PJI A;  1QUT A;  2F5Q A;  1MU5 A;  4PT5 A;  2BNK A;  3GPP A;  1R2Z A;  2JY6 B;  3K1J A;  3HJ8 A;  2QHO B;  2KNV A;  2LH0 A;  2F4V M;  3SAV A;  5EXX A;  1GAB A;  3WHK A;  5EP1 A;  2VF7 A;  2C9C A;  4LGY A;  5KQD A;  1N34 M;  1GL6 A;  3I4Y A;  1TH4 A;  1WXQ A;  4Z6Y A;  4M9Z A;  3PNY A;  1IXZ A;  4PD2 A;  4CGY B;  1XXH A;  3Q8X A;  4RKU F;  7CAT A;  1HT1 E;  4CJ6 A;  4G3O A;  3PFI A;  4R71 A;  5EJC A;  3JR5 A;  4GHA A;  1R7R A;  2APL A;  3KOW E;  5FTN A;  5ITQ A;  1PJS A;  3L2A A;  4XK8 F;  4X62 M;  2L7H A;  4G4O A;  3T1H M;  3E21 A;  4G4Q A;  1OIP A;  3GO8 A;  2N35 A;  4IJE A;  2C96 A;  3DFZ A;  1C7Y A;  3GPU A;  2KW0 A;  3EIH A;  4OVZ B;  3UZU A;  2WSE F;  3U6D A;  1Z5C A;  4MB7 A;  2DWN A;  2UUA M;  1NHW C;  1XC8 A;  1UFZ A;  4B3R M;  2QBY A;  3SYL A;  2D7G A;  2UUB M;  3GPY A;  4LRT A;  1DO2 A;  3HHY A;  3C58 A;  4LJ5 A;  1DGH B;  1PRB A;  2DI0 A;  4REZ A;  4ITQ A;  3BBZ A;  2I7N A;  1R6B X;  3AJI B;  2GQF A;  3AOE C;  4LJ8 A;  3VDP A;  4IBF A;  2XLJ A;  4JI7 M;  4LF4 M;  5ITT A;  2QP9 X;  1HQC A;  3B7Q A;  2C98 A;  2JY5 A;  2JZ0 A;  3B89 A;  1AIP C;  2JY8 A;  3TWK A;  3AOG A;  3FTC A;  4BLC A;  5E26 A;  2HCB A;  1HQY E;  2EKK A;  5ITX E;  2FFJ A;  4YY3 M;  2UXC M;  2KRK A;  3QYB A;  4OX9 M;  1XXH E;  3E4R A; 
#chains in the Genus database with same CATH homology
 3LQR A;  2XZU A;  1W5S A;  1K3X A;  3TWL A;  4X64 M;  5FTK A;  2O5R A;  2CV0 A;  2ZM6 M;  3A46 A;  2VQE M;  4OW0 A;  2Z3X A;  1IY2 A;  2W82 A;  1IXR C;  1TDH A;  2UU9 M;  4EIW A;  3AOE A;  4S12 A;  3JAM S;  1S3S A;  3J81 S;  3DA1 A;  4LG2 A;  4R3D A;  4X65 M;  3SAU A;  2X49 A;  2QZ4 A;  4QHS A;  2CV2 A;  2CHG A;  4LRS A;  1IBK M;  3L28 A;  4OVZ A;  4IBG A;  3W0F A;  5IRE B;  3KS4 A;  5A2Q S;  4XBO A;  4NL4 H;  5FSW A;  2CEA A;  3HHW A;  3U6C A;  3KSX A;  1DGH A;  4D82 A;  3KS8 A;  1QAQ A;  1DGG A;  2G8L A;  1PM5 A;  4FD2 A;  3SBJ A;  5C18 A;  2FOI C;  3KP0 E;  4II7 A;  3TL4 X;  3FUX A;  4Z8X A;  1HNZ M;  2R4E A;  4JI6 M;  3GRR A;  4JI5 M;  4AKG A;  2Q2E B;  1XNQ M;  3QAU A;  4DR7 M;  5DYG A;  4KHP M;  1L2B A;  2UXB M;  4NXN M;  3DOA A;  3MHV C;  4B7H A;  1NNJ A;  4M9X A;  4JI1 M;  2L7I A;  2LNH C;  3VK7 A;  3U6M A;  4KOD A;  1ZQ9 A;  3A45 A;  3GRY A;  3I4V A;  3GLF B;  1PJJ A;  3CF6 E;  5DNY A;  3JR4 A;  5ITR A;  4PDG A;  4JI8 M;  1I4W A;  2BJW A;  2ZAN A;  3GLI B;  3DZD A;  4MGY E;  1J7K A;  4L4U A;  1E9R A;  5FLX S;  2F5N A;  1K82 A;  3SC3 A;  2R65 A;  2L6O A;  1IQP A;  4WUR A;  3RGP A;  2YFQ A;  4PDI A;  3SAW A;  1XMQ M;  4FWD A;  4MGZ E;  3LQQ A;  1Z5B A;  4LFC M;  3CF0 A;  2DWM A;  2NQ8 C;  1NY6 A;  3HJS A;  1DO0 A;  5ITX A;  2OPF A;  2V6Z M;  4DR3 M;  2ZAO A;  4HL4 A;  3TQS A;  4L16 A;  4QNR A;  2R18 A;  5GKN A;  1DGB A;  4LJA A;  2JA2 A;  3MK6 A;  3RE8 A;  3VLF B;  3GLH B;  4LF5 M;  5F3W A;  3EIE A;  1E32 A;  3QWL A;  3M6A A;  3U6S A;  2C99 A;  3A42 A;  3ILK A;  4DV6 M;  1NJF A;  4MH0 E;  3TPZ A;  4IBD A;  4NRV A;  1NY5 A;  4I8O A;  1ZAE A;  2AHM A;  2M5Z A;  1GKI A;  4FCV A;  3KSJ A;  1L2D A;  3WHL A;  1JR3 A;  3KOY E;  1XWI A;  4TUW A;  1Q3C A;  2UXD M;  1L2C A;  4NXM M;  3J27 B;  4L78 A;  3VKH A;  2J7O A;  1QZM A;  4IBK A;  3GLF A;  2C5R A;  2XF3 A;  3PNV A;  1SXJ D;  1TH3 A;  3KDS E;  3OTO M;  1W5T A;  1IN6 A;  2G5G X;  4K0K M;  3B9P A;  1GL7 A;  4FCT A;  1XNR M;  4IBB A;  4BB9 A;  4P16 A;  4I4L A;  5KO3 A;  2CHV A;  4LF6 M;  3T15 A;  4M9S A;  3R8F A;  2V1U A;  3HJQ A;  3AKZ A;  5EXT A;  4WW0 A;  8CAT A;  2XSZ A;  1IY1 A;  2DZN B;  1J5E M;  1EE8 A;  3RGS A;  1FJG M;  3GRV A;  4MGH A;  2Y0Q A;  3FTE A;  2LXE A;  3L27 A;  2Y21 A;  3U6O A;  4QNM A;  1E94 E;  1QQW A;  3THG A;  3ZCB B;  3GLH A;  1Z5A A;  2RKO A;  3HU1 A;  4KO8 A;  4OU7 A;  3K2L A;  1JQJ C;  2YR0 A;  3HGI A;  3TWM A;  3L25 A;  4B08 A;  2CFO A;  4DV4 M;  1GVN A;  1UM8 A;  1J09 A;  1OJL A;  1OFH A;  3GRU A;  4LCB A;  3L26 A;  2VQF M;  4DV1 M;  2QCU A;  4GRI A;  3SFZ A;  3VK8 A;  1FNN A;  3A98 B;  4GC9 A;  1VDD A;  1YUB A;  2Z4R A;  3PVS A;  4QOZ C;  2F5P A;  1X37 A;  4DV5 M;  1E9S A;  1GLN A;  2D7E A;  2X8A A;  3HWS A;  3SAR A;  4CIS A;  1L1Z A;  1T3T A;  1HT2 E;  1MX0 A;  1SXJ B;  3E9S A;  4G6Z A;  4LFB M;  2ERC A;  1G8P A;  1QAO A;  4RF0 A;  5IZ7 D;  4DR2 M;  3HKP A;  1K3W A;  2DWL A;  4GHL A;  2XH9 A;  2RGO A;  4XGI A;  2QPA A;  1N78 A;  5E6J A;  4QHT A;  1KYI A;  4DV2 M;  3K92 A;  4JI4 M;  1XMO M;  3BOS A;  5KPR A;  3CF2 A;  4YHH M;  4GC5 A;  2FE8 A;  5EQT A;  3U6Q A;  3LMM A;  3U61 B;  1TH2 A;  2OQ4 A;  3AL0 C;  4NOO B;  4RNA A;  3SHG B;  4AG5 A;  4FW9 A;  2DVW B;  3HU2 A;  4GKK M;  3CTW B;  3FUV A;  1Z59 A;  2HL7 A;  4FWH A;  1H6U A;  4AQY M;  3FUU A;  1IBM M;  5BPV A;  4DUY M;  3I51 A;  2E5L M;  4MGI E;  2DWZ B;  3SAT A;  2LWX A;  5EXS A;  2H1R A;  3UK6 A;  4NRW A;  3FUT A;  4NSR A;  3GQ3 A;  4DR4 M;  2CV1 A;  4DR1 M;  4JI3 M;  4PCZ A;  4AW4 A;  2RGH A;  5EP4 A;  5KQ8 A;  2I7P A;  3FD9 A;  4D81 A;  2EA0 A;  1IXS B;  4IBJ A;  2R4J A;  1R2Y A;  4DR5 M;  1G41 A;  1OFI A;  4G4R A;  3TE6 A;  3FTF A;  3AV0 A;  1IN8 A;  4LJ7 A;  2X4A A;  4LJ4 A;  1G3I A;  3ZC7 B;  3GLG B;  5KPZ A;  2P5T A;  1NJG A;  2Y20 A;  2Z7J A;  2R45 A;  3UMM A;  2DZO B;  5ITU A;  3GQ5 A;  5LMN M;  3T1Y M;  4IJF A;  3VKG A;  3K8Z A;  4GKJ M;  4W5W A;  3SMS A;  4IBE A;  4JI2 M;  1IN4 A;  5KPT A;  3U61 A;  3SYK A;  1IBL M;  2F5S A;  4B3T M;  2Y0T A;  3FYD A;  3VFD A;  3U60 B;  1QAN A;  3IG5 A;  5BR8 M;  3J80 S;  4LZZ A;  3D8L A;  3FUW A;  2L09 A;  4QOS A;  2KXE A;  3D8B A;  5EP2 A;  4AKH A;  2KZS A;  1TDZ A;  4AKI A;  4IBC A;  5JI3 E;  2ZAM A;  2HHH M;  3MJ5 A;  1C1K A;  1NNU C;  4FWG A;  3H4M A;  3AFH A;  3ZH9 B;  4GIT A;  2XFS A;  5FTM A;  3GLI A;  4LZJ A;  2CE7 A;  2D7H A;  4JV5 M;  4RF1 A;  2V1C A;  3SHF A;  1Q3B A;  1DGF A;  4I81 A;  5LMU M;  4B3M M;  4LF8 M;  2YNM D;  1ORY B;  4B7F A;  3U5Z B;  1NHG C;  4I5S A;  1QVR A;  2XGN A;  1SXJ E;  2DHR A;  3KOZ E;  3SMP A;  4AG6 A;  3J7A S;  2KEB A;  4NSO B;  1HNW M;  4ZPX A;  4G4N A;  5EP3 A;  1NSF A;  1HR0 M;  2R62 A;  2KA6 B;  4JN6 A;  3T38 A;  2EO2 A;  5DYI A;  3UJN A;  3LVW A;  1XHB A;  2CUZ A;  5FTL A;  3GLG A;  1NVM A;  2CHQ A;  4R7G A;  3NBI A;  1YE9 A;  4GMQ A;  5EXP A;  2C9O A;  1IN5 A;  2FNA A;  1JR3 D;  4DV3 M;  2KRU A;  4FCW A;  4MGK E;  4JYA M;  1N75 A;  3U60 A;  1LV7 A;  3KOX E;  5JI2 E;  3IG8 A;  1G59 A;  4AI6 A;  4MM3 B;  3PXG A;  3FKE A;  4DV7 M;  3FYC A;  2XEP A;  4M0W A;  4IIW A;  1N32 M;  1QAM A;  3L29 A;  2YQZ A;  3VDU A;  2HKJ A;  4JXJ A;  1KSF X;  2QEN A;  4LF9 M;  3KFU G;  4FVM A;  2XZF A;  3FTD A;  1HNX M;  1N33 M;  4DV0 M;  1XXH B;  3U6L A;  2Z4S A;  4JI0 M;  4L8R C;  4LGM A;  4LJ9 A;  1I94 M;  2XSZ D;  3NWL A;  2VII A;  3W0L B;  3U5Z A;  3KP1 E;  5FTJ A;  5ITY A;  4DUZ M;  3U6E A;  3KW6 A;  2R46 A;  2DXI A;  1YSY A;  1SXJ C;  1D2N A;  4B7G A;  4BBA A;  1Q39 A;  3KVW A;  1G4A E;  4B3S M;  4GIP A;  4LFA M;  1N36 M;  3HU3 A;  5IT9 S;  4X66 M;  1TGU A;  3SAS A;  4LY6 A;  3GPX A;  2KZU A;  4IBI A;  2QBY B;  1QYR A;  2K47 A;  3UGJ A;  2EUC A;  1L8Q A;  4LF7 M;  1IY0 A;  4GH9 A;  2J7N A;  2M60 A;  4LJ6 A;  4M0D A;  5H37 D;  3U6P A;  3HHX A;  3R9X B;  2XFT A;  4KLN A;  3LVV A;  2F5O A;  4DR6 M;  1IN7 A;  2UUC M;  3GP1 A;  4AZF A;  3J2P B;  3J7B A;  2BJV A;  3M0E A;  3RFW A;  1Z6T A;  4CHT B;  3M7G A;  1L1T A;  3HHZ A;  2A5Y B;  2ZBK B;  5C1B A;  1SXJ A;  1N77 A;  1IM2 A;  3GQ4 A;  1KFV A;  4L15 A;  4A3V B;  3KXE C;  5IWA M;  4HLQ A;  4D80 A;  1PJI A;  2F5Q A;  1MU5 A;  4PT5 A;  2BNK A;  3GPP A;  1R2Z A;  3K1J A;  3HJ8 A;  2LH0 A;  2F4V M;  3SAV A;  5EXX A;  3WHK A;  5EP1 A;  4LGY A;  2C9C A;  5KQD A;  1N34 M;  1GL6 A;  3I4Y A;  1TH4 A;  1WXQ A;  4Z6Y A;  4M9Z A;  3PNY A;  1IXZ A;  4PD2 A;  4CGY B;  1XXH A;  3Q8X A;  7CAT A;  1HT1 E;  3PFI A;  3JR5 A;  5EJC A;  4GHA A;  1R7R A;  3KOW E;  5FTN A;  5ITQ A;  3L2A A;  4X62 M;  2L7H A;  4G4O A;  3T1H M;  4G4Q A;  3GO8 A;  4IJE A;  2C96 A;  3DFZ A;  3GPU A;  2KW0 A;  3EIH A;  4OVZ B;  3UZU A;  3U6D A;  2DWN A;  1Z5C A;  4MB7 A;  2UUA M;  1NHW C;  1XC8 A;  4B3R M;  2QBY A;  3SYL A;  2D7G A;  2UUB M;  3GPY A;  4LRT A;  1DO2 A;  3HHY A;  3C58 A;  4LJ5 A;  1DGH B;  4REZ A;  4ITQ A;  2I7N A;  1R6B X;  3AJI B;  3AOE C;  4LJ8 A;  3VDP A;  4IBF A;  2XLJ A;  4JI7 M;  4LF4 M;  5ITT A;  2QP9 X;  1HQC A;  2C98 A;  3TWK A;  3AOG A;  3FTC A;  4BLC A;  5E26 A;  2HCB A;  1HQY E;  5ITX E;  2FFJ A;  4YY3 M;  2UXC M;  2KRK A;  4OX9 M;  3E4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...