3KXEC

A conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
NTSVVLGDHFQAFIDSQVADGRYGSASEVIRAGLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFIEERSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conserved Mode of Protein Recognition and Binding in a ParD-ParE Toxin-Antitoxin Complex.
pubmed doi rcsb
source organism Caulobacter crescentus na1000
molecule tags Protein binding
molecule keywords Toxin protein parE-1
total genus 24
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03693 ParD_antitoxin Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1250 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kxeC01
3KXEC
chains in the Genus database with same CATH superfamily
1K3XA 4AKHA 1D0LA 1T43A 4RF0A 2OQ4A 2XSZD 1J09A 4I81A 2VQFM 4RKUF 1ZV1A 3CTWB 3HWSA 1UFZA 1GLNA 3KXEC 1NY5A 1D0MA 3U6PA 1QAOA 5EP2A 1E32A 5BR8M 2L7HA 4AG6A 3VDUA 3GLFE 3KOWE 2CFOA 1R4GA 4GH9A 1YLAA 2EJSA 2LBCA 1OTRA 1VQ1A 2XEPA 3C3DA 4IBGA 4LJAA 1L2BA 2EA0A 4LF5M 2D7EA 2UUAM 1DV0A 3THGA 1R7RA 1GVNA 2D7GA 3W0FA 3UGJA 3IG5A 4D81A 5FTNA 2ZTCA 2F5SA 3FE3A 1AUAA 5KO3A 2CHQA 2J5YA 3RFWA 3K92A 3GPXA 2MJ5B 1SG9A 2I7PA 2H5XA 1VDLA 4RF1A 2G3QA 5KPTA 4DV1M 2DHYA 4CGYB 1SXJB 3KS8A 3SBJA 4UN2B 2A5YB 2HHHM 5E6JA 3DZDA 1LV7A 1IY2A 3KP1E 3BBZA 1R2YA 4IBBA 2Q2EB 3K9OA 2YFQA 4MGYE 4B3MM 3HHWA 4LY6A 3B74A 1WR1B 3HU3A 2VQEM 1QANA 1QUSA 5ITYA 1DO0A 2ZBKB 3GLHB 1YE9A 4CISA 1ZAEA 1QDTA 2DWNA 2JY5A 3AFHA 1GJSA 3H4MA 2Y20A 2CV1A 4MB7A 4ZPXA 4IBJA 1QUTA 3HKPA 4RNAA 4OVZB 3QAUA 1N75A 2CUZA 2LVOC 1VEJA 1N32M 1JR3D 2DNAA 3TWLA 2M5ZA 2E5LM 4LZZA 2CV0A 3SFZA 5H37D 2RGOA 3FUVA 2KDLA 4AW4A 2DAEA 4X62M 2ZM6M 1QZEA 1HJPA 2KNAA 3B7QA 3DFZA 4B08A 2R4JA 4G4NA 4AKGA 5ITTA 2UU9M 3KP0E 4PT5A 4IJEA 4DUYM 5FSWA 4LRSA 2KNZA 3L29A 2L09A 1Z5CA 3LCUA 5FLXS 2LXEA 1T3TA 1G71A 3GQ4A 5DYIA 3VKGA 2R44A 3KFUG 4NL4H 3K9PA 3SYKA 2VF7A 1HQCA 3FRIA 2FE8A 4JI5M 1TGUA 4FWHA 4K0KM 3UMMA 4HLQA 1TDZA 1ZQ9A 2K47A 1BVSA 3WHLA 1VEGA 4FW9A 4OVZA 3NBIA 4L15A 4KODA 3GP1A 1Y8GA 4JN6A 1Q3CA 1OFHA 1RU3A 3GLGA 4QNMA 3JR4A 3DOAA 5ITRA 4DR2M 3J2PB 4JXJA 2MR9A 4B7GA 1IQPA 4QHTA 1GABA 1GL7A 3MJ5A 4L8RC 5DFLA 1P3QQ 2JA2A 4NSRA 3VFDA 1QZMA 1VG5A 2DKLA 3FTDA 3K8ZA 2DXIA 1VEKA 4G3OA 2MH8A 1V33A 3IG8A 3GLHE 3L2AA 1ZMWA 1MN3A 3LMMA 4JI4M 2JY8A 3GRVA 3MK6A 1PGYA 1PRBA 2R6FA 2OPFA 4B3RM 2QSFX 4DBGB 1V92A 2RGHA 4LJ9A 5ITXE 3BOSA 2DZOB 1WHCA 3GLFB 3GQ5A 3M7GA 2QENA 3LW5F 4WP2A 4X65M 2R65A 5EXTA 2UXDM 4LF6M 4D80A 1OKSA 1HNZM 3KOXE 1TH3A 4M9XA 4YHHM 1W5SA 4Q7JA 3CF6E 2F5QA 3UK6A 3FUXA 2LVQD 1C7YA 3LQQA 2KZSA 1SXJA 3D8LA 4QNRA 5IREB 3HX3A 1IN4A 3U5ZA 3TPZA 3ZCBB 3HHYA 4I8OA 2ZAMA 3T1YM 3KDSE 5EXPA 2L7IA 4YY3M 5GKNA 4JYAM 2FFJA 3LVVA 3ZC7B 4BLCA 2DVWB 3A98B 5EP1A 2UXCM 1IN8A 2O5RA 2V6ZM 3T6PA 1QAQA 3FTEA 4LGYA 1QYRA 4F1IA 3TL4X 1PJJA 3I51A 2JUJA 3MMPA 1IXSA 1SXJE 1PJQA 1VDDA 2V1CA 4GKKM 4MGHA 4MM3B 2DI0A 2Z4SA 5IT9S 4IBEA 2W82A 4NC6A 1R2ZA 2F5NA 1D0KA 1G41A 2DHRA 2KEBA 4W5WA 3T15A 4JI8M 1N36M 2N35A 2KNVA 3HHZA 4M9SA 2CEAA 2D7HA 1ORYB 1IXZA 4LJ8A 3WHKA 3SAVA 3BXWA 1GKIA 4L78A 3U6DA 2WSCF 3E4RA 2XF3A 3D8BA 2LVNC 4DV5M 3H4JA 4LFCM 1EE8A 3U6QA 1J7KA 1OFIA 4II7A 4AQYM 1OAIA 1SXJC 2QHOB 3FUTA 1TF0B 1IBMM 5KPZA 2QBYB 4L6V6 3SAWA 2HL7A 4MGKE 3T1HM 2QCUA 4IBDA 4DR5M 1NJFA 4TUWA 2X49A 5IZ7D 2L4FA 3I01M 2F5PA 2M60A 2QP9X 2HWJA 1R6BX 1XB2B 4L16A 4DR3M 1GO5A 1JQJC 1HT2E 1W5TA 2MROB 3PFIA 5KQDA 4CIZA 2Z7JA 4B7FA 4LRTA 4DR1M 4PCZA 1GJTA 4G4OA 5FTJA 3OTOM 4LJ7A 2BNKA 2V1UA 2R45A 2Y0QA 4IBKA 4IJFA 4NOOB 2UXBM 1Q02A 3GQ3A 4NRVA 4LJ6A 3FUUA 4Y28F 3JAMS 3TWMA 4LZJA 1WGNA 4NRWA 4KHPM 4DV2M 2L2DA 3U6EA 4LCBA 3L28A 1OIPA 4GRIA 2VF8A 1IY0A 2KRKA 1X37A 3CF0A 1PJIA 2R4EA 1GL6A 3B9PA 2LVAA 2G8LA 2O25A 3GLIA 5A2QS 2JNHA 3HJ8A 3GO8A 4DR4M 2BJVA 1HQYE 1Z5AA 1N77A 5FTMA 1KYIA 3W67A 3SC3A 2OO9A 2XLJA 4OX9M 2QPAA 4GHLA 3NBXX 3SHGB 4ANRA 4MGZE 5C18A 3VKHA 2OOBA 4P16A 2L6OA 2CRUA 1FJGM 1AIPC 1PJTA 3I4VA 5F3WA 2EKKA 1K3WA 1T6OA 4LF7M 4M9ZA 3B7NA 2R18A 5ITUA 2WSEF 4A3VB 1HR0M 2EO2A 2XFSA 1TTEA 4XK8F 1WJ7A 2K0BX 4I5SA 2K6BA 2UUCM 1J5EM 3GLIE 4FWGA 1TDHA 4L4UA 1E9SA 2C9OA 5ITQA 1I94M 1YUBA 2WZJA 4QOZC 4R71A 4IBIA 3W0LB 2KA6B 1IBKM 4ITQA 1HNWM 4MH0E 3QYEA 4EIWA 5LMUM 4NXNM 3ZQJA 4IBCA 2I7NA 1DGHB 2ZANA 3FKEA 1XXHB 2R46A 3KVWA 2Z3XA 3U61B 4DUZM 2UUBM 4LGMA 4GC9A 2AHMA 3FD9A 4JI0M 2HAKA 1PM5A 2GQFA 2XGNA 3GLHA 3MHVC 4XGIA 3TE6A 4LF4M 2DENA 1NY6A 2QNJA 4D82A 4REZA 3W68A 4OW0A 1A5TA 1I4WA 4LF9M 2JP7A 2QBYA 3RGPA 2FNAA 1MX0A 2HKJA 1F4IA 3VK8A 1HNXM 4DR6M 2O01F 2C99A 1Z5BA 2L4EA 2Z8YM 2QQ8A 4FCTA 2LHGA 5DYGA 5ITXA 2DAGA 3J7AS 2BJWA 3I04M 3KOZE 4IBFA 1NHWC 3KSJA 5EJCA 5JI2E 2DAIA 2JY7A 3EIEA 4OU7A 4B3TM 4NXMM 1XXHA 4HL4A 3U60B 3ILKA 1IBLM 3HHXA 5E26A 1WXQA 5JI3E 3AOEC 2YNMD 2EUCA 1NHGC 4X64M 1XNRM 1MU5A 1TR8A 4QOSA 3SAUA 2R62A 2XZFA 4CHTB 1JR3E 5FTKA 3GLGE 1CUKA 1QVRA 4NSOB 4PDGA 5IWAM 1L1ZA 3U60A 4Z8XA 4AG5A 2C96A 3C9PA 2KZUA 3IHPA 3PNVA 3K2LA 3J7BA 2J7OA 3SMSA 3UZUA 3E21A 2Z4RA 2ZAOA 4JI7M 3Q8GA 1JR3A 3HJSA 3SYLA 2CHGA 3GPPA 1L2DA 3J27B 1QAMA 3GRUA 4Z6YA 1UM8A 4BB9A 4AKIA 4KT0F 2F4VM 1FNNA 2DWMA 3KOYE 5EQTA 3UJNA 2BWBA 4B7HA 1OIZA 4JV5M 2Y0TA 3DA1A 5BPVA 1G3IA 4CJ6A 3K1JA 1XMOM 1G8PA 1OJLA 2KW0A 1DGHA 2JWSA 2XSZA 1KFVA 1IN6A 3E9SA 4P17A 3U6SA 3AV0A 1V34A 2EKFA 3RE8A 2DAMA 4KLNA 3SATA 3QYBA 1QDRA 3TWKA 1SXJD 2KHHA 4GIPA 3U6CA 3VLFB 2VIIA 1HT1E 1OQYA 3TQSA 5KPRA 1OAOC 2RRUA 4GKJM 4GEWA 5LMNM 2P5TA 4XBOA 1H6UA 2LWXA 3LQRA 1XWIA 3LVWA 2X4AA 5KQ8A 1NNUC 1NV9A 2KRUA 3E46A 3FYCA 4G6ZA 4G4RA 2BWEA 4JI6M 1Q3BA 4FCWA 3RGSA 3PNYA 3C3EA 3U5ZB 3HZJA 1XMQM 4LJ5A 2JZ0A 1G59A 1EFUB 3AKZA 5FTLA 3HU1A 3U6OA 4GHAA 2NQ8C 1IY1A 3GLIB 4FWDA 4DV0M 4IIWA 3KSXA 1C1KA 1E9RA 3B89A 3R8FA 3JR5A 3J81S 1L8QA 2LH0A 3SHFA 4DV7M 3SARA 2XH9A 4B3SM 2JXNA 2RKOA 3U61A 1NJGA 1Z6TA 2Y21A 3M6AA 3I4YA 3C58A 1DGGA 4G4QA 3VDPA 2DWLA 1MJGM 4GC5A 3FTCA 5EP3A 1D2NA 3CGWA 7CATA 2YQZA 3HGIA 2B3TA 2VDBB 4LFBM 4JI3M 2MGWA 2CP8A 4I4LA 1E94E 3U6LA 1NNJA 2FH0A 3AOEA 1XHBA 1L1TA 1DGBA 3GLGB 4BBAA 1DGFA 4LFAM 1IN7A 1NV8A 4AZFA 1IXRC 1G4AE 3Q8XA 4JI1M 3LCVB 4PDIA 1NVMA 2H1RA 3FTFA 1TH4A 3FUWA 2R0IA 2CE7A 4GITA 4DR7M 1DO2A 1PJSA 2DWZB 3M0EA 1QQWA 2JY6B 3KW6A 2OOAA 3IECA 3ZH9B 3PVSA 2C5RA 1S3SA 2CHVA 2XZUA 2GNOA 2ZTDA 4WURA 1K82A 1EIJA 1L2CA 3KS4A 1Q39A 1ZMVA 2JZ1A 5EXXA 1JB0F 2FOIC 4WW0A 2G5GX 3GPUA 4S12A 3F92A 1IFYA 3U6MA 1Z59A 1XXHE 4DV3M 2K9DA 4QHSA 2FS1A 3L27A 4F2LA 4R3DA 2DZNB 5L8RF 2YR0A 2DAKA 3A42A 3AOGA 2J7NA 3A46A 3SASA 1IXSB 3HY5A 2APLA 2WSFF 1IN5A 3AJIB 1YSYA 3QWLA 2DZLA 4FCVA 4M0DA 2LNHC 2F5OA 4DV4M 1WIVA 4DV6M 1NO1A 3GRYA 4LG2A 3VK7A 1KSFX 2KXEA 2C9CA 3NWLA 4X66M 3SMPA 3EIHA 4GMQA 1LTMA 4AI6A 3V76A 1TH2A 2LTUA 3R9XB 3GPYA 1N33M 4LJ4A 2CWBA 4FVMA 3B7ZA 4KO8A 3AL0C 5DNYA 2LHCA 3CF2A 1N78A 1WGLA 2QZ4A 5EXSA 1XC8A 4R7GA 1IM2A 5C1BA 2C98A 1R5LA 1NSFA 3FYDA 4FD2A 3J80S 3HJQA 8CATA 2LVPC 3PXGA 4PD2A 3L26A 3L25A 2HCBA 1N34M 4LF8M 3FRHA 4M0WA 3HU2A 3GLFA 5EP4A 2CV2A 3GRRA 4MGIE 3A45A 2XFTA 4HEOA 4JI2M 1XNQM 2ERCA 1ZMUA 2X8AA 3T38A
chains in the Genus database with same CATH topology
1K3XA 4AKHA 2OQ4A 4RF0A 2XSZD 1J09A 4I81A 2VQFM 3CTWB 3HWSA 1GLNA 3KXEC 1NY5A 3U6PA 1QAOA 5EP2A 1E32A 5BR8M 2L7HA 4AG6A 3VDUA 3KOWE 2CFOA 4GH9A 3JAMS 1PM5A 4LJAA 2XEPA 4IBGA 1L2BA 2EA0A 4LF5M 2D7EA 2UUAM 3THGA 1R7RA 1GVNA 2D7GA 3W0FA 3UGJA 3IG5A 4D81A 5FTNA 2F5SA 5KO3A 2CHQA 3RFWA 3K92A 3GPXA 2I7PA 4RF1A 5KPTA 4DV1M 4CGYB 1SXJB 3KS8A 3SBJA 2A5YB 2HHHM 5E6JA 3DZDA 1LV7A 1IY2A 3KP1E 1R2YA 4IBBA 2Q2EB 4MGYE 2YFQA 4B3MM 3HHWA 4LY6A 2VQEM 3HU3A 1QANA 5ITYA 1DO0A 2ZBKB 3GLHB 1YE9A 4CISA 1ZAEA 2DWNA 3AFHA 3H4MA 2Y20A 2CV1A 4MB7A 4ZPXA 4IBJA 4RNAA 3HKPA 4OVZB 3QAUA 1N75A 2CUZA 1N32M 1JR3D 3TWLA 2M5ZA 2E5LM 4LZZA 2CV0A 3SFZA 5H37D 2RGOA 3FUVA 4AW4A 4X62M 2ZM6M 3DFZA 4B08A 2R4JA 4G4NA 4AKGA 5ITTA 2UU9M 3KP0E 4PT5A 4IJEA 4DUYM 5FSWA 4LRSA 3L29A 2L09A 1Z5CA 5FLXS 2LXEA 1T3TA 3GQ4A 5DYIA 3VKGA 3KFUG 4NL4H 3SYKA 1HQCA 2FE8A 4JI5M 1TGUA 4FWHA 4K0KM 3UMMA 4HLQA 1TDZA 1ZQ9A 2K47A 3WHLA 4FW9A 4OVZA 3NBIA 4L15A 4KODA 3GP1A 4JN6A 1Q3CA 1OFHA 3GLGA 4QNMA 3JR4A 3DOAA 5ITRA 4DR2M 3J2PB 4JXJA 4B7GA 1IQPA 4QHTA 1GL7A 3MJ5A 4L8RC 4NSRA 2JA2A 3VFDA 1QZMA 3K8ZA 3FTDA 2DXIA 3IG8A 3L2AA 3LMMA 4JI4M 3GRVA 3MK6A 2OPFA 4B3RM 2RGHA 4LJ9A 5ITXE 3BOSA 2DZOB 3GLFB 3GQ5A 3M7GA 2QENA 4X65M 2R65A 5EXTA 2UXDM 4LF6M 4D80A 1HNZM 3KOXE 1TH3A 4M9XA 4YHHM 1W5SA 3CF6E 2F5QA 3UK6A 3FUXA 3LQQA 2KZSA 1SXJA 3D8LA 4QNRA 5IREB 1IN4A 3U5ZA 3TPZA 3ZCBB 3HHYA 4I8OA 2ZAMA 3T1YM 3KDSE 5EXPA 2L7IA 4YY3M 5GKNA 4JYAM 2FFJA 3LVVA 3ZC7B 4BLCA 2DVWB 3A98B 5EP1A 2UXCM 1IN8A 2O5RA 2V6ZM 1QAQA 3FTEA 4LGYA 1QYRA 3TL4X 1PJJA 3I51A 1VDDA 1SXJE 2V1CA 4GKKM 4MGHA 4MM3B 2Z4SA 5IT9S 4IBEA 2W82A 1R2ZA 2F5NA 2DHRA 1G41A 4W5WA 2KEBA 3T15A 4JI8M 1N36M 3HHZA 4M9SA 2CEAA 2D7HA 1ORYB 1IXZA 4LJ8A 3WHKA 3SAVA 1GKIA 4L78A 3U6DA 3E4RA 2XF3A 3D8BA 4DV5M 4LFCM 1EE8A 3U6QA 1J7KA 1OFIA 4II7A 4AQYM 1SXJC 3FUTA 1IBMM 5KPZA 2QBYB 3SAWA 2HL7A 4MGKE 3T1HM 2QCUA 4IBDA 4DR5M 1NJFA 4TUWA 2X49A 5IZ7D 2F5PA 2M60A 2QP9X 1R6BX 4L16A 4DR3M 1JQJC 1HT2E 1W5TA 3PFIA 5KQDA 4DR1M 3U6OA 2Z7JA 4B7FA 4LRTA 4PCZA 4G4OA 5FTJA 3OTOM 4LJ7A 2BNKA 2V1UA 2R45A 2Y0QA 4IBKA 4IJFA 4NOOB 2UXBM 3GQ3A 4NRVA 4LJ6A 3FUUA 4NRWA 3TWMA 4LZJA 4KHPM 4DV2M 3U6EA 4LCBA 3L28A 4GRIA 1IY0A 2KRKA 1X37A 3CF0A 1PJIA 2R4EA 1GL6A 3B9PA 2G8LA 3GLIA 5A2QS 3HJ8A 3GO8A 4DR4M 2BJVA 1HQYE 1Z5AA 1N77A 5FTMA 1KYIA 3SC3A 2XLJA 4OX9M 2QPAA 4GHLA 3SHGB 4MGZE 5C18A 3VKHA 4P16A 2L6OA 1FJGM 3I4VA 5F3WA 1K3WA 4LF7M 4M9ZA 2R18A 5ITUA 4A3VB 1HR0M 2EO2A 2XFSA 4I5SA 2UUCM 1J5EM 4FWGA 1TDHA 4L4UA 1E9SA 2C9OA 5ITQA 1I94M 1YUBA 4QOZC 4IBIA 3W0LB 2KA6B 1IBKM 4ITQA 1HNWM 4MH0E 4EIWA 5LMUM 4NXNM 4IBCA 2I7NA 1DGHB 2ZANA 3FKEA 1XXHB 2R46A 3KVWA 2Z3XA 3U61B 4DUZM 2UUBM 4LGMA 4GC9A 2AHMA 3FD9A 4JI0M 2XGNA 3GLHA 3MHVC 4XGIA 3TE6A 4LF4M 1NY6A 4D82A 4REZA 4OW0A 1I4WA 4LF9M 2QBYA 3RGPA 2FNAA 1MX0A 2HKJA 3VK8A 1HNXM 4DR6M 2C99A 1Z5BA 4FCTA 5DYGA 5ITXA 3J7AS 2BJWA 3KOZE 4IBFA 1NHWC 3KSJA 5EJCA 5JI2E 3EIEA 4OU7A 4NXMM 4B3TM 1XXHA 4HL4A 3U60B 3ILKA 1IBLM 3HHXA 5E26A 1WXQA 5JI3E 3AOEC 2YNMD 2EUCA 1NHGC 4X64M 1XNRM 1MU5A 4QOSA 3SAUA 2R62A 2XZFA 4CHTB 5FTKA 1QVRA 4NSOB 4PDGA 5IWAM 1L1ZA 3U60A 4Z8XA 4AG5A 2C96A 2KZUA 3PNVA 3K2LA 3J7BA 2J7OA 3SMSA 3UZUA 2Z4RA 2ZAOA 4JI7M 3SYLA 1JR3A 3HJSA 2CHGA 3GPPA 1L2DA 3J27B 1QAMA 3GRUA 4Z6YA 1UM8A 4BB9A 4AKIA 2F4VM 1FNNA 2DWMA 3KOYE 5EQTA 3UJNA 4B7HA 4JV5M 2Y0TA 3DA1A 5BPVA 1G3IA 3K1JA 1XMOM 1G8PA 1OJLA 2KW0A 1DGHA 2XSZA 1KFVA 1IN6A 3E9SA 3U6SA 3AV0A 3RE8A 4KLNA 3SATA 3TWKA 1SXJD 4GIPA 3U6CA 3VLFB 2VIIA 1HT1E 5KPRA 3TQSA 4GKJM 5LMNM 2P5TA 4XBOA 1H6UA 3LQRA 2LWXA 1XWIA 3LVWA 2X4AA 5KQ8A 1NNUC 4G4RA 2KRUA 3FYCA 4G6ZA 4JI6M 1Q3BA 4FCWA 3RGSA 3PNYA 3U5ZB 1XMQM 4LJ5A 1G59A 3AKZA 5FTLA 3HU1A 4GHAA 2NQ8C 1IY1A 3GLIB 4FWDA 4DV0M 4IIWA 3KSXA 1C1KA 1E9RA 3R8FA 3JR5A 3J81S 1L8QA 2LH0A 3SHFA 4DV7M 3SARA 2XH9A 4B3SM 2RKOA 3U61A 1NJGA 1Z6TA 2Y21A 3M6AA 3I4YA 3C58A 1DGGA 4G4QA 3VDPA 2DWLA 4GC5A 3FTCA 5EP3A 1D2NA 7CATA 2YQZA 3HGIA 4LFBM 4JI3M 4I4LA 1E94E 3U6LA 1NNJA 3AOEA 1XHBA 1L1TA 1DGBA 3GLGB 4BBAA 1DGFA 4LFAM 1IN7A 4AZFA 1IXRC 1G4AE 3Q8XA 4JI1M 4PDIA 1NVMA 2H1RA 3FTFA 1TH4A 3FUWA 4GITA 2CE7A 4DR7M 1DO2A 2DWZB 3M0EA 1QQWA 3KW6A 2C5RA 3ZH9B 3PVSA 1S3SA 2CHVA 2XZUA 4WURA 1K82A 1L2CA 3KS4A 1Q39A 5EXXA 2FOIC 4WW0A 2G5GX 3GPUA 4S12A 3U6MA 1Z59A 4DV3M 4QHSA 3L27A 4R3DA 2DZNB 2YR0A 3A42A 3AOGA 2J7NA 3A46A 3SASA 1IXSB 1IN5A 3AJIB 1YSYA 3QWLA 4FCVA 4M0DA 2LNHC 2F5OA 4DV4M 4DV6M 4LG2A 3GRYA 3VK7A 3NWLA 1KSFX 2KXEA 2C9CA 4X66M 3SMPA 3EIHA 4GMQA 4AI6A 1TH2A 3R9XB 3GPYA 1N33M 4LJ4A 4FVMA 4KO8A 3AL0C 5DNYA 3CF2A 1N78A 2QZ4A 5EXSA 1XC8A 4R7GA 1IM2A 5C1BA 2C98A 1NSFA 3FYDA 4FD2A 3J80S 3HJQA 8CATA 3PXGA 4PD2A 3L26A 3L25A 2HCBA 1N34M 4LF8M 4M0WA 3GLFA 3HU2A 5EP4A 2CV2A 3GRRA 4MGIE 3A45A 2XFTA 4JI2M 1XNQM 2ERCA 2X8AA 3T38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXE C; 
#chains in the Genus database with same CATH topology
 1K3X A;  4AKH A;  1D0L A;  1T43 A;  4RF0 A;  2OQ4 A;  2XSZ D;  1J09 A;  4I81 A;  2VQF M;  4RKU F;  1ZV1 A;  3CTW B;  3HWS A;  1UFZ A;  1GLN A;  3KXE C;  1NY5 A;  1D0M A;  3U6P A;  1QAO A;  5EP2 A;  1E32 A;  5BR8 M;  2L7H A;  4AG6 A;  3VDU A;  3GLF E;  3KOW E;  2CFO A;  1R4G A;  4GH9 A;  1YLA A;  2EJS A;  2LBC A;  1OTR A;  1VQ1 A;  2XEP A;  3C3D A;  4IBG A;  4LJA A;  1L2B A;  2EA0 A;  4LF5 M;  2D7E A;  2UUA M;  1DV0 A;  3THG A;  1R7R A;  1GVN A;  2D7G A;  3W0F A;  3UGJ A;  3IG5 A;  4D81 A;  5FTN A;  2ZTC A;  2F5S A;  3FE3 A;  1AUA A;  5KO3 A;  2CHQ A;  2J5Y A;  3RFW A;  3K92 A;  3GPX A;  2MJ5 B;  1SG9 A;  2I7P A;  2H5X A;  1VDL A;  4RF1 A;  2G3Q A;  5KPT A;  4DV1 M;  2DHY A;  4CGY B;  1SXJ B;  3KS8 A;  3SBJ A;  4UN2 B;  2A5Y B;  2HHH M;  5E6J A;  3DZD A;  1LV7 A;  1IY2 A;  3KP1 E;  3BBZ A;  1R2Y A;  4IBB A;  2Q2E B;  3K9O A;  2YFQ A;  4MGY E;  4B3M M;  3HHW A;  4LY6 A;  3B74 A;  1WR1 B;  3HU3 A;  2VQE M;  1QAN A;  1QUS A;  5ITY A;  1DO0 A;  2ZBK B;  3GLH B;  1YE9 A;  4CIS A;  1ZAE A;  1QDT A;  2DWN A;  2JY5 A;  3AFH A;  1GJS A;  3H4M A;  2Y20 A;  2CV1 A;  4MB7 A;  4ZPX A;  4IBJ A;  1QUT A;  3HKP A;  4RNA A;  4OVZ B;  3QAU A;  1N75 A;  2CUZ A;  2LVO C;  1VEJ A;  1N32 M;  1JR3 D;  2DNA A;  3TWL A;  2M5Z A;  2E5L M;  4LZZ A;  2CV0 A;  3SFZ A;  5H37 D;  2RGO A;  3FUV A;  2KDL A;  4AW4 A;  2DAE A;  4X62 M;  2ZM6 M;  1QZE A;  1HJP A;  2KNA A;  3B7Q A;  3DFZ A;  4B08 A;  2R4J A;  4G4N A;  4AKG A;  5ITT A;  2UU9 M;  3KP0 E;  4PT5 A;  4IJE A;  4DUY M;  5FSW A;  4LRS A;  2KNZ A;  3L29 A;  2L09 A;  1Z5C A;  3LCU A;  5FLX S;  2LXE A;  1T3T A;  1G71 A;  3GQ4 A;  5DYI A;  3VKG A;  2R44 A;  3KFU G;  4NL4 H;  3K9P A;  3SYK A;  2VF7 A;  1HQC A;  3FRI A;  2FE8 A;  4JI5 M;  1TGU A;  4FWH A;  4K0K M;  3UMM A;  4HLQ A;  1TDZ A;  1ZQ9 A;  2K47 A;  1BVS A;  3WHL A;  1VEG A;  4FW9 A;  4OVZ A;  3NBI A;  4L15 A;  4KOD A;  3GP1 A;  1Y8G A;  4JN6 A;  1Q3C A;  1OFH A;  1RU3 A;  3GLG A;  4QNM A;  3JR4 A;  3DOA A;  5ITR A;  4DR2 M;  3J2P B;  4JXJ A;  2MR9 A;  4B7G A;  1IQP A;  4QHT A;  1GAB A;  1GL7 A;  3MJ5 A;  4L8R C;  5DFL A;  1P3Q Q;  2JA2 A;  4NSR A;  3VFD A;  1QZM A;  1VG5 A;  2DKL A;  3FTD A;  3K8Z A;  2DXI A;  1VEK A;  4G3O A;  2MH8 A;  1V33 A;  3IG8 A;  3GLH E;  3L2A A;  1ZMW A;  1MN3 A;  3LMM A;  4JI4 M;  2JY8 A;  3GRV A;  3MK6 A;  1PGY A;  1PRB A;  2R6F A;  2OPF A;  4B3R M;  2QSF X;  4DBG B;  1V92 A;  2RGH A;  4LJ9 A;  5ITX E;  3BOS A;  2DZO B;  1WHC A;  3GLF B;  3GQ5 A;  3M7G A;  2QEN A;  3LW5 F;  4WP2 A;  4X65 M;  2R65 A;  5EXT A;  2UXD M;  4LF6 M;  4D80 A;  1OKS A;  1HNZ M;  3KOX E;  1TH3 A;  4M9X A;  4YHH M;  1W5S A;  4Q7J A;  3CF6 E;  2F5Q A;  3UK6 A;  3FUX A;  2LVQ D;  1C7Y A;  3LQQ A;  2KZS A;  1SXJ A;  3D8L A;  4QNR A;  5IRE B;  3HX3 A;  1IN4 A;  3U5Z A;  3TPZ A;  3ZCB B;  3HHY A;  4I8O A;  2ZAM A;  3T1Y M;  3KDS E;  5EXP A;  2L7I A;  4YY3 M;  5GKN A;  4JYA M;  2FFJ A;  3LVV A;  3ZC7 B;  4BLC A;  2DVW B;  3A98 B;  5EP1 A;  2UXC M;  1IN8 A;  2O5R A;  2V6Z M;  3T6P A;  1QAQ A;  3FTE A;  4LGY A;  1QYR A;  4F1I A;  3TL4 X;  1PJJ A;  3I51 A;  2JUJ A;  3MMP A;  1IXS A;  1SXJ E;  1PJQ A;  1VDD A;  2V1C A;  4GKK M;  4MGH A;  4MM3 B;  2DI0 A;  2Z4S A;  5IT9 S;  4IBE A;  2W82 A;  4NC6 A;  1R2Z A;  2F5N A;  1D0K A;  1G41 A;  2DHR A;  2KEB A;  4W5W A;  3T15 A;  4JI8 M;  1N36 M;  2N35 A;  2KNV A;  3HHZ A;  4M9S A;  2CEA A;  2D7H A;  1ORY B;  1IXZ A;  4LJ8 A;  3WHK A;  3SAV A;  3BXW A;  1GKI A;  4L78 A;  3U6D A;  2WSC F;  3E4R A;  2XF3 A;  3D8B A;  2LVN C;  4DV5 M;  3H4J A;  4LFC M;  1EE8 A;  3U6Q A;  1J7K A;  1OFI A;  4II7 A;  4AQY M;  1OAI A;  1SXJ C;  2QHO B;  3FUT A;  1TF0 B;  1IBM M;  5KPZ A;  2QBY B;  4L6V 6;  3SAW A;  2HL7 A;  4MGK E;  3T1H M;  2QCU A;  4IBD A;  4DR5 M;  1NJF A;  4TUW A;  2X49 A;  5IZ7 D;  2L4F A;  3I01 M;  2F5P A;  2M60 A;  2QP9 X;  2HWJ A;  1R6B X;  1XB2 B;  4L16 A;  4DR3 M;  1GO5 A;  1JQJ C;  1HT2 E;  1W5T A;  2MRO B;  3PFI A;  5KQD A;  4CIZ A;  2Z7J A;  4B7F A;  4LRT A;  4DR1 M;  4PCZ A;  1GJT A;  4G4O A;  5FTJ A;  3OTO M;  4LJ7 A;  2BNK A;  2V1U A;  2R45 A;  2Y0Q A;  4IBK A;  4IJF A;  4NOO B;  2UXB M;  1Q02 A;  3GQ3 A;  4NRV A;  4LJ6 A;  3FUU A;  4Y28 F;  3JAM S;  3TWM A;  4LZJ A;  1WGN A;  4NRW A;  4KHP M;  4DV2 M;  2L2D A;  3U6E A;  4LCB A;  3L28 A;  1OIP A;  4GRI A;  2VF8 A;  1IY0 A;  2KRK A;  1X37 A;  3CF0 A;  1PJI A;  2R4E A;  1GL6 A;  3B9P A;  2LVA A;  2G8L A;  2O25 A;  3GLI A;  5A2Q S;  2JNH A;  3HJ8 A;  3GO8 A;  4DR4 M;  2BJV A;  1HQY E;  1Z5A A;  1N77 A;  5FTM A;  1KYI A;  3W67 A;  3SC3 A;  2OO9 A;  2XLJ A;  4OX9 M;  2QPA A;  4GHL A;  3NBX X;  3SHG B;  4ANR A;  4MGZ E;  5C18 A;  3VKH A;  2OOB A;  4P16 A;  2L6O A;  2CRU A;  1FJG M;  1AIP C;  1PJT A;  3I4V A;  5F3W A;  2EKK A;  1K3W A;  1T6O A;  4LF7 M;  4M9Z A;  3B7N A;  2R18 A;  5ITU A;  2WSE F;  4A3V B;  1HR0 M;  2EO2 A;  2XFS A;  1TTE A;  4XK8 F;  1WJ7 A;  2K0B X;  4I5S A;  2K6B A;  2UUC M;  1J5E M;  3GLI E;  4FWG A;  1TDH A;  4L4U A;  1E9S A;  2C9O A;  5ITQ A;  1I94 M;  1YUB A;  2WZJ A;  4QOZ C;  4R71 A;  4IBI A;  3W0L B;  2KA6 B;  1IBK M;  4ITQ A;  1HNW M;  4MH0 E;  3QYE A;  4EIW A;  5LMU M;  4NXN M;  3ZQJ A;  4IBC A;  2I7N A;  1DGH B;  2ZAN A;  3FKE A;  1XXH B;  2R46 A;  3KVW A;  2Z3X A;  3U61 B;  4DUZ M;  2UUB M;  4LGM A;  4GC9 A;  2AHM A;  3FD9 A;  4JI0 M;  2HAK A;  1PM5 A;  2GQF A;  2XGN A;  3GLH A;  3MHV C;  4XGI A;  3TE6 A;  4LF4 M;  2DEN A;  1NY6 A;  2QNJ A;  4D82 A;  4REZ A;  3W68 A;  4OW0 A;  1A5T A;  1I4W A;  4LF9 M;  2JP7 A;  2QBY A;  3RGP A;  2FNA A;  1MX0 A;  2HKJ A;  1F4I A;  3VK8 A;  1HNX M;  4DR6 M;  2O01 F;  2C99 A;  1Z5B A;  2L4E A;  2Z8Y M;  2QQ8 A;  4FCT A;  2LHG A;  5DYG A;  5ITX A;  2DAG A;  3J7A S;  2BJW A;  3I04 M;  3KOZ E;  4IBF A;  1NHW C;  3KSJ A;  5EJC A;  5JI2 E;  2DAI A;  2JY7 A;  3EIE A;  4OU7 A;  4B3T M;  4NXM M;  1XXH A;  4HL4 A;  3U60 B;  3ILK A;  1IBL M;  3HHX A;  5E26 A;  1WXQ A;  5JI3 E;  3AOE C;  2YNM D;  2EUC A;  1NHG C;  4X64 M;  1XNR M;  1MU5 A;  1TR8 A;  4QOS A;  3SAU A;  2R62 A;  2XZF A;  4CHT B;  1JR3 E;  5FTK A;  3GLG E;  1CUK A;  1QVR A;  4NSO B;  4PDG A;  5IWA M;  1L1Z A;  3U60 A;  4Z8X A;  4AG5 A;  2C96 A;  3C9P A;  2KZU A;  3IHP A;  3PNV A;  3K2L A;  3J7B A;  2J7O A;  3SMS A;  3UZU A;  3E21 A;  2Z4R A;  2ZAO A;  4JI7 M;  3Q8G A;  1JR3 A;  3HJS A;  3SYL A;  2CHG A;  3GPP A;  1L2D A;  3J27 B;  1QAM A;  3GRU A;  4Z6Y A;  1UM8 A;  4BB9 A;  4AKI A;  4KT0 F;  2F4V M;  1FNN A;  2DWM A;  3KOY E;  5EQT A;  3UJN A;  2BWB A;  4B7H A;  1OIZ A;  4JV5 M;  2Y0T A;  3DA1 A;  5BPV A;  1G3I A;  4CJ6 A;  3K1J A;  1XMO M;  1G8P A;  1OJL A;  2KW0 A;  1DGH A;  2JWS A;  2XSZ A;  1KFV A;  1IN6 A;  3E9S A;  4P17 A;  3U6S A;  3AV0 A;  1V34 A;  2EKF A;  3RE8 A;  2DAM A;  4KLN A;  3SAT A;  3QYB A;  1QDR A;  3TWK A;  1SXJ D;  2KHH A;  4GIP A;  3U6C A;  3VLF B;  2VII A;  1HT1 E;  1OQY A;  3TQS A;  5KPR A;  1OAO C;  2RRU A;  4GKJ M;  4GEW A;  5LMN M;  2P5T A;  4XBO A;  1H6U A;  2LWX A;  3LQR A;  1XWI A;  3LVW A;  2X4A A;  5KQ8 A;  1NNU C;  1NV9 A;  2KRU A;  3E46 A;  3FYC A;  4G6Z A;  4G4R A;  2BWE A;  4JI6 M;  1Q3B A;  4FCW A;  3RGS A;  3PNY A;  3C3E A;  3U5Z B;  3HZJ A;  1XMQ M;  4LJ5 A;  2JZ0 A;  1G59 A;  1EFU B;  3AKZ A;  5FTL A;  3HU1 A;  3U6O A;  4GHA A;  2NQ8 C;  1IY1 A;  3GLI B;  4FWD A;  4DV0 M;  4IIW A;  3KSX A;  1C1K A;  1E9R A;  3B89 A;  3R8F A;  3JR5 A;  3J81 S;  1L8Q A;  2LH0 A;  3SHF A;  4DV7 M;  3SAR A;  2XH9 A;  4B3S M;  2JXN A;  2RKO A;  3U61 A;  1NJG A;  1Z6T A;  2Y21 A;  3M6A A;  3I4Y A;  3C58 A;  1DGG A;  4G4Q A;  3VDP A;  2DWL A;  1MJG M;  4GC5 A;  3FTC A;  5EP3 A;  1D2N A;  3CGW A;  7CAT A;  2YQZ A;  3HGI A;  2B3T A;  2VDB B;  4LFB M;  4JI3 M;  2MGW A;  2CP8 A;  4I4L A;  1E94 E;  3U6L A;  1NNJ A;  2FH0 A;  3AOE A;  1XHB A;  1L1T A;  1DGB A;  3GLG B;  4BBA A;  1DGF A;  4LFA M;  1IN7 A;  1NV8 A;  4AZF A;  1IXR C;  1G4A E;  3Q8X A;  4JI1 M;  3LCV B;  4PDI A;  1NVM A;  2H1R A;  3FTF A;  1TH4 A;  3FUW A;  2R0I A;  2CE7 A;  4GIT A;  4DR7 M;  1DO2 A;  1PJS A;  2DWZ B;  3M0E A;  1QQW A;  2JY6 B;  3KW6 A;  2OOA A;  3IEC A;  3ZH9 B;  3PVS A;  2C5R A;  1S3S A;  2CHV A;  2XZU A;  2GNO A;  2ZTD A;  4WUR A;  1K82 A;  1EIJ A;  1L2C A;  3KS4 A;  1Q39 A;  1ZMV A;  2JZ1 A;  5EXX A;  1JB0 F;  2FOI C;  4WW0 A;  2G5G X;  3GPU A;  4S12 A;  3F92 A;  1IFY A;  3U6M A;  1Z59 A;  1XXH E;  4DV3 M;  2K9D A;  4QHS A;  2FS1 A;  3L27 A;  4F2L A;  4R3D A;  2DZN B;  5L8R F;  2YR0 A;  2DAK A;  3A42 A;  3AOG A;  2J7N A;  3A46 A;  3SAS A;  1IXS B;  3HY5 A;  2APL A;  2WSF F;  1IN5 A;  3AJI B;  1YSY A;  3QWL A;  2DZL A;  4FCV A;  4M0D A;  2LNH C;  2F5O A;  4DV4 M;  1WIV A;  4DV6 M;  1NO1 A;  3GRY A;  4LG2 A;  3VK7 A;  1KSF X;  2KXE A;  2C9C A;  3NWL A;  4X66 M;  3SMP A;  3EIH A;  4GMQ A;  1LTM A;  4AI6 A;  3V76 A;  1TH2 A;  2LTU A;  3R9X B;  3GPY A;  1N33 M;  4LJ4 A;  2CWB A;  4FVM A;  3B7Z A;  4KO8 A;  3AL0 C;  5DNY A;  2LHC A;  3CF2 A;  1N78 A;  1WGL A;  2QZ4 A;  5EXS A;  1XC8 A;  4R7G A;  1IM2 A;  5C1B A;  2C98 A;  1R5L A;  1NSF A;  3FYD A;  4FD2 A;  3J80 S;  3HJQ A;  8CAT A;  2LVP C;  3PXG A;  4PD2 A;  3L26 A;  3L25 A;  2HCB A;  1N34 M;  4LF8 M;  3FRH A;  4M0W A;  3HU2 A;  3GLF A;  5EP4 A;  2CV2 A;  3GRR A;  4MGI E;  3A45 A;  2XFT A;  4HEO A;  4JI2 M;  1XNQ M;  2ERC A;  1ZMU A;  2X8A A;  3T38 A; 
#chains in the Genus database with same CATH homology
 1K3X A;  4AKH A;  2OQ4 A;  4RF0 A;  2XSZ D;  1J09 A;  4I81 A;  2VQF M;  3CTW B;  3HWS A;  1GLN A;  3KXE C;  1NY5 A;  3U6P A;  1QAO A;  5EP2 A;  1E32 A;  5BR8 M;  2L7H A;  4AG6 A;  3VDU A;  3KOW E;  2CFO A;  4GH9 A;  3JAM S;  1PM5 A;  4LJA A;  2XEP A;  4IBG A;  1L2B A;  2EA0 A;  4LF5 M;  2D7E A;  2UUA M;  3THG A;  1R7R A;  1GVN A;  2D7G A;  3W0F A;  3UGJ A;  3IG5 A;  4D81 A;  5FTN A;  2F5S A;  5KO3 A;  2CHQ A;  3RFW A;  3K92 A;  3GPX A;  2I7P A;  4RF1 A;  5KPT A;  4DV1 M;  4CGY B;  1SXJ B;  3KS8 A;  3SBJ A;  2A5Y B;  2HHH M;  5E6J A;  3DZD A;  1LV7 A;  1IY2 A;  3KP1 E;  1R2Y A;  4IBB A;  2Q2E B;  4MGY E;  2YFQ A;  4B3M M;  3HHW A;  4LY6 A;  2VQE M;  3HU3 A;  1QAN A;  5ITY A;  1DO0 A;  2ZBK B;  3GLH B;  1YE9 A;  4CIS A;  1ZAE A;  2DWN A;  3AFH A;  3H4M A;  2Y20 A;  2CV1 A;  4MB7 A;  4ZPX A;  4IBJ A;  4RNA A;  3HKP A;  4OVZ B;  3QAU A;  1N75 A;  2CUZ A;  1N32 M;  1JR3 D;  3TWL A;  2M5Z A;  2E5L M;  4LZZ A;  2CV0 A;  3SFZ A;  5H37 D;  2RGO A;  3FUV A;  4AW4 A;  4X62 M;  2ZM6 M;  3DFZ A;  4B08 A;  2R4J A;  4G4N A;  4AKG A;  5ITT A;  2UU9 M;  3KP0 E;  4PT5 A;  4IJE A;  4DUY M;  5FSW A;  4LRS A;  3L29 A;  2L09 A;  1Z5C A;  5FLX S;  2LXE A;  1T3T A;  3GQ4 A;  5DYI A;  3VKG A;  3KFU G;  4NL4 H;  3SYK A;  1HQC A;  2FE8 A;  4JI5 M;  1TGU A;  4FWH A;  4K0K M;  3UMM A;  4HLQ A;  1TDZ A;  1ZQ9 A;  2K47 A;  3WHL A;  4FW9 A;  4OVZ A;  3NBI A;  4L15 A;  4KOD A;  3GP1 A;  4JN6 A;  1Q3C A;  1OFH A;  3GLG A;  4QNM A;  3JR4 A;  3DOA A;  5ITR A;  4DR2 M;  3J2P B;  4JXJ A;  4B7G A;  1IQP A;  4QHT A;  1GL7 A;  3MJ5 A;  4L8R C;  4NSR A;  2JA2 A;  3VFD A;  1QZM A;  3K8Z A;  3FTD A;  2DXI A;  3IG8 A;  3L2A A;  3LMM A;  4JI4 M;  3GRV A;  3MK6 A;  2OPF A;  4B3R M;  2RGH A;  4LJ9 A;  5ITX E;  3BOS A;  2DZO B;  3GLF B;  3GQ5 A;  3M7G A;  2QEN A;  4X65 M;  2R65 A;  5EXT A;  2UXD M;  4LF6 M;  4D80 A;  1HNZ M;  3KOX E;  1TH3 A;  4M9X A;  4YHH M;  1W5S A;  3CF6 E;  2F5Q A;  3UK6 A;  3FUX A;  3LQQ A;  2KZS A;  1SXJ A;  3D8L A;  4QNR A;  5IRE B;  1IN4 A;  3U5Z A;  3TPZ A;  3ZCB B;  3HHY A;  4I8O A;  2ZAM A;  3T1Y M;  3KDS E;  5EXP A;  2L7I A;  4YY3 M;  5GKN A;  4JYA M;  2FFJ A;  3LVV A;  3ZC7 B;  4BLC A;  2DVW B;  3A98 B;  5EP1 A;  2UXC M;  1IN8 A;  2O5R A;  2V6Z M;  1QAQ A;  3FTE A;  4LGY A;  1QYR A;  3TL4 X;  1PJJ A;  3I51 A;  1VDD A;  1SXJ E;  2V1C A;  4GKK M;  4MGH A;  4MM3 B;  2Z4S A;  5IT9 S;  4IBE A;  2W82 A;  1R2Z A;  2F5N A;  2DHR A;  1G41 A;  4W5W A;  2KEB A;  3T15 A;  4JI8 M;  1N36 M;  3HHZ A;  4M9S A;  2CEA A;  2D7H A;  1ORY B;  1IXZ A;  4LJ8 A;  3WHK A;  3SAV A;  1GKI A;  4L78 A;  3U6D A;  3E4R A;  2XF3 A;  3D8B A;  4DV5 M;  4LFC M;  1EE8 A;  3U6Q A;  1J7K A;  1OFI A;  4II7 A;  4AQY M;  1SXJ C;  3FUT A;  1IBM M;  5KPZ A;  2QBY B;  3SAW A;  2HL7 A;  4MGK E;  3T1H M;  2QCU A;  4IBD A;  4DR5 M;  1NJF A;  4TUW A;  2X49 A;  5IZ7 D;  2F5P A;  2M60 A;  2QP9 X;  1R6B X;  4L16 A;  4DR3 M;  1JQJ C;  1HT2 E;  1W5T A;  3PFI A;  5KQD A;  4DR1 M;  3U6O A;  2Z7J A;  4B7F A;  4LRT A;  4PCZ A;  4G4O A;  5FTJ A;  3OTO M;  4LJ7 A;  2BNK A;  2V1U A;  2R45 A;  2Y0Q A;  4IBK A;  4IJF A;  4NOO B;  2UXB M;  3GQ3 A;  4NRV A;  4LJ6 A;  3FUU A;  4NRW A;  3TWM A;  4LZJ A;  4KHP M;  4DV2 M;  3U6E A;  4LCB A;  3L28 A;  4GRI A;  1IY0 A;  2KRK A;  1X37 A;  3CF0 A;  1PJI A;  2R4E A;  1GL6 A;  3B9P A;  2G8L A;  3GLI A;  5A2Q S;  3HJ8 A;  3GO8 A;  4DR4 M;  2BJV A;  1HQY E;  1Z5A A;  1N77 A;  5FTM A;  1KYI A;  3SC3 A;  2XLJ A;  4OX9 M;  2QPA A;  4GHL A;  3SHG B;  4MGZ E;  5C18 A;  3VKH A;  4P16 A;  2L6O A;  1FJG M;  3I4V A;  5F3W A;  1K3W A;  4LF7 M;  4M9Z A;  2R18 A;  5ITU A;  4A3V B;  1HR0 M;  2EO2 A;  2XFS A;  4I5S A;  2UUC M;  1J5E M;  4FWG A;  1TDH A;  4L4U A;  1E9S A;  2C9O A;  5ITQ A;  1I94 M;  1YUB A;  4QOZ C;  4IBI A;  3W0L B;  2KA6 B;  1IBK M;  4ITQ A;  1HNW M;  4MH0 E;  4EIW A;  5LMU M;  4NXN M;  4IBC A;  2I7N A;  1DGH B;  2ZAN A;  3FKE A;  1XXH B;  2R46 A;  3KVW A;  2Z3X A;  3U61 B;  4DUZ M;  2UUB M;  4LGM A;  4GC9 A;  2AHM A;  3FD9 A;  4JI0 M;  2XGN A;  3GLH A;  3MHV C;  4XGI A;  3TE6 A;  4LF4 M;  1NY6 A;  4D82 A;  4REZ A;  4OW0 A;  1I4W A;  4LF9 M;  2QBY A;  3RGP A;  2FNA A;  1MX0 A;  2HKJ A;  3VK8 A;  1HNX M;  4DR6 M;  2C99 A;  1Z5B A;  4FCT A;  5DYG A;  5ITX A;  3J7A S;  2BJW A;  3KOZ E;  4IBF A;  1NHW C;  3KSJ A;  5EJC A;  5JI2 E;  3EIE A;  4OU7 A;  4NXM M;  4B3T M;  1XXH A;  4HL4 A;  3U60 B;  3ILK A;  1IBL M;  3HHX A;  5E26 A;  1WXQ A;  5JI3 E;  3AOE C;  2YNM D;  2EUC A;  1NHG C;  4X64 M;  1XNR M;  1MU5 A;  4QOS A;  3SAU A;  2R62 A;  2XZF A;  4CHT B;  5FTK A;  1QVR A;  4NSO B;  4PDG A;  5IWA M;  1L1Z A;  3U60 A;  4Z8X A;  4AG5 A;  2C96 A;  2KZU A;  3PNV A;  3K2L A;  3J7B A;  2J7O A;  3SMS A;  3UZU A;  2Z4R A;  2ZAO A;  4JI7 M;  3SYL A;  1JR3 A;  3HJS A;  2CHG A;  3GPP A;  1L2D A;  3J27 B;  1QAM A;  3GRU A;  4Z6Y A;  1UM8 A;  4BB9 A;  4AKI A;  2F4V M;  1FNN A;  2DWM A;  3KOY E;  5EQT A;  3UJN A;  4B7H A;  4JV5 M;  2Y0T A;  3DA1 A;  5BPV A;  1G3I A;  3K1J A;  1XMO M;  1G8P A;  1OJL A;  2KW0 A;  1DGH A;  2XSZ A;  1KFV A;  1IN6 A;  3E9S A;  3U6S A;  3AV0 A;  3RE8 A;  4KLN A;  3SAT A;  3TWK A;  1SXJ D;  4GIP A;  3U6C A;  3VLF B;  2VII A;  1HT1 E;  5KPR A;  3TQS A;  4GKJ M;  5LMN M;  2P5T A;  4XBO A;  1H6U A;  3LQR A;  2LWX A;  1XWI A;  3LVW A;  2X4A A;  5KQ8 A;  1NNU C;  4G4R A;  2KRU A;  3FYC A;  4G6Z A;  4JI6 M;  1Q3B A;  4FCW A;  3RGS A;  3PNY A;  3U5Z B;  1XMQ M;  4LJ5 A;  1G59 A;  3AKZ A;  5FTL A;  3HU1 A;  4GHA A;  2NQ8 C;  1IY1 A;  3GLI B;  4FWD A;  4DV0 M;  4IIW A;  3KSX A;  1C1K A;  1E9R A;  3R8F A;  3JR5 A;  3J81 S;  1L8Q A;  2LH0 A;  3SHF A;  4DV7 M;  3SAR A;  2XH9 A;  4B3S M;  2RKO A;  3U61 A;  1NJG A;  1Z6T A;  2Y21 A;  3M6A A;  3I4Y A;  3C58 A;  1DGG A;  4G4Q A;  3VDP A;  2DWL A;  4GC5 A;  3FTC A;  5EP3 A;  1D2N A;  7CAT A;  2YQZ A;  3HGI A;  4LFB M;  4JI3 M;  4I4L A;  1E94 E;  3U6L A;  1NNJ A;  3AOE A;  1XHB A;  1L1T A;  1DGB A;  3GLG B;  4BBA A;  1DGF A;  4LFA M;  1IN7 A;  4AZF A;  1IXR C;  1G4A E;  3Q8X A;  4JI1 M;  4PDI A;  1NVM A;  2H1R A;  3FTF A;  1TH4 A;  3FUW A;  4GIT A;  2CE7 A;  4DR7 M;  1DO2 A;  2DWZ B;  3M0E A;  1QQW A;  3KW6 A;  2C5R A;  3ZH9 B;  3PVS A;  1S3S A;  2CHV A;  2XZU A;  4WUR A;  1K82 A;  1L2C A;  3KS4 A;  1Q39 A;  5EXX A;  2FOI C;  4WW0 A;  2G5G X;  3GPU A;  4S12 A;  3U6M A;  1Z59 A;  4DV3 M;  4QHS A;  3L27 A;  4R3D A;  2DZN B;  2YR0 A;  3A42 A;  3AOG A;  2J7N A;  3A46 A;  3SAS A;  1IXS B;  1IN5 A;  3AJI B;  1YSY A;  3QWL A;  4FCV A;  4M0D A;  2LNH C;  2F5O A;  4DV4 M;  4DV6 M;  4LG2 A;  3GRY A;  3VK7 A;  3NWL A;  1KSF X;  2KXE A;  2C9C A;  4X66 M;  3SMP A;  3EIH A;  4GMQ A;  4AI6 A;  1TH2 A;  3R9X B;  3GPY A;  1N33 M;  4LJ4 A;  4FVM A;  4KO8 A;  3AL0 C;  5DNY A;  3CF2 A;  1N78 A;  2QZ4 A;  5EXS A;  1XC8 A;  4R7G A;  1IM2 A;  5C1B A;  2C98 A;  1NSF A;  3FYD A;  4FD2 A;  3J80 S;  3HJQ A;  8CAT A;  3PXG A;  4PD2 A;  3L26 A;  3L25 A;  2HCB A;  1N34 M;  4LF8 M;  4M0W A;  3GLF A;  3HU2 A;  5EP4 A;  2CV2 A;  3GRR A;  4MGI E;  3A45 A;  2XFT A;  4JI2 M;  1XNQ M;  2ERC A;  2X8A A;  3T38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...