3KXEC

A conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
NTSVVLGDHFQAFIDSQVADGRYGSASEVIRAGLRLLEENEAKLAALRAALIEGEESGFIEDFDFDAFIEERSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Conserved Mode of Protein Recognition and Binding in a ParD-ParE Toxin-Antitoxin Complex.
pubmed doi rcsb
source organism Caulobacter crescentus na1000
molecule tags Protein binding
molecule keywords Toxin protein parE-1
total genus 24
structure length 75
sequence length 75
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03693 ParD_antitoxin Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1250 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3kxeC01
3KXEC
chains in the Genus database with same CATH superfamily
4XBOA 5F3WA 2ZTCA 5EP2A 2QHOB 2CWBA 2R18A 3FUTA 2K6BA 3J7AS 2MH8A 2DAKA 1QDRA 2OOBA 2XH9A 4AG5A 2FFJA 4FWGA 2LVPC 2C98A 2LVOC 3F92A 4QOSA 3GLGA 2UXBM 4I4LA 1XNQM 3LQQA 1W5SA 4LCBA 1WIVA 3W68A 1S3SA 3GLGB 4AKIA 3GRYA 2FS1A 2GNOA 3GPXA 2RGOA 4AG6A 5C1BA 1N34M 3KP1E 1C7YA 2QENA 2O25A 2FH0A 5KQ8A 2LVAA 1QYRA 4DV2M 4KO8A 2KNAA 2Z3XA 1F4IA 2YR0A 2GQFA 2ZBKB 3KOXE 1P3QQ 2KRKA 4PDGA 1HNXM 2CE7A 4RF1A 4YHHM 3K2LA 3UGJA 4S12A 3T15A 1PGYA 1IXSB 4QHTA 5KQDA 2KXEA 2XFSA 2QBYB 4OX9M 2JY8A 2C99A 4GEWA 3RGPA 3GLIA 4B3MM 3QAUA 4B3TM 3L2AA 4X62M 2CRUA 2LHGA 3HJ8A 3J81S 2VIIA 3GLIB 2JY6B 5EXSA 2Y0QA 2YQZA 4QHSA 1XWIA 1PJJA 1IN6A 4D82A 2CUZA 1TDZA 1VEKA 3QYBA 3RE8A 2HL7A 5IREB 1X37A 3M0EA 1GKIA 4HEOA 4REZA 2JY7A 3B89A 3J80S 3W0LB 2JZ0A 1T3TA 3U5ZB 1NSFA 1JR3D 1EIJA 4GC5A 4KODA 2QPAA 3UMMA 2ZANA 3JR5A 1G41A 1VEGA 4HL4A 1SXJD 2Q2EB 2VQEM 2DXIA 4JYAM 3QWLA 3SAWA 1TF0B 3Q8GA 1NV9A 1OJLA 4FCTA 5ITXE 4CGYB 5L8RF 1MN3A 5DYIA 2QCUA 5LMUM 4DV4M 2Z4RA 2KNZA 4JI4M 3J2PB 2CV0A 5JI3E 3GLFA 2BWBA 4DR5M 5EP1A 3W0FA 4K0KM 1AUAA 3GLFB 2DHRA 1HNWM 1ZV1A 3U61B 1PM5A 4OVZB 2XLJA 3I51A 5KPZA 3CGWA 4JXJA 4LZZA 1TR8A 1N78A 3VDUA 3LCVB 1KFVA 1NNJA 3SAVA 3H4MA 4F2LA 3CF2A 3L25A 1JQJC 5EP4A 3RFWA 1T6OA 2L7IA 5ITTA 2F5QA 1QDTA 3GLIE 2XZFA 1UM8A 3I04M 3U60A 3FYCA 3AV0A 4JI0M 1NY5A 3AOEA 1H6UA 4NSRA 2F5OA 3CTWB 5BR8M 4G4OA 2DZNB 4RNAA 1IY2A 3A42A 2QZ4A 4HLQA 3NBIA 3GQ5A 1JR3A 2MJ5B 3FUWA 5JI2E 1IM2A 2DWZB 3HKPA 3RGSA 3U6LA 2A5YB 1QAMA 4JI3M 4AKHA 1NNUC 1R5LA 3GO8A 3SBJA 2CHQA 2Z4SA 1HQYE 3R9XB 1WGLA 4II7A 5FTNA 2L4EA 4X64M 3JR4A 2DAMA 1GABA 3KOYE 1IXZA 3WHLA 2G8LA 3W67A 4ANRA 2EUCA 4LFBM 1VG5A 4LF6M 1SXJA 3FTDA 4DR1M 1E32A 1PRBA 2H5XA 2DENA 4FD2A 1SXJB 2BJVA 3T1HM 2CFOA 3ZQJA 3H4JA 1AIPC 1Q39A 1TH3A 3E9SA 5LMNM 1ZQ9A 4LFAM 2V1UA 2L2DA 2D7EA 1NJGA 4FWHA 4LGMA 3L29A 4IBDA 3UK6A 3U6EA 1N75A 2M60A 2LWXA 1MX0A 2RRUA 4AI6A 2DAEA 2KDLA 2R62A 2R0IA 3CF6E 1E9RA 1WXQA 3DA1A 4LJ7A 1OAIA 4WW0A 7CATA 2HAKA 3K9OA 3HU2A 5EXPA 4IBEA 2VDBB 4IBJA 3KS4A 1IXRC 5BPVA 3HWSA 4L15A 5GKNA 4L78A 1YE9A 3KSJA 1ZMVA 3DFZA 1IN8A 3FD9A 1Y8GA 3T38A 3PVSA 3ZCBB 2K47A 2ZAMA 4LJ8A 8CATA 2XGNA 4TUWA 4FWDA 5ITUA 4GHLA 5FLXS 4CHTB 4UN2B 2J7OA 2HWJA 2MROB 4GMQA 3GRUA 3T6PA 2R44A 3FUUA 3U6PA 4B3RM 4NL4H 2MGWA 1IBMM 3VKHA 2R46A 3EIEA 5FTMA 4LJ9A 4BLCA 3LCUA 4QOZC 4GH9A 1PJIA 1RU3A 4GITA 1NHGC 1DGHA 2MR9A 3GLHA 2ZAOA 2EJSA 5IZ7D 3HHZA 1VQ1A 4WP2A 5EJCA 1XNRM 3MJ5A 4LF4M 2XF3A 3FYDA 1DO2A 4LF9M 1GL7A 4DV7M 2F4VM 2KEBA 2Y0TA 3FE3A 4IBBA 4GKJM 1N32M 2CV2A 1OIPA 3TL4X 3PNYA 1IN7A 1BVSA 4IJFA 2EKFA 4NOOB 4RKUF 1HT2E 4LF5M 3U6MA 3TQSA 4B7FA 3B7NA 3KOWE 4B7HA 3HJQA 4KLNA 2C9CA 1XXHA 1Z59A 1GJTA 3C9PA 1OFHA 2KZSA 4NC6A 1DGFA 2Z8YM 4MGIE 4W5WA 3GP1A 1J5EM 2M5ZA 2F5SA 2LVNC 3Q8XA 2YFQA 2V1CA 2K9DA 2KA6B 3I4YA 3GRVA 3IHPA 1IXSA 1J7KA 1QUTA 1HT1E 3BOSA 5KO3A 4LRTA 2LVQD 2I7PA 2EKKA 2KNVA 1Q02A 3D8LA 3HHXA 5FTLA 5ITQA 1K3WA 4MGHA 1ZMUA 3WHKA 2APLA 1Z5CA 3ILKA 2D7GA 4IBKA 4LGYA 3JAMS 4G4QA 3AFHA 4JN6A 1HQCA 4PDIA 3PNVA 3U6SA 1XXHE 2EA0A 3NBXX 4CISA 3AOGA 2XFTA 2RKOA 1DV0A 1D0LA 1JB0F 3TWKA 1R2YA 4Z6YA 1PJSA 2G3QA 2YNMD 4ITQA 1UFZA 2JY5A 3HHWA 1FNNA 3KFUG 3ZH9B 5ITYA 3TE6A 3SAUA 3HZJA 4MGKE 3E21A 5FTKA 3SMSA 1WGNA 3FUVA 2DKLA 3K8ZA 3PFIA 3SYKA 4PD2A 2CEAA 2WSCF 4Z8XA 1WJ7A 5H37D 3K1JA 2LH0A 2DVWB 1GJSA 1T43A 3HU1A 4L16A 2DZLA 1OKSA 1HJPA 4DUYM 5DNYA 4KT0F 2WSFF 3VDPA 1VEJA 1QZEA 3A98B 2JWSA 4FCWA 4MH0E 3CF0A 1QAOA 3FTEA 1EE8A 1VDDA 4I81A 3DOAA 4OVZA 5DYGA 3HX3A 1WR1B 1DGGA 4RF0A 3FRIA 2B3TA 3OTOM 4DV5M 1IBLM 3E4RA 3FRHA 2Z7JA 2CP8A 1HR0M 3HHYA 3FTFA 4DV1M 2V6ZM 5EP3A 4DV0M 3U6CA 1NHWC 1NO1A 1DGHB 3B9PA 1SXJE 1XMQM 4IBIA 5IT9S 2AHMA 1I4WA 4M9XA 3U5ZA 3U60B 4LY6A 1OTRA 4PT5A 4JV5M 4XGIA 3SYLA 3GLGE 4OW0A 1LV7A 1WHCA 4GKKM 4XK8F 4Q7JA 4JI1M 2L4FA 2XSZD 4NSOB 4DR2M 1V34A 2VF7A 3MMPA 3GQ3A 1YSYA 2R4EA 4NXNM 1DO0A 3L26A 4JI8M 2I7NA 4D80A 2C5RA 3SMPA 4D81A 5ITXA 2UXCM 4R7GA 2RGHA 3MK6A 1OIZA 4DV6M 4MGYE 2DAIA 2F5PA 2JP7A 3BBZA 1TH4A 4DV3M 1IQPA 3HJSA 4IJEA 3U61A 4AQYM 1W5TA 3IECA 2KRUA 2DWNA 3SFZA 2R45A 2WZJA 2QBYA 4LFCM 1NJFA 4MM3B 3TWMA 2XZUA 1KSFX 4GC9A 2CHGA 3KXEC 3LMMA 1L1TA 2Y20A 2UUCM 3SASA 1KYIA 2QSFX 4LF7M 2X4AA 4LF8M 1K3XA 2HHHM 4CJ6A 3M6AA 1QUSA 4JI5M 4LRSA 5IWAM 3UJNA 1G8PA 1G71A 2D7HA 3GLFE 1QANA 1XMOM 2QP9X 2J7NA 3C3EA 1N77A 2BNKA 4CIZA 1N33M 3VK8A 5KPTA 4QNRA 3SATA 2HCBA 4JI7M 4MGZE 1K82A 1L8QA 1NY6A 3D8BA 1TH2A 3SHFA 3HGIA 3VK7A 2OOAA 1PJTA 5FSWA 1G59A 4DR4M 1VDLA 5A2QS 3LQRA 5EQTA 1FJGM 3B74A 2Y21A 2FOIC 4GIPA 4AZFA 1I94M 4B7GA 3M7GA 2F5NA 1Q3CA 4YY3M 1ORYB 1XB2B 3GQ4A 3SHGB 2VF8A 4FW9A 3L27A 1OAOC 1QQWA 2R6FA 2C9OA 3R8FA 1L2BA 4G6ZA 2VQFM 1GO5A 3KDSE 4JI2M 2JA2A 4JI6M 2C96A 1SXJC 1GVNA 4GHAA 3A45A 1TGUA 4X66M 2W82A 3GLHE 3A46A 1L2CA 1TDHA 3L28A 1Q3BA 1GL6A 3GLHB 1R7RA 2DAGA 1D0MA 2FNAA 3B7QA 1D2NA 1E9SA 3TWLA 4QNMA 4L8RC 4IBCA 4Y28F 3AL0C 2JZ1A 2BJWA 3AJIB 2FE8A 4M9ZA 3EIHA 3VLFB 3KP0E 4WURA 1OFIA 2N35A 3KOZE 3GPPA 4NXMM 1IY1A 2DWLA 4G4NA 3QYEA 3J27B 2P5TA 3C58A 3LW5F 1G4AE 2O01F 1YLAA 3THGA 3LVWA 1SG9A 1QZMA 3SC3A 1XC8A 3MHVC 2KW0A 3AOEC 2LHCA 5EXXA 3J7BA 2X8AA 2BWEA 4DR6M 2CHVA 1Z5AA 1IBKM 1Z6TA 4R3DA 2ERCA 2QNJA 2E5LM 1XHBA 4MB7A 4IBFA 1A5TA 1R6BX 2JXNA 3BXWA 1YUBA 4M9SA 1IFYA 1E94E 2LXEA 2O5RA 1MJGM 1GLNA 2OO9A 3PXGA 3IG5A 4B3SM 3KSXA 1R4GA 4EIWA 2K0BX 5KPRA 4LJAA 5ITRA 1G3IA 3SARA 2LTUA 2DWMA 1NVMA 2H1RA 4P17A 4OU7A 2J5YA 4M0DA 3C3DA 2LBCA 2G5GX 2L09A 2L7HA 3VKGA 4LJ6A 1HNZM 1C1KA 4LJ5A 2OQ4A 4BB9A 3T1YM 1R2ZA 4R71A 2DZOB 1MU5A 1Z5BA 4IIWA 3TPZA 4F1IA 3I01M 4FCVA 5C18A 2CV1A 4P16A 3KS8A 3NWLA 4DR7M 1ZAEA 4L4UA 4G3OA 2EO2A 1IN5A 1V33A 3HY5A 4DBGB 2UXDM 5E6JA 4I8OA 4LJ4A 3VFDA 1JR3E 1EFUB 4IBGA 1OQYA 2UUAM 3U6DA 2HKJA 4NRWA 4FVMA 1QVRA 4AKGA 2JUJA 1D0KA 2QQ8A 2KZUA 3IG8A 3U6OA 4G4RA 2JNHA 2NQ8C 5EXTA 4B08A 1ZMWA 4L6V6 5DFLA 3UZUA 4DR3M 3B7ZA 1LTMA 2R4JA 2XSZA 4I5SA 3V76A 1V92A 3GRRA 4PCZA 2L6OA 4GRIA 1IY0A 1J09A 2R65A 2XEPA 3K92A 4M0WA 4A3VB 4DUZM 4NRVA 3DZDA 2ZM6M 1L1ZA 4LZJA 2OPFA 4KHPM 4AW4A 4X65M 2ZTDA 3AKZA 3KVWA 4ZPXA 5FTJA 3FTCA 3U6QA 2LNHC 2KHHA 4BBAA 1TTEA 3GPYA 2UUBM 3GPUA 2DNAA 1NV8A 4LG2A 1N36M 2DHYA 1XXHB 5E26A 3ZC7B 3HU3A 1CUKA 2DI0A 2WSEF 1QAQA 3I4VA 1DGBA 3K9PA 3LVVA 2X49A 3E46A 1IN4A 3FKEA 1L2DA 3KW6A 2UU9M 1PJQA 3FUXA
chains in the Genus database with same CATH topology
4XBOA 5F3WA 5EP2A 2R18A 3FUTA 3J7AS 2XH9A 4AG5A 2FFJA 4FWGA 2C98A 4QOSA 3GLGA 2UXBM 4I4LA 1XNQM 3LQQA 1W5SA 4LCBA 3GLGB 1S3SA 4AKIA 3GRYA 3GPXA 2RGOA 4AG6A 5C1BA 1N34M 3KP1E 2QENA 5KQ8A 4DV2M 1QYRA 4KO8A 2Z3XA 2YR0A 2ZBKB 3KOXE 2KRKA 4PDGA 1HNXM 2CE7A 4RF1A 4YHHM 3K2LA 3UGJA 4S12A 3T15A 1IXSB 4QHTA 5KQDA 2KXEA 2XFSA 2QBYB 4OX9M 2C99A 3RGPA 3GLIA 4B3MM 3QAUA 4B3TM 3L2AA 4X62M 3J81S 3HJ8A 3GLIB 2VIIA 5EXSA 2Y0QA 2YQZA 4QHSA 1XWIA 1PJJA 1IN6A 4D82A 2CUZA 1TDZA 3RE8A 2HL7A 5IREB 1X37A 3M0EA 1GKIA 4REZA 3J80S 3W0LB 3U5ZB 1T3TA 1NSFA 1JR3D 4GC5A 4KODA 2QPAA 3UMMA 2ZANA 3JR5A 1G41A 4HL4A 1SXJD 2Q2EB 2VQEM 2DXIA 4JYAM 3QWLA 3SAWA 4FCTA 1OJLA 5ITXE 4CGYB 5DYIA 5LMUM 2QCUA 4DV4M 2Z4RA 4JI4M 3J2PB 2CV0A 5JI3E 3GLFA 4DR5M 5EP1A 3W0FA 4K0KM 3GLFB 2DHRA 1HNWM 3U61B 1PM5A 4OVZB 2XLJA 3I51A 5KPZA 4JXJA 4LZZA 1N78A 3VDUA 1KFVA 1NNJA 3SAVA 3H4MA 3CF2A 3L25A 1JQJC 5EP4A 3RFWA 2L7IA 5ITTA 2F5QA 2XZFA 1UM8A 3U60A 3FYCA 3AV0A 4JI0M 1NY5A 3AOEA 1H6UA 4NSRA 2F5OA 3CTWB 5BR8M 4G4OA 2DZNB 4RNAA 1IY2A 3A42A 2QZ4A 4HLQA 3NBIA 3GQ5A 1JR3A 3FUWA 5JI2E 1IM2A 2DWZB 3HKPA 3RGSA 3U6LA 2A5YB 1QAMA 4JI3M 4AKHA 1NNUC 3GO8A 3SBJA 2CHQA 2Z4SA 1HQYE 3R9XB 4II7A 5FTNA 4X64M 3JR4A 3KOYE 1IXZA 3WHLA 2G8LA 2EUCA 4LFBM 4LF6M 1SXJA 3FTDA 4DR1M 1E32A 4FD2A 1SXJB 2BJVA 3T1HM 2CFOA 1TH3A 1Q39A 3E9SA 5LMNM 1ZQ9A 4LFAM 2V1UA 2D7EA 1NJGA 4FWHA 4LGMA 3L29A 4IBDA 3UK6A 3U6EA 1N75A 2M60A 2LWXA 1MX0A 4AI6A 2R62A 3CF6E 1E9RA 1WXQA 3DA1A 4LJ7A 4WW0A 7CATA 3HU2A 5EXPA 4IBEA 4IBJA 3KS4A 1IXRC 5BPVA 3HWSA 4L15A 5GKNA 4L78A 1YE9A 3KSJA 3FD9A 3DFZA 1IN8A 3T38A 3ZCBB 3PVSA 2K47A 2ZAMA 4LJ8A 8CATA 2XGNA 4TUWA 4FWDA 5ITUA 4GHLA 5FLXS 4CHTB 2J7OA 4GMQA 3GRUA 3FUUA 3U6PA 4B3RM 4NL4H 1IBMM 3VKHA 2R46A 3EIEA 5FTMA 4LJ9A 4BLCA 4QOZC 4GH9A 1PJIA 5IZ7D 4GITA 1NHGC 1DGHA 3GLHA 2ZAOA 3HHZA 5EJCA 1XNRM 3MJ5A 4LF4M 2XF3A 3FYDA 1DO2A 4LF9M 1GL7A 4DV7M 2F4VM 2KEBA 2Y0TA 4IBBA 4GKJM 1N32M 2CV2A 3TL4X 3PNYA 1IN7A 4IJFA 4NOOB 1HT2E 4LF5M 3U6MA 3TQSA 4B7FA 3KOWE 4B7HA 3HJQA 4KLNA 2C9CA 1XXHA 1Z59A 1OFHA 2KZSA 4W5WA 1DGFA 4MGIE 3GP1A 2F5SA 1J5EM 2M5ZA 3Q8XA 2YFQA 2V1CA 2KA6B 3I4YA 3GRVA 1J7KA 1HT1E 3BOSA 5KO3A 4LRTA 3HHXA 2I7PA 5FTLA 3D8LA 5ITQA 1K3WA 4MGHA 3WHKA 1Z5CA 3ILKA 2D7GA 4IBKA 4LGYA 3JAMS 4G4QA 3AFHA 4JN6A 1HQCA 4PDIA 3PNVA 3U6SA 2EA0A 4CISA 3AOGA 2XFTA 2RKOA 3TWKA 1R2YA 4Z6YA 2YNMD 4ITQA 3HHWA 1FNNA 3KFUG 3ZH9B 5ITYA 3TE6A 3SAUA 4MGKE 5FTKA 3SMSA 3PFIA 3K8ZA 3FUVA 3SYKA 5H37D 4PD2A 2CEAA 4Z8XA 3K1JA 2LH0A 2DVWB 3HU1A 4L16A 4DUYM 5DNYA 3VDPA 4FCWA 3A98B 4MH0E 3CF0A 1QAOA 3FTEA 1EE8A 1VDDA 4I81A 3DOAA 4OVZA 5DYGA 4RF0A 1DGGA 3OTOM 1IBLM 4DV5M 3E4RA 2Z7JA 1HR0M 3FTFA 3HHYA 4DV1M 2V6ZM 5EP3A 4DV0M 3U6CA 1NHWC 1DGHB 3B9PA 1SXJE 1XMQM 4IBIA 5IT9S 2AHMA 1I4WA 4M9XA 3U5ZA 3U60B 4LY6A 4PT5A 4JV5M 4XGIA 3SYLA 4OW0A 1LV7A 4GKKM 4JI1M 4NSOB 2XSZD 4DR2M 3GQ3A 1YSYA 2R4EA 4NXNM 1DO0A 3L26A 4JI8M 2I7NA 4D80A 2C5RA 3SMPA 4D81A 5ITXA 2UXCM 4R7GA 2RGHA 3MK6A 4DV6M 4MGYE 2F5PA 1TH4A 4DV3M 1IQPA 3HJSA 4IJEA 3U61A 4AQYM 1W5TA 2KRUA 2DWNA 3SFZA 2R45A 2QBYA 4LFCM 1NJFA 4MM3B 3TWMA 2XZUA 1KSFX 4GC9A 2CHGA 3KXEC 3LMMA 1L1TA 2Y20A 2UUCM 3SASA 1KYIA 4LF7M 2X4AA 4LF8M 1K3XA 2HHHM 3M6AA 4JI5M 4LRSA 5IWAM 3UJNA 1G8PA 2D7HA 1QANA 1XMOM 2QP9X 2J7NA 1N77A 2BNKA 1N33M 3VK8A 5KPTA 4QNRA 3SATA 2HCBA 4JI7M 4MGZE 1K82A 1L8QA 1NY6A 3D8BA 1TH2A 3SHFA 3HGIA 3VK7A 1G59A 5FSWA 4DR4M 5A2QS 3LQRA 5EQTA 1FJGM 4GIPA 2Y21A 2FOIC 4AZFA 1I94M 4B7GA 3M7GA 2F5NA 1Q3CA 4YY3M 1ORYB 3GQ4A 3SHGB 4FW9A 3L27A 1QQWA 2C9OA 3R8FA 1L2BA 4G6ZA 2VQFM 3KDSE 4JI2M 2JA2A 4JI6M 2C96A 1SXJC 1GVNA 4GHAA 3A45A 1TGUA 4X66M 2W82A 3A46A 1L2CA 3L28A 1TDHA 3GLHB 1Q3BA 1GL6A 1R7RA 2FNAA 1D2NA 1E9SA 3TWLA 4QNMA 4L8RC 4IBCA 3AL0C 2BJWA 3AJIB 2FE8A 4M9ZA 3EIHA 3VLFB 3KP0E 4WURA 1OFIA 3KOZE 3GPPA 4NXMM 1IY1A 2DWLA 4G4NA 3J27B 2P5TA 3C58A 1G4AE 3THGA 3LVWA 1QZMA 3SC3A 1XC8A 3MHVC 2KW0A 3AOEC 5EXXA 3J7BA 2X8AA 4DR6M 2CHVA 1Z5AA 1IBKM 1Z6TA 4R3DA 2ERCA 2E5LM 1XHBA 4MB7A 4IBFA 1R6BX 1YUBA 4M9SA 1E94E 2LXEA 2O5RA 1GLNA 3PXGA 3IG5A 4B3SM 3KSXA 4EIWA 5KPRA 4LJAA 5ITRA 1G3IA 3SARA 2DWMA 1NVMA 2H1RA 4OU7A 4M0DA 2G5GX 2L09A 2L7HA 3VKGA 4LJ6A 1HNZM 1C1KA 4LJ5A 2OQ4A 4BB9A 3T1YM 1R2ZA 2DZOB 1MU5A 1Z5BA 4IIWA 3TPZA 5C18A 4FCVA 2CV1A 4P16A 3KS8A 3NWLA 4DR7M 1ZAEA 4L4UA 2EO2A 1IN5A 2UXDM 5E6JA 4I8OA 4LJ4A 3VFDA 4IBGA 2UUAM 3U6DA 2HKJA 4NRWA 4FVMA 1QVRA 4AKGA 2KZUA 3IG8A 3U6OA 4G4RA 2NQ8C 4B08A 5EXTA 3UZUA 4DR3M 2R4JA 2XSZA 4I5SA 4PCZA 3GRRA 2L6OA 4GRIA 1IY0A 1J09A 3K92A 2R65A 2XEPA 4M0WA 4A3VB 4DUZM 4NRVA 3DZDA 2ZM6M 1L1ZA 4LZJA 2OPFA 4KHPM 4AW4A 4X65M 3AKZA 3KVWA 4ZPXA 5FTJA 3FTCA 3U6QA 2LNHC 4BBAA 3GPYA 2UUBM 4LG2A 3GPUA 1N36M 1XXHB 5E26A 3ZC7B 3HU3A 3I4VA 1QAQA 1DGBA 3LVVA 2X49A 1IN4A 3FKEA 1L2DA 3KW6A 2UU9M 3FUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KXE C; 
#chains in the Genus database with same CATH topology
 4XBO A;  5F3W A;  2ZTC A;  5EP2 A;  2QHO B;  2CWB A;  2R18 A;  3FUT A;  2K6B A;  3J7A S;  2MH8 A;  2DAK A;  1QDR A;  2OOB A;  2XH9 A;  4AG5 A;  2FFJ A;  4FWG A;  2LVP C;  2C98 A;  2LVO C;  3F92 A;  4QOS A;  3GLG A;  2UXB M;  4I4L A;  1XNQ M;  3LQQ A;  1W5S A;  4LCB A;  1WIV A;  3W68 A;  1S3S A;  3GLG B;  4AKI A;  3GRY A;  2FS1 A;  2GNO A;  3GPX A;  2RGO A;  4AG6 A;  5C1B A;  1N34 M;  3KP1 E;  1C7Y A;  2QEN A;  2O25 A;  2FH0 A;  5KQ8 A;  2LVA A;  1QYR A;  4DV2 M;  4KO8 A;  2KNA A;  2Z3X A;  1F4I A;  2YR0 A;  2GQF A;  2ZBK B;  3KOX E;  1P3Q Q;  2KRK A;  4PDG A;  1HNX M;  2CE7 A;  4RF1 A;  4YHH M;  3K2L A;  3UGJ A;  4S12 A;  3T15 A;  1PGY A;  1IXS B;  4QHT A;  5KQD A;  2KXE A;  2XFS A;  2QBY B;  4OX9 M;  2JY8 A;  2C99 A;  4GEW A;  3RGP A;  3GLI A;  4B3M M;  3QAU A;  4B3T M;  3L2A A;  4X62 M;  2CRU A;  2LHG A;  3HJ8 A;  3J81 S;  2VII A;  3GLI B;  2JY6 B;  5EXS A;  2Y0Q A;  2YQZ A;  4QHS A;  1XWI A;  1PJJ A;  1IN6 A;  4D82 A;  2CUZ A;  1TDZ A;  1VEK A;  3QYB A;  3RE8 A;  2HL7 A;  5IRE B;  1X37 A;  3M0E A;  1GKI A;  4HEO A;  4REZ A;  2JY7 A;  3B89 A;  3J80 S;  3W0L B;  2JZ0 A;  1T3T A;  3U5Z B;  1NSF A;  1JR3 D;  1EIJ A;  4GC5 A;  4KOD A;  2QPA A;  3UMM A;  2ZAN A;  3JR5 A;  1G41 A;  1VEG A;  4HL4 A;  1SXJ D;  2Q2E B;  2VQE M;  2DXI A;  4JYA M;  3QWL A;  3SAW A;  1TF0 B;  3Q8G A;  1NV9 A;  1OJL A;  4FCT A;  5ITX E;  4CGY B;  5L8R F;  1MN3 A;  5DYI A;  2QCU A;  5LMU M;  4DV4 M;  2Z4R A;  2KNZ A;  4JI4 M;  3J2P B;  2CV0 A;  5JI3 E;  3GLF A;  2BWB A;  4DR5 M;  5EP1 A;  3W0F A;  4K0K M;  1AUA A;  3GLF B;  2DHR A;  1HNW M;  1ZV1 A;  3U61 B;  1PM5 A;  4OVZ B;  2XLJ A;  3I51 A;  5KPZ A;  3CGW A;  4JXJ A;  4LZZ A;  1TR8 A;  1N78 A;  3VDU A;  3LCV B;  1KFV A;  1NNJ A;  3SAV A;  3H4M A;  4F2L A;  3CF2 A;  3L25 A;  1JQJ C;  5EP4 A;  3RFW A;  1T6O A;  2L7I A;  5ITT A;  2F5Q A;  1QDT A;  3GLI E;  2XZF A;  1UM8 A;  3I04 M;  3U60 A;  3FYC A;  3AV0 A;  4JI0 M;  1NY5 A;  3AOE A;  1H6U A;  4NSR A;  2F5O A;  3CTW B;  5BR8 M;  4G4O A;  2DZN B;  4RNA A;  1IY2 A;  3A42 A;  2QZ4 A;  4HLQ A;  3NBI A;  3GQ5 A;  1JR3 A;  2MJ5 B;  3FUW A;  5JI2 E;  1IM2 A;  2DWZ B;  3HKP A;  3RGS A;  3U6L A;  2A5Y B;  1QAM A;  4JI3 M;  4AKH A;  1NNU C;  1R5L A;  3GO8 A;  3SBJ A;  2CHQ A;  2Z4S A;  1HQY E;  3R9X B;  1WGL A;  4II7 A;  5FTN A;  2L4E A;  4X64 M;  3JR4 A;  2DAM A;  1GAB A;  3KOY E;  1IXZ A;  3WHL A;  2G8L A;  3W67 A;  4ANR A;  2EUC A;  4LFB M;  1VG5 A;  4LF6 M;  1SXJ A;  3FTD A;  4DR1 M;  1E32 A;  1PRB A;  2H5X A;  2DEN A;  4FD2 A;  1SXJ B;  2BJV A;  3T1H M;  2CFO A;  3ZQJ A;  3H4J A;  1AIP C;  1Q39 A;  1TH3 A;  3E9S A;  5LMN M;  1ZQ9 A;  4LFA M;  2V1U A;  2L2D A;  2D7E A;  1NJG A;  4FWH A;  4LGM A;  3L29 A;  4IBD A;  3UK6 A;  3U6E A;  1N75 A;  2M60 A;  2LWX A;  1MX0 A;  2RRU A;  4AI6 A;  2DAE A;  2KDL A;  2R62 A;  2R0I A;  3CF6 E;  1E9R A;  1WXQ A;  3DA1 A;  4LJ7 A;  1OAI A;  4WW0 A;  7CAT A;  2HAK A;  3K9O A;  3HU2 A;  5EXP A;  4IBE A;  2VDB B;  4IBJ A;  3KS4 A;  1IXR C;  5BPV A;  3HWS A;  4L15 A;  5GKN A;  4L78 A;  1YE9 A;  3KSJ A;  1ZMV A;  3DFZ A;  1IN8 A;  3FD9 A;  1Y8G A;  3T38 A;  3PVS A;  3ZCB B;  2K47 A;  2ZAM A;  4LJ8 A;  8CAT A;  2XGN A;  4TUW A;  4FWD A;  5ITU A;  4GHL A;  5FLX S;  4CHT B;  4UN2 B;  2J7O A;  2HWJ A;  2MRO B;  4GMQ A;  3GRU A;  3T6P A;  2R44 A;  3FUU A;  3U6P A;  4B3R M;  4NL4 H;  2MGW A;  1IBM M;  3VKH A;  2R46 A;  3EIE A;  5FTM A;  4LJ9 A;  4BLC A;  3LCU A;  4QOZ C;  4GH9 A;  1PJI A;  1RU3 A;  4GIT A;  1NHG C;  1DGH A;  2MR9 A;  3GLH A;  2ZAO A;  2EJS A;  5IZ7 D;  3HHZ A;  1VQ1 A;  4WP2 A;  5EJC A;  1XNR M;  3MJ5 A;  4LF4 M;  2XF3 A;  3FYD A;  1DO2 A;  4LF9 M;  1GL7 A;  4DV7 M;  2F4V M;  2KEB A;  2Y0T A;  3FE3 A;  4IBB A;  4GKJ M;  1N32 M;  2CV2 A;  1OIP A;  3TL4 X;  3PNY A;  1IN7 A;  1BVS A;  4IJF A;  2EKF A;  4NOO B;  4RKU F;  1HT2 E;  4LF5 M;  3U6M A;  3TQS A;  4B7F A;  3B7N A;  3KOW E;  4B7H A;  3HJQ A;  4KLN A;  2C9C A;  1XXH A;  1Z59 A;  1GJT A;  3C9P A;  1OFH A;  2KZS A;  4NC6 A;  1DGF A;  2Z8Y M;  4MGI E;  4W5W A;  3GP1 A;  1J5E M;  2M5Z A;  2F5S A;  2LVN C;  3Q8X A;  2YFQ A;  2V1C A;  2K9D A;  2KA6 B;  3I4Y A;  3GRV A;  3IHP A;  1IXS A;  1J7K A;  1QUT A;  1HT1 E;  3BOS A;  5KO3 A;  4LRT A;  2LVQ D;  2I7P A;  2EKK A;  2KNV A;  1Q02 A;  3D8L A;  3HHX A;  5FTL A;  5ITQ A;  1K3W A;  4MGH A;  1ZMU A;  3WHK A;  2APL A;  1Z5C A;  3ILK A;  2D7G A;  4IBK A;  4LGY A;  3JAM S;  4G4Q A;  3AFH A;  4JN6 A;  1HQC A;  4PDI A;  3PNV A;  3U6S A;  1XXH E;  2EA0 A;  3NBX X;  4CIS A;  3AOG A;  2XFT A;  2RKO A;  1DV0 A;  1D0L A;  1JB0 F;  3TWK A;  1R2Y A;  4Z6Y A;  1PJS A;  2G3Q A;  2YNM D;  4ITQ A;  1UFZ A;  2JY5 A;  3HHW A;  1FNN A;  3KFU G;  3ZH9 B;  5ITY A;  3TE6 A;  3SAU A;  3HZJ A;  4MGK E;  3E21 A;  5FTK A;  3SMS A;  1WGN A;  3FUV A;  2DKL A;  3K8Z A;  3PFI A;  3SYK A;  4PD2 A;  2CEA A;  2WSC F;  4Z8X A;  1WJ7 A;  5H37 D;  3K1J A;  2LH0 A;  2DVW B;  1GJS A;  1T43 A;  3HU1 A;  4L16 A;  2DZL A;  1OKS A;  1HJP A;  4DUY M;  5DNY A;  4KT0 F;  2WSF F;  3VDP A;  1VEJ A;  1QZE A;  3A98 B;  2JWS A;  4FCW A;  4MH0 E;  3CF0 A;  1QAO A;  3FTE A;  1EE8 A;  1VDD A;  4I81 A;  3DOA A;  4OVZ A;  5DYG A;  3HX3 A;  1WR1 B;  1DGG A;  4RF0 A;  3FRI A;  2B3T A;  3OTO M;  4DV5 M;  1IBL M;  3E4R A;  3FRH A;  2Z7J A;  2CP8 A;  1HR0 M;  3HHY A;  3FTF A;  4DV1 M;  2V6Z M;  5EP3 A;  4DV0 M;  3U6C A;  1NHW C;  1NO1 A;  1DGH B;  3B9P A;  1SXJ E;  1XMQ M;  4IBI A;  5IT9 S;  2AHM A;  1I4W A;  4M9X A;  3U5Z A;  3U60 B;  4LY6 A;  1OTR A;  4PT5 A;  4JV5 M;  4XGI A;  3SYL A;  3GLG E;  4OW0 A;  1LV7 A;  1WHC A;  4GKK M;  4XK8 F;  4Q7J A;  4JI1 M;  2L4F A;  2XSZ D;  4NSO B;  4DR2 M;  1V34 A;  2VF7 A;  3MMP A;  3GQ3 A;  1YSY A;  2R4E A;  4NXN M;  1DO0 A;  3L26 A;  4JI8 M;  2I7N A;  4D80 A;  2C5R A;  3SMP A;  4D81 A;  5ITX A;  2UXC M;  4R7G A;  2RGH A;  3MK6 A;  1OIZ A;  4DV6 M;  4MGY E;  2DAI A;  2F5P A;  2JP7 A;  3BBZ A;  1TH4 A;  4DV3 M;  1IQP A;  3HJS A;  4IJE A;  3U61 A;  4AQY M;  1W5T A;  3IEC A;  2KRU A;  2DWN A;  3SFZ A;  2R45 A;  2WZJ A;  2QBY A;  4LFC M;  1NJF A;  4MM3 B;  3TWM A;  2XZU A;  1KSF X;  4GC9 A;  2CHG A;  3KXE C;  3LMM A;  1L1T A;  2Y20 A;  2UUC M;  3SAS A;  1KYI A;  2QSF X;  4LF7 M;  2X4A A;  4LF8 M;  1K3X A;  2HHH M;  4CJ6 A;  3M6A A;  1QUS A;  4JI5 M;  4LRS A;  5IWA M;  3UJN A;  1G8P A;  1G71 A;  2D7H A;  3GLF E;  1QAN A;  1XMO M;  2QP9 X;  2J7N A;  3C3E A;  1N77 A;  2BNK A;  4CIZ A;  1N33 M;  3VK8 A;  5KPT A;  4QNR A;  3SAT A;  2HCB A;  4JI7 M;  4MGZ E;  1K82 A;  1L8Q A;  1NY6 A;  3D8B A;  1TH2 A;  3SHF A;  3HGI A;  3VK7 A;  2OOA A;  1PJT A;  5FSW A;  1G59 A;  4DR4 M;  1VDL A;  5A2Q S;  3LQR A;  5EQT A;  1FJG M;  3B74 A;  2Y21 A;  2FOI C;  4GIP A;  4AZF A;  1I94 M;  4B7G A;  3M7G A;  2F5N A;  1Q3C A;  4YY3 M;  1ORY B;  1XB2 B;  3GQ4 A;  3SHG B;  2VF8 A;  4FW9 A;  3L27 A;  1OAO C;  1QQW A;  2R6F A;  2C9O A;  3R8F A;  1L2B A;  4G6Z A;  2VQF M;  1GO5 A;  3KDS E;  4JI2 M;  2JA2 A;  4JI6 M;  2C96 A;  1SXJ C;  1GVN A;  4GHA A;  3A45 A;  1TGU A;  4X66 M;  2W82 A;  3GLH E;  3A46 A;  1L2C A;  1TDH A;  3L28 A;  1Q3B A;  1GL6 A;  3GLH B;  1R7R A;  2DAG A;  1D0M A;  2FNA A;  3B7Q A;  1D2N A;  1E9S A;  3TWL A;  4QNM A;  4L8R C;  4IBC A;  4Y28 F;  3AL0 C;  2JZ1 A;  2BJW A;  3AJI B;  2FE8 A;  4M9Z A;  3EIH A;  3VLF B;  3KP0 E;  4WUR A;  1OFI A;  2N35 A;  3KOZ E;  3GPP A;  4NXM M;  1IY1 A;  2DWL A;  4G4N A;  3QYE A;  3J27 B;  2P5T A;  3C58 A;  3LW5 F;  1G4A E;  2O01 F;  1YLA A;  3THG A;  3LVW A;  1SG9 A;  1QZM A;  3SC3 A;  1XC8 A;  3MHV C;  2KW0 A;  3AOE C;  2LHC A;  5EXX A;  3J7B A;  2X8A A;  2BWE A;  4DR6 M;  2CHV A;  1Z5A A;  1IBK M;  1Z6T A;  4R3D A;  2ERC A;  2QNJ A;  2E5L M;  1XHB A;  4MB7 A;  4IBF A;  1A5T A;  1R6B X;  2JXN A;  3BXW A;  1YUB A;  4M9S A;  1IFY A;  1E94 E;  2LXE A;  2O5R A;  1MJG M;  1GLN A;  2OO9 A;  3PXG A;  3IG5 A;  4B3S M;  3KSX A;  1R4G A;  4EIW A;  2K0B X;  5KPR A;  4LJA A;  5ITR A;  1G3I A;  3SAR A;  2LTU A;  2DWM A;  1NVM A;  2H1R A;  4P17 A;  4OU7 A;  2J5Y A;  4M0D A;  3C3D A;  2LBC A;  2G5G X;  2L09 A;  2L7H A;  3VKG A;  4LJ6 A;  1HNZ M;  1C1K A;  4LJ5 A;  2OQ4 A;  4BB9 A;  3T1Y M;  1R2Z A;  4R71 A;  2DZO B;  1MU5 A;  1Z5B A;  4IIW A;  3TPZ A;  4F1I A;  3I01 M;  4FCV A;  5C18 A;  2CV1 A;  4P16 A;  3KS8 A;  3NWL A;  4DR7 M;  1ZAE A;  4L4U A;  4G3O A;  2EO2 A;  1IN5 A;  1V33 A;  3HY5 A;  4DBG B;  2UXD M;  5E6J A;  4I8O A;  4LJ4 A;  3VFD A;  1JR3 E;  1EFU B;  4IBG A;  1OQY A;  2UUA M;  3U6D A;  2HKJ A;  4NRW A;  4FVM A;  1QVR A;  4AKG A;  2JUJ A;  1D0K A;  2QQ8 A;  2KZU A;  3IG8 A;  3U6O A;  4G4R A;  2JNH A;  2NQ8 C;  5EXT A;  4B08 A;  1ZMW A;  4L6V 6;  5DFL A;  3UZU A;  4DR3 M;  3B7Z A;  1LTM A;  2R4J A;  2XSZ A;  4I5S A;  3V76 A;  1V92 A;  3GRR A;  4PCZ A;  2L6O A;  4GRI A;  1IY0 A;  1J09 A;  2R65 A;  2XEP A;  3K92 A;  4M0W A;  4A3V B;  4DUZ M;  4NRV A;  3DZD A;  2ZM6 M;  1L1Z A;  4LZJ A;  2OPF A;  4KHP M;  4AW4 A;  4X65 M;  2ZTD A;  3AKZ A;  3KVW A;  4ZPX A;  5FTJ A;  3FTC A;  3U6Q A;  2LNH C;  2KHH A;  4BBA A;  1TTE A;  3GPY A;  2UUB M;  3GPU A;  2DNA A;  1NV8 A;  4LG2 A;  1N36 M;  2DHY A;  1XXH B;  5E26 A;  3ZC7 B;  3HU3 A;  1CUK A;  2DI0 A;  2WSE F;  1QAQ A;  3I4V A;  1DGB A;  3K9P A;  3LVV A;  2X49 A;  3E46 A;  1IN4 A;  3FKE A;  1L2D A;  3KW6 A;  2UU9 M;  1PJQ A;  3FUX A; 
#chains in the Genus database with same CATH homology
 4XBO A;  5F3W A;  5EP2 A;  2R18 A;  3FUT A;  3J7A S;  2XH9 A;  4AG5 A;  2FFJ A;  4FWG A;  2C98 A;  4QOS A;  3GLG A;  2UXB M;  4I4L A;  1XNQ M;  3LQQ A;  1W5S A;  4LCB A;  3GLG B;  1S3S A;  4AKI A;  3GRY A;  3GPX A;  2RGO A;  4AG6 A;  5C1B A;  1N34 M;  3KP1 E;  2QEN A;  5KQ8 A;  4DV2 M;  1QYR A;  4KO8 A;  2Z3X A;  2YR0 A;  2ZBK B;  3KOX E;  2KRK A;  4PDG A;  1HNX M;  2CE7 A;  4RF1 A;  4YHH M;  3K2L A;  3UGJ A;  4S12 A;  3T15 A;  1IXS B;  4QHT A;  5KQD A;  2KXE A;  2XFS A;  2QBY B;  4OX9 M;  2C99 A;  3RGP A;  3GLI A;  4B3M M;  3QAU A;  4B3T M;  3L2A A;  4X62 M;  3J81 S;  3HJ8 A;  3GLI B;  2VII A;  5EXS A;  2Y0Q A;  2YQZ A;  4QHS A;  1XWI A;  1PJJ A;  1IN6 A;  4D82 A;  2CUZ A;  1TDZ A;  3RE8 A;  2HL7 A;  5IRE B;  1X37 A;  3M0E A;  1GKI A;  4REZ A;  3J80 S;  3W0L B;  3U5Z B;  1T3T A;  1NSF A;  1JR3 D;  4GC5 A;  4KOD A;  2QPA A;  3UMM A;  2ZAN A;  3JR5 A;  1G41 A;  4HL4 A;  1SXJ D;  2Q2E B;  2VQE M;  2DXI A;  4JYA M;  3QWL A;  3SAW A;  4FCT A;  1OJL A;  5ITX E;  4CGY B;  5DYI A;  5LMU M;  2QCU A;  4DV4 M;  2Z4R A;  4JI4 M;  3J2P B;  2CV0 A;  5JI3 E;  3GLF A;  4DR5 M;  5EP1 A;  3W0F A;  4K0K M;  3GLF B;  2DHR A;  1HNW M;  3U61 B;  1PM5 A;  4OVZ B;  2XLJ A;  3I51 A;  5KPZ A;  4JXJ A;  4LZZ A;  1N78 A;  3VDU A;  1KFV A;  1NNJ A;  3SAV A;  3H4M A;  3CF2 A;  3L25 A;  1JQJ C;  5EP4 A;  3RFW A;  2L7I A;  5ITT A;  2F5Q A;  2XZF A;  1UM8 A;  3U60 A;  3FYC A;  3AV0 A;  4JI0 M;  1NY5 A;  3AOE A;  1H6U A;  4NSR A;  2F5O A;  3CTW B;  5BR8 M;  4G4O A;  2DZN B;  4RNA A;  1IY2 A;  3A42 A;  2QZ4 A;  4HLQ A;  3NBI A;  3GQ5 A;  1JR3 A;  3FUW A;  5JI2 E;  1IM2 A;  2DWZ B;  3HKP A;  3RGS A;  3U6L A;  2A5Y B;  1QAM A;  4JI3 M;  4AKH A;  1NNU C;  3GO8 A;  3SBJ A;  2CHQ A;  2Z4S A;  1HQY E;  3R9X B;  4II7 A;  5FTN A;  4X64 M;  3JR4 A;  3KOY E;  1IXZ A;  3WHL A;  2G8L A;  2EUC A;  4LFB M;  4LF6 M;  1SXJ A;  3FTD A;  4DR1 M;  1E32 A;  4FD2 A;  1SXJ B;  2BJV A;  3T1H M;  2CFO A;  1TH3 A;  1Q39 A;  3E9S A;  5LMN M;  1ZQ9 A;  4LFA M;  2V1U A;  2D7E A;  1NJG A;  4FWH A;  4LGM A;  3L29 A;  4IBD A;  3UK6 A;  3U6E A;  1N75 A;  2M60 A;  2LWX A;  1MX0 A;  4AI6 A;  2R62 A;  3CF6 E;  1E9R A;  1WXQ A;  3DA1 A;  4LJ7 A;  4WW0 A;  7CAT A;  3HU2 A;  5EXP A;  4IBE A;  4IBJ A;  3KS4 A;  1IXR C;  5BPV A;  3HWS A;  4L15 A;  5GKN A;  4L78 A;  1YE9 A;  3KSJ A;  3FD9 A;  3DFZ A;  1IN8 A;  3T38 A;  3ZCB B;  3PVS A;  2K47 A;  2ZAM A;  4LJ8 A;  8CAT A;  2XGN A;  4TUW A;  4FWD A;  5ITU A;  4GHL A;  5FLX S;  4CHT B;  2J7O A;  4GMQ A;  3GRU A;  3FUU A;  3U6P A;  4B3R M;  4NL4 H;  1IBM M;  3VKH A;  2R46 A;  3EIE A;  5FTM A;  4LJ9 A;  4BLC A;  4QOZ C;  4GH9 A;  1PJI A;  5IZ7 D;  4GIT A;  1NHG C;  1DGH A;  3GLH A;  2ZAO A;  3HHZ A;  5EJC A;  1XNR M;  3MJ5 A;  4LF4 M;  2XF3 A;  3FYD A;  1DO2 A;  4LF9 M;  1GL7 A;  4DV7 M;  2F4V M;  2KEB A;  2Y0T A;  4IBB A;  4GKJ M;  1N32 M;  2CV2 A;  3TL4 X;  3PNY A;  1IN7 A;  4IJF A;  4NOO B;  1HT2 E;  4LF5 M;  3U6M A;  3TQS A;  4B7F A;  3KOW E;  4B7H A;  3HJQ A;  4KLN A;  2C9C A;  1XXH A;  1Z59 A;  1OFH A;  2KZS A;  4W5W A;  1DGF A;  4MGI E;  3GP1 A;  2F5S A;  1J5E M;  2M5Z A;  3Q8X A;  2YFQ A;  2V1C A;  2KA6 B;  3I4Y A;  3GRV A;  1J7K A;  1HT1 E;  3BOS A;  5KO3 A;  4LRT A;  3HHX A;  2I7P A;  5FTL A;  3D8L A;  5ITQ A;  1K3W A;  4MGH A;  3WHK A;  1Z5C A;  3ILK A;  2D7G A;  4IBK A;  4LGY A;  3JAM S;  4G4Q A;  3AFH A;  4JN6 A;  1HQC A;  4PDI A;  3PNV A;  3U6S A;  2EA0 A;  4CIS A;  3AOG A;  2XFT A;  2RKO A;  3TWK A;  1R2Y A;  4Z6Y A;  2YNM D;  4ITQ A;  3HHW A;  1FNN A;  3KFU G;  3ZH9 B;  5ITY A;  3TE6 A;  3SAU A;  4MGK E;  5FTK A;  3SMS A;  3PFI A;  3K8Z A;  3FUV A;  3SYK A;  5H37 D;  4PD2 A;  2CEA A;  4Z8X A;  3K1J A;  2LH0 A;  2DVW B;  3HU1 A;  4L16 A;  4DUY M;  5DNY A;  3VDP A;  4FCW A;  3A98 B;  4MH0 E;  3CF0 A;  1QAO A;  3FTE A;  1EE8 A;  1VDD A;  4I81 A;  3DOA A;  4OVZ A;  5DYG A;  4RF0 A;  1DGG A;  3OTO M;  1IBL M;  4DV5 M;  3E4R A;  2Z7J A;  1HR0 M;  3FTF A;  3HHY A;  4DV1 M;  2V6Z M;  5EP3 A;  4DV0 M;  3U6C A;  1NHW C;  1DGH B;  3B9P A;  1SXJ E;  1XMQ M;  4IBI A;  5IT9 S;  2AHM A;  1I4W A;  4M9X A;  3U5Z A;  3U60 B;  4LY6 A;  4PT5 A;  4JV5 M;  4XGI A;  3SYL A;  4OW0 A;  1LV7 A;  4GKK M;  4JI1 M;  4NSO B;  2XSZ D;  4DR2 M;  3GQ3 A;  1YSY A;  2R4E A;  4NXN M;  1DO0 A;  3L26 A;  4JI8 M;  2I7N A;  4D80 A;  2C5R A;  3SMP A;  4D81 A;  5ITX A;  2UXC M;  4R7G A;  2RGH A;  3MK6 A;  4DV6 M;  4MGY E;  2F5P A;  1TH4 A;  4DV3 M;  1IQP A;  3HJS A;  4IJE A;  3U61 A;  4AQY M;  1W5T A;  2KRU A;  2DWN A;  3SFZ A;  2R45 A;  2QBY A;  4LFC M;  1NJF A;  4MM3 B;  3TWM A;  2XZU A;  1KSF X;  4GC9 A;  2CHG A;  3KXE C;  3LMM A;  1L1T A;  2Y20 A;  2UUC M;  3SAS A;  1KYI A;  4LF7 M;  2X4A A;  4LF8 M;  1K3X A;  2HHH M;  3M6A A;  4JI5 M;  4LRS A;  5IWA M;  3UJN A;  1G8P A;  2D7H A;  1QAN A;  1XMO M;  2QP9 X;  2J7N A;  1N77 A;  2BNK A;  1N33 M;  3VK8 A;  5KPT A;  4QNR A;  3SAT A;  2HCB A;  4JI7 M;  4MGZ E;  1K82 A;  1L8Q A;  1NY6 A;  3D8B A;  1TH2 A;  3SHF A;  3HGI A;  3VK7 A;  1G59 A;  5FSW A;  4DR4 M;  5A2Q S;  3LQR A;  5EQT A;  1FJG M;  4GIP A;  2Y21 A;  2FOI C;  4AZF A;  1I94 M;  4B7G A;  3M7G A;  2F5N A;  1Q3C A;  4YY3 M;  1ORY B;  3GQ4 A;  3SHG B;  4FW9 A;  3L27 A;  1QQW A;  2C9O A;  3R8F A;  1L2B A;  4G6Z A;  2VQF M;  3KDS E;  4JI2 M;  2JA2 A;  4JI6 M;  2C96 A;  1SXJ C;  1GVN A;  4GHA A;  3A45 A;  1TGU A;  4X66 M;  2W82 A;  3A46 A;  1L2C A;  3L28 A;  1TDH A;  3GLH B;  1Q3B A;  1GL6 A;  1R7R A;  2FNA A;  1D2N A;  1E9S A;  3TWL A;  4QNM A;  4L8R C;  4IBC A;  3AL0 C;  2BJW A;  3AJI B;  2FE8 A;  4M9Z A;  3EIH A;  3VLF B;  3KP0 E;  4WUR A;  1OFI A;  3KOZ E;  3GPP A;  4NXM M;  1IY1 A;  2DWL A;  4G4N A;  3J27 B;  2P5T A;  3C58 A;  1G4A E;  3THG A;  3LVW A;  1QZM A;  3SC3 A;  1XC8 A;  3MHV C;  2KW0 A;  3AOE C;  5EXX A;  3J7B A;  2X8A A;  4DR6 M;  2CHV A;  1Z5A A;  1IBK M;  1Z6T A;  4R3D A;  2ERC A;  2E5L M;  1XHB A;  4MB7 A;  4IBF A;  1R6B X;  1YUB A;  4M9S A;  1E94 E;  2LXE A;  2O5R A;  1GLN A;  3PXG A;  3IG5 A;  4B3S M;  3KSX A;  4EIW A;  5KPR A;  4LJA A;  5ITR A;  1G3I A;  3SAR A;  2DWM A;  1NVM A;  2H1R A;  4OU7 A;  4M0D A;  2G5G X;  2L09 A;  2L7H A;  3VKG A;  4LJ6 A;  1HNZ M;  1C1K A;  4LJ5 A;  2OQ4 A;  4BB9 A;  3T1Y M;  1R2Z A;  2DZO B;  1MU5 A;  1Z5B A;  4IIW A;  3TPZ A;  5C18 A;  4FCV A;  2CV1 A;  4P16 A;  3KS8 A;  3NWL A;  4DR7 M;  1ZAE A;  4L4U A;  2EO2 A;  1IN5 A;  2UXD M;  5E6J A;  4I8O A;  4LJ4 A;  3VFD A;  4IBG A;  2UUA M;  3U6D A;  2HKJ A;  4NRW A;  4FVM A;  1QVR A;  4AKG A;  2KZU A;  3IG8 A;  3U6O A;  4G4R A;  2NQ8 C;  4B08 A;  5EXT A;  3UZU A;  4DR3 M;  2R4J A;  2XSZ A;  4I5S A;  4PCZ A;  3GRR A;  2L6O A;  4GRI A;  1IY0 A;  1J09 A;  3K92 A;  2R65 A;  2XEP A;  4M0W A;  4A3V B;  4DUZ M;  4NRV A;  3DZD A;  2ZM6 M;  1L1Z A;  4LZJ A;  2OPF A;  4KHP M;  4AW4 A;  4X65 M;  3AKZ A;  3KVW A;  4ZPX A;  5FTJ A;  3FTC A;  3U6Q A;  2LNH C;  4BBA A;  3GPY A;  2UUB M;  4LG2 A;  3GPU A;  1N36 M;  1XXH B;  5E26 A;  3ZC7 B;  3HU3 A;  3I4V A;  1QAQ A;  1DGB A;  3LVV A;  2X49 A;  1IN4 A;  3FKE A;  1L2D A;  3KW6 A;  2UU9 M;  3FUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...