3KXFD

Crystal structure of sb27 tcr in complex with the 'restriction triad' mutant hla-b*3508-13mer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
b'QKVTQAQTEISVVEDEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSGFYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Hard wiring of T cell receptor specificity for the major histocompatibility complex is underpinned by TCR adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 204
sequence length 204
chains with identical sequence G, M, N
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kxfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kxfD01
1Q94B 4I5BA 4E9LA 3GMPA 1MPAL 1VPOH 3EKCA 4IRJA 4TUJB 2IBZY 1KJ2H 4PRID 3U4EB 3BE1L 1DLFH 1N64H 2FX9H 4KVNH 2ZSVA 4S10A 4XMKL 2IAMD 1AH1A 3HZMA 2E6PA 4PREB 3O6MH 3QIUC 4O2FA 4R2GB 2DQFA 3WL9B 1HYRC 1OM3H 4Q9CA 1LNUB 4IOFD 5HHXL 3GI8H 4JZNA 3CAFA 3VXPB 1RZJC 4HUXB 1DFBH 2BSRB 4HMEA 1RULL 1VGEH 2RGSA 4APQD 4XPHL 4HKJB 1TVBB 5J6HA 4HWEH 4G6MH 5B38G 6FABL 3FRPG 2MQCA 1YEGL 1KBGH 1FIGL 2APXA 2W9EL 2YD2A 4M43H 3ZKND 3IF1A 3KPSD 3VFWA 5HI5D 3MLVL 4V2CB 2R56L 1ZGLA 3MLRL 4FQCH 5IEKB 1IGMH 3GDBA 4NCC2 3BJLA 4ZO9A 1CXHA 3RPIA 5IB3B 2ZNWA 3P9MA 4MMZC 2WIMA 4U6XA 2DYPA 1TJHL 4XXDB 3D69A 3K80A 2EDJA 3H3PH 2R4RH 3V8CA 1WAAE 4O58L 1A5FH 4AH2A 1G7LA 1TQCB 3RRQA 5C0GA 3ZT7A 1I1RA 2WQ8A 3CFJB 3KYNA 2GQHA 3G5XA 1B0GB 4OZGE 2R2HA 1I7RB 1AI1L 3SOBL 1BJMA 1EDQA 3CX2A 4HIHA 4Y1AA 1YQVL 3GSNH 4I18A 3FB5A 3VXUD 4G9FB 4P3WA 4OGXH 4NO0D 5HVWA 5DZOA 2OSLB 1XCQB 3TJHC 1F2XK 1WF5A 4WI9A 4YWGL 5HY9B 3GSQA 5E00A 5E24E 3BKCL 2FL5A 2VLKB 4GSDH 1C5BH 2OMNA 3SDCB 1F4WL 1CD1B 2D03L 2X4SB 3BT2H 3FL7A 3W9EB 1OCWL 1GZQB 4ZFOL 4N8CH 4GLRH 4P5KB 2UWEE 1XH3B 4JHAH 4Z7UF 2AJXL 1X4ZA 3MROA 4IBLT 4NZUH 4JQXC 3W82A 1VGKA 4OLZH 4JANB 3ET9F 3BRGC 4KRPB 5JHLH 2AP2A 3LQZB 4OUOA 4XHJC 2CD0A 4NQDE 5F8QC 1JGDA 3MRJA 5TDNA 4F9PA 1MHCB 1MJJA 2AEWA 1U8JA 2VKWA 4YHPB 1MCOH 2A9NH 2R23B 4R3SA 5F6IC 3MLSL 4N8VG 1TCRB 2A6IB 1H3VA 2CLZB 4MAYD 3T0EC 5GGRA 2A9MH 5J3HD 4N9GA 4YDLC 1P7KA 3V7AE 3PGCA 4JFZH 4XPTL 3HZYB 2DBLL 5CP3H 5GS2D 5T5FH 4OI7A 4NC2B 4Y5VC 1UCTA 3QULB 5E2WL 3OWEA 2Z31B 5GS1B 5L2KD 4M6OH 4WY7H 3LDBB 3NN8A 4UT9L 1OTTC 3LKRB 3HR5B 3O2DA 4M93B 2CJUL 2NR6D 2DF3A 1DQML 4YLQT 5T1DH 3RUGA 2EDNA 4GG6B 4G8GB 2XG5A 1KIPB 1XIWA 4L4TE 5EBLB 1HKFA 3KPNA 1FGVL 1V3KA 3QQ3A 1EMTH 2VERN 3PDOA 3QUKB 3BJ91 2CDEB 1NMBH 1X3DA 4HK3J 3SBWA 5AUMB 3CIQA 2HJFB 4JO1H 5I1HL 1ZGLM 2YA1A 3QO1B 2XNAA 4AENB 4ODHL 2LAGB 4ODWA 5KSAC 3CLEL 1FZOB 4XVJH 3MYZA 5JPMA 5TQ2H 5DVOA 3QSKB 1WCBA 1H15A 3EOBA 3LKPA 5CILL 3VRLF 1PG7H 1TZHB 2NW3A 5I1IH 1MFCL 5INDB 1LP9E 4LVNC 4WGWB 3DXAA 5BMFH 4OZFB 3ULVF 3BN9C 4NQDD 4P9HH 4M8QB 3ALWA 3O4OB 2KH2B 1A6UL 2CKNA 5GGTA 3GIVA 1BQSA 1E6JH 5D5ME 4NP4L 1IKFL 1NMAL 3FHQA 5H94A 3M1BB 3T4AB 5JXED 1KENL 1U41A 5F8RC 5I19H 1RJLB 3WXWL 2EXYD 2I9TA 1HZHH 1T2QH 4RFNC 3L9RB 4NQUA 4U3XA 4H0GA 2VXTL 4PRIA 3IDXL 4ZUWB 1R5VA 2GJ6E 4XBPB 1MCQA 5DDHB 3DO7A 3CLFL 3PWVA 1D5XB 1P4BH 4LLYB 2IAMA 4ZPTB 3TO2B 3O6FC 2ARWA 5CBEA 2GYSA 3IFPB 2O61B 3WS3B 1T3FA 4LKCA 4HS8L 5CZKA 3UDWA 5DXWA 2OLDA 3ARDC 3F12A 2WWMC 1HQ4A 3O9WD 3FB7A 1HQRA 1CFVH 5D9SB 3FQNA 2V5MA 1CD0A 1TZGL 4L4TD 4JG1H 4LSSL 4APQA 4S1SH 4Z8FH 3UBXB 1TENA 2XT1B 3KPTA 4TYUA 2J88L 5C0EA 1ZLWK 2APTA 2RFXA 3I6GB 1D6EB 3KPSA 5B39A 3SJVB 5JNYB 3H3BC 1MNUL 5IW1A 3NABH 4NM8L 3VA6A 5BJTA 4WI4A 1R5IA 4JAMB 4JRWA 5J8OA 1N2RB 1MCBA 1XZ0A 4F7PA 5ITFB 3GMLA 3UTQB 1AGFA 4H26B 4FQJL 1EJOH 3K2MC 4CU6A 1EAPA 2DKSA 1DQDH 4M1CD 2GCYB 3O2WH 1UQSB 4H8WH 2A0LD 2EEAA 1JNJA 3W0WB 3B9KD 3OB0K 1IGFH 1P7QA 3LN4B 4X6EB 3QWRD 4L8SA 2FEDD 4PY7A 2NQCA 5F71A 3MPCA 1ZA3A 3SCMC 3X3GL 1IL1B 3FO0L 1PX4A 3TH3T 1D7FA 2BVQB 3IYLW 1QPPA 3U1SL 5JLZB 1EVUA 1T83A 2DMBA 5IJKC 5I1JH 2MCPL 4NO0A 3PDDA 1N6VA 4U1HA 2BNRE 4PJBA 3KJ6L 3QNYB 3O6KH 4DK6A 3ALPA 4JREB 4CVZA 1J1PL 4FQXB 1A02N 3MGTB 3EYUH 3DRTB 3I3EA 4HFUL 2GJ6D 5GGSY 1IAII 4HKBA 1DBJL 2AK4B 4JRYE 1EUTA 1WZ1H 2Q76B 1RUPH 2IPKA 2XRAL 3H0TB 1I7UA 1W72L 2P8MA 1U3YA 5AWNH 2BOBB 4FG6C 3VXNB 4M5ZL 5CEYA 3QRGH 3BWAA 3TYGL 3ETBF 1N59B 4HUUB 3BKYL 1QLFB 1XGTB 4EUPG 5F9OL 1SVZA 2VNCA 2XTJD 4P5TD 4YFLF 1GJIA 1N4XH 3BP6A 4RGOL 1UWEL 4JDZA 2HTKC 1KJVA 4L5FL 1K4CA 1BPVA 1FL6B 1HEZA 4Z7WB 2ADFL 1KEMH 4PJCF 5FDWA 4EI6B 5CJBA 1HOCA 5AZEL 3VD9A 3O2DH 4NQSA 3FN3A 1UJTA 1KTLB 4QOKE 1WK0A 3TA3A 3TT1H 2BSTA 1P4IH 5ADPH 5DJ0A 4MAYA 2B1AL 3KYKH 4ETQA 5IB2A 4UTBH 2GJJA 4OIIH 1KELL 3JV4A 3DV6B 4ZUVA 3LRGA 4MB5A 2NY0C 2D7PA 3QUYA 4LCYB 1UXWB 1WAAA 2Z91A 3OKYA 4MSWB 1NEZB 4R0LC 3MBEB 2YPLE 3TV3H 3L95A 2OCFD 1K3IA 4MZ3A 1ITBB 3AVEA 3KPQB 4YDKH 5ACZA 5L2KA 1MRDH 1F8TH 2HFGH 1ZHBA 2V5TA 1X6LA 1OLZA 5IBUB 1LK2B 2HH0L 4P2OC 4X5WB 3EYOA 2VAJA 3HC4H 1N3NB 4ISVB 2BNRD 4PJ8D 1U42A 1LD9B 4YAQA 4GH7B 2L0DA 3VCLB 1X5ZA 4WEUD 5EA0L 4NQVB 2HP4A 3VD5A 3CFIC 4M4PA 5GGTH 5F1NB 4GKZA 4RMQA 4TULL 1QFUH 1QG3A 4JRYD 3ZE2F 4NKMA 4JY4B 4UB0H 3EO9L 1DANT 1ETZA 4PGEB 3HI1A 1Q0YH 5TE4H 1CFNB 3AM8A 3DVGA 3BKJH 1HH6A 4X6FA 4MCYA 5IR1A 3SDAB 1KTDB 1S8DB 2UWEA 4P3CL 4RIRB 1JZ4A 4PJ9C 3GFUA 3BPLC 4TQEL 2C1OB 1M7DB 3VXMB 4L8BA 3D0VA 3RDTB 2V7HA 2VABB 3WJLA 5A2FA 3K46A 4KDTA 1KB5L 4GXVL 1OAXL 2VE6B 4NKDA 5DQJA 4EIGB 4ZUSA 1X7QB 5BQ7A 3WN5C 5IW3A 3SDCD 1INDH 4NQDA 3MRLB 1UA6L 5I16A 5HVHC 4LSPH 5HHNA 4PP2A 4PJDB 4UNUA 4QT5A 4Z77A 2APVA 2J7LA 4QOKD 1E4KA 2BERA 4AM0B 4L9LC 4DN4H 1L7IH 2ADJB 1GAFL 2EDWA 1NAMH 3IB4A 5FGBC 5JXEA 5T3ZE 2IG2L 1GIGH 1A1NB 2J2ZA 5HYFA 1QO3B 2DWDB 5CD3A 3CD4A 4FNLL 4EOWH 1JPGA 3P2TA 3PHOB 4PJHF 3VFVA 4FP8H 4IS6B 4X6BB 2YPLD 3LPFA 12E8L 4HLJA 1DJSA 5DUML 2RHEA 4ERSH 4ZQKB 1GSMA 4LBEB 3RA7H 3RVVD 3EOYG 1L7TL 4OD1H 4XRCB 3FQWB 2X9YA 3WUWB 4Z7NF 3AS3A 1OTUC 4U49A 2P5ED 2W07A 1DEEA 3RJQB 3O9WA 4MA8L 2MOVA 2Z4QB 3P73B 1MVUB 2EEDA 4L4TA 2VQ1B 4RAVB 4D9LL 4KI5C 4XCYB 2A73A 1JE6A 4JY6B 3TFKD 1I8IB 3C2SA 3OKKB 2BP3A 3SGEI 1JMXA 1MCHA 2ENYA 1ZT1A 5F96L 2ATPA 2APWA 1CXKA 3X17A 4NT6A 3IXAB 3V0WH 4F8QA 3QIUB 1VFOA 2VIRA 1CFQB 4YUEH 1EO7A 1A7PH 3ARBB 2HWZL 4BFIA 3MQIA 3KYOB 4DCQB 1W72B 5IBTL 3U0PA 4LVHC 1R5WA 3SJVE 2VLRE 5HHVH 3LS5L 5EBGA 5J9PA 1UKSA 3B9KA 1WFNA 3FRUA 3QWRA 5T1KD 2E7MA 5CP7A 1LO0H 1R3HB 2Y5TB 4JCLA 5FK9A 1NGZA 2E9JA 4V1DB 3EO1B 3RWEA 3KHOA 1QBMH 1P9MC 4WUUB 5FUOL 3MMEA 4K3HA 5D5MA 3W0WE 1A3LH 4PJIF 1N0XH 2YPVL 5JW3H 1U8OB 4UT7H 1P53A 5T3ZD 3WO3B 3CCHB 4PJEF 2JB6A 3L3OA 3TBSA 3E6FB 2W91A 4DAGL 1BQUA 2DQJH 5JOPD 2GJ6A 4OM0L 5HSFA 5IB4A 3QEGL 3IVKB 1FVCA 2VDLH 1H5BA 4AT6A 4EQ3A 1AGCA 4YHYC 1Q94A 3X14B 1MCFA 1QVOA 3AB0C 3IDGA 1A9EB 3E3QC 1B0WA 2J4WL 3ARTA 4MLIA 3LB6D 1IGIH 3B83A 3HMWH 4P5TA 5GS2H 2AK4E 1EGJL 4OJFL 4Y4FD 2YK1L 1VEOA 4PREA 1R0AH 1HHIB 4JFHE 4UV7H 2VQUA 4L8DB 4LVEA 4XPGL 4JFPB 2OXGA 2QV2A 3VXPA 4HUXA 4R26H 32C2B 3QG6A 1Z0MA 1K4DB 1LVEA 1TVBA 4KQ3H 4WV1C 3RWFA 4H0HB 1JFQL 3LN5B 4Z7WE 4K7PL 2WNGA 5DA4A 4TNVF 4OCWH 4KHXL 2VLRD 3SJVD 3DX8B 4XX1E 1A7NL 3G5VB 3ABZA 4CVXB 3EYSL 2DL2A 1B4JL 1KB5B 3TIDA 5ILTL 3VG9B 5M7QA 2FD6L 2Y07H 4KV5E 4J8RB 3RWDA 1B90A 3UPAA 1H3WM 5IB3A 5F6IB 1YECL 4JQIL 5EOCJ 4FTVB 2BHYA 4QRRB 5KVGL 1UXSB 3T0EB 4GMSL 4WFGE 5IESL 4Z7OF 4YDLB 4ZNEE 2BNRA 4DQOL 5JW4R 3QUMH 4PJ8A 5A2JH 1C1EH 1NCCH 4AIZB 5SWQB 1B0GA 1UJ3A 1EHNA 4GRMA 3QWQB 1LEKB 2A77L 1FZJB 5JHDB 1AHWA 3VXTB 4Q74A 1G0DA 3SGDH 5CLWA 3VGBA 4JKPH 2CGRH 5KBNC 2XKNB 3ZTNH 3TN0C 4JRYA 1MY7A 4Y2OA 4MXWL 2VRAA 2XA8L 2AK1H 2F8OA 1AC6A 1MJUH 2BMKA 3ALXA 2OSLA 1NLDH 4Z76B 1CT8A 3QXWA 1CVRA 4WFFD 1CFSB 4LSQL 2HLAB 3DHMA 3VFRB 5CEZE 1J11A 1BBDH 4MD5B 1EEUA 4GW1A 2I26N 3C6LD 1MRCH 5JXAH 3PDGA 4N0CC 1CFBA 4PLKC 1IBGL 4HIEA 5F9AC 4DN3L 1CK0L 5J1AA 3SDCA 1Q9WB 2X4SA 4JFHD 1BJ1H 3W9EA 2QHRL 1GZQA 1BQHB 2XXCB 3FQRA 4P5KA 1WWWX 3CFEB 3RHWF 5FYLD 3P0YH 2MSPA 3GI9L 3K7UA 4QOKA 5DJ2A 2ERJC 2A1WL 2H6PB 4BQ8A 4J1UB 4BJLA 1NBQA 5C0RL 3VG0H 4GS7C 5T1MB 1WBYB 5I8OH 4KK9C 3UZQA 3DIFB 1MHCA 4PJDE 5GGRY 5HD8C 5I6XC 3QI9D 5JZ7C 1E27B 2YPLA 1TCRA 1A7OL 4K9EH 4H1LG 2CLZA 4WW1B 5F88B 4F33A 1Z6JT 1BFOB 1JVKA 4NZTL 5TFSH 3QR2A 1U36A 1QYGH 4UQ3B 2P5EA 5CKGA 4RGND 3HZYA 2G2RB 3TIEB 4RMWA 4WFGD 1WTGT 3MBED 4QRQB 1G7QB 1JNHB 4XB8A 1FHGA 3QA3B 3QULA 2VUYA 5GS1A 1T04B 3CZJA 3SQBA 5JMOC 3ARPA 4I1NB 1F58L 3O6FB 1UCBH 4MB3A 2YC1A 4IOIB 3H9ZA 3HG1E 4D8PB 1OTSD 1JV5B 5EBLA 2FB4H 4QTIH 2WBJB 3W9DA 1U95B 1MFEH 4NFCA 4PD4J 5IHZB 2N56A 1NCTA 5HDQL 5SV4A 2CDEA 3AUVA 3H2WA 2QQKL 2YHGA 3VGAC 5CEZD 4X7FC 3U83A 2HJFA 2I27N 3FQXB 5IBLC 2XYCA 2C3XA 3N85H 4RDQF 1WT5C 3QO1A 4AENA 3MLTB 5T1KA 4LQFL 4MQ7B 4P99A 2ED7A 4P2CG 3RTQC 3OR6A 1LO2H 5FF6B 2VYRE 4WW2A 4U1IB 1J12A 2AJYL 4MXQD 1MIML 1MAMH 4BH7B 2B0SL 5INDA 1S9XB 3NIFF 4OZFA 4FQ1L 1EO5A 3GMQB 1JNNL 4M8QA 2BVUA 4V1DE 3PGFH 2J8OA 4XWGH 1PJ9A 1XAUA 4EVNA 2BZDA 4WUUE 2GT9B 5DD6A 1NCBL 1Z0NA 3TJEL 1KLGA 1D9KC 5DSCA 3H42L 2VDPH 4Z7VB 1KACB 4ODVH 3O6LH 3QG7L 3A67L 2BX5A 5F6HI 1W8OA 4AEHH 2ESVE 4G43A 5LQBL 1TJGL 4XBPA 1YA5A 1D5XA 1HYSD 4LLYA 1REIA 3RX7A 1MCKA 4ZPTA 2YZ8A 1BEYL 4Y4FA 1RZFL 1NFDB 1YUHB 3ARZA 4U3CA 1ZS8A 3Q5YA 4R4BB 1WFOA 2WQRA 3STBA 3JWOC 1ZHNA 1V7NL 5H2BB 4JFYB 5I1AB 5DD1L 1T89C 2KZ1B 2SEBB 2FX8H 5I73B 3MRBA 1Y0LA 3V0VB 5BVJA 1RZIB 3HG1D 2AW2A 1RVFL 2WAHA 4AL8L 5HYEA 3JWDH 5C09B 1KPUB 5I18L 4PD4K 3AAZB 2R0ZH 4HJ0C 3MRIB 5F9WC 4KKLC 4HIXH 3I6GA 3CMOH 4F15B 5ESQB 1PY4A 3SJVA 2VLRA 2EIBA 5JNYA 2EH8L 3IKCB 4OLUL 1DL7H 4NC1C 1EO8H 3QIUD 5DURB 5HDBF 3MJ7A 1NSNH 3RKPA 1QLEL 1J7VR 3D18B 4M02A 5ITBL 4CN6A 3KLAB 5A2KH 5DT1L 4BH8A 2VL5B 3CDFA 2D7NA 3H6JA 1MREL 1YNKH 4JFOB 1BLNB 3UCRA 4UT6L 5B8CA 2NY0B 3VD7A 4O2CB 4AJ0A 4O4YL 4B5EA 4YHIA 3QPQC 4V1DD 2ZKHL 4N9OB 2QJDA 4R0LB 5F7UA 2BVQA 3CNKA 3LPGA 2R1WA 4LNVA 4NZRH 5IV2B 3T0EE 4WUUD 4NUJB 1SM3H 1H3PL 1F02I 4WDIB 1QOKA 4DKEL 3QNYA 4G7YL 2HFTA 4YC2C 3QAZB 4FQXA 2ESVD 1K5NB 2XWTB 4K94H 4LHUG 4M62H 5JHDE 3M17A 5E99H 3U7YL 5MEQB 5GRUL 5BVPH 3GO1L 4A6YL 4LLQB 1JF5A 3C6LA 1FBIH 4LDLB 2Q76A 3RIFK 3ZDYF 2IFFH 3KVQA 4XP9H 1BBJA 4NHCL 4ALAL 2BOBA 1WBZB 3K3QA 4HUUA 4XP5H 3S6CA 1XGTA 4G7VH 4IEFB 3FN9A 4OGYH 3MRCA 1BVLB 2VDRL 3QH3B 3CSYA 5SWZB 1IZJA 3F7YB 3QHZL 2OL3B 3D85D 3MUZ1 1RMFH 4HEPG 3TJHD 5TGBA 1YPZF 1FL6A 2AJSL 3KJ4C 4PJ9B 3BPLB 3EDJA 2R0LL 5FYKE 3UEZA 4FFWC 1RZ8B 1WVZA 2I07A 3WN5B 3OG6B 5JDSA 2QSCL 2VDNL 3QI9A 1IEAB 4X7TB 2WIIA 3DX6B 1JZ3A 4P4RA 1RK1B 1VFBB 5HVHB 4OFKA 3WEXA 5CBAA 2YMXH 2IADB 1BM3L 1CXLA 2NZ9D 5LKNA 1YNTA 2D7QA 2P5WB 3I9GH 4L9LB 1G7PB 1MRFL 4UILH 1D5ZB 4MSWA 3T0VA 4XHJD 4ZNEA 3MBEA 3VRIB 4Q7DA 2NNAA 5ACLA 3OJDB 1FZKB 3GMMA 4AZ8A 1T1YA 4O02L 1NCWH 2R15A 1B6DA 1MCSA 1B2WH 3IETB 2NY5C 3FB6B 4KGJA 5EO0A 1LK2A 3T0ED 3IJSA 4B53A 4R4FH 4BFBD 2QQLH 4OSUH 2FO1A 2EC9T 1NCAL 3VCLA 5E03A 1ZLUH 5JHDD 2V6HA 3WHE1 3GRWH 5F1NA 3V95A 3S35L 2IQ9H 2P42B 4UU9B 4OUUB 3HUJB 4G5ZL 5EN2B 5F9DC 4P48A 4JY4A 3GBML 2JB5L 1GPOH 1RZGA 3IXTB 3T65A 2P45B 1OTTD 1X5KA 2F58H 3GHBL 3T4YA 4H25A 2HKHH 4GRWF 5AYUH 3DVIA 1OAKL 4RIRA 5E8PA 3FOMB 5LBSH 2C1OA 1M7DA 3PWPB 1A6PA 3QWOB 2ZUWA 2VE6A 2NTFB 3KPRB 5I74C 3U4BL 1IQWH 4ZO6A 4CMHC 4NIKB 3IGAA 5FYKD 3UO1L 1DQLL 1QSVA 4MQSB 4PR5B 2CDFB 2EDXA 5CJ8A 5LGHL 4PJDA 1UM6H 3ROOB 1MFDL 5EZJB 2FLBT 4AM0A 4DGYL 5KSAD 4R8WL 4PRAB 1T1ZA 3D3VB 3SEPA 3W5NA 3PHQB 4FMKA 4OCNC 3CDYA 1A1NA 1RZ7L 4OF0A 2C1PB 3BN3B 5MEOA 7FABL 4S0TD 2X1PA 3DUUA 4MX7A 3GB7B 4JDVB 4IS6A 5SX5K 4KPHH 4EBQL 4X6BA 4J3XA 3BN9D 4XMPH 1F3DH 1U6AL 4X6DE 2NY6C 4K8RC 2OX5A 2CIKA 4WIQA 1XR8B 3NA9L 1JWSB 4LBEA 4Z0BL 4XNMA 3REWB 1EFXB 4U1JB 4HKZB 1KV3A 3D2UB 4YHYB 4MNHB 4XT1C 2PTVA 1AGBB 3MA9L 2Z4QA 3P73A 1I85C 3AB0B 1J8KA 2UZIH 3HG1A 4RAVA 4RBPK 4PUBH 4XCYA 5JOFB 3UTSE 4NO2B 1PSKH 1NFDE 4M3JA 3FO9B 2YRLA 1T22B 1BWWA 3LHPL 2DOCA 4TSCH 4G3YL 3O6FD 3GIZL 4E42A 1CD8A 4O51B 3QIUA 4JN1H 3QISA 4A6YB 5F89B 1UG9A 4NWTL 5B38B 5C09E 4G6KL 5DHYB 2QL1A 3QQ4B 3ARDD 3HE6C 5IIEB 2WWMD 3T3PE 2O5ZH 3L3IA 1T20B 4YNYA 4HBCH 2EYTB 5I2IA 1KCSL 4YJZL 4PRHB 4QRPD 5KJRL 4OF3A 4G6AC 3KPLB 1MWAH 4QKXB 1J0ZA 4FXGB 4K3JL 3WNLA 3H7LA 4V1DA 5F72S 2ZNXA 5BCAA 1A2YB 4X80H 5FYLH 5HYIA 5JA9A 1WWCA 4WUUA 3WIHL 3ZYIA 1DBKL 1RURL 3U30C 1BD2B 1U8OA 3GHEL 2FIRT 4HH8A 4KVCH 2HLFC 4OLXH 2ESVA 3E6FA 4J23A 3ULUF 3L5JA 2DJUA 1N6UA 3MV9D 1AXTL 4GBXD 3IVKA 4HQQL 2X41A 4O2EB 1ULVA 3SCMD 2P47B 1RK0B 3U6RB 2X44D 5KSVB 2V7NB 1KN4L 3C9NB 4OKVB 1A9EA 5H37G 4YEFA 3LS4L 4F58L 3WSQH 1SBSH 4KXZI 2VZ1A 1N5AB 1A1OB 2YD6A 3QT2A 3WNPA 3IU3B 5D96C 2PW2B 3D85A 1GGCL 4ONGH 3UTSD 4LRNL 1S7VB 3I75A 3I3DA 5IQ7L 2Z8RA 1M7IB 2J5LC 2Y25A 5KZCB 1CU4L 4KUCD 3P4MA 3P0GB 5BOZG 5TDOB 4UIKL 2VDKH 4HIIA 4MWFB 2XFXB 5FO9B 1DDHB 4QHUB 4MA3B 5SWZE 4GAJL 1JF1A 3F62A 1K4DA 5H8DA 4DW2L 1ZGLP 5ISZB 1FZMA 3KXFB 4U1NB 3LN5A 3I6KB 2H32B 3ZO0A 1FLRL 5CEZH 3G5VA 3TO4B 4N8VB 3VGFA 1OB1B 4KROC 5B39G 4CVXA 1V5JA 5F6HJ 3HMXA 4J8RA 5E8OA 3MNWB 5C6TL 2V9QA 3IU4H 4HCRH 5I6XB 2DM7A 3NACH 1S7WA 2XWBB 4LSTH 3U0TB 3V6ZA 2P5WE 4XPAH 5HI4C 5EORL 4OZHF 4YZFE 3VWKC 4OV5B 1UXSA 3T0EA 4XZUB 2AJUL 5GGQL 3V4UL 1UH2A 4JEGB 2X70A 4Y7MA 3DJ9A 4S11A 3ZL4H 2YWZA 3OQ3B 3QHTC 3DWTA 3UPRB 5SWQA 2NY0D 4LSVL 5FO7B 1NMCB 5JHDA 3MLYL 5IHUL 4ZXBD 4Y5VA 3RL1B 2CPCA 3IT8D 3UC0H 1HILB 4PJGB 3KDMB 1NC4D 2NY3C 3QPXL 2R69L 3ZHLA 4QXWA 4XPFH 4P2OD 1QLRB 2JELH 5KANI 2VISB 4L29A 1CBVH 1HCVA 2J8UF 4YBQC 3OAUL 5INCB 1CFSA 2HLAA 1PAMA 1AR1D 3C09C 1E28B 2WP3O 1OW0C 3VFRA 3CC5A 4KI5E 3CU7A 1OY3B 4MD5A 2MFNA 3HUJE 3O4LB 4OF7A 1G9NC 2E6QA 4Y16C 3O3UN 15C8L 1I1CA 5DO2C 5BW7A 2AJ3B 4K7PX 5IW6B 2DQEH 3SKMB 3L6FA 5D2NC 1QR1B 4NJAL 1Q72H 2XZZA 4I2XB 2OR7A 4M6AA 3CFEA 2Q8BH 3PWPE 1NCUA 5KSAA 3LH2H 5LCVL 1AIFA 3RTQB 4J1UA 3MRNB 4JN2B 3RZWA 3UJTL 4MQXD 5KTEL 5J6GB 4PJ9D 5KSBF 5T1MA 3S34H 3EYQC 3QBTB 3DIFA 4DGVL 1LGVA 3CX5J 2E7BA 5TE6H 3SDYL 1E27A 1JTOA 1IGTB 1MY5A 3GMOB 3KLDA 2DKUA 3D3VE 3RVXC 5KAQG 1DSFL 1RZJH 1LO4H 2JJTC 5L6YL 4ODBD 5HGGS 1YEJH 1S7RB 4MD4B 4NGHH 4EXKA 1ADQL 2P5WD 2VXSH 4UQ3A 1U8IB 3HC3H 3P4OB 4FHBD 1D9KB 1KIQA 2G2RA 3TPUB 3TIEA 1FYTB 5FUZH 1QA9A 5D1XC 3BOVA 4OZGF 1UZ8B 4QRQA 2AQ1A 1G7QA 1MHPL 3BMVA 4M1DL 4PGJA 2AS5M 4MXVE 1T04A 5L8KB 4NHUB 4JG0L 1ZV5A 1GHFH 3PWNA 1U8NA 2JJSA 4LLMA 3O6FA 2W0FA 3RZCC 4WJ5A 2VXUL 3ZDZF 1BOYA 2BHUA 3E3QE 3MV01 4FMFA 1OTUD 4HMCA 4AMKL 5IGXL 4KRMB 1U95A 3ARDA 5DD5L 4PG2C 4J3WA 5IHZA 4GUPB 2ARJQ 5K9OA 2GK0B 4ZUTA 5HDOA 4KI5D 5I76A 5DRXB 3MNVB 3B43A 2Z92A 4DTGL 3FQXA 2EZ0C 5F9WB 1JTTA 4QRPA 3L7FA 3MLTA 3MRHB 1J5OL 4IJ3C 4MQ7A 1HKLH 4LLAA 5CD5C 1X5LA 2GSGA 3RWGA 3MFGB 2R4SL 3QEHB 2IQAB 4NZJA 5FF6A 2PR4L 5BV7L 3WXVH 3PWPD 1NANH 1NGQL 4RQQB 4U1IA 3ARFB 3MLZL 4HFWB 2KUTA 2I5YL 3MV7B 3RNKB 3K74B 1EFQA 2BOCA 1JPSL 1AQDB 1SEBA 1J10A 4PTTB 1RUMH 4UIMA 4NO3B 3MRGB 4TPRL 3U9PH 3MLUL 1OPGH 4P46C 4YIQB 3MV9A 4GBXA 4QHNB 4XVTH 2GITB 1DBBL 2VOTA 3G08A 4X6DA 3SCMA 4LCUB 5TH2B 1BD2E 2ZP0T 5JIKA 1ES0A 3BAEL 1CD9B 5IJKA 4YXKL 4KZDL 1ZLWH 1ZLSL 1ACZA 4JY5L 4R96B 3TGXA 3V7AG 3CXDH 4PJ5B 3HB3C 4O5LL 5A16B 4YC2B 1GZPB 2D2OA 3UTSA 1LK3H 1R3IL 3HMXH 4X99A 4XCFL 3MRMB 1NFDA 5IFHL 1YUHA 1OP5K 3VU2A 4KQ4H 4RZCA 1CE1L 4M7LH 1EFXD 3AY4A 5F44A 4MJIE 4AIXA 4EUPB 4WHCA 2C3VB 2SEBA 2HG5B 4OBRA 3WLBA 1CG9B 3OXRA 1P5UA 1RZIA 1SJHB 4QF1B 5GPRA 3G5YB 1NCNA 5IF0B 3BSZL 2NX5E 1KPUA 1XGUA 3OB0H 2ICEA 3U36B 3MRIA 2DQCL 4NQTA 3P0VL 5HHPB 2FZ3B 5FM5O 3TNMB 3P77A 4JB9H 1JYXA 4OF6A 5E2VH 3I84A 1KGCE 2VXQL 2B4CL 5ISZE 1IARB 1A7BA 3BHBA 4OIAA 5E2TL 3STZB 1T7VA 5C0CB 3VXOA 4DFHA 2VDMH 3HLAA 1CQYA 3Q3GB 3KLAA 1I9JH 1U8PB 5DA0B 2LU4A 2VL5A 1LP9F 3WIIH 4LARL 3S97C 2CRYA 4J3SA 2PETA 3HPLA 2DD8L 3OKMB 1MFBH 4CBPA 5DHXB 5FYKH 1FGNL 1F90L 5C0JA 4JJ5B 1L6XA 4IRZH 1FFPB 5IV2A 4ZXBA 4PRBB 1AO7B 3ES6B 1H8OA 2WP3T 3VFPA 4OLVH 4WDIA 1NC4A 4LMQI 4LLUA 1BD2D 1SBBA 5J1TC 1S9KC 4M5YL 1YMMB 4KUZL 3IKKA 2YXMA 4P2OA 5JO5B 2J6EA 2C4FU 1K5NA 1MF2L 4N0FB 5JR1H 4QRUA 2W9DL 4M3KB 3FHAA 5JUEH 4LLWB 3BUYB 5E9DD 4NKQB 4PJGE 4IRJC 2NXYC 2NY1C 3BDYH 1FFRA 5A2LH 4BQ9A 1NJ9B 1ZTXH 5F7KC 3SE4C 4HHAB 4YBHA 3TN0D 3BRDA 4MJID 1CCZA 4P4KD 5DJ8A 1T0MB 3S8WA 5C08B 3QH3A 3RFZC 4P9HC 3F7YA 2F5BL 2LV4A 1FNFA 4GAYA 2OL3A 4LEXH 4R7DA 2NX5D 1EZVX 4DGIH 4PJ9A 5KZCD 5FECB 2IBGA 3L3HB 2ICWI 1RZ8A 4QTHA 2ZCHL 2EE6A 5I74B 1JZ5A 4X7TA 4CMHB 1J9CT 1KGCD 1OAUH 3L7EB 1RK1A 5FB8B 5ISZD 4G8FA 3T1FA 3DETC 2IADA 1CDJA 1FJ1B 4B7IA 2HVJA 2HN7B 2P5WA 4L9LA 5I15H 5DD0H 4I8DA 5EC2B 4OFPA 4I3SL 5FGBA 2AV7B 4QXUL 5LVEA 1JK8B 2F19L 4XAWH 1JGLL 3I50L 1NBVH 2DI9A 5JIIA 4KK9D 1C7SA 5EUOF 1RUQH 4FZ8L 1UFUA 4AK1A 5HD8D 4KK5C 4LKXB 2YKLL 5JZ7D 3FB6A 1N5YH 3BP7A 3H9SB 3SDXB 2YR3A 3LEYH 1J1OL 2YN5A 4MA1C 4FN0A 3O0RH 4NBXB 1NC2B 2FJFA 4P3DB 1TVDA 5D71L 5B4MD 1ED3B 3LCYA 2RCSL 3K4ZA 5HYJE 1CL7H 5EH1A 3IDJB 3RVTC 5EU6E 5GRXG 1RFDH 4AEIH 3HUJA 5EN2A 3I02B 4XMLH 4FQLL 4HEME 1P1ZA 5HI3C 1FP5A 4TSBH 1QFWL 3PQYB 4H8WC 3U7WL 5I17B 4RNRB 2EDEA 4P2RB 2UUDH 4F7TB 1B4RA 2FWOB 5CEXA 5HGBA 4L8CB 3UYRH 1HIML 1QRKA 2ZSWB 3PWPA 2YD3A 1X5YA 1F6AB 3PHSA 3DYMA 3HE6B 5HYQA 4URTB 3SQOH 4K71B 1VPOL 4MDIA 4NKOB 4YFLI 4NC1E 5IBLD 1RUKH 3OXSB 1KJ2L 3FZUC 1LO3H 1NH6A 5H35B 3QUZC 2R8SL 1DLFL 2IBBA 1N64L 2FX9L 4PRAA 3ZYZA 3KS0J 4FQHB 2ARJB 3MV7E 4FA8A 4F9PC 3BKMH 3D9AH 1LMKA 3MYJB 1JNLL 2C3GA 5DQDL 4YHZH 2C1PA 1P9MA 4GW4B 1OM3L 1KG0A 3GI8L 3FT2B 4AY0A 4JM4H 1MLCA 1MLBA 1DFBL 4D0DA 4X5LA 1F00I 5AG9A 5ERWB 5CMAB 4DZ8A 4DFIA 4KKAC 5E08H 1XR8A 1ZHLB 4G6ML 4GMTH 2HMIC 1KBGL 1EFXA 4GW5A 3R1GH 4MNHA 4XP6H 4YXLH 1AGBA 1BZQK 2QADC 4JM2F 4X98B 1AFVH 1JIBA 3EYFB 5JOFA 3MLPA 4XNUH 1IGML 4NO2A 4R6UA 5JOEA 4M9OA 1Q9KA 5HYJD 1II4E 1T22A 3EDKA 5EU6D 4X7SH 5C0AD 3BI9X 1A21A 2UY6A 1QSZA 4GG6F 3H3PL 4U0RC 2R4RL 4O51A 4WNQA 1NLBH 2J5LB 1A5FL 4ZAKD 5F89A 4Z6AT 2JCCE 5DHYA 3QQ4A 5IIEA 3SBWC 1W0WA 2DL9A 4QY8A 4ZPVA 1E0OB 1S5IH 3GSNL 1B3JA 1I9IH 3JV6A 4FQQB 2EYTA 4WV1A 3IDUA 4OGXL 5BO1H 2VXVH 4KKLD 3RKDC 5C7XH 5AD0A 2C26A 3TBTB 4LCWB 5C0CE 2DI7A 3B5HA 4KROB 3MGOB 3MO1A 4YBLC 4DVRH 1HWHB 2D7OA 1BFVL 1UB6B 4HDIB 4JHWH 4XCCH 4OM1H 2MPAH 2HJLB 4GSDL 4PV8B 1C5BL 4XH2A 1BD2A 5BZDB 2O93L 4U6YB 4HJJL 3MRPB 4LLDB 3BT2L 3JUZA 3VWKB 1DE4A 1PX3A 4JFQB 4K07A 1X5AA 3A6BH 4N8CL 4JHAL 3BH9B 2KDGA 1G6VK 2RAMA 4NZUL 5E9DA 1F13A 4OLZL 3IFNL 1F4HA 4O2EA 1RK0A 4XBGB 5CSZB 3QPQD 5KSVA 5JHLL 3C9NA 1YMME 4OKVA 5DMYA 1RHHB 5KG9B 2VZOA 1HHKB 5JPNB 2D7MA 3TN0A 4MJIA 4P4KA 1A1OA 1PEWA 2NY3B 1SJXA 1MCOL 2A9NL 3IU3A 1U9KA 2PW2A 5DRWB 3UDWC 5KS9B 4TVPE 2NX5A 2JIXB 2A9ML 1S7VA 3ARUA 3LMJH 4XP4H 5D2LB 1OGTB 5GGSB 3C09B 5DUBB 2GJZA 4Y16B 5TDOA 4JFZL 5EFIB 3NZ8B 3ZE1E 3FT3B 5DJDA 4MJ4A 4QHUA 4CN1A 1I1FA 5CLTA 5ISZA 5T5FL 3MRRA 2APBA 4U1NA 4M6OL 4WY7L 2AAVA 3QXDA 1X5JA 3WFHB 2H26B 4WFHE 3INUH 4JFDE 2DM4A 1OB1A 1XF4A 3MUJA 4H1LB 1IGJB 1FSKB 5T1DL 5DQ9B 1XGPB 4MHHI 3T08A 4IRSD 4FFWD 3S88H 3QJFB 5C0CD 3MNWA 1KCUH 4I0PC 2XWBA 4JRXB 2F53B 1PY9A 5HDLA 1EMTL 5F1SA 1RJYB 3V7MA 4OV5A 4L8SC 1PEZA 2EEBA 5C0BB 3FQUB 3DURB 2ZUSA 3UPRA 4LU5H 1GRWA 1ZANH 3VXSB 5IP4A 1IAMA 1T83C 1X5IA 5D1XB 5MENB 1SY6A 3ARSA 1PG7L 1SEQL 1MJ7H 3WV0A 1UM4H 3RL1A 1JBJA 4PJGA 3KDMA 2BCKB 5BMFL 1YMMD 1FNGB 4P9HL 1QLRA 2VISA 3RZCB 4OZIB 5F7DB 2A6KB 3VJ6B 4RX4D 1E28A 2NCMA 3OKDA 1E6JL 3ROLA 4U7SA 2VZ3A 2PW1A 4TVPD 5FYJE 3PQYE 3BZDA 5I19L 5IW6A 1BF8A 3SKMA 3MXWH 3FN0H 1T2QL 1C12A 3KYAA 5EOCH 5L8JB 2E7CA 3MRDB 5FKPB 3Q0HA 1A3QA 5FHAH 3LQAL 2OBGA 4Z7WF 1YEDB 4JN2A 1JGEB 4GG8B 4ETYA 1UZ6E 2ZCLH 3D1MC 4WFHD 3TBVB 4UOJA 5J3HC 4JFDD 3OGOE 1RIHH 2CK2A 1U92B 1CFVL 1IGTA 4KV5F 5TF1H 4HWZB 4XX1G 3R4DA 1PZUB 1IC4H 4S1SL 4Z8FL 4P46B 4X9IA 4CADB 1A0QH 4PV9B 1OWWA 5E6IB 1IAIM 1KCLA 3OKLB 4MD4A 2AJVL 5IB1B 5IUSA 5SX4I 4ZG1A 3G6DH 1U8IA 2AJZB 1D9KA 3M8OL 3BMWA 1A6VH 2XZCH 3NABL 4NNXB 3MLXH 3WIHA 4UDTB 3KGRA 5DMIL 2EYSB 2XACC 1HHHA 2MKWA 3TNNA 4IMLB 4Q2ZB 5D93C 5ICYA 5HYJA 3IFOB 3MCKA 5EU6A 2RB8A 1DQDL 5C0AA 2I24N 2AI0L 1PGRB 3O2WL 4H8WL 2NY6D 4K8RD 5FKAA 4HUKB 3T2NH 4WI2A 1JN6B 4MCZA 3C60D 3FONA 5FXCH 1NC2D 4TNWF 3NZHH 4Z18A 4I0KA 5IBUG 4ZAKA 4PGDB 2ICWJ 5I75C 3GUTA 4ZYKB 4BFGA 3WNMA 3C8DA 2EE9A 4KK6C 1LEIB 4ZOCA 2GK0A 5EO9B 1MQKH 1JUFB 2VH5H 5I1JL 5ESAA 4YHNB 5FYJD 1LILA 3O6KL 3T77A 3PQYD 3SO5A 1QQDB 2VSCA 4OLYH 5T1LB 1R3LB 3WJLC 1TCMA 4AG4H 3NVQA 1IAIH 3BEVB 2VKXA 3BYTA 3QEHA 3EYUL 2IQAA 4LK4A 4R7NB 3SE3C 1IM3B 4TUOB 4JR9H 2NLJB 4KAQH 1MCEA 1VFUA 4RQQA 2PXYC 5EC1B 1VA9A 4HFWA 1OAZH 1A4KA 4JGMA 3SY0B 1FVEB 3RNKA 1I8MA 2ICES 1WZ1L 2P49B 1RUPL 1I3VA 4AEEA 3DOSA 4PTTA 4NO3A 1VHPA 3VFGH 4AEFA 4M61B 5AWNL 5IT2H 4WTZG 3QRGL 1DLHB 4U6HA 1JJUA 5BZWB 4Z7QF 4MAUH 5ID1B 1WEJH 4G6AD 4U1KA 2A6DB 3B6SB 4BSVB 4KJQD 4D3CH 4LCUA 5TH2A 1O7VA 4OFYD 2VR4A 1JPFA 4IIQC 2OXHA 3T8XB 2Z8WC 1KEML 1TVHB 4R96A 2Z93B 3ZKSD 5J11C 3O2DL 3NGBB 2EYRA 3TT1L 2HLFD 1P4IL 3C8KB 1GZPA 5ADPL 5GJSH 3KYKL 3MRMA 4I5BB 4UTBL 5EUKA 5KOMC 4OIIL 3GMPB 5GRJH 4IRJB 2NXYB 4ODTH 1HSBA 2BVEA 2C3VA 4QLRA 3S9DB 2ZWLT 3FT4A 1BIHA 5FGRA 1CG9A 1KSRA 1SJHA 4OTXL 2VC2H 2G5BA 3TV3L 5KS9E 2JCCA 4XPHH 4PYHA 3CGTA 4YDKL 5D2LE 3U36A 1OF2A 1MRDL 1U8MA 3LRSA 1F8TL 5F1OB 2HFGL 2YD9A 6FABH 4G6FB 2W9EH 4K9EC 4EDXB 1BQLH 1PKQE 1SY6H 4JO2H 4JZNB 1I75A 5I8KL 1PW3A 1I3GH 2RJMA 4X4MA 5D2NE 5K59F 1C5DB 4IRSA 3MLRH 1WJ3A 4W70A 3STZA 1CLOH 5J6HB 5C0CA 4OV6F 2A0LC 3Q3GA 2YOCA 3VI3E 5GGTL 2P8PB 1S3KH 1QFUL 3B5GA 4PTUA 1WV7T 4UB0L 1T7ZA 2IFGA 1ZGLB 1Q0YL 5TE4L 3BKJL 3UX9B 4KROD 4JRXE 3RPIB 3RU8H 4U6XB 1FFPA 3D69B 3LKNA 2GIYA 4Z95H 2VR5A 5FA3A 1MCPH 4U05A 4MJ6A 5FYKU 5K9QI 5C0BE 4XC1H 4AH2B 1YMMA 1INDL 1MIEH 3VWKD 5JO5A 3NH7H 3G5XB 1A7QH 2R2HB 1UWXK 4LSPL 4RX4A 3BUYA 4HIHB 2C5DC 3VW3L 3WFBL 3AREC 4DN4L 1O5DT 4I18B 1L7IL 1C7TA 3FB5B 3C5ZC 4JQVA 4POZD 1FNSH 1NJ9A 1DEDA 5EZIH 2BY0A 1GIGL 3DX9B 2ADGB 2XTJC 4I48B 4P5TC 4HHAA 4OZIE 2YD1A 1JF6A 4EOWL 5CJXA 1T0MA 4FP8L 4ZFZA 2AJXH 1IEBB 3AMKA 3P9WB 5E00B 4U0QB 2BC4B 1ZOXA 4RFOH 1Z5LA 2JIXD 4ERSL 3RA7L 4OD1L 4TUKH 3G5ZA 1F3JA 1K8IA 5C0ND 4JFDA 1GGYA 2L7JA 3L7EA 3MROB 1VGKB 4PJFE 3SGEH 3JWOH 3TH4T 3PWLA 1FJ1A 5CS7A 2HN7A 1AY1L 3QUZB 1U3JA 4KGLA 1FYHB 4WU7A 5EC2A 3MRJB 1T1WB 5C0FA 1MJJB 2DBLH 3V0WL 1U8JB 5C70A 4YUEL 4Z78A 1A7PL 3EYQD 3O41A 3ZKMD 5GGRB 4N9GB 5KN5B 4JRXD 2EE3A 5I8EA 4YHKH 1P7KB 3UJJH 3RVXD 5IMLA 4UAOB 4QYOB 3C60A 4K3GA 4MJ5A 1BP3B 1NC2A 1DQMH 5FUCC 5ANMA 5C0BD 1AHWC 4Q9BA 4S2SA 1LO0L 1QTYT 1FQ9C 2IPUG 2FDBP 2QADB 1I85A 3IDJA 5KVEH 4OCRH 1MFNA 4NBZB 1QBML 1EHXA 3I02A 1A3LL 1N0XL 4ZSOB 3RUGB 1YZZA 5GSVA 3PQYA 2QTEA 1N26A 4UT7L 5JW3L 4ODHH 3RBSA 1XIWB 4L3CB 2PKDA 4F7TA 5C6WH 3RP1A 1UEYA 3RWIA 3C2AH 2EIEA 3QQ3B 2ZSWA 4M7LT 5FCSH 1F6AA 5JQ6H 1UT9A 2VDLL 5SX5H 2YRZA 4M6NH 5CGTA 2XNAB 1YEFH 1JYWA 3MUY1 4NKOA 4ODWB 4M1GL 2EZ0D 1F42A 4AQ1B 2X4TB 1H15B 3EOBB 3HMWL 4LLVA 2Q1EA 3UMTA 2ZG1A 1HN1A 3NCMA 5EIQA 5M94B 3CSBA 4OFYA 2WUCH 1ZT7A 2IMNA 1R0AL 4RBPH 3DXAB 4UV7L 4GW4A 4FQIH 1QD0A 2XPGA 3C5SA 2VLLB 1CLCA 3GIVB 4OT1H 4LPUA 3CLFH 4NBYB 1VADB 1ZHLA 2Y06H 5H94B 2GKIA 2E27L 4K7FA 1R6VA 3MJ9A 3U79A 2CQVA 1H3GA 4PRIB 1R5VB 4XVSH 3HC0B 3DO7B 1NBZB 1OD9A 1I9RH 3PWVB 3EYFA 3ARGC 1V8HA 2Y07L 2OI9C 1G7IB 5I0ZA 4BK4A 2IALB 4HGMA 3DMMC 1T3FB 4YXHH 3VI4E 2YSSA 5BRZE 1DCLA 4UTAH 3BYYA 2XN9E 3Q5OA 3GM0A 3F12B 2J3SA 1K8DA 4KKBC 1HQ4B 4LP4A 5FA4A 1HQRB 3FQNB 1C1EL 1NCCL 1BZ9A 4APQB 2NY5H 1BJ8A 4KKNA 1NAMB 3S3JA 3ZMRA 2RFXB 1ND0B 4XB7A 2AEQH 3KPSB 5B39B 4FQQA 1O7SA 4JKPL 2CGRL 5DS8B 4RA0C 3ZTNL 5AEAA 4TVPH 2AK1L 1NGXB 4XI5D 1BOGA 1MJUL 1R5IB 3PV6A 3FQTA 1ZEAH 1XZ0B 3DROB 5T1LD 4F7PB 3GMLB 1NLDL 1IJ9A 1A7RL 1UB6A 4MYWB 4Y89A 2YZ1A 1PQZB 5A1AA 4P5MA 4HDIA 5FM8A 2KQMA 1BBDL 3U1SH 1PDKA 3LZFL 4HH9A 5JXAL 1MRCL 1GGBL 4I0PB 4U6YA 1KCVL 3SE8H 3VWKA 2FYYA 2G5RA 4L8SB 3DI2B 5CFHA 1J1PH 4WU5A 1ZA3B 2CIIA 1MJ8H 3BH9A 1KULA 4U1MB 4X9HA 4DK3A 3P0YL 4ENED 1CICC 1AP2A 3NFPA 4Z7VF 2A2QT 3VXUB 3VFUA 1DTUA 2JJVA 4XBGA 3NIDE 5DZNA 2EH7L 5DK2B 2E5EA 1BIIA 1RHHA 5KG9A 3VG0L 2WBKA 4HAFA 4XNZC 4CVZB 5L7XL 5JPNA 3S3PA 4OLWH 4ZUUB 3CPLB 5I8OL 3TYGH 5CUSH 1F3RB 2J8HA 4NNYA 4HKBB 1KJ3H 4LSDA 3FFCE 4TSAH 4K9EL 3RGVC 5KS9A 1NCDH 4HLZH 1E4XI 2JIXA 5D2LA 1GGUA 4L5FH 2IPKB 3Q6FB 3MOBH 3OGCA 4X8XA 5DUBA 3MOQA 3TYFA 2P8MB 5EFIA 2NXYD 2NY1D 3CFKA 1PKQA 5BRZD 5TFSL 4C58B 1OP9A 3NZ8A 4K8RH 3FT3A 1CDYA 1YN6B 2XN9D 5DEFA 5D2NA 5F9JA 3LSOB 3K4DA 4OFVA 3UTZA 3LKSB 4JDZB 4CW1A 1KJVB 1K4CB 1HEZB 5C2BH 2IJ0C 3WFHA 2VUOA 2AGJH 2R39A 3OKOB 4HC1H 5FDWB 3FFDB 1UCBL 2DS4A 1RIUH 1XF2A 2F5AL 2BSTB 4WWID 4F7CB 2FB4L 4QTIL 4X4XA 3NCBB 1MFEL 1GC1C 1HDMB 3EJYD 4JRXA 3X11A 4PPTA 2X9WA 3JV4B 5L88L 2DQDH 2X4PB 5B8CC 2HT2D 4YHOL 4NYLB 2DIJA 2JJTA 4LDEB 3DETD 3Q1SH 3N85L 2Z91B 3T04D 5C0BA 3FQUA 3DURA 3L95B 5L8LB 4OLEA 1N6QH 5ACZB 5L2KB 4KWUA 1LO2L 1ZHBB 5F7EH 3GMRA 5DMKB 5D93B 3TCXA 2BVTA 5GGVL 1KCRH 4KK5D 3EYOB 4LSUH 2W0KA 3RVWD 1FNGA 3FO2B 5C07D 3DGGB 1IQDB 1O0VA 1KLUA 1WIUA 3RZCA 3VD3A 4KFZC 4DKFH 5F7DA 3C08H 1YNLH 5EOQH 3VJ6A 4OCXH 3PGFL 4OD3L 4QRTB 4XWGL 3C87A 3M45A 4L3AA 5I75B 5JW4M 3FFCD 1AQKH 5E7BA 1U0QA 4PG2A 1OAXH 1LDPL 2D7TH 2NY2C 4NKMB 4ZSOE 2QR0A 3C6SB 2VDPL 3RVTD 3O6LL 1T7YA 1ETZB 3HI1B 3MZGB 3GJFK 3V6OC 1I7TB 3MJ9H 1HH6B 4JGJA 4X6FB 1I1AC 2N7AA 4MCYB 2UWEB 2ORBH 3MRDA 2BVOA 3QCVH 4L8BB 2V7HB 1GAFH 4PJFA 4LASH 3QQ9C 5DQJB 4GT7A 1ZLVK 1FNEB 4I4WB 4OAWB 3QUMB 5JW5B 3QI9C 2PXYB 4ZTOH 4N1EA 4FQPA 3KG5A 4Y5YA 1K6QH 5DD3H 4W6WB 3IDMA 1A9BB 4KMTH 1U92A 2GSIA 2FX8L 4PP2B 4QT5B 5DK3A 3K8LA 4D94A 3K8KA 4Z7UE 1PZ5B 4XC3H 3JWDL 4CADA 2I9LA 4RGNC 3FZUD 4PV9A 3WJJC 2R0ZL 1TETH 5IVZB 3QUZD 4HIXL 3BDBA 4G8IA 3BZ4A 3CMOL 3FJTA 5DMGC 5IB1A 1JWUB 3D25A 3RL2A 1PG7X 3ZSSA 1JZ6A 1DL7L 4NJ9H 1FL3A 1EO8L 4GJTB 1FDLH 5D6CA 3RPKA 2D0FA 1NSNL 2X40A 4Q2ZA 3X3FH 3RX5A 5J11B 3IFOA 4KKAD 4LNRA 4NQEE 5FGCB 3T0DA 3BO8B 5F96H 1YNKL 1JN6A 3T2QA 3S96A 3W81A 2HMID 1DEEB 2OK0H 5EIIA 3F7VA 4LIQH 1QEWB 1EH9A 4L4TB 4UINH 4ZYKA 1G1YA 2A73B 1TTFA 1FAIH 5CGYD 2FX7H 5CCKL 4NZDA 1VFAA 4U1LB 1ONQA 1QACA 2Z35A 1IGCH 1KPRA 1SM3L 3DUSB 2YPKA 4YHNA 3SN6N 5K9JH 5E4EC 2VIRB 2XICA 1QQDA 5T1LA 1R3LA 3WFZA 4X6CF 3BEVA 3QDJE 4K94L 5EULV 4M62L 2MNUA 4TUOA 4MNQB 5EC1A 3U0PB 1R5WB 5BVPL 5FUOH 5J9PB 1FVEA 3THMH 1FBIL 5IM7B 3B9KB 5JIHA 4MD0B 1IAKA 2IFFL 3FB8B 4XP9L 3H9YA 4M61A 5CP7B 4F8TA 2FJHA 1G9NH 1OP5H 2V9RA 4XP5L 4G7VL 3RKDD 4BZYA 4OGYL 3W39B 5I1LB 4WWKD 5ID1A 3QDGB 4YEEA 4N90E 3QEGH 4BSVA 1Q9LA 3UPCA 3VRLE 2YBRB 2WANA 4W68A 3T8XA 5DFWH 2JB6B 4CVWA 2X1QA 1TVHA 1DBMH 3ULVE 4RAUB 4LMQE 4EDWH 3VD4A 3C8KA 3VXUE 1FVCB 4PJHB 3HS0A 2QSTA 3CVIH 4N68A 4NUGH 1AGCB 2YK1H 2YMXL 3JV0A 4HPOH 4PLJD 1QVOB 3AREB 3IDGB 3I9GL 3RWHB 1UYWH 1D5IL 1U3ZA 4NQED 4UILL 5BRZA 4U2YA 3OMZA 1T66D 4CMMA 4JZOB 2XN9A 5CZXD 1UWGH 4I3RH 4JE4B 1I9EA 1U93B 2XTJB 3DLQR 4P5TB 3SE4A 2VL4A 1JGVH 3AS1A 4CDGC 1FIEA 4HZLB 5A2IH 1NCWL 3PJSB 3HNSH 1JFQH 1B2WL 4EDXA 1OAQH 5D4QA 1J1XH 4FS0A 4RA3A 2IANB 1A7NH 4NRYB 4RMRA 5D1QC 3B9VA 4R4FL 3LIZH 1C5DA 2QQLL 4OSUL 3QG6B 1RAMA 1JI2A 1FFQA 5T3ZL 5DMJB 4KTDH 4M7ZC 3QDJD 3RWFB 3R8BB 4NQXB 2IQ9L 2P8PA 4P0DA 2Q8AH 5KVGH 3MSPA 3SKOB 2B2XH 4DQOH 3QCTH 3TBWB 1GPOL 2R2EB 1ZVYA 1FFNB 3TIDB 4U6TA 1OSPH 2F58L 3D48R 3O11A 3RWDB 2HKHL 5GZNC 5AYUL 1LE9A 2A77H 4HG4J 2W9LA 4HBQA 4PYGA 4XNYH 4N90D 3O3BA 3C5JB 3NCFB 4D0CA 3W2DH 4I0PD 2COQA 1EUUA 4DEPB 1IQWL 2BNRB 3LAFA 4TRPH 1T1XB 3HI6H 4PJ8B 5C07A 4N0RA 5L2KE 5GRZA 1UJ3B 4GRMB 1KFAH 3ULVD 4BSJA 1UM6L 4UNTA 2DQGH 1AHWB 5C2UB 3FFCA 2WLYA 4JRYB 1CK0H 1NBYA 3U82B 3DX9A 2ADGA 4I48A 2BMKB 1UC6A 2DLTA 3LVEA 4QO1A 2C9AA 5C6PB 1UB5A 1CT8B 3U2SB 4KPHL 4L3EB 4XMPL 3VH8B 1IEBA 5F7NC 2HAZA 2BC4A 4GW1B 4U4BA 4MA7H 5IG7B 4HIEB 4C56D 5J1AB 1MCIA 1PKOA 3VWJD 5J1SC 3FQRB 2JK5A 5IOPB 2DQIH 3B2VL 3EIFA 3FAXA 3ZHKA 1I4FA 2UZIL 2NZ9C 4MJ2A 4QOKB 5DJ2B 1D5MB 4PUBL 1FORL 4NN6C 2VSDA 1NFKA 1PSKL 3QUZA 1JL8A 3T0BA 5DRNA 2Y7QA 1B0RB 4X7DC 3IAGC 3BIBX 1T1WA 4S0SD 3CSPA 5DTFA 1UVQB 4PJCE 4QWWC 2G9HA 2LAAA 4G80A 2YPLB 4YX2H 5J13C 2XWJB 5KN5A 4F33B 5EBWA 2O5ZL 4HG4K 2E7HA 4JFFE 1S9VB 1ZMYA 4HBCL 2CR6A 2P5EB 4QYOA 4PJAF 5E6ZA 4MZ2A 4OQTA 1AGDA 1GYAA 4Y4HC 1AGEA 4P2YA 4HV8A 3ECBB 2AABL 4QHKI 5ID0A 4ZFGL 4RFEA 5KVFH 3D39B 1FRGH 3BX7C 4PGZA 5FGCE 1OHQA 5FYLL 3ARGB 4Y4KC 4H0IA 4JVUA 2QQKH 4KZEH 2VLJE 4NFBA 2YC1B 4ZSOA 2PO6C 2OS7A 3DMMB 5C0DB 4L3CA 3O81A 1U8HA 1KN2H 4OLXL 3W9DB 2ZUYA 5E1AB 4H88H 4L1DA 5BW7C 2Y36H 4DWHA 2CXGA 2VZSA 2BJML 4KK6D 5F70A 4KXZH 5T1KB 3ZE2E 5JMRA 3WSQL 1SBSL 3OR6B 4WCYH 2X4TA 3ESUF 4MNQE 1ZWIA 3V9FA 3N1QC 4WWKA 4RMTA 4J3OC 4WW2B 2FEEL 1U91A 3VXQB 4Z7UA 2EKSB 2VR9A 2LVCA 2R1YB 1NCBH 4S1RL 4ONGL 1SHMA 3TZVC 4MB4A 2PXYD 5L0QB 1VEPA 2JF1A 5ETUA 1ZXQA 5E95B 2VLLA 2VDKL 4TOYH 5HGDA 2UV3A 1IGYA 1WFUA 3QDGE 1CFTB 4EVNB 1VADA 5DD6B 2FHBA 2HT3D 2AQ3A 1KLGB 2ZOKA 3HN3A 4F3FA 5DSCB 1HCFX 3VFOA 1RQ5A 4JFFD 4NQEA 4G43B 5CEZL 1S7XA 4RMVA 3HC0A 5CHNB 1NBZA 1B9ZA 4XNZB 3SPVA 4PJHE 3TF7C 1K2DA 2JJSC 2ENSA 1G7IA 4Y4FB 5DC4B 5I18H 3IU4L 1TDQA 4LSTL 3NACL 2IALA 4XPAL 3BWUC 1ZS8B 1DANU 4PJ7B 1ZHNB 4C4KT 3O3AB 2VLJD 3G6JF 4N5ED 3RWJB 4E5XA 3KS0H 2XTJE 3MRBB 3VFNB 4Z7NE 1Y0LB 5BVJB 3ZL4L 3UTOA 2BDNH 1H3TA 4WO4D 1NAMA 2P48B 3QDJA 1BFSA 4D9RE 1UEMA 1ND0A 5JDJA 3W11C 2VLRB 5DS8A 2IANE 3UC0L 5IROA 4P9MH 4YHMH 2Y4SA 3IDYB 1NGXA 3BDXA 5DVLA 3MJ7B 5DVKA 2M8XA 3DROA 3EOTH 4XPFL 4B7LA 2M26A 2JELL 1CBVL 25C8H 4MNQD 2MJWA 1PQZA 4BH8B 2OJZH 1AD9A 4HT1H 2X1XR 4I0PA 1JHLL 1PFCA 4DKEH 3HFMH 4GBXC 2DQEL 5B8CB 5B3JF 2PF6A 1Q72L 1SYVB 4KDVA 2B1HH 4YHIB 4U1MA 4KKCC 1ACYH 2Q8BL 3QDGD 2O5YL 2R1WB 3LH2L 3VXUA 4NO5B 4U1SA 1P84J 1HE7A 4X0KA 5IFAH 4RGMB 4LCCC 5DK2A 3UROR 3E8UL 3GSWB 3S34L 1H3UA 4NHCH 4PJIE 4ZUUA 3CPLA 3V4VH 1TTUA 1XT5A 5FUCE 4YE4H 1KPVA 3M17B 5TE7H 2VDQH 1CLZH 3AY4C 1MHHB 3C6LB 1DP0A 4K55A 1RZJL 1LO4L 4C56A 3Q6FA 3NCJH 1GXEA 5KVMC 1YEJL 4M00A 4NGHL 4OQ1A 1FC2D 3ARED 3JTSB 1BBJB 1MWAB 1MCWM 2EO1A 2VXSL 3VWJA 3HC3L 3C5ZD 3HPJB 1K85A 2NY2B 1DUYA 2DQUH 1YN6A 5FUZL 2X1OA 4L3EE 3MRCB 3BZFA 2VDNH 3HRPA 4X9GA 3CSYB 3LSOA 3D0LB 4NSKB 4WUKH 4OQTH 3LKSA 2QQNH 1I1AB 2Y6SC 5TGBB 1QSFE 4O9HH 1UACH 4D9RD 4X8JA 3O8XC 3L3DA 1GHFL 5EDXA 2ITDB 3OKOA 3FFDA 5DLMH 3NTCH 2IAND 1E6OH 2I07B 5JDSB 2WBWB 3QI9B 2WIIB 4P4RB 4F7CA 1YMHB 4P2QB 1Y6KR 3WEXB 1HDMA 5CBAB 4JJHA 4BKLB 1RU9H 1EA9C 2ZCKH 1YNTB 5FYJU 2X4PA 2V2WB 4YDJA 4NYLA 4RGNB 2Q7NA 3FTGA 5I71C 1NAKL 4WGVB 2ZJSL 4K7PY 5JORA 2NNAB 2V5RA 1E4WH 3WD5H 5EB9A 1HKLL 4ZXBC 4Z5RB 2CLVA 3GMMB 1T1YB 1AXSA 5GQBA 1DVFC 4HF5H 5JA8B 3WXVL 1NUDA 2XXMB 3NPZB 3S35H 1S9YB 5DMKA 5EO0B 2P5EE 1P84K 3V8OA 3TC9A 5LWYH 3IJSB 3MRKB 1AR1C 3GBMH 3FO2A 3DGGA 1IQDA 1RUML 4HXBH 4Z7OE 2W60B 3U9PL 4M7JH 4PGCA 1OPGL 2GFBB 3D39E 4QRTA 3RY5A 5T5NG 4N1HB 4DKAA 5GS0C 3C6SA 1R24A 3FO1A 3CVHB 2HFEA 1M71B 3KR3H 1RZGB 4JZJC 3T65B 4Q9RH 1I7TA 3I2CH 4H25B 3T4YB 2DQTH 2NY4C 1OSZB 2W0LA 4L3ED 4MQXC 5E8PB 3CXDL 3BQUC 4ONHA 3M07A 3PNWB 2OM5A 3EHBC 1FNEA 4I4WA 4OAWA 3SE3A 3QUMA 5JW5A 1LK3L 3HMXL 2W59A 1QSFD 1MHEB 2H2PD 4P57A 2PXYA 5HYSB 4KQ4L 3QEUB 3UBXI 3IGAB 2KQNA 3QDMB 3OSKA 1CGTA 1C5CL 4FQ2H 1A9BA 3DSFH 4PJCA 1T03H 5KSUB 1INQB 1PZ5A 1T1ZB 1MCJA 3BP5A 3E6HB 3AS2A 5MI0C 3NA9H 5IVZA 1JWUA 5IWLC 4JFFA 5EZLB 5MEOB 5JOPE 5E2VL 4IIQA 3DUUB 4MX7B 4HSQA 5I8CB 4XXCC 2EDYA 1T5XA 3QXUA 5GRVK 4F80A 5JTWA 2CIKB 5CJOH 1F4YH 1KJMA 2VDML 4HLZG 3OAZK 3SDXF 3REVA 3MREA 4XNMB 1M6OA 1XGRA 3BO8A 3RVUD 3WIIL 4TTDC 2PN5A 2VLJA 2QHLA 1TQBC 1A6ZB 1QEWA 2FJGA 3HG1B 1MFBL 1MCRA 4HUWA 3G9AB 4WO4A 5C3LD 1CF8H 2BSED 5FYKL 3WNNA 3D39D 3S4SG 1MH5A 3ULVH 4IRZL 4U1LA 3ARGD 3GSXA 4QHMA 2ZUXA 4PJ7E 3CMGA 4OLVL 3QO0B 4FZEH 4E42B 3DUSA 4Q0XH 1KCSH 3DMMD 1HNFA 3TWCH 5E5RB 5JR1L 4NOFA 1V7ML 4KKBD 1F4AA 3L3IB 5JUEL 4MNQA 3QP3A 5D1QB 4HULB 3MFFB 3MUGA 4S1QH 4R2GC 4YNYB 4HWBA 1XGQB 4M7ZB 3BDYL 1S9WB 5I2IB 5IM7A 1UZ6F 4FFVC 4DVBA 4QNPF 1EPFA 4MD0A 1WBXA 4NRZB 3FB8A 3MTRA 43C9A 2AVGA 3MV8E 2R1XB 5I1LA 3W39A 4KTYA 3QDGA 1AXTH 4HQQH 4NM4H 4CU7A 3IFLL 3V79C 4LEXL 4QHKJ 3ZKQD 2PYEB 2YBRA 2FLRT 3BD5A 4DGIL 3MZTA 3HZVA 5GISH 5BOPA 2WSKA 3NIFE 2ESVB 1QBAA 4RAUA 3QZWB 4A2LA 4PRPE 2BSSB 1IMHC 1IKNC 5F1IA 1OAUL 3QRFM 4PJHA 3AC0A 4OCSH 3WS6C 5SWSB 1L0YA 2QSQA 4HS3A 2V2TB 1CICD 1F5WA 5E4IA 3AREA 3RWHA 2E9IA 4CJ0A 3PWUB 5I15L 5DD0L 3ZDXE 4ACPA 3O2VL 3IJHA 3C5ZA 3WDJA 4JZOA 4WFFE 4OF8A 1U93A 3EJZC 2FBJH 4XAWL 3D85B 1NBVL 2J12B 4BZ2H 4HZLA 1RUQL 3UYPA 3I75B 1Z9SA 3PJSA 5MP6H 3P4MB 1Q0XH 3RGVD 1N5YL 1DQTA 5D7LD 3LEYL 2IANA 4HIIB 5FYLE 4NRYA 4KH2A 4J12A 3O0RL 4KRNA 3VXRE 1JF1B 1C16A 1F4XH 3V6OE 1TTGA 1CLYH 1DQJA 4GQ9H 1FZMB 1EHLH 3GSVB 3MBXH 4CVUA 4LAQH 3V5DA 4NQXA 1IT9H 1UWXH 4UDUA 1RFDL 4AEIL 4NN6B 1A6AB 3SKOA 4XMLL 5A43C 2XQBH 3R8QA 4TSBL 3TBWA 2R2EA 4LF3B 3Q48A 4XCEA 1FFNA 4EEEA 4P2QE 1HXMA 3OAYH 3MV8D 5HDBE 2RBLA 5E8OB 4G42B 4ODUA 5EWIL 2Z9TA 1GGIH 1S7WB 3G9VA 3UYRL 3V6ZB 3U0WL 5J13B 2HA1A 2X1WL 4DKDC 4RGNE 3HAEB 3C5JA 3AFLA 4MGXA 5D8JL 3SQOL 2X70B 4X7EC 1T1XA 3FOLB 1LQSR 3FAWA 1KIUA 4PJIA 1RJZB 1HXYB 5EU7C 1ORQB 3JTTB 2HKFH 1LO3L 4PJEA 5F3BB 4PRPD 4Y4HB 5ABDE 4Y5VB 1WITA 5I66B 3BKML 3D9AL 4P4KC 15C8H 2AEIT 1ERNA 3VMOA 4YHZL 4JGUA 4Y4KB 4NJAH 4L29B 4JM4L 4JM2C 3U2SA 2PO6B 5BXFA 3F7PC 2Z31C 2XOTA 4L3EA 5KS9F 3VH8A 1MUJA 1JZ7A 4LRIC 3CC5B 3EFFA 3V5HB 1LO5A 4YGAB 5E08L 5IG7A 3LEXB 4RRPG 1QSFA 1IC5L 4GMTL 2WK2A 1IM9B 3DHJA 3L6FB 3CH1A 1T5WB 2IH3A 3R1GL 2NY2D 5B21A 2YWYA 4FXKA 4XP6L 5EBMA 3HTLX 4R90H 4YXLL 2ID5A 5IOPA 3SDYH 2P7TB 1AFVL 3VXRD 1D5MA 5KSAB 1AE6H 1AIFB 3S36H 2F74A 1I1AD 1AJ7H 1HHJA 3N1MC 4KTEH 4NCC1 1QSEE 2G75A 1B0RA 1KC5L 4X7SL 1NPUA 1G9MH 3QDME 4F7EA 3QQ9D 3R06B 1F45A 1UVQA 3TZVB 4LVNB 1NLBL 2OTUA 2DM2A 4P2QD 2XWJA 2E6JA 3TH2T 3GNMH 2J6EL 1S5IL 1S9VA 3WLWC 5B4MC 1I9IL 4NDMB 4NQCE 2HTLD 3SKUD 4HWBH 4F57H 1KIQB 2JE8A 2LFGA 5BO1L 2Q7YA 5DR5H 2VXVL 4J3UA 2VXUH 4OZHB 5DMGD 1QA9B 5C7XL 1VFMA 4RFNB 1G7HB 3ECBA 5EU5A 3VRJA 1FG2A 3D39A 4DVRL 2OTWA 4YGVA 5T33H 3ARGA 1ZVSB 3PWNB 1U8NB 3MUHL 4JHWL 5EG6C 3TT3H 4LLMB 4OM1L 2MPAL 2W0FB 4DTGH 2OL3L 4WJ5B 4DUWA 3CZFB 4OZIF 3DMMA 5C0DA 1J5OH 3SO3C 3ARDB 2OMBA 3A6BL 4K23H 4JKKA 2R4SH 3HRZA 5E1AA 2CMRH 2PR4H 5BV7H 1MCLA 5K9OB 1QZ1A 1NGWB 3T0WA 1XEDA 3F58L 4ZUTB 1QBLH 2HFFB 5I76B 2Z92B 35C8H 4MS8C 4Y5XC 1JYVA 4QRPB 3EDEA 3L7FB 2O26U 1M05B 4ORGB 2GSGB 3O3DA 4AIOA 3RWGB 4UOW0 3GJFA 4N5UA 2G60H 5CIPA 4LP5A 5ALCL 3I6LD 5T3XE 4GRWE 3VXQA 3H9HA 1WUNT 2EKSA 2R1YA 1TITA 2DLHA 2BOCB 4XP4L 1SEBB 1QSED 2BNUA 2CO7B 4UIMB 1QBBA 1EIBA 2GTZB 3QDMD 4YXKH 5D7IF 3GRWA 1ZLSH 2OQJA 3DX7B 4U7MA 5KSBB 3MV9B 1CFTA 4GBXB 4O5LH 5HGAA 2FECL 1CR9H 1AC0A 1L0QA 2F54E 3G08B 5DZLA 4X6DB 2PYEE 3SCMB 1S5HA 1ES0B 1CICA 1P2CB 1ITCA 3B8SA 3INUL 4NQCD 3QFJB 4LCCB 5CHNA 2EC9U 2V5YA 2UVFA 3DGCR 5E1HB 5SWSE 3UTSB 4LPTA 3SGJC 1KCUL 1A6WH 3ZZ1A 2DQCH 4X99B 1I8LC 4PS4H 4ZAKC 3RGVA 4RZCB 3VFMA 4JREC 5D7LA 4PJ7A 1FPTH 1IFHL 5FM5M 2MWCA 1G6RA 3O3AA 3RWJA 2A74A 3VFNA 4EQ2A 3WLBB 1OAYH 4UMGA 3OXRB 3A6CH 4LU5L 1CZ8H 1YYLH 1F6LL 1XGUB 2ICEB 2MTPA 3P11H 1YEKH 4ELMF 1MJ7L 4AQOA 1OQXA 3P77B 3RY6C 1BAFL 1F3DJ 2MMXA 3MCLH 3OPZH 3O8XB 1L9MA 1CXIA 5E6YA 4P59H 3BHBB 3MV8A 1Y6MR 2LABA 2H3NA 3VXOB 3HLAB 4OI8A 5D1QD 1NQBA 2FRGP 4RWYH 4UQ2B 5T3XD 4K3EH 1P6FA 1WICA 1Y18B 2X10A 3HPLB 3ZKXC 3MXWL 2Q3ZA 3FN0L 4MNGE 1SYVA 1W8NA 4WRLA 5EOCL 5I71B 1Z9OA 5C0JB 4PRPA 5FIEA 3TBYB 1TZIA 4ZXBB 3FMGH 5FHAL 4NO5A 2IPTH 2F54D 3VFPB 2PYED 5GZND 1NC4B 4LLUB 1S7UA 3OV6A 1DVFB 1TJIH 4DZBB 3GSWA 2D9CA 5KOVC 2ZCLL 4P2OB 4HUNB 1Q8MA 1KEGH 4QRUB 5I30H 1RIHL 4GKSB 5HVGB 3ULUE 3MACH 3BGMB 5TF1L 3QCUH 1MHHA 1IC4L 5IB5B 5SWSD 5SX4H 1A0QL 3CFCL 3VI4F 3JTSA 1MWAA 3KYMA 2CO6B 3G6DL 1AKJD 1EV2E 1RSFA 3HPJA 3K81A 4LPXA 1A6VL 2XZCL 3EGSB 3ZHDA 5DJ8B 1YEIL 3D0LA 4NSKA 3VXRA 1Q9OB 3V6OA 4LEOB 2P8LA 4GAYB 1Z9LA 4DUVA 4KI1A 1I1AA 4R7DB 2CRMA 2NY4B 3BQUB 2ITDA 4IRSC 1U8KB 2ITCA 4QTHB 4BSWA 2FATH 5HHMB 3NZHL 3SDAC 2BRQA 43CAA 1RHFA 3UTPE 1YMHA 1L0XA 3QIWC 4P2QA 5FM4A 4XVUD 4NN7C 3RDTC 4IHOA 4G8FB 1WFTA 3T1FB 1GH7A 4ZFFB 3LQMA 4BKLA 2HVJB 3R0MA 1MQKL 2V2WA 3EBAA 5F1KC 5MI0B 2VH5L 1DR9A 2VO5A 3WJJA 3RI5K 1NGPH 4MVBD 5CZVH 3NIGF 1WTLA 5D71H 4AG4L 4OLYL 4Z5RA 1IAIL 2LTQC 2FIKB 1ZT4B 4QWWD 4JR9L 3GJFH 2DLEA 1S9YA 5CIPH 3L3KA 1NUNB 3BP7B 3GM8A 1OAZL 5DUPH 1C08B 2EDOA 3KLHD 2IMMA 5DVNA 4OZHE 5A40E 3MRKA 1A1MB 2FJFB 4KJWC 4ODXB 1ZLVH 4WEMB 2W60A 3U7WH 3VFGL 3WE6A 5IT2L 1DQQA 4HUVA 2GFBA 1MFAL 2R2BA 4JQVC 4YDIH 1TQBB 1B88A 2I60H 4Y4HD 4MAUL 1WEJL 3ULUD 4HGWB 5SV3A 1YYML 3OHXB 2YD5A 1UADC 3T0AA 3QEQE 1SJEA 1P1ZB 5CJXC 3CVHA 5DGQA 1M71A 5KANG 4Y4KD 3BH8B 4HCRA 5CEXB 3MCG1 5HGBB 2PO6D 4BK5A 1OSZA 3GSRA 2J8UE 2NXZC 2R8SH 3QFDB 3Q5TA 3ZE0F 2CKBB 3PNWA 2VZVA 5GJTL 5GJSL 5HYQB 5E5MA 3ZLQC 5HHQB 4J4PC 4QRPE 2V5SA 1MHEA 2XTLA 1JNLH 4WTZA 1BGXH 4LVHB 5HYSA 1QSEA 2X5PA 1IM9D 5DQDH 3QEUA 4MDIB 4Y8AA 3ARBC 5GRJL 1PBYA 1YPZA 4ODTL 3QDMA 3MOAH 3E2HC 1G0XA 1G6RH 5KSUA 1S7TA 1INQA 1L4IA 2IH1B 2VC2L 3IDIB 4H20H 3UTPD 3E6HA 4LSRH 4RISL 4U33A 4PJXB 4JO4L 1FAKT 1E4JA 3BPCA 2R0WH 1YN7A 2VB5A 3MRFA 5EZLA 2EICA 1BQLL 1SY6L 4JO2L 1KG0B 1XF3A 2FNBA 2P24B 4G8EA 4NQCA 1MLCB 3TZVD 5KSBE 1MLBB 3MV9E 4D0DB 3WNKA 1I3GL 3WCYA 5I8CA 4PIRF 2AXGA 4DZ8B 2WZPD 1CLOL 3JSSA 3C60C 1I7ZB 4PGBB 1X5HA 3HZKA 3L3GB 2LU3A 4K2UH 5EUOB 4GW5B 3WMSA 1S3KL 5HHOD 1EEZA 3QFJE 5AG8A 1GC1H 1A6ZA 3JXAA 4TNWK 1P7QD 3HHRB 4Y19E 1JZ2A 3CSGA 2YEZA 4PLOB 4NN5C 3S37H 1Q9KB 3I3BA 2BNQB 3KNBA 4KJYA 2YRPA 4UBDD 3RU8L 3PP4L 3RUGF 2QQQA 4Z95L 3QO0A 5J57B 1MCPL 4UV4H 4WNQB 3BEWB 3QEQD 4XC1L 2AXJA 1PVHA 1MVFA 1MIEL 3TLRA 2VWEC 3ZDZE 3NH7L 3QNXA 3WBDA 1A7QL 2ATKB 1W0WB 4QY8B 1JHKH 5D1QA 3RNQB 4ZPVB 3MFFA 4FXLA 1BFVH 4OCYH 2Q86B 1XGQA 3JV6B 3VFSA 2IGFL 4WV1B 1S9WA 1FNSL 2D4DA 3F5WB 3VDAA 2VDOH 5EZIL 4NRZA 5AD0B 1FL5A 4HJJH 3W11D 3ARVA 4KJQC 1FE8H 2R1XA 2ZPKH 4ZO7A 1JPTL 3MO1B 5J06A 3VE0B 4C54A 4KHTH 4Y2DC 1FO0B 3PL6D 4JDTH 2F54A 5K9KA 3IFNH 1EBPA 2PYEA 4RFOL 3PP3K 3QYCA 4XH2B 4TUKL 1DE4B 2NY7L 2MHAA 2JJWA 3VG9C 3QZWA 5DHVA 3RIAF 2BSSA 3GBNH 3PXHA 1DN0B 5E9DB 3TA3D 2X4OA 5E8NB 5SWSA 3JWOL 4KKCD 3GBLA 2V2TA 3L1OH 4F7MB 3BUTA 3PWUA 2CRIA 4IDJH 1AKJA 3TN0B 3WFCH 4MJIB 4HK3N 4P4KB 3QFJD 4N1CA 3QUYD 2B5IC 1H9VA 4Y19D 1U58A 2OR9L 3MNZA 2NX5B 4JM2B 2FECI 4OZ4A 1BHGA 5F7YC 4YHKL 4B0MM 2EXWC 4IOSD 3UJJL 2GJZB 2DRUA 3V6BR 5DJDB 3X12A 2V17H 5IMMA 3KWWB 1I1FB 1CGWA 4XAKE 2E8YA 1NDGA 1QHOA 4M6MH 3MRRB 4C83B 3GSVA 1SVCP 1H3XA 3EJJX 4LGPB 5KVEL 3QXDB 4OCRL 4FABL 4YPJA 4Q9QH 2XV6B 1N8ZB 4CRPA 2ERJB 2Y6SD 1A6AA 4LCIH 4ZOEA 5HHME 1XF4B 2R0KH 4LF3A 3O8XD 4GS7B 3CVHH 4G6JL 4MNGA 4NCDA 1RI8A 4G42A 4EN3C 1NFIA 1T0PB 2WMPA 4HUMB 3C2AL 3NAAH 1LE5B 5ESVB 1SEQH 4JPWH 5JQ6L 3HAEA 5IJVB 4ZS6D 1BFTA 3P30H 2OJEA 2AV1B 1T7XA 4M6NL 3FOLA 1YEFL 2UY7A 1G7MA 4XBEH 4GRLD 1RJZA 1HXYA 1ORQA 3JTTA 1D6VH 2GUOA 4POZC 5F3BA 4X4YA 4Y4HA 4ONFH 2K1MA 4U31A 2NW2A 4PJBF 4EJ1C 5I66A 2H1PH 1FFOA 3RGHA 2DAVA 1J88A 1CS6A 2WUCL 3KLSA 4L4VB 1DVFD 5IEHA 4WHTA 4Y4KA 4WI3A 2H41A 3OZ9L 4FQIL 4GXUN 2W65A 2PO6A 3ORJA 3MJ8A 4OT1L 5I0DA 3V5HA 1FG9C 3OKDB 3ZTJH 2Y72A 3LQAH 3SO3B 4EI5D 3ROLB 2Y06L 5C0NC 2PW1B 3LEXA 4HWNA 5I1CH 4KMLB 4LHQB 3HA0A 5DJCA 5IHBA 1IM9A 3VGAB 1T5WA 3SDDC 5D7SH 1C12B 3BZEB 3PE9A 5GS0D 2WBJC 4HJGB 4Y5XB 4XVSL 1URLA 4N0YH 2P7TA 1I9RL 2DTMH 4XAKD 3MXVH 4U7KA 1IC1A 2NY4D 3QUXC 3BQUD 2AJVH 4YXHL 4F37F 3R06A 3EHBD 4UTAL 5KAQF 5FGSA 3RX8A 3M8OH 3TZVA 3ZKMC 1VKXA 5HHMD 5GZOC 1HH9A 1BVKA 5DMIH 5ADOH 4JPIB 2NY5L 4PJXE 4JO3H 1ZHKA 5TPWH 5MERA 1EX0A 1IC7H 5I1GL 5LXGH 1YY8B 3W5MA 1WAAF 2AEQL 2DDQH 2AI0H 4ZFOB 5F7WC 5HHOA 4ZD3H 4NDMA 5T3XH 1KIRB 3EO0B 4GRWH 3VDCA 2IPUK 4OZHA 1BX2A 4TVPL 1T0NB 1TNMA 1HHHB 2XQYG 3TNNB 1G7HA 1ZEAL 2X09A 4NRXA 5HVFB 3NFNB 3BP4A 4PRDA 5ICYB 5HYJB 1DBAH 5EUOE 3MCKB 5EU6B 1ZVSA 4HX1A 5C0AB 5FDYA 4OGAC 2H2SC 4F9LC 1S7QA 5FKAB 3TVMC 4J6RL 5GRWA 4MCZB 3FONB 4YHLL 3QEQA 3CZFA 4ZAKB 3L5WB 3SE8L 3BESR 3UYOD 3UJIH 1T4KB 3GKWL 1QP1A 5IK3B 4TTDD 3GUTB 2BNQE 4I77H 1MJ8L 5DHVH 1NGWA 2J8UA 2HFFA 4N8PA 4X7CC 1QKZL 4KRLB 4G9FE 2BVPA 1CDUA 1IILE 5ESAB 1OD7A 3LKQB 1YEHH 3T77B 3K1KC 1LHZA 5I73C 1FNLA 3ULSA 1A14H 1M05A 4ORGA 2UWEF 5FAAA 4OLWL 5E8DH 5FHBH 3GSUB 2GAZA 5CUSL 5CKAA 1CQKA 1E4XH 1KJ3L 4YO0B 4F15C 4TSAL 3PL6A 1DN2A 3NCYS 5M95B 2VLKE 4Y5YC 1A4KB 1NCDL 2BRRH 5CINH 1I8MB 1YEEH 3MA7B 3MOBL 4R2GD 2GTZA 1QNZH 1RY7B 1T2XA 3CX5K 3FCTA 4FFVD 3DX7A 4K8RL 4U6HB 5KSBA 5ICZA 3OR7B 3ZKXB 5IMOA 1XFPA 4U1KB 4EIZC 3CJJA 5FCUH 1PLGH 5AAMA 1JPFB 5IVNA 1P2CA 2R29H 5C2BL 3T3ME 2AGJL 1U8LA 4HC1L 3SGKA 3AROA 1X4YA 3BVNB 3QFJA 4LCCA 4M7KH 1RIVH 4ZS7H 1RIUL 5E9DE 3K2UH 5FYJL 3WFEH 2EYRB 4OTXH 4Y19A 5EU7E 3ZYJA 2XI9A 2GHWB 2Y9RT 4OZGA 4BQ6A 1CTOA 5EUKB 1WC7A 3S5LA 3DTXA 3IRPX 5JW4Q 3H7BB 2DQDL 5CJQL 1A3RH 2R2CA 1HSBB 3QAZC 3FT4B 5C0IA 3QHFH 3HAEH 3Q1SL 5I8KH 1HSAA 2NPLX 1LEGB 2G5BB 2JCCB 4N0UB 1N6QL 1OF2B 1U8MB 2BNQD 3LRSB 1WIOA 4XI5C 5F7EL 1RV6X 3EJZD 4CL7A 2YD8A 4GXUM 3NFSH 3ULUH 3N9GL 4G9FD 1KCRL 4LSUL 2EDKA 3KJ4B 4GG6E 4G8GE 2P46B 5H37H 3O8XA 1WWBX 2YUWA 2LU7A 1H0DA 2L4OA 4IRSB 3V4PH 2A83A 4DKFL 1PG7W 1W0VB 5I1KH 3C08L 1YNLL 1JTPA 5EOQL 3CFDA 4OCXL 5E2JA 3MODH 3QIWB 4UQ2A 4NN7B 1CGSL 2O5XL 4BUHA 1AQKL 2DQHH 2VLKD 1BWMA 5HGHA 1Y18A 2D7TL 1QPXA 4OD2B 4PTUB 4NOBA 4ENEC 4QEGA 4GRLA 3MJ9L 2QKIB 1UENA 2D31B 3BW9A 3X13B 2ORBL 5D5MF 3TBYA 3L3JA 5KW9H 1TNNA 3VW3H 3