3KXFD

Crystal structure of sb27 tcr in complex with the 'restriction triad' mutant hla-b*3508-13mer
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
204
structure length
204
Chain Sequence
QKVTQAQTEISVVEDEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSGFYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-35 alpha chain
publication title Hard wiring of T cell receptor specificity for the major histocompatibility complex is underpinned by TCR adaptability
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 204
sequence length 204
chains with identical sequence G, M, N
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kxfD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kxfD01
1T7XA 3RVUD 3ZYJA 4MXVF 3ABZA 1N8ZB 4K7FB 2IMMA 2A38A 4Y2DC 5IMLA 3OG4B 5DMGC 5FHAH 2IJ0C 4LSVL 5CEZD 1S3KL 1YECH 3IJHB 4QOKE 1KYOK 1HKFA 2CLRA 4LLYA 3ARWA 1HH9A 1KENH 3T0XA 4ZS6D 2BCKA 3G6AB 2IALA 3IKKA 2V2WB 3CFDB 1C8PA 4OLZH 1L9MA 1KN2L 1VENA 4OBRA 4CGTA 4MJID 1S9KC 4DKEL 1RUPH 4R90H 1TLKA 1P1ZB 3V5DA 5F3HA 2WW8A 2HFFA 4WJ5A 5E8NB 4JFOA 3R0MA 2CGRH 4LGPB 2QL1A 4HQQH 4WV1C 3VFGL 5FO9B 2X9XA 3WO4C 4B7LA 4NKMB 4N9OB 2DWDB 1R3IH 2AI0L 3HE6D 4UAOC 1HINH 1JP5A 3ULUD 5TGBB 3OPZH 2C9AA 5IQ7L 2J8UA 3ILPA 4P59L 35C8L 3ULSA 2ADIA 3C6LD 4I2XE 3QISA 4X99B 3C5ZD 2FECL 4N8VG 3QDGE 3ZE2F 4H26A 5LG1A 3KYMA 1LO4H 5B39A 4UZGA 2UWEE 5C08A 1QLEH 3NABH 3TPUA 4CW1B 1A9EB 1J0YA 4DGVH 4L8BA 3MRPB 5MENE 3CFCH 3RZCD 4NT6B 4JFED 3X3FH 5BJTB 3F7VA 1S5HB 5I1IH 1CL7L 4ONFL 3EYVA 4RAUA 4CU7A 2R56H 4JRXD 4PJAF 1NAKL 3OL2A 3L5XL 3ULVF 2ICEA 5AEAA 4WU5B 3P2TA 3TIEA 4UOW0 3ETBF 1FIEA 1U8OA 4JGMA 4L8DB 1JN6A 1BQHA 4GMSL 2HG5A 1T21B 1QEWA 4ODWB 4PGCA 2FX9L 3L1OL 4U6YA 4MAYA 1T22A 4PB0H 2UYLA 4O51B 3QZWG 5EOCL 3EOBB 1RIHL 3P9WB 4E41A 1T1ZA 1ZTXH 2VLRB 3CK0H 3HUJA 4MD5A 2BNRE 3G6JF 3LEXB 5K59E 4ZXBA 1T2JA 2VQ1B 4RZCB 1OP9A 1IGYA 1LMKA 1WCBB 2EC9U 3MRCA 3V4VH 4O5LH 5EU6A 4L9DA 3ROOA 5HVHC 4GRMA 4CVUA 4P4KB 5D1QA 4O2FB 4Z5RB 3AMKA 2QLVB 4W4OC 2WQ8A 4MHHG 3LS5H 2DQIH 4K8RC 2ZUYA 1I4FA 4GKOA 1S9WB 2Z4QA 2PYEE 4JFPA 4GUPB 4APQD 4X6DA 4XWGH 3V6ZB 4KK5D 5E70A 1B4JL 1RIVL 3T3PF 5ICXB 3QO0B 4PP2B 1JYXA 2D3VA 4QRSA 4ZS7L 4EDWL 4WNQA 3LKSA 4YXHL 1TTFA 2JJVA 1PG7W 1D9KB 1UA6L 4M6NL 5KVEL 1HXYB 1P9MC 5ANME 4TYUA 3A0OA 4G5ZH 3WIFA 4JAMB 4R6UA 3MLUH 2ZUVA 5DEFA 4LCWD 1UWGL 2XQYG 2OL3A 1S7XA 2KL6A 1U3HC 5FECB 3BPOB 2NCMA 4YBQC 2GFBA 5KJRH 1IQDA 2DJSA 1WC7A 1DBBH 2DWEB 1X4YA 2R4SH 3O3EA 3OX8A 5J13B 2IAMA 4B0MM 5F88B 1Q72L 4GBXB 5GRJL 1NMBL 3TCLB 3L3GB 2F54B 3GHBL 4P5TA 4NQVB 2VRAA 3OGCB 5E4EB 5EO0B 1CLYL 2Q20A 3EDFA 4KAQL 1N5YH 2AJUH 4L4VE 4BSWB 3MUJA 1NEUA 3V6FB 3TESA 1RURL 3WN5C 3WNLA 4M8QA 2Q86B 2ADFH 3KPQB 3SDXA 4WUUA 4NC2B 3P9MA 2VAAA 4YXKL 2C4XA 1A7PH 1GGIH 2CR6A 4JQIH 2VLLB 3BGFB 2AK4A 1JIBA 1MY7A 4HDIA 4MWFB 4Z7WA 1W8NA 3DIFA 3BPCB 3OSKA 3JBG7 2WIIB 2CH8A 4Y88A 1YMME 1FFPA 3BP4B 2Y9RT 1G7JB 1ETZA 4XNMB 4OLWL 2Z9TA 3D6GA 5MEPB 2Y6SC 3PQYB 2CXKA 4LEXL 4MX7B 4X83A 4KY1L 5E8OB 2WP3T 5J12C 2WLYA 4U1JA 3MLRH 1K5NA 5IF0B 5JTWA 1M7XA 5CD5D 2O61B 1YZZA 1A64A 4F57H 1HCVA 1M7DB 3VG9C 3BW9B 1OAUH 5KZCB 1RZ8A 3QUYB 5D1XC 5D96B 3H8NA 4DJMA 2QEJA 3PGFL 3GMRB 4P49A 3KPSA 5DTFB 4X7TB 5I17B 4FXKB 4PRAB 3KHOA 3QIWC 4WENB 5CJBA 3KPPA 4RIRA 3U0TA 1NC2A 3TN0A 4UT7L 3S4SB 1I9JH 2ZNWA 4OIIH 3KPOB 1CLOL 1PY4A 2MOVA 2A83A 4LCYB 1MIMH 4HAGA 4CRPA 2FD6L 3ARQA 2AK1H 1N0XH 2B1HL 1WBXA 4PGBA 3DBXB 5SWSA 1DQML 4I13B 1E4WH 3OZ9L 5D2NE 4X8XA 4LNRA 3CFIC 5J1AA 4HIXH 4RWYL 3RGVD 4P5KA 1VFOA 1T6VN 3MBXL 3BN3B 3OAZH 2XNAA 1SYSB 4PJ7E 2AJXH 2H3NA 2WAHA 3W0WD 3VWJB 1A4KA 4NM4L 3SGDI 3MFFA 4TSCL 4UUJA 3U7WL 3D3VD 1BD2E 1UXWA 2GT9A 4BFBD 2HP4A 1P5VA 3MA7B 4KKAD 3P40A 3MLZH 3O2WL 4E0RB 2HJLA 2P42B 2PCPB 1UACL 1WT5C 3BO8B 3F12A 3NPZB 3INUL 3AS3A 3QUXC 5D7SH 1ADQH 4OM0H 3KG5A 3RUGB 4JHWL 1SM3L 2YD4A 3MOBL 3V7MA 4H25B 3WS6C 1SMAA 1AP2B 5HYJB 4YE4H 4LSPL 4OZFB 3QHZH 3QWRA 5TF0A 2NY5C 7FABH 1E6JL 3RL2A 4UILH 5TDOB 1M71B 5J1SC 4Y4HB 4PRIE 3QIBB 4N90E 3T2OA 5F1OB 3L3IA 4FFWD 1FGNL 5IEHA 2I60L 3H3PL 4POYA 4K8RD 1DE4B 4PRNA 2ZUXA 2Q8AL 1BVKB 5B8CA 3MCKB 4V2BA 5ICYB 4WFEE 4YHKL 1MHEB 1TITA 3I6LE 2XFXA 3M8OH 5SX5H 2EYRA 5HYSA 5ID0B 1EEUA 5DUMH 3MRRB 2YSSA 2ZSVA 3FONB 4XC3L 5D5MB 5ALCH 5A16A 3FO0L 4HXAL 4RRPG 4E42A 5JXEC 4ELKA 4NQDB 5KAQF 1CFBA 3RBSA 4TOYH 3U4BL 1ZLSH 1QLFB 4RA0C 3K8MA 4FFVC 2VXUH 3WLWC 5DMIH 5I19L 5GZOC 3W5MA 4KZDH 3A6BH 4GW1A 1KT2A 3CDCA 1WAAA 4YBQD 3HE7C 2VDKH 3CLFL 3F62A 1EHLH 3OAYH 3QDHA 3GEWB 4UQ2A 4QTIH 5MEQB 3KPLA 1P7QB 3P4LA 5C0RL 5EWIL 5KSAA 1RK1A 1WK0A 2EH8H 4OM1L 3LPWA 4E41D 4XPTL 5I76A 4NHUB 3TNNB 2L0DA 2HMIC 1BQSA 4YK4C 4UQ3B 1U8QB 5T33L 1BF2A 3C5SA 3B9KB 5DD0L 5CJQL 2HN7B 1XF2A 2JB5H 3AY4A 4GAFB 1TDQA 4KUCF 4OD3H 4ONHA 3V95A 3BE1H 4X98A 2EICA 5IV2A 2OZ4A 4C57C 2ZJSH 5D1QD 1G9ML 2XG4A 5D7LB 5F7LB 2DLHA 5EUOE 4Z6AT 3KLSA 2H2PD 2XV6B 3G5XA 3NZHL 2FHBA 4KQ4H 4PJBB 5HJ3B 5T5FL 4S1RH 1HKLH 5GISL 3EZ8A 3E6HA 2AEIT 4ZFOB 1H8NA 3ARPA 4PGEB 2X4QB 4LCUB 2XTLA 2GI7A 4HGMA 2WWKT 1JGUL 4KRLB 1A6VH 2G60H 3NA9H 1T3FA 1G6RB 2DYPA 2ATPB 3IF1A 3KXFE 4I77L 3LKOA 3GFUA 2HJFB 2VLKA 3N06B 4FABL 1WVZA 5DMKB 1HNGA 4O4YH 3IKCA 2Y07L 1P7KB 5GS2H 4WGWB 3MJ9H 1TVBB 2NXYB 5DVOA 2YS4A 1FVDB 2Y06H 1AGCA 1CXHA 4CVZB 1RJLB 3O9WC 5IB2A 1CK0H 2AXHA 3MREB 1HI6B 5CIPH 5E8PA 3AS0A 5TDPB 5J06A 1JZ5A 5C0CE 2NMSA 3C08L 5SX4H 4HKZA 2YD3A 4Q6IC 1D6EB 3U9PH 5IHBA 3OKDB 5H35A 4ZSOB 4M9OA 5DUPH 4XC1L 3SHSA 3ARBA 4OZIE 1A3LH 1NCBH 4RWHA 4EEEA 4WUUD 2RR3A 5I2IB 4OZ4B 4OI7A 3EOYG 4RFNB 1SJEA 1CD0A 3CSBA 2NY1C 1MQ8A 2AK4D 5IR1B 1KNOB 1OGTA 1UZ8A 5T1KD 4R2GC 3MNWB 8CGTA 3JUZA 2HT4C 1MLCB 4A6YL 4DFHA 4L1HA 3ET9F 3QUXD 4YR6B 3FKUS 3WJLA 3GSXA 4X6BA 4B53A 5F1SA 4MA8L 5ABDE 5JLZA 3VXSA 1OQOA 3MLTA 4XMLL 5BV7L 4P9ML 4OIBA 1KFAL 4P9HH 2ZG1A 4HFWA 3OKEB 4WGVB 1P7HL 3DURA 4F58H 3U7YH 4ZUSA 1QR1B 3X3GL 2BVYA 2CDFA 4B5EA 2OP4L 3U46A 3VFUB 2R2HA 4X4ME 4JEGB 1RUKL 4QWWC 3KPSD 3UPRB 3PGDB 3ZDYE 4DGYH 1TCMA 4K3JL 3GMLB 2FEEL 3SDDB 1UJ3A 2AXGA 1BQLH 1VFAA 3Q6GH 5F9OL 4IMKC 3IAQA 4KRMB 4QKXB 1RK0A 4ZUVB 3FO2A 2XT1B 4JKPH 3CUPB 4XVTL 1JGVH 3BP7B 5GRYA 5JXED 4MS8D 1LP9B 4PJEB 1BGXL 4URTB 3VW3H 4Y5YB 1ZVHA 1YYLL 4UTAL 3MRNA 4K7PX 1MFAH 3UYRL 4GW5A 2CO6B 4N68A 4U0RC 1LO2H 2ESVA 5K9JL 4JB9H 1LP9F 3B9AA 5DJ6A 5TE7L 4C56D 2YUXA 2IFFL 4FMKA 4OCYL 43C9B 2DQTH 1CBVH 2ENSA 3VGEA 1YYMH 1FNFA 4JLRB 1I85A 3MGTB 5D6CA 2W9DH 4YHIA 5FK9A 2P8PA 1E4KA 4JGUA 1MJJA 2X4OA 2OR9H 3JSSA 4MB5A 4Y4KB 1R24B 4R9HA 4G7VL 4EUPH 1JZ3A 1MUJA 3KPMB 3HI6L 4PRDB 1KC5L 1JPST 4Z0BH 5C07E 3IJSB 4HWNA 3QPXH 5JW4N 2Y25A 4R7NB 4I18A 1MFBH 2WK2A 4N8VB 2DLFH 2MPAH 1AGDA 1PW3A 2FB4H 5D6DC 3RWEA 1T0PB 5AWNL 3DVIA 1KELH 3HMXA 1XT5A 4IRSC 4L3CA 4P57B 3QWRD 3LDBC 4NRZA 1E4XI 4JKMA 2AJ3B 1RZKH 1ONQB 3W5NA 3DSFL 1EJOL 1VA9A 5L9DH 1EMTL 4QYOB 1I8KB 3GRWA 4DKFL 1GAFL 3VXMA 15C8L 2FEDC 5GJTL 3SDYL 5ILTH 5DK0B 3OXSA 4MD0A 3BYTA 5BQ7B 1PG7H 5TDNA 4OF8A 3VE0A 4OCLC 3ZTNL 2L7UA 3M17B 3N0PB 1OTUC 4PD4K 1O7VA 3GI9H 3O3BA 3BT2H 1HILB 4Y7MA 5C2BH 5I73B 5CEXB 1MREH 3C60C 5L6YL 1J86A 1C5DA 3WHXA 1FIGL 4I3RL 5GGSA 1A1MA 2EYTA 1RZFH 1FL3B 3QFJA 3HE6B 3LOWA 3F5WA 4O58H 1ZT1A 2YUWA 2CLZA 3S5LA 5ID1B 2I07B 5GGTA 5DJ2B 3X11B 2ARJB 5DD5H 4HK0B 4RDQG 3T77A 3ARSA 4YHNB 1QRNA 3C6LB 5ESVA 2OR7A 5EOQH 3TO4C 1TQCC 5ISZA 4U6XB 1FPTH 1NBVL 2HWZH 3LRSB 3C5ZB 1N6QL 2DM2A 2WINB 4ONOA 5MI0B 3B9EA 1TZIA 2IQ9H 3GMPA 2FYYA 1UKTA 1CZ8L 4QXTB 2V7NA 5TJWK 4I0PA 1Y6NR 1C5BL 3RIFF 2FO4B 5K9KB 1DBMH 4F37K 4YAQA 1MRCL 1FN4A 1OARH 4KVNH 5D1ZC 3BP5B 5CJ5A 1RU9L 4QRUB 4QEGA 5JDSB 1OAKL 5AYUL 4ORGB 4G6MH 2O5YL 2YUZA 3FQXB 3TA3C 1B6DA 4GRLC 2NY1D 2HTLC 2G5RA 3SJVD 4Y4FB 4R2GD 2P5WD 5KSBA 3WFHB 2HT4D 4JZOA 1UB6B 3RWGA 5IW6B 1NCWH 2EC8A 1IBGH 3KJ4B 3QNYB 2DIAA 1S5IL 2F8XC 3MPCA 1UJTA 5D2LA 1KLGB 2VLRE 4OF7A 1NAMB 5I9QC 3LEYH 5LBSL 5CBEA 3U6RA 1NGYA 1C5CL 2V7HB 1Z9SA 4LLQA 5E8EA 4HHAB 1DDHB 1K4CB 5D7JD 2MCPL 4P2RA 1AXTL 1Q94B 2EC9T 3ULVL 5E6IC 4YO0A 4PJIA 3QR2A 3EKCA 3LMJH 4KXZH 4WCYL 3NFSL 3QUZD 1MHCB 3MROB 4G43B 4TNWK 5T1MA 1U8KB 5B38G 5F89B 4AG4L 1A9BA 4KTDL 1Z3GL 4OD2A 1MCLA 2BP3A 3LZFL 4YHML 4GXVL 5I8KL 4MJ6B 2V17H 2I5YH 1RJYA 3F7QA 4W68A 2GK0B 1DANU 4L5FH 3O0RL 4MA3A 3ZYOA 2O93L 3FMGL 2A6IA 4KMQA 4F9PA 3PWPD 5IGXL 5HVGB 3GMMA 4WIQA 3SPVA 1DSFH 4X80L 4S0TD 4LP5A 4NRXA 2YK1L 5D7IA 2DKMA 3G04A 1G1YA 4H88L 4FQLH 3C87A 5DHVB 1HSAA 2B0SH 3HC0A 4TVPD 3AAZA 3CFKB 3OAUH 1PSKH 4HS3B 4PG2C 2FL5A 1NL0L 4YFDB 3TYGH 4LCWB 1KTRL 5BW7A 2G2RA 4ODXA 1CFVH 4AL8H 1SBBA 3QAZC 4NYLA 2DLEA 3PE9A 4GLRI 2VE6A 4LU5H 2MCG1 4CN4A 5BXFA 2F54E 5LQBH 2X70B 1GSMA 2LAGB 3FOLA 3GKWH 1I9IL 3EO0A 5DFWH 4YQXL 2FDBP 4OCXH 2QSTA 1ZA3B 1LK2B 2FEDD 2VUOA 1G9NC 4KZEH 1MWAL 5DRWB 1BFOB 2F53D 2OJEB 3CAFA 4BK5A 1WBYA 3MYJA 3WLBB 2JLLA 2GTWB 2V5MA 1T1XB 4RMWA 4O2CB 5JZ7D 4X8JA 3C60D 1FNEA 4WV1B 5F1IB 1MOEA 3HNSL 3WO4B 1CVRA 3SDCA 2Z35A 2HRPL 2QHRH 3T4AB 3NIFF 4PB9H 1OAZL 1TJGL 4HW6A 5IW1A 1FJ1B 1QUNA 1LD9A 1INEL 1B2WL 3OKOB 4D0CB 2ESVD 2D03H 1A6AB 1WBZA 1H5BC 3GUTB 1CTNA 4NN7C 5T3XL 2ICWI 1GJIA 1FZOB 5KVFH 4DQOL 1VFBB 3MV8B 4NZUH 3BEVA 3DI2B 3TF7C 1PZ5B 2Q6WA 1GPOH 2OI9C 2CKBL 1YEEL 4DAGH 3WE6A 4F2MA 3GO1H 4HWBH 1DBKH 1SEBA 5IB3B 4IMLA 1SY6H 5CP3A 4M61B 3M45A 2WUCH 4MCZA 1FNHA 1X5YA 3TM6A 4ZUUA 3IFLH 1WUNT 4K2UH 4XB8A 2H1PH 5I30L 2YD9A 2V2TB 4L9LC 5C0DB 2HTLD 4EIGB 1A3QA 2BY2A 4WFFE 3RGVB 2AEQH 5I1JH 5F7DA 1P4LA 5BRZD 2C1OA 4HG4K 3OJ2C 1AD9A 1JF1A 1YDPB 4OD1L 2APFA 3JWDH 5JMOC 3W0WB 4Y5VC 3NGBC 3D3VB 1MI5A 4K07A 4GRWB 4TSBL 2R2EB 5DHYA 1YC7A 3MLWL 5J6GA 3VGAB 5C6PB 3RUGE 2BRQA 1HSBB 3LEVL 5I1LA 4WHDA 5HYJE 1IAKB 2CIIA 5JHDD 1RSFA 4F3FB 3TWCH 4Z7VF 3TVMA 2R8SL 5E6ID 4UOW1 4OGZA 3A67L 3RWJA 3D87B 2OK0H 4XNQB 4ZD3L 4YIQA 2H6PA 3MV11 5HVHB 1BREA 1DQJA 1QRND 3AMLA 4Q97A 5DRNB 3AROA 4GW4A 4MJ5B 4NQEB 3DX6B 1DQTA 1T5WA 3TJHD 2W0PA 5KOMC 3SKNB 2CO7B 2VDPL 1KJMA 4JO1L 2ZWLT 4EN3A 2YOCA 3OKNB 2X5PA 5FYJU 1OSZB 4M5YL 4I0PD 3OR7B 3F6IA 3HZVA 1M7IA 4KJYA 3VCLB 2VDML 1EO5A 3L7EB 4RFOH 3FT4B 5D5ME 2EDDA 1MFDL 5L88H 3SDAC 4DUVA 3KYKL 5DJAA 2YPVL 1XF4A 1HDMA 1FC2D 3CNKA 2G9HB 2FGWH 4NCC1 4ZTOH 4KVCL 2EDHA 5ICZB 3VFRB 5KTEL 1I1FB 4LLMA 3ARGD 2VLJA 4XPAH 3RL1B 3EDEA 3BDBA 4U6HA 5I0DA 1SYVA 5E2JA 3QQ9D 3OR6B 5GZNC 5GSRB 5INDB 4PY8I 1F45A 2H32A 3KAAA 1MCFA 3NH7H 5DEGA 2DQFA 4JPIA 4Z95H 3UO1L 5IFHH 3ZDXE 3QBTB 3QEGH 2GHWB 5DGRA 3UZQA 2UY7A 4PGDA 1KBGH 3T0WA 1OSPH 3O2DL 2AERT 3DROA 3QA3A 3KNBA 3HG1D 2YMXH 1YEJH 2Z31C 3VXUD 1V5JA 4JG1H 4TNVK 3OKKA 4QXWA 4CMMA 4UI2A 3H9HA 3WN5B 5D7LE 3SEPA 1K4DB 4WW1A 1WV7T 4YDIL 2DQUH 5L2JA 4PJBE 3T3MF 4TSAL 5IVXA 4EIZC 4H20H 5EA0H 1UENA 3JV0A 2CMRH 3O3DA 4MQ7B 1AE6H 4LQFL 5HI4C 5GJSH 2Y36L 1OP3H 4BELD 3FT3A 5F6IC 2YA2A 1J0ZA 4P46A 3DVGA 4B41A 2IEPA 5C0FA 4PJGA 2IADB 1FDLL 2Y7QB 3QPQD 4M7LH 5ALBH 3VI4F 3ZKMC 4TQEH 2YC1A 4KC3B 5GS1A 1CGXA 4R4BA 3SN6N 1BM3L 3MGOB 2A77H 4H8WL 1A5FH 4QRRA 3ZSSA 2ILLA 2ZCKH 5J12B 2CRIA 1CQKA 3NN8B 3HZMA 4JM2D 2DTMH 3QJFA 1R3HA 1YN6A 5F1KC 3V6OA 1YEDA 3VG9B 3I3EA 2H8PB 4IHOB 4AH2B 5A2LH 1FFOA 2EIBA 5D1XB 1FHGA 1WIOA 3NZ8A 4TUJB 5DJCA 3U4EA 1U0QA 4AMKL 1BFSA 4ERSL 3BSZL 3BGMB 3U0PB 1WZ1H 2FJFA 3JV4A 4IIQA 3LH2H 4IOIA 2J88H 1S7RA 1KPVB 1OVZA 3EUUA 4PJ5A 4CADA 5FHAL 1MCEA 4EBQL 1QNZH 5HI5D 3CJJA 3QCUL 2AAVA 4XP9H 4HXBH 1JV5A 4ZSOE 3DGGA 2A0LD 4LFHG 4ZFOL 5IK3A 2CSPA 4OGYH 1KENL 2BHUA 4HSQA 3OHXB 3L3HB 5FYKL 4J23A 1YQ2A 3IFOB 4XI5C 4OLZL 3B43A 2VNCA 1G6RH 4UDTB 4HS6A 5ESQB 2JB6B 4R90L 1CIUA 3O4LA 1XEDA 1A02N 4LLUA 4OZHB 4FQ2H 2WBKA 1YEKH 1F13A 5T1KB 1RZJC 4JPKH 1MCHA 1C1EH 3PHOA 1KF9B 5JXAH 1KIRA 2CGRL 1CICD 4L8CA 1QBLH 3QUXB 3IT8D 1I8LC 3VWKC 1JZ4A 3VG0H 4X6EA 4NHCL 4G8GD 4O2EA 5EN2A 2W60B 3O2DA 4OZHF 3U9UA 4X6CA 1FVCB 4JO2L 2XWBA 3MFGB 5J0BA 2FJGA 2AGJH 1PBYA 3QNXA 3HLAB 5FOBB 5E2VL 1DQQB 4P23C 5HHOA 3O45B 2LTQC 3GHEH 1CQYA 3E3QC 4XBPB 1YPZF 3CU1A 1D5XB 2C3HA 3O11B 4DK3A 3PNWB 1LO4L 5CMAB 3BZEA 3CPLA 3NABL 3PIQB 3JWOH 1XCTA 1IAOA 4PLNC 4Y2OA 3WIIH 1J8HD 3SDAD 3CFCL 2PETA 3X3FL 4HC1H 4PJEE 5IB4B 2X4RB 1KN4H 3MV9A 5CKAA 1T80A 4U1KB 3H3KA 4HX1A 4ZPVA 5FDWB 1BFTA 4V1DA 2OTWB 3QDME 4I0CC 5DJDB 2R56L 4F7TB 1CU4H 4ZNCD 5ERWB 1DLHA 2HAZA 2JCCB 1CGSL 3O6KH 4PJ8D 2BMKB 1A1NA 3MLVH 3JVGA 2EH7L 4KKCD 5JPMB 1CLZH 1X5KA 1KTLA 3K80A 3B6SB 4X7FC 1KSRA 1OPGH 1RVFH 3FT2A 3HE7B 5FKPA 2R1XB 1NFDB 2OQJB 1KXQE 4NWTH 2EZ0C 4D9LH 5CEZE 2XKNA 2Y5EA 4WHCA 5JW3H 1G9EA 3UBXG 4MNGB 2OTPA 1ZTXL 4LAJH 1ZT7A 3UZVB 1NFDF 4U7KA 5IIEA 4HIIA 4YK4B 4DN3H 2YXMA 3P9LA 3MJ7A 1RZ7H 4MJ2A 3GSOA 4XVUC 1NGWB 3AGVA 1U8PB 2BVPA 2XA8L 4LSQH 4KMLB 4MJIE 5GSVB 5HI4D 2A6JA 3WNNA 2F58H 3LS5L 2CK2A 1KB5H 1Q8MA 3RKDC 4AT6A 1XFPA 3MJGX 1LGVA 3H9SA 3ZKMD 4Z7NF 2IPUG 3V5HB 3T0EA 5E4IA 1G0DA 3SQBA 3KPNA 4XWGL 4OCWL 2DBLL 1FFNB 3HNVH 4R7DB 3FRUA 3ULUE 1F58H 4XCCH 2Z0BA 2GUOA 3P11H 5DS8B 1MCNA 2F74A 5CEZH 1CFQA 3EYSH 4G5ZL 1CLCA 4F7MB 2J8OA 1AHWC 1T5XA 2ICWB 2HRLA 4BH8A 1OD9A 2D7PA 2GSGA 4J3XA 4QXUL 4KTEH 1YEFH 4RMQA 1QTYT 5TPWH 3DWTA 5KJRL 5AAWA 1BOGB 2AABH 4OV5B 2R4SL 1M05B 3SGJA 3EHBD 4GG8B 1D5MB 4R96B 1OL0A 3FQRB 2P4AB 5B38B 4RGMC 2D7NA 1LO0L 4Q6IB 5FA3B 4JRXE 1YJDH 1KJVB 3DMMD 5AZEH 4KMTH 1JUFB 2IMNA 3LKPB 1U93B 5FYLD 4ZXBC 3RTQC 1N5YL 2IH3B 4XI5D 3AB0B 5IBLC 3TBSA 3DO7A 1IGCH 3PWJA 5BMFL 1YNLH 2FHCA 5IQ9A 3DX9B 3ULUH 4WVRA 2NY1B 4JZJA 4JQIL 2H45A 3DLQR 1FCGA 4JDZB 4R2GB 2P5WB 4F15C 4K9EC 3N1PC 2W9EH 4WUKL 4P4RA 1G1CA 4HKJA 4OLUH 3MTRA 3VWKD 3FB5A 1A7BA 3HC3H 4G8EA 2QQQA 4I2XA 4ALAL 3NA4A 1BIIA 5GGUB 2WBJC 1I8MA 1W72B 4MCYB 5A2FA 4NRYB 1T4KB 5IBTH 3QDGA 4DW2L 1IKFH 3IU4H 4DUWA 1QHPA 3G6DH 5CGYC 2J6EH 2B39A 2HLAA 5F93C 2UWEA 1SJHA 1B0RA 3FQUA 1UH2A 5EU7E 3MLRL 2QSCL 3BKJL 5D7JB 1OB1B 4F57L 2DQEH 5MENA 5IVNA 1ITBB 1UFUA 3QQ4B 2P5ED 3D2UA 4U3XA 4LHQB 4HFUH 4KRPC 4UTBH 2E6QA 3CU7A 3AM8C 4OAWA 3W9DB 4GT7A 2OS7A 3QH3B 1JNNH 5HGAB 3KWWA 5EULV 3SGDH 3WD5H 1F6AB 1DANT 4XNYL 2CUMA 2OLDA 4HCRH 1MIML 3TBWB 2AK1L 2V9TA 1NGPL 4NN5C 1L0YA 3DUSB 4IRJD 3RA7H 3PWPB 4GKZA 1NAMH 1X5HA 4U0RB 4OKVB 2R39A 4XVSL 4ZPTB 5HHPA 1OAQH 3HR5A 2BNRA 4LCWE 5GQBA 2A73B 3X12B 5IMKB 2EZ0D 4FTVB 3EOAB 1VEOA 3TIDA 1Y6MR 3MLZL 3QUMA 5ACLA 5D7SL 1AC0A 4M7JH 2PW2B 3NPSC 4QHMB 4QRPB 3ZTJH 5DI8B 5IKCB 1F4YL 3H0TA 1HQ4A 3FB6A 1Y18B 2YBRB 3LDBB 3OJDB 3DRTA 4F7EB 1HHGB 1QO3B 3KPRD 3H7BA 2R9HC 3QHZL 1DEEA 3ZSTA 4JDTH 4XVUD 3ROLB 3UP1A 2PYEA 1NKOA 4ZUWB 4J3OC 3STLB 3FN0H 1IKNA 5ETUB 3SBWA 5KBNC 3VFNA 4XCNA 3OXRA 2ATKA 5K33A 4P2OA 3RFZC 3SGKC 2VZ1A 5HDQL 5DJXA 3MRIA 3WDJA 4RA3A 1S9YA 4M6OH 5DHVH 5ENWA 2FR4A 4JHBA 3GM0A 4DGIH 5ANMA 4LSSL 3M8OL 3MRMA 5DYOB 3MRGB 32C2A 3C60B 5K93A 4HKBB 2DI7A 5DUML 2D31A 1F3JB 5ALCL 2UZYB 3ILQC 2EYSA 3VRJA 5F7EL 4U1LB 2NW2B 2DOCA 1R5VA 5DJZA 4EI6B 1MVUB 4WTZA 5F9JB 2BNQD 3WUZA 4C55A 1S7UA 5BVJA 1T20A 5FM5M 2QQNH 1R3KB 3MV8E 1BLNA 4M43L 1JRHL 2VDKL 3EIFA 5GIRA 4G7YL 5J7CC 1T66C 1LILA 4L4VA 3EGSB 5K9OB 4QTIL 5E6YA 2ZOLA 4YGVB 4JFQA 3QNZB 2EH8L 2WUBH 5GRUL 5D71H 5BZWB 4HV8B 2XQBH 1QSFD 1J9CT 3RTQD 5B39G 3FB7B 4YWGH 2IQAA 4ZYKA 1SBSL 1NUNB 3BDYH 1YMMA 4OD3L 4ENEC 3CSYB 1F02I 2IH1A 5I66B 3MC0A 3TA3B 4GRLB 2ZJSL 1PD6A 1IAIM 4MZ3A 1A6ZB 1I1RA 3GSNA 5FA4A 4M7KH 4N9GB 3W0WE 2OXHA 4KQ4L 1EBPA 3RX7A 2ORBH 3D3VE 3C09C 1IEAA 4X5LA 5FF6B 3O8XA 3RWDB 4GRWE 4LSRL 3TT3L 5B8CC 3MGAA 1K8IA 3H9SD 1T83A 3F6LA 4LLWB 2WBJD 2PO6A 2W0LA 1GC1C 3VRLE 3AXLA 1BQHG 1WEJL 4JN2A 1RUML 3R8QA 1G7MA 1BEYL 1H0DA 4M48L 4OBSA 4UDUB 5CGYD 3UDWA 1ADQA 5JHDB 1A6VL 3GNMH 4K3HA 3JUYA 2FGZA 5E6IB 5C09B 1IRAY 1BBDH 3V0VA 3C8KB 3F65A 4MD4B 3N85L 3TYFB 4NQEE 1WIUA 8FABB 5GRVL 3UAJD 4G8IB 5TFSH 4CU8A 4O4YL 3TFKC 3EJJX 4PR5B 3FN3A 1ZSDB 5D9SB 1LEKA 3BUTA 4NFCA 1FO0B 5EBLA 2XKUA 1HH6B 2Y06L 5D2NA 5C0IB 4GAJH 3RWHB 1FORH 1CK0L 3JTSB 3QCVH 1BPVA 2XPGA 4XCYA 1WF5A 3DV6B 4PJ7A 1NANI 5BVPH 1H8SA 1N59B 2EXYC 1BD2A 3K2MC 2FJHA 4NNYB 3L3OB 2L7JA 4OJFH 1A3LL 2NNAA 2MKWA 3ARGB 4EVNB 1UXSA 1CTOA 5IMOB 3ECBA 3U7AA 3CVHB 5B3JF 3PJSB 3PWLB 1F2XK 1HWHB 1MRDH 1NBZA 4Q9CA 5GGVY 1JTTA 5AZ2L 4RMSA 5EPMA 3TCXA 3QAZB 3FHAA 1MJUH 3BPNC 5IFJA 1ED3B 4HJ0C 3VXRD 4PRIA 1U9KA 4LRNH 4FP8H 3LHPH 4ZUTA 1JNLH 1NCDH 1JWUB 4S2SB 3RIFK 5EU5B 3HC4H 1DL7H 4JFDD 1L7TH 2QKIA 1BVLA 4BQBA 1CDUA 1HIMH 4ZTPH 3WSQH 4P9HL 2PR4H 3PDDA 3LN5A 4BZ1H 4F58L 3F58H 3RPIB 2AEPH 3D2UD 3GIZH 5FIEA 4WWID 2R1WB 1RJCA 1QVOB 3CVIH 4L4TB 2AV7B 3HCVA 1MCPL 4PRHB 1SJXA 1EHAA 3QO1A 4JY4B 5D8JL 1NQBA 2PNDA 5DRXA 4NNXB 5CZXD 2V5SA 3KDMA 3Q6GL 3TPKA 2UZXB 2H2SC 4CU6A 3FQTB 1JGVL 5KANG 1S8DB 1NLBH 1K2DB 3IDMB 3QCTH 1BX2A 4D0DA 4L3ED 4NWUH 3S88L 3BH9A 3QJHA 3PWNA 3I6KB 3ARBC 1ZWIA 4M03A 3RNKB 1PYWB 1XR8A 1H5BB 3T8XB 2A9MH 3GJFB 4ETQA 1CBVL 2BNRD 4FQHB 4NPYA 4WY7H 3SOBH 3RIAK 43CAB 3MJ9A 1CT8A 2W9DL 3PWVB 3CDGB 1N26A 2OI9B 1OHQA 3WJLC 1NDGB 3HZYB 2GEEA 4QHUA 3ZE0F 5DSCB 4FZEL 4Z0BL 3H9YA 3CD4A 3FFCD 4NQTA 5EUOA 1UM5H 3QPXL 3MA9H 1MFBL 3GIVB 1GGBL 2MPAL 4Z7UA 4R8WH 1KELL 3P30H 1MFCH 3IVKB 5H2BA 1Z9OA 3DUUB 4ENED 4NC1C 3W39B 4M5ZH 4D2NA 2GTZA 1CVSC 2QR0B 1FZKA 1NMAH 4L9LB 2FRGP 2V6HA 1F3DJ 4HJGB 5L9DL 1HXMB 4NOFA 1ND0A 5ADOL 4P3CH 5ILTL 2JJWA 1G7LA 1G9MC 4DKDC 3L9RB 2ITDA 3GSRB 2DICA 5F7MC 2X4SA 1PG7L 4Y5VB 3NGBB 4PGZA 3KXFA 1UJ3C 3DUHA 3BVNA 3BT2L 4GG6F 1QYGL 5C2BL 4NQCD 1MREL 5CZVH 2OL3H 3VD7A 2BFVH 4M4RA 3D85A 5EBWB 4ISVA 4MNHA 3EFFB 4G8GB 5HHQB 2A9NH 5HY9A 1RZFL 1RHFA 4O58L 2OCFD 4M8VA 2FIRT 1NDMB 1QOKA 1MQKH 3RPKA 1GGCH 4YX2L 3N9GH 3TFKD 5DD5L 3UBXB 4Y19D 2NY0C 4HGWA 2AXFA 4AEHH 4HJJH 3VXQB 5DD6B 1PEWA 5C0CA 2E8ZA 1FPTL 2HWZL 4S1SH 3SGEI 1YNKH 1I85C 1UWEH 1CE1H 4L4VD 2IQ9L 4OZIA 4XP6H 4M9PA 5FUCC 1AGEB 4J6RL 3WYRA 3BZ4A 1J8HB 1CD1B 1I1YA 3IXAA 2VERN 3SDAB 2JIXD 4HG4J 1AIFA 2AJSH 1DBML 1A7NH 1ZHBA 4I18C 1JHTA 1RZIB 3AFLA 5DQ9B 4AEEA 1OARL 4KVNL 1CL7I 4JY6A 2N56A 2DQHL 1J1OH 2JCCE 2G5BA 3PV6B 5EBGA 3QXTA 3UTZB 2DQCH 1FL6B 3W11C 4M1GH 4XP1H 4YDJB 3TBVB 4MXQC 4GKSA 5E7BA 4G6ML 3EOTH 4C56E 3AUVA 4JG0H 5EC1A 2VZOA 5GPRA 3LQZB 5HGHA 4PV8A 1KIQA 1NCWL 2I27N 5L2KD 4BZ2H 1WFOA 1S9XA 3FTGA 1XZ0B 1M6OA 1HQRB 1F8TH 3CXHJ 1Q9OA 2A6KA 2C3WA 1ORSA 4OFYD 4MNGE 5JIHA 2P8MA 4Y16C 3MRKB 3SQOL 4EUPA 4EI5A 4X4MA 4HUWA 5IWLA 1L7IL 3V4PH 1EJ6A 1ZLVH 3S3JA 5F71A 1IM9A 1T0NB 2Z31B 1DUYA 5BV7C 3RNQB 2MWCA 1NFIA 4EZMA 1PLGH 1I3RA 3LMJL 2H9GB 1BOYA 4RMUA 1LO5A 4N8CL 3FOMA 2QSVA 1XGRB 1OAXH 4WWKA 4XZUA 4NKIL 4WU7B 3T2PA 3U36A 4KI5C 3MQIA 3KPTA 1KPRA 2EDQA 4HPYL 4AQOA 2HFEA 2GW5A 3C6SA 4LRIA 2N7AA 4HH9A 5I6XC 2V17L 5C0JA 1VACB 1N2RA 1QBMH 3GGWA 4L5FL 4U1HA 2UVEA 5I8CA 3LRHA 4PJHF 3G08B 3V52H 4DZ8B 3ZYIA 2WP3O 3REVA 4GLRH 4K7FA 5I74C 2D7MA 1XAUA 4JREC 1X5JA 4FQLL 4JVUA 2PF6A 5C07A 5BZDB 3IJHA 4FG6D 3FQNB 4C83B 3OAUL 1PSKL 5LCVL 2EECA 2CXGA 2OTUB 1MJ7H 3G6AA 1T89A 3JXAA 4PJDB 1CFVL 2BNUB 1JGEA 2V2WA 3CFDA 4AL8L 2O26U 3UPCA 1V8HA 1RI8A 4LU5L 5J4MA 1P1ZA 5LQBL 4J12A 1WIPA 3GKWL 1HOCB 3TH2T 4HIHB 1TTGA 2X4UB 3DMMB 5FO9A 4H0IA 1KG0B 2GJ6D 3OB0H 4NKMA 2ADJB 4XXCC 3MBEC 2DWDA 4HWEH 3UJTH 1R6VA 4KZEL 2ZSWA 4LEOA 3SJVE 3WEXB 1JYWA 2P5WE 5DJ8B 5JQ6L 4JZNB 3IDIB 1QACA 1XGUB 1H3WM 2HVKB 2R15A 2YWZA 4L8SB 4EOWH 4WEBL 5KSVB 2BY3A 4X99A 2IPTH 4XPFH 3VWKB 1VADB 2FHFA 1EEZB 1EAPB 1K3IA 1UZ6E 1U36A 1CE6A 2QHRL 1EV2E 2R0ZH 1IQWH 1IGJA 5EIQA 3I3DA 4CW1A 1A9EA 3UTTD 4R4NC 4RCAA 1KJ2L 3DSNA 4UT9H 4NT6A 5BJTA 1S5HA 4LLDA 5IVOA 4P23B 4LIQH 4R3SB 2D03L 2LTQB 3NCJL 5A2KH 4M7ZC 3O41B 2VDLL 2E5EA 5JMRA 4FQIH 1JGLH 3V7AG 1WZLA 1OWWA 3CCHB 3GB7B 3D0LA 4WU5A 5KVFL 2DQDH 4NZUL 2EDYA 3QIUD 1GZQB 3Q5OA 3BN9D 4L8DA 4P3DB 4DAGL 4S1QH 2HKHH 4ODWA 1T21A 2MQ3A 4HWBL 1FGVH 3MR9B 2VL5B 5DLMH 1ZHNB 2WUCL 3P4MB 4WI8A 2PXYC 3PWPE 3MV01 4O51A 4OT1L 3IFLL 1HH9B 1N0LA 2H1PL 4KGLA 5IESH 3EOBA 4HUVB 1W72L 1FC1A 2VLRA 1MCRA 3BISA 1LEGB 5AG9A 2EDXA 3LEXA 4NKOB 2AEQL 4TVPE 5I1JL 1CGUA 2VQ1A 4RZCA 3F8UB 4FTVE 3JWDL 4L4JA 4R0LC 3N1GC 5GS0D 1U95B 4I1NB 3R0NA 1FSKC 4U1SA 4P4KA 4NUJB 4Z5RA 3FRPA 3R06B 2DKSA 1NPUA 3CLEH 4PBWD 2BOCB 2Z93A 4NO5B 4NQSB 2HT2C 2K7PA 3S97C 3EFDH 1S9WA 1GRWA 1A7RH 2FX7H 2VISB 3B2UC 4GUPA 4RGOH 3KPRB 4ODSH 4D3CH 4KTYA 2OK0L 3V6ZA 2ADIB 1OF2B 5AUMB 3RVVD 4ODVH 2F53E 3QO0A 2KQNA 4PP2A 5ICXA 2YZ1A 1CCZA 3PL6D 4KI5D 2DQGL 2J8UF 2W9LA 1YEIH 1HXYA 5C08B 4NCDA 1TNMA 4JAMA 2GITB 1MEXH 3H9ZA 1ES0B 4ZOAA 3EO9H 2XN9D 4TVPH 5L88L 1KACB 5EIIB 4PJXE 4QNPF 3BKYH 4P99A 5E1HB 5FECA 3SO3C 3N1MC 2VN7A 1OW0A 2QJDA 3RZWA 4ZTOL 5ADPH 5JORB 2DWEA 3TIEB 5F88A 5IROC 5J8OA 4J4PD 4XPAL 3TCLA 1AHWB 3L3GA 2F54A 2BNQB 3OGCA 5EO0A 1FG2B 4I4WB 4DCQB 12E8H 1WCQA 4BSWA 5IG7B 3V6FA 3QEUA 2IC2A 4U6YB 2PTVA 3NH7L 3BD4A 1T22B 2I25N 3HPLB 5FUZH 3S5LG 4Z95L 3KPQA 5MP6L 5DXWA 3QEGL 4OCRH 3RJDA 5MHSD 5C0NC 4EI5D 5DD3H 3SKJH 2VLLA 1HYSC 2BSSB 4MWFA 2YMXL 1SY6A 1YEJL 4PP1C 3BPCA 1VGEL 1D5ZB 2X4TB 4XVJH 3ZKQD 1NCAL 5IHZB 1QSFB 4JG1L 1BJMA 3RTQB 3MBED 4QO1A 1VESA 3BP4A 3MRCB 4FNLH 2BOBB 4NKQB 5DZLA 3CDFA 4XNMA 1B88A 2NW3B 3HUJF 4LVNC 2HVJB 3MRFB 2DLTA 4H20L 5BRZE 5E8OA 1E27B 2I24N 3A6CH 2CMRL 3MJ6A 4F15B 2NY6C 5GJSL 5IF0A 2O61A 1W8OA 2VIRB 4OLVL 4EN3C 3HA0A 3WO3B 1HE7A 3CX5J 3UTSD 3OTTA 3QUYA 2BY1A 5ALBL 4R26H 3QHTC 1ZHKB 2WBJB 3GMRA 4TQEL 5DTFA 1JK8B 4X7TA 5I17A 4FXKA 4PRAA 5JHDE 4RSVA 3S4SA 2EE6A 4WNQB 5GRZA 3MRLB 4ZAKC 2ZCKL 3LKNB 4G9FD 2AJZA 3KPOA 3G5ZB 4X6DF 5KW9H 1AR1C 4XBEH 3CFJA 4LCYA 2HFGH 3DBXA 3V6BR 5C0GB 3HMXH 3CSGA 2NXZC 5DEFB 1AJ7L 4MQXC 4ZOEA 3BP6B 1S7XB 3NCYP 1VB9A 2D0HA 1TJHH 1WZ1L 3GRWH 2DAVA 3S6CA 1IQDB 3LH2L 5JR1H 2AJVH 1SYSA 1VKXB 3L5HA 1NJ9B 2CPCA 3VWJA 1ZANH 1KXTB 1QNZL 4JRYD 4HXBL 4NN5B 4E0RA 2PCPA 4KV5E 4OGYL 2VITB 2VN4A 1QKZH 1A1OB 2GSIB 4CMHC 3NIDE 4M8QB 1EZVX 3RUGA 1L6ZA 2H26B 4Y1AB 2NQCA 1SHMA 4H25A 2VAAB 1AP2A 5HYJA 4OZFA 4QCIB 3B5HA 1REIA 2MQ0A 1N7ML 4FQ2L 5L0QC 5GGTH 3ALWA 1M71A 4JR9H 4MMXC 4Y4HA 4JPKL 4P46C 3QIBA 1C1EL 3SDXF 5JPNB 4K3GA 1UB5B 4IOSD 3FQWA 4XP5H 3GI8L 4LCCC 2HT2D 2K1MA 3ARRA 3VG0L 3NPSB 1FO0H 3VXRB 1DE4A 4HZLA 5GS1C 2XZQH 1UEMA 3HG1E 4Z7WF 1BVKA 1QD0A 3NCYS 3MCKA 3VXUE 3LKQA 3B2UD 3QI9C 4L3AA 5F7NC 1MHEA 4JFDB 3ULVD 3ZO0A 2AGJL 3WXVH 5ID0A 3ESUF 3K3QA 1U3ZA 3FONA 5D5MA 2MKLC 5CBAB 1RZ8B 3GHEL 2YRZA 5TE4L 1XF3B 1T1YB 3BKCH 2DD8H 1JE6A 1EERB 4XPBH 1ZVSB 2EDRA 3KPPB 5DD1L 1QLFA 3VFWB 3JWOL 1XIWC 2FEEI 2BSTB 2VKXA 4QHKJ 5TH2B 4LVOC 2HH0H 5E0QA 4R97B 4UU9B 2LU4A 2W0FB 1F5WA 4UIKL 5MEQA 1CU4L 3OF6A 3OKMB 4KHXH 4L3EB 1JL8A 5E5UB 3EJZC 4LARH 2VQUA 2APBA 2DM7A 1LE5A 3O6KL 1EK3A 4NHUA 3EAKA 3TNNA 4JGJA 3RJQB 2E6JA 1U8QA 3B9KA 1CLZL 3QXUA 4IS6B 4MAUH 2X1WL 1A4KB 1A8JH 2XYCA 2HN7A 1OPGL 4NSKB 1UXWB 3S36H 2GT9B 1RHHB 3PDGA 4PV9B 5ITBL 1ZLUH 1ZHLB 4P4KD 5D7LA 2LU7A 4PJBA 4EKXA 5HJ3A 5CGMA 4MDIB 4JVPA 3DPBA 3FFCB 4DN3L 3VD9A 4LSDA 3UX9B 4AEIH 4PGEA 2X4QA 4LCUA 4IBLT 3FCTB 4LSQL 2WWMC 5ITFB 1G6RA 1D5IL 1D9KD 2ATPA 3C09B 1H3PL 1T1WB 4AM0B 3IRZA 5F7FA 1KB5L 2HJFA 2XG5A 4YNYB 4MLIA 1A7QL 5DMKA 2KDGA 1RJZA 2R1YB 1KIUA 4JKLA 4G8GE 1P7KA 4GAYA 1TVBA 4F9LA 1FVDA 3HNVL 4Z8FH 4E42B 4LCIH 4OZGE 1Q38A 1F58L 5JOFB 3IETB 4XCCL 1R0AL 4H8WC 2HT3D 4ELKB 2YA1A 1CF8H 4ODHL 3MREA 1HI6A 3WIHA 3JZ7A 3K8KA 5TDPA 3EYSL 1IGIL 2ZCHL 4GBXD 5EU4B 5T3XD 5EZJB 1D6EA 2P49B 4Y19B 4ZSOA 2OJZH 2VOTA 1JJUA 3QSKB 1BAFL 3K0WA 2VB5A 3S96B 4F7CB 5GHWH 5TQ2H 1YEFL 3DI3B 1WFUA 5DEZA 1J8HE 4XNXL 5I2IA 4OZ4A 1RK1B 1NH6A 2Z8VC 3I3BA 3BZDA 2ARWA 1FE8H 4KJQC 3ZZ1A 1KNOA 4MNQD 1WAAF 1TMCB 4HC1A 5DUBB 2JIXB 1MLCA 2AP2A 3D25B 1CDBA 5FM8A 1L4IA 5E2WH 3T0DA 1YJDL 2JF1A 3IFNH 2MNUA 4FA8A 5AZEL 3GBNL 4YR6A 4KMTL 2DS4A 4ONHB 3WMSA 1I7TB 2RAMA 4HIJB 2R0WH 4X98B 3PQYD 1P6FA 1IGCL 1YNLL 2ZPKL 4Q0XH 5DJYA 3G5XB 5JHLL 5JNYB 2LAAA 4YZFE 3TNMB 2W9EL 5L2KB 1QR1A 3BPNB 3T0EC 4Q6YA 5F96L 3UPRA 4XWOC 1IC7L 1HHJB 3PGDA 3QI9D 5IBTL 3UPAA 3GMLA 1IKFL 3IU4L 5F44A 4OLEA 1Q0YH 2X9YA 3RI5F 4RISH 3QXVA 3SDDA 3Q0HA 2J6EL 3MLXH 2DYPB 2QSQA 5MERA 1W0VB 1MCDA 2BVQB 2X9WA 3MV7D 4ZUVA 3O6LH 2I9LA 3CUPA 1DJSA 4PJEA 4QRTB 4UTBL 4PG9B 4Y5YA 4N0UB 4YC2C 2PUQT 3TGXA 3DXAB 3QDMA 4POUB 1XIWD 3IAGC 3VI3F 3I2CH 4I3GA 43C9A 2X4NB 4LLVB 4NJAL 1QPXA 1X4XA 1C7SA 3VWJD 4CNIB 5E8PB 4HCRL 1YY9C 4JLRA 4HKZB 2KUTA 2DF3A 1AXSB 1NBQA 2WSKA 4Y4KA 1R24A 3RA7L 1SEQH 3KPMA 1IZKA 3ARBB 4Z7QF 3BMVA 1MCKA 3RU8H 3WL9A 3IJSA 2P8LB 4R7NA 1QFUL 3BX7C 4N8VA 2PKDA 3CH8A 3NFNB 3NMEA 3ZKNC 1A2YB 1QFWM 3GK8L 2N7BA 4NO3A 4P57A 3FO9B 1AI1H 1EO7A 1I7UB 4JZJC 2AJ3A 3JWNC 1ONQA 4PJDE 5CWSA 2FZ3B 4Y4HD 1AGFB 4QYOA 4X7SH 2VAJA 4G6KL 5DQJB 1OOAA 5DK0A 4PRBA 2EDNA 5C8JB 5BQ7A 4HF5L 4PYHA 3ZT7A 5JLZB 3RVTD 5JOPE 5DURD 3M17A 3V8OA 3RWIB 2DLGA 3ARDC 3PDOB 4PJ9D 4KROC 5FYLE 3VFSB 4MXWL 1HILA 2BERA 4PBXA 4BFEA 5CEXA 4XH2B 3AS1A 1BJ1H 1UM4H 2WWMD 3Q1SH 3U46B 1IILE 5HGBB 1FL3A 1MCJA 3AS2A 3HE6A 4FFYH 5E2UH 4NQDD 4MQSB 2EIDA 1JZ8A 5ID1A 4I5BB 2VH5L 3P0YL 5DJ2A 5EZLB 3IDXL 4M6OL 3X11A 2ARJA 4G3YL 1CXFA 4DGIL 4YHNA 3C6LA 4J7RA 4QHNB 3O6FC 1CN4A 4U6XA 3LRSA 3C5ZA 4TULH 3GMQB 3W9EA 2C7UB 2WINA 5SV4A 1IT9H 4QXTA 2IPKA 1P7QD 2FSEB 3MJ8B 3MRNB 3V5KB 3UTTB 4KUCD 4D8PA 2XTJD 4XPGH 5HPMB 3RZCA 2FO4A 1BF8A 2P5EE 2VWEE 2HA1A 4KRNA 5K9KA 1TQBB 1KCLA 1RFDH 2VR4A 3BP5A 1F4XH 4QRUA 3D1MC 1NCCL 2QQNL 5FYLH 1U8MA 4JRXA 4YEEA 3HPJB 1JHKH 1H3VA 4ORGA 2P8PB 4O02H 3FQXA 3SE8H 1DLFL 4Y4FA 4MDJB 2W0KA 3WFHA 5L8JB 5HSFA 1UB6A 2WUBL 5IW6A 4Q2ZB 4I18B 1ZLUK 4BK4A 5A3IC 5D71L 3QNYA 1CFNA 1RZJL 4LHJB 2XQBL 4L3CB 3K1KC 4X4YA 4YWGL 5DGQA 1EFXD 5FGBA 1VFUA 1KLGA 3BDYL 5FYKD 1NAMA 1JYNA 2NZIA 2E7CA 5BS0B 4I0KA 1NCUA 5I1KH 1NBYB 2V7HA 1AQKH 3SBWC 4K23H 5KS9E 4HHAA 3TBYA 1DDHA 1JPSL 1K4CA 4AEFA 1AQDB 4QTHB 4AY0A 2EIZB 1U6AH 2C1PA 3MXVH 3LQAH 3FB8B 4A6YB 1IAIL 3K2UH 2XWTB 4NZRH 4XWOD 1FRGL 4Y16B 2D9QB 3MROA 4G43A 3IU3A 2DDQH 1U8KA 4PJFE 4XGZA 3AREC 2NXYD 2X1XR 3I75A 4U1NB 3WHXB 5LGKA 3GJFK 3I02A 2R0LH 4K94H 5GGSB 4D0BB 3RWCA 5BV7B 4O00A 2AKRB 3KPRE 3GNML 4NO2B 3L95B 4NO0D 1BBDL 1NANH 3S5LB 4A2MA 4HWUA 2GK0A 1F4WL 2R29H 5TFSL 2R23B 1GVIA 4W81A 5J1TC 1TZIB 4UOJA 3GMPB 2FYYB 3L3DB 4PYGA 1F2QA 5IVZB 3L7FB 2D0FA 1V3KA 4N5EC 5DHVA 3V0WL 3SE4C 4OI9A 2BJMH 3H42H 3QCVL 3CFKA 4LBEB 4HD9A 4HS3A 3EDDA 3S9DB 4M6MH 3T1WA 1LK3H 5DA0B 5DK2A 1YA5A 5BVPL 4LCWA 2BRRH 5I1CH 5I74B 1Y6KR 4FQJL 5CHNB 1K6QH 2EDKA 2NY2C 3EW3B 3GMOA 3ZKND 2X70A 2BNQE 4OJFL 4X9BA 4HUXA 3QP3A 4FFZH 5KSBB 4X4XB 4QXGL 1MRDL 4OB5L 1NEZG 4BQCA 4PJCB 1LK2A 4FS0A 3O8XC 4KUZH 5T3ZL 1MCSA 5DRWA 1T83C 1II4E 1BFOA 2OJEA 2DJ4A 3VMOA 3VFTB 3BEWB 4GSDL 5KSBF 1UQSB 5D70H 1CG9B 3WLBA 3CFBA 3ARDD 1JNLL 1NCDL 5CBEB 3UDWC 1QSFE 2GTWA 4KROD 3BAEL 4CN1A 4OGXH 1L7TL 1S7VA 4O2CA 4ZTPL 3WSQL 3K1DA 4WV1A 5D2LF 2XZCH 3TJEL 3ZDZE 4BZ1L 3MBEB 3T4AA 3F58L 2AEPL 4LASH 4G6AC 3GIZL 4DTGH 3G5VB 1D6VH 3MLYL 1FJ1A 2X09A 5EDXA 5JO5B 4LPXA 4AIZB 5A1AA 2F19H 1KEGL 3OKOA 4KDTC 4PJIF 4BYHA 4D0CA 3WDIA 3TBTB 4OD2B 3H9SE 4AIXA 2FX8H 3IFPB 4CVWA 3GUTA 2VXVH 1UKQA 4FXGB 1FZOA 3T0BA 5JW4R 1YEHH 2VZ3A 3E6FB 1NLBL 3RVWC 1VFBA 3MV8A 3QCTL 2A6IB 2R0KH 4Y4KD 1PZ5A 3SPVB 3DETC 5FHBH 5GGRB 2VDOH 4POZC 1RUAH 3PABB 1BZ7B 4G9FB 5IB3A 1MAMH 2VSDA 3WCYA 4M61A 2YPKA 5F9WC 2A9ML 4U1MB 3BXNB 3LPFA 1PQZB 1B4RA 4ELME 4WY7L 3QXAA 5C9JB 3SOBL 5D7IF 1GL4B 4OF5A 5DT1H 3ME0A 5KVDH 2RHEA 3RGVA 5L8LB 3T08A 1G0YR 4DKEH 5L7XL 1OTSC 5A3ID 4KJWD 1YDPA 4W4NA 4K9EL 1UM5L 3W0WA 3MA9L 2P47B 2PXYB 5E8DH 1WLHA 3D3VA 4WHTB 4JRYB 1UCTA 3DHJA 5GS3A 3VFGH 2COQA 2R2EA 3WJJA 4JO3L 1S78D 4Y1AE 1HSBA 1FLTX 2AI0H 4QHKI 3HAEB 5TQ0L 4HT1L 4P3CL 4F3FA 1M1SA 1EO8H 5IQ7H 4R0LB 4X7DC 1Q0XL 4P59H 35C8H 4XNQA 2X4PB 4PIRF 1UVQB 4IOFD 1FSKB 3ARED 1FNEB 3VXRE 3JTTA 3SGEH 1OWRM 4NQEA 3DX6A 4UNVA 4W4OA 3SKOB 2ZKHL 1X7QB 3GJEB 5E9DD 3SKNA 2OL3L 4JQVA 1JF6A 3C9NB 4LVHC 4G9DB 4XPHL 4JFDE 1KUMA 3OKNA 3QEHA 3OR7A 3VCLA 4PJAB 3L7EA 3FT4A 5HDBF 4U1IB 4GOSA 1GGCL 1CL7H 3N9GL 5CINL 3PP3K 4P0DA 2OBGA 4HJJL 4LF3B 1BBJA 3QXDB 4LKCB 5ICZA 4S1SL 3VFRA 3S3PA 1I1FA 1OTTC 1TXKA 1UWEL 4N5ED 1PG7X 3BEVB 3RL1A 2OMNA 3MRJA 3PWUB 4S0SD 4Y4FD 3EJYD 4CN6A 4F2MB 1MY5A 1F6FB 5JUEH 1SEBB 3OR6A 5DF0A 3SKMA 5INDA 3F7YB 2SEBB 1A7NL 2FX9H 3SO3B 3O2VH 3EYOA 4L3EE 3G6JB 4ZUUB 2DQCL 3IGAB 1F11A 1RIHH 2VR9A 4XP1L 3U2SB 3ESVF 3L5WB 3WNOA 1X5AA 1V3JA 4TPRH 1G84A 5I18H 4JG0L 1I1AC 3LS4H 3NIGE 2C1OB 2NTFB 1AD9B 3K8LA 1JMZA 4B50A 4BZ2L 1U8JB 4M7LT 5E5RB 4W6XB 4H1LG 3WN5A 5CUSL 5FXCH 1K4DA 3U1SH 1EIBA 2NPLX 5I8EB 4YHPA 3BWUC 1A14H 4QRQB 4WTZG 3VXTA 5J6GB 4Q74A 2AEWA 2P48B 3FFCE 1ZXQA 4JDVB 4MQ7A 4XXDB 3R1GH 5B22A 3V4PL 2DL2A 3D18B 4U6TA 1CD8A 1U8NB 3QG7H 1FNLA 4P9HC 2AQ2A 5HVWA 2H6PB 3NACL 3HRPA 1ACYH 4RQQA 4LVNB 3MGOA 4P2QB 4CUCA 1MWAB 4GW4B 4ZS7H 4KK6D 4EDWH 4LK4A 1NC4B 2JJSA 2DMCA 3STZB 4YXHH 1IAMA 1OAXL 3NN8A 5KG9A 2NY6B 2VC2L 1X6NA 4QLRA 1Y0LA 2DTSA 4LAQL 3T2NH 5CCKH 2W65B 4KJYB 2H8PA 4IHOA 4AH2A 5D1XA 3PXHA 1FFRA 4NQCE 4TUJA 4BH7B 3RVWD 2ZG2A 3NBNA 3QB7C 3V52L 3BGMA 5JOEA 3DETD 3U0PA 2J7LA 5IEKB 1HDMB 4Y2DD 5DMGD 1Q9KB 4ZAKB 3QUMH 5FO7B 1KPVA 4MJ4A 1E28B 4ZQKB 4D9RD 1ZEAH 5GRJH 3T0VA 1J1PL 4Y19E 1SYVB 2NXZB 3ZL4H 2CUIA 1W0WB 4KAQH 4JCMA 2H32B 1MJ7L 1NSNH 4J3VA 1GOHA 2F5AH 5HGDB 4Z7OF 4JPIB 3CH1B 5GGVL 5ELIA 3IFOA 3VFVA 1WSST 1FNGB 4YXKH 5C0AD 2CKBB 2XOTA 2JB6A 5ESQA 1PFCA 3O4OC 1FNSL 1ZA6B 1F4AA 4MNQB 5T1KA 5KVGL 2GY7B 3E1F1 3QUXA 1WT5A 2J4WL 1GC1L 1PX4A 4CMMB 4PGJA 3MACL 2VABB 2WIMA 1RZKC 5CP7A 5EO9B 2W60A 5F97E 2JK5A 3UJTL 5L2JB 1FVCA 5DZNA 5IVXB 3WS6A 5DDHB 3DECA 3RAJH 4WHYH 4WWKC 5L2KE 1QFPA 3HLAA 1INQB 3W81A 5FOBA 1DQQA 4Y5XC 4P46B 3DVGB 2C3VB 5C0FB 2HYMA 2BK8A 4LRIC 4XBPA 5IVXF 2IPTL 4WDIB 4LCCB 3PGFH 4Z78B 1D5XA 1T0MA 3O11A 3BQUC 5GS1B 3QWOB 3M1BA 3PNWA 2YN5A 3MV8D 5CMAA 4TTDC 5LKNA 1OCWL 3PIQA 4QRRB 3FZUC 3QI9B 3GSQB 1IGFH 2CDEB 1GHFH 4OGAC 2XRAH 4UT9L 4PJGF 4LDLB 1CLOH 1MAKA 1TNNA 2IBZY 2DMBA 5IB4A 3QJFB 1FBIL 2X4RA 2FD6H 3MV7B 1W2KT 2LU3A 4LIQL 4U1KA 4BQ6A 5C71A 4N0UE 5FDWA 1KEML 5JXEA 2F5BH 2OTWA 2CK0L 3DXAE 5DJDA 5TF1L 1JGLL 4F7TA 4MHHI 5FUOH 1OTTD 4Z76B 2M1KA 5M95B 3KYNA 2JCCA 1T89C 2FJFB 2DB8A 2BC4B 2OZ4L 1XIWB 2BMKA 3MBXH 3E8UH 1S7RB 2ERJC 3BWAB 4PJ5B 3GSNH 4C56A 1BMGA 1G7QB 4NM4H 3B6SA 4TSCH 3U7WH 1VERA 4ZOBA 2R1XA 5DLML 1FV1B 2OQJA 5EORH 1WWBX 4F8TA 4NP4H 3HRZB 4I9WD 1PKQB 4MNGA 1U8LA 3I6GB 3CC5B 3ORJA 4K71C 3LIZL 2ICWJ 3MOBH 1SM3H 2P7TB 2VYRE 3KS0J 1WJ3A 5HHXL 2K3TA 1XF5A 4LSPH 4U7MA 5DFVC 1E6JH 5C3TA 3HZKB 2D9CA 1IZJA 1MH5A 2JJTC 1RULH 3VA6A 1UG9A 1U8PA 1KIRB 1RV6X 4HUNB 4NQED 4Q58C 5GSVA 2GCYB 1IC4H 3TV3L 3CLEL 5EN2B 3V7AE 1HNFA 1ZK9A 2J3SA 4X9GA 5DURB 3BHBB 2VDRH 4PJ9B 5FV1L 4RGOL 3U4AA 2EDLA 2GJ6E 1N64H 4ODSL 4D3CL 5HHVH 5HHOB 1FFNA 4BJLA 4HXAH 3BIKB 3KJ6H 4X6CF 4R7DA 3ZE1E 2V9RA 5GGRY 5CD3B 1JZ2A 1IFHH 5J89A 4UNUA 5DS8A 3KHQA 1YEIL 1XCTB 5IFAL 1MEXL 5I19H 5IMMB 1N4XL 4ZDHB 2ICWA 3CXDL 3VDCA 3EO9L 5HHMB 3MV9B 4JRWA 1J05B 1U3HD 3CLFH 1DN0B 4HX1B 4BKLB 3PHQB 3UTTE 1J1XL 4MSWA 1BOGA 3ZT5A 5C0RH 4N1EA 1DLHB 3B83A 2OYPA 4FQPA 1M05A 3AU1B 4MQTB 1ZT4B 2P44B 4GG8A 4XPTH 1D5MA 4R96A 2DJUA 2GAZB 3FQRA 4G80B 2YKLH 4TVSa 4LDOB 4NUGH 3TZVC 2XTJB 5F1NB 1A1NB 2GK2A 3MXWH 4Q6IA 5FA3A 2D7QA 5LWYH 1KJVA 4Q9RH 5DD0H 1X5ZA 1KTLB 1JUFA 2ADGB 3LKPA 3LSOB 12E8L 4PREA 3MRQA 5FKPB 2IH3A 4TUKH 4GS7C 1JYVA 1JRHI 2X89D 4G42B 4KI1A 5FUZL 3UXFA 3DX9A 3V0AC 3UEZA 2XKNB 3BD5A 2YZ8A 3BGAA 5DD3L 3SJVA 5GISH 4JDZA 2P5WA 4Z7UE 1ZT7B 5I1HH 5LGJB 5FEBA 4XVJL 1E4JA 5AG8A 1EA9C 3NAAL 5LGHH 5KN5B 2YHGA 3BUYB 4BFIB 1EFXB 5BS0E 4RNRB 1JWMA 2Y6SD 5GGUA 4MCYA 4NRYA 1T4KA 4BSJA 3TH3T 4UIMB 4XT1C 1JPGB 2VXTL 4YPGA 2VZTA 2MTPA 1WFTA 2A6JB 3A6CL 4PY8J 3S7GA 3V9FA 5D7JA 3VGFA 5B4MC 5KSUB 4AT6B 1OB1A 1ODAA 1JWSB 3QQ4A 1RUQL 4FABH 5C0EB 1KCSH 5D1XD 1NLDL 2E8YA 3T0EB 1F90H 3BQUD 4R26L 1TVHA 2Y07H 3QUZA 2OX5A 4TTDD 3QIWD 3FRUB 2ZUUA 4OGAD 3W9DA 4K55A 4HMEA 1MCWW 1NEZB 5IP4A 4IMKA 2DBJA 2FH8A 1CFQB 2VXQH 1IC5L 4NO0B 4XBEL 2YRPA 4EUPG 1KCRL 2HFGL 2PTUA 3HMXL 4YC2B 5E4EC 4KI5E 4DKAA 1VSCA 3DUSA 1H3GA 1KTDA 2GSGB 2NX5D 5FGCB 3PWPA 4GFTB 4QOKB 5E24E 4XC1H 3RHWK 4OKVA 2MFNA 5LAXB 1TJHL 3GRWL 1V7MH 3FFDB 4PS4L 5JR1L 1DFBL 1L6XA 2XN9E 1RZGA 4M1DH 2A73A 5IMKA 3ZHDA 4FTVA 5GS0H 2VJXA 3EOAA 2FWOB 3LD8C 3SCMC 2MJWA 2ITCB 5DQDH 3UJJH 3NOIA 2PW2A 2MMXA 1QKZL 4XMPH 1I3GH 4QHMA 3X14B 5DI8A 5IKCA 4WI6A 1Y18A 5DFVD 4NGHL 4P9MH 3OJDA 1KFAH 3FO1B 4PJCE 4ZFZB 4F7EA 1HHGA 4JZJB 1QO3A 5EO1B 3ROLA 4CJ1A 5GGTL 4P4RB 3JWDC 3KYOA 3X3GH 4ZUWA 4M62L 5IJKA 3STLA 3FB5B 5MHSE 4G8EB 4I2XB 4XP5L 3RBGA 2F53A 1DBAH 1QLRA 2FLRT 4K3JH 2X44D 2BSRB 3ARDB 1F3DH 4HPOL 4KROB 4GAGL 1QA9A 1SJHB 5F9OH 2UVFA 4XTRC 3V4UL 4BQ9A 3WXVL 3GSVB 5DYOA 3DRQB 3MRGA 3C60A 4L1DA 4X0KB 4HKBA 1F3JA 4UV7L 2P43B 4PJXA 1H9VA 4LHUG 1YYLH 4UTAH 2UWEF 4U1LA 2NZ9C 4H5SA 3LN4B 3K74B 4EI6A 2PYFB 2XZAL 1F97A 2KZ1B 4MXVE 5K9JH 1MVUA 4FFVD 1FQ9C 3WLWD 5F9JA 3UTSE 5GZOD 2DQJH 4OCYH 1I9EA 3KWWB 5SWQB 3O6FB 1R3KA 3IXTB 1WGOA 3HE7D 5EOTB 2HH0L 5K9OA 2E7LA 4G7VH 2FBJH 2P24B 4OUOA 4G9FE 3HI6H 2Y23A 3TZVD 4HGKC 4LARL 2HMID 2XA3A 5BZWA 3RP1A 1I8IB 4HV8A 1MHPH 2Q1EA 3H2WA 3HR5B 1CXIA 4WO4C 3FHQA 4MAUL 5K9QG 3P0GB 4HUMB 1C16B 3DSFH 1GYAA 1EJOH 5C0BD 3CSYA 4NBZB 3S36L 1EMTH 5I66A 1GAFH 3T1FA 5GJTH 5FKAA 3SDYH 3GBMH 3ALXA 3IDYC 7CGTA 3OKLB 4N9GA 3MSPA 4LSUL 4OFIA 4JRYE 5BRZA 5K59F 5FF6A 3RWDA 4Z18A 4GH7B 1JPTL 5H94B 3B4NA 2CJUH 3MRDB 2JELH 1XGPB 2OXGA 4LLWA 5DWUL 5HBBA 2VDNL 1B0WA 6CGTA 1CDYA 2ICCA 5L6YH 4AEIL 3VU2A 1FIGH 3AC0A 1AO7D 1CXLA 4RX4D 4UDUA 5EFIB 1AC6A 3ZE2E 4XCNB 5JHDA 2ATKB 5E6IA 4FZ8L 2D4DA 1UYWL 4MD4A 3MRBA 4M3KB 2X42A 3QZWB 3TYFA 3VGHA 1Z2KA 3BD3A 2B5IC 5KOVC 4G8IA 4PLKC 3MRMB 1VGKA 2QQKL 3AREB 32C2B 4PR5A 5D9SA 1N6QH 4NBYB 5I16A 1FO0A 1HH6A 4JM4L 5E9DB 5C0IA 3PP4L 4PJAE 2QADC 2W91A 1CZ8H 3O9WD 4ZFGH 3ULVE 3RWHA 2YD8A 4H1LB 4OQTA 4DVRH 3DV6A 2B8OT 4N1HB 4PBVC 4E5XB 1S7UB 1TCRA 3DX8A 4HH8A 1N59A 2IG2L 4XX1G 5C6TH 2OJZL 1OAKH 4NNYA 3VA2C 1FH5L 3L3OA 3VMPA 2YPLD 3ZHKA 4XAKE 3HAEH 1URLA 1XGTB 2O5YH 1U8HA 3ARGA 4EVNA 1J87A 2CRYA 5IMOA 1A3RL 1WTLA 2E27H 3PJSA 3PWLA 4PG2A 5DR5H 3G6JE 2RIKA 2LFGA 4NM8H 3PGCB 1S5IH 5E2WL 3IFNL 2IQAB 3REWB 1U3YA 1ED3A 3VXPB 4KDWA 1JGDB 3S37H 1WZKA 4S2SA 3R4DA 1O5DT 5EU5A 3P4OB 1BWMA 5FA4B 1D3CA 2X7LA 3HG1A 1RPQA 3B3IB 3ULVH 3NCFB 4PTTB 3GSUB 1IEAB 3VXUA 3DYMA 3O8XB 2J2ZA 4NDMA 1K8IB 4WCYH 5CJOL 1LNUB 2R1WA 3NFSH 1AR2A 1QVOA 1JI1A 5CS7A 4QWWD 4YH6A 5J6HB 2AV7A 4AG4H 3T3PE 1F4HA 4KTDH 4FQXC 1Q9LB 4MLSA 3L3JB 3LZFH 4YHMH 4GXVH 1Q0YL 4NNXA 4MB4A 4XCFH 4XTRD 4H0HB 4UBDC 1UH4A 3V0VB 5JW4Q 2AQ1A 3O6LL 3BZFB 4P2QE 3O0RH 5SWZD 1S8DA 2Q8BL 1K2DA 5JQHC 3FMGH 3IDMA 2NZ9D 5FAAA 3BPLC 4DZBB 5TE6L 5J9PA 4IDJL 5DVLA 4JPVL 2ZUSA 1UEYA 3I6KA 3UTPD 3RNKA 1PYWA 4JM2A 4H88H 1H5BA 3I2CL 2W1NA 1MIEH 3MUGA 3T8XA 1GIGL 3JWOC 3GJFA 2D4FA 4RFNC 4FQHA 4J2XA 5J56B 3NVQA 4XCYB 3GSWA 3MOAL 5D4QA 4ZNEE 43CAA 1CYGA 4FTVD 3PWVA 5F3BA 1BD2B 2YUVA 4NKDB 2YD6A 4Y2DB 1NDGA 3HZYA 1AKJB 3NCBB 5DSCA 4B7IA 4QRPD 5FYJL 1ZGLM 4PJ7F 1KJ3L 4MA1C 4YDLC 3RU8L 5F7HA 2DM3A 1I9IH 4YQXH 1UXSB 3GIVA 4IRSD 4JVWA 4WO4D 5F9WB 5T3XE 3NFPB 2EKSB 2WANA 3TT1L 3IVKA 3DUUA 4U4BA 1LEIB 3D0VB 1NBZB 2QR0A 4L9LA 5EH1A 1QBAA 1SVCP 4JN1H 4HJGA 4X7CC 4X7SL 1QFWL 1VPOH 4PRIB 1B3JA 1AXIB 5C7XL 4MNQE 1T04B 5C0AB 1P5UA 1C7TA 1U42A 4ZUTB 3IYLW 1OTUD 4HLZH 4LKXB 2QKIB 1BVLB 4U2YA 1BWWA 3LKRB 1OAYH 3TEUA 3IDGB 4KJPC 1CICA 3X13B 4U7SA 1AY1L 3PQYE 5EBWA 1TTUA 3Q1SL 1UM4L 1OAZH 1TJGH 3EFFA 2BX5A 4G8GA 3DJ9A 5FO8B 4UAOB 2LVEA 4MZ2A 1D5BB 4FFYL 3ARFC 5E2UL 4IJ3C 1INEH 1B2WH 4OZGA 3U48A 1NDMA 1FVEA 3KDMB 3CGTA 3TO4D 1A6WH 2BSED 4PRPD 3UBXA 4XAWL 1NCTA 3VXQA 5DD6A 1PKOA 5AAMA 2QADD 4DQOH 5IB1B 4XMKH 4LVHB 1CFSB 4GMTH 2CKBH 2OSLB 5JDJA 1YEEH 3BH9B 1AGEA 3MV7E 1AH1A 1GZPB 1J8HA 3RDTC 1OY3B 3SDAA 4HS8H 5HXMA 1AFVH 3MCLL 1RZIA 5D1ZD 5DQ9A 5E2TL 2AJYH 1K85A 3ZLQC 1T7ZA 3UTZA 4JHZA 4ONGH 1CDHA 1FL6A 1FG9C 4YDJA 3BH8B 4TNWF 4WFHD 1F3RB 3TA3D 1JHKL 2Z91B 3TBVA 2Y5TB 3EYUL 4GRLD 4ZS6C 3VDBA 3D69B 1G7HA 1KLFA 4OV6F 4PJ8A 4QHUB 1WWCA 1UCBH 4QHLB 3U82B 3QHFH 3H6JA 3QEQD 3ZMRA 4OD1H 4JY5H 1IARB 5CIPB 1BJ1J 3QDJD 1T2QH 1T7YA 1XZ0A 2CD0A 1HQRA 4NNPL 4Z7VB 1U2CA 1PKQE 1YJDC 3MRKA 2VMFA 3EYFB 1L0XA 3LEVH 5EUOF 1OQXA 4Z7UF 1T0NA 5ECJE 3BRFA 2R8SH 1I1AB 1NGXB 5AD0B 4K23L 4M1CC 5I0ZA 3RNQA 5C09D 2X4SB 5E1AB 5HHNA 1EEYB 1U6AL 2ZUQC 4KPHH 4ZD3H 3WFDL 3K4DA 2HJKB 3CXHK 4U6VL 2H9GA 3K2UL 1J0IA 4NZRL 1VDGA 5EB9A 4FQXD 4W6WB 4TTGA 2DDQL 1A7OL 2VDPH 4WU7A 4JO1H 2R0LL 3LV3B 4QY8B 2W38A 1K8DB 4IRZL 4ACPA 2XWJB 2VDMH 5DJ0B 1VACA 4G8FA 3MLSH 3RZCC 1Z6JT 4LSTH 1JHLH 4DZ8A 3G08A 4YUEH 2WLZA 3T09A 4NQDE 2NTSP 4EXKA 5KTEH 2EKJA 4PLJC 1I7RB 1CR9L 5I75C 5HHME 3VXOB 3CZFB 5BZDA 3FQNA 4OZFH 1I1YB 1PAMA 2BJML 3H42L 5J57B 1U91B 1T03H 4C83A 5IUSA 1AIFB 4NCC2 1ZHBB 2OTUA 3G5YA 3VXNB 1JHTB 1U3HB 2BRRL 4JY6B 4LLAA 3UO1H 5I1CL 4PJDA 2BNUA 4OZIF 4RFEB 1A6TB 2XTJE 5D72H 4KWUA 3D9AL 2F8VA 1WWAX 5ACZB 2X1PA 5EZOH 1HOCA 1AGBB 1MCBA 5EC1B 1BVZA 4HIHA 4FFZL 1CXKA 2X4UA 4KQ3H 3TO2A 3DMMA 1KG0A 2IAND 1M6OB 2MHAB 1XMWA 5HDLA 1ORSB 2D7TH 3BDXA 4L4TD 4TSAH 3WEXA 5C92A 3VD3A 1QSED 4EUPB 4JZNA 2UUDH 3O4OB 4PRHD 2IGFH 1XGUA 4LFHD 3MUY1 3IJYB 1VCAA 2HVKA 2Y36H 1S7SB 2M26A 2DM4A 4L8SA 5KSVA 4HWZA 2ZUWA 1FDLH 1I8LA 3VWKA 1VADA 3DX7B 5FYKE 1EEZA 5I1EH 1J0HA 4CVXB 3C2AH 4APQC 3ZKXC 4LASL 3ARFD 4KK5C 5HYQA 1D6VL 4YXLL 3ZDYF 3FOMB 1H15B 3OGOE 3UTOA 2F19L 3LB6C 3WDHA 1ZAGA 3U36B 5I1DA 4NZTL 4Y5XB 1KPRB 4P2CG 4R3SA 4WI2A 2FX8L 2VXVL 3O41A 4HH9B 2P5EA 5M94B 3GGWB 1DQDH 5FB8B 3BQUB 4U1HB 3BSZH 3HS0B 4JJ5A 1DVFC 3QIWB 2R0KL 3WXWH 4YLQT 3RDTD 1GZQA 5FHBL 2XZZA 4P3DA 3F7RA 2VDOL 2PTTB 4EBQH 2Q76B 1RUAL 1XH3B 4CAGA 5E03A 3QCUH 1X5IA 4HK3J 1MAML 3MR9A 2VL5A 1ZHNA 3IDNA 5FGCE 3P4MA 5C07B 4CDGC 1YECL 5ESAB 4X5XB 2GJZB 4I48B 4I3SH 4PTUB 5FGSA 4IRJA 1MCQA 2NX5B 2VXSH 5FYKH 4HUVA 4JQXA 5DT1L 2I26N 4OCNC 3WUWG 1JGEB 1LEGA 5KVDL 2ERJB 3IRPX 4NKOA 4O9HH 4TUOA 1OGAD 3ELAT 4P5MB 1BIHA 1RUPL 1JNHB 1HHKB 1JCKA 5KS9A 4LHUB 2DRUA 3BRGC 2CLVA 1S7QA 5E8DL 3S8WA 5F70A 4QF1B 1U95A 4YFLI 4F80A 1MLBB 4NUJA 3R06A 2O5ZH 4HQQL 4NHCH 4JFHD 1C12B 1HHHB 2BOCA 5JA9A 4NO5A 4NQSA 4K71B 3RKPA 3GZKA 4PJFA 1R3IL 4M1CD 2ZSWB 4LEOB 5F7UA 4JO2H 1MVFA 1HINL 4NQXB 1EO8L 1YPZB 2VISA 3WIHH 3OPZL 5E2VH 3KPRA 1IVLA 1OF2A 5CD5C 5AUMA 4F8QA 1A0QH 4LPUA 1N6VA 1OM3H 1CE6B 2ZNXA 1N3NA 1IGJB 1X5GA 1GOGA 2V5YA 1G7IB 2GITA 1OT1A 1QLEL 1EFQA 4GKNA 5IOPB 1ES0A 2B4CH 3HI1B 4DGVL 2D2OA 5EIIA 4HAFA 1LP9E 4LLDB 1MJ8H 4JFFD 4DVBB 4TNVF 4QT5B 3HKFA 5I1IL 4PLJD 5JORA 3D0LB 1CGSH 4DN4H 3QFDB 4PLOB 1AHWA 3RGVC 2EH7H 5E99H 2BNQA 3MCG1 1FG2A 3QULB 5GZND 4I4WA 4K3DH 4DCQA 5JUEL 5IG7A 4EJ1C 1PX3A 5E5MB 3HPLA 3NTCH 1ZMYA 3O2VL 3OB8A 1I3VA 4JJHA 4PB0L 4KKAC 3UYOD 3WJJC 3WS3A 3VGAC 4L29B 3ALPA 3TZVB 5DZOA 4LGSB 2Z31D 2BSSA 3CK0L 4TPRL 1D5ZA 2X4TA 5I18L 3LS4L 5DVKA 5IHZA 1QSFA 3IDUA 2B1AH 3RTQA 2C5DC 3FJTA 4GS7B 2BOBA 1LE9B 3V4VL 4O5LL 1YY8A 4N8PA 5C0BB 2NW3A 3U1SL 3VFPB 2HVJA 3MRFA 1BZ9B 2XA8H 1A14L 4U1SB 2RGSA 1E27A 3JV6B 4FFWC 2Z93B 4JQVC 3R1GL 1SQ2N 1U58B 1EXUB 2DQIL 2VIRA 4YHZH 4AIOA 1U92B 2YEZB 5H8DA 1FYTD 1P2CB 3QG7L 1ZGLB 1ZHKA 4OCWH 2P46B 2WBJA 2DBLH 1JK8A 1ACYL 3KLAB 1R3LB 1AO7B 2Z8WC 3LB6D 5MEOA 4R4FH 1EUTA 3MRLA 3LKNA 4JKKA 3G5ZA 3T2NL 5CCKL 3O3AB 3S35H 3CX5K 5C0GA 3MLUL 5EOCJ 2Z92B 5E9DE 1DVFD 4QXUH 3MMEB 3BP6A 4ELMA 3AM8A 1J5OH 4RMRA 4MAYC 1IEHA 3QUML 3O9WB 1VKXA 1KJ2B 3D39D 1DBBL 1NJ9A 2PW1B 5INCB 1YN7B 1ZEAL 2RFXB 1LO0H 5E7FA 1TPXC 5JOPD 3ZL4L 3ZTJG 2QTEA 3EBAA 3HTLX 3MZGB 3VH8G 2VITA 4C54A 1G7PB 5T5NG 3QEUB 1NSNL 2AJUL 1A1OA 2F5AL 2GSIA 2YPLB 5BMFH 2H26A 4Y1AA 4Z0XB 2ADFL 5D1QC 3RX5A 4QCIA 1A7PL 1GGIL 2H2PC 2AV1B 4WUKH 2Q7YB 3LD8B 2UUDK 4WFGE 3SCMB 5JPNA 1MFEH 1UB5A 4ALAH 4HULB 1B0GB 3TH4T 5EUKB 2W07A 3VXRA 3BJ91 5F9AC 1BJ8A 1L9NA 3RY4A 4DW2H 1DZBA 3DYOA 3I50H 4RGNC 2JJSC 4H1LH 3RAJL 4JFDA 1BHGA 4LDEB 2QSCH 3BKJH 4Z77B 4P23D 5T1LD 4J8RB 1U8IA 4XNUH 2V2XB 4MGXA 5CBAA 2EDWA 2FATH 4G6FD 1OAUL 3UBXI 1HHIB 4UINH 2IBGA 1XF3A 1T1YA 3SGKA 1ZVSA 2DL9A 1QQDB 4XHJC 2GYSA 5I8OH 5J11C 3VFWA 4CL7A 1IGFL 1LQSR 1RD6A 1GHFL 2D0GA 2XRAL 1I9JL 2BSTA 2AJZB 4ZMAT 5TH2A 4J3WA 4TRPH 1KCVH 4OIIL 2IAMC 1QP1A 4XNYH 3CFJB 3EO1B 3WNKA 5CILH 4UU9A 1R5WB 4U49A 1N0XL 1NGPH 2O5XH 5SWZB 2F5BL 2W0FA 4P5TC 1XCQB 5FUOL 3OKMA 1E4WL 1CFTB 4FXLA 4L3EA 4XVSH 4HIXL 4LNVA 1BQUA 3E8UL 5E94B 3GSNL 1NUFA 4IS6A 3QUKB 2VKWA 2AJXL 4NSKA 3Q5TA 5CSBA 3B5TA 3SE9H 1RHHA 1ZS8B 4PV9A 2QV2A 5EORL 1ZHLA 4NP4L 1I7ZB 4D9RE 2FIKB 3LRGA 4OQ1A 3C5JB 1OT2A 4MDIA 1ADQL 1F4YH 1S7TA 4OM0L 3FFCA 5CZKA 4IRSB 4WO4B 4OTXH 2B20A 4YE4L 7FABL 1KB9J 4UILL 5T3ZD 1RULL 1N5AB 3RUGF 2EDFA 3IDYB 3FCTA 3FQWB 4ZO6A 5C0AE 5ITFA 1IC4L 3NIFE 1C08B 4HZLB 3MNVB 5HDQH 5C08D 3RKDD 1T1WA 4AM0A 3LKQB 4J1UB 2NLJA 4YNYA 3TN0C 4LSSH 3MODH 1Z5LB 2V9QA 4EDXB 3Q3GB 2VDRL 3K7UA 2R1YA 2VDQH 1N64L 4XRCB 3VRIA 5HHVL 4NQCA 5GGQH 3KJ6L 1YUHA 3IDJB 4MS8C 5BO1H 5JOFA 1IFHL 3IETA 5F7EH 4N0FB 1HZHH 3VFMB 1S7WB 1DQLH 3I85A 2J8HA 4OF3A 4TOYL 5D5MF 4U05A 1ZLSL 3MNZB 2B5IB 2AS5M 3UTQB 5EU4A 3WHE0 2VXUL 5EZJA 5DMIL 3TO4B 4PRPB 1TQCB 4OLXH 1BECA 4X6FB 4Y19A 4KZDL 3A6BL 4M43H 4KK9C 1JRHH 1IEBB 1YEGH 4G7YH 4MAYD 5F7KC 3S96A 4F7CA 2QADB 1EHLL 2MSPA 4FHBD 5KVMC 1E6OH 4HKXB 5I1AB 3LPGA 5GRUH 2BY0A 1LE5B 5IJVB 2YKLL 4NUGL 5DUBA 5D7KD 2JIXA 3D25A 3DVNB 4AQ1B