3KXGA

Crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor 3,4,5,6,7-pentabromo-1h-indazole (k64)
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
327
structure length
326
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP site-directed inhibitors of protein kinase CK2: an update.
pubmed rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase II subunit alpha
total genus 109
structure length 326
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kxgA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kxgA02
4TN6A 2I0VA 1PW2A 4EC9A 3VVHA 4PV0A 2PWLA 4WIHA 4EK8A 2Y4IC 3F7ZA 4XOYA 3EYGA 3QL8A 1XH8A 4NW5A 4U3YA 2UZBA 3K54A 4FK6A 4YNOA 4BTJA 2J0MB 1YI6A 3E63A 5BVEA 2CN8A 4PDOA 3ZZEA 5H8GA 3D7TB 3I1AA 3MTFA 2W5BA 3DK3A 4C36A 5HIEA 3PXQA 3QKMA 3ZONA 1YOLA 4BTFA 4KKEA 4AW5A 5HLPA 4XHKB 4CFFA 4L42A 4XUFA 4GW8A 4OR5A 1BI7A 5J7HA 1JLUE 3JY9A 4BL1A 1OIQA 2H9VA 1OKYA 3UPXA 3E8EA 1L8TA 3EQHA 5FG8A 3OEFX 2GU8A 2YZAA 3IW6A 3LFEA 4TYGA 3P7BA 4MXAA 1GIHA 2WEVA 3KN5A 3MA6A 3QA8A 5AX3A 1XH5A 3BV3A 4H58A 4MQ1A 1JKKA 3EQDA 3QX4A 3RM7A 3U87A 4I6HA 3C5IA 5C4LA 2WFYA 4NSTA 2QG7A 1OZ1A 4FIGA 4ZTHA 5FQDC 2IVSA 2ZV8A 2YCFA 3A60A 3FQEA 2XJ0A 5J1VA 3LCOA 3FSFA 2HZ0A 3L9NA 4IZYA 3Q6UA 2OF4A 4BDJA 4GRBA 5KMIA 4RC2A 1Y8YA 2UVZA 3FYJX 4FKSA 4RIYA 4AP7A 3Q5ZA 3AD6A 4E4XA 1PJKA 2Z7QA 4FVRA 3UDBA 3RMFA 3DA6A 4G3EA 3CBLA 5BYYA 3OWPA 3CTJA 4NIFA 4APPA 5D11A 5HEZA 1BL6A 2WO6A 4C4EA 1OUYA 3QD2B 3LXLA 5B2MA 2PZ5A 3LM5A 4TWCA 4RLLA 4O7WA 1I44A 4FSUA 2VX0A 4EOIA 1VR2A 3FXZA 4FKIA 5CZHA 3WIGA 3OTUA 5DIAA 3RHKA 3NNVA 1OECA 5LVPA 2HXLA 3AMYA 4X2JA 1ZYLA 3QRJA 4H36A 2CSNA 3CS9A 4LOOA 4DGNA 3EZRA 3FMEA 2HW7A 5DRDA 4JX3A 5DT3A 4D2PA 4U40A 2R3QA 3TNQB 3QRIA 4FZAB 4G9RA 4GK2A 4TNDA 3QYWA 3DK7A 2BTRA 4U7ZA 5CEIA 5AV4A 4JVGA 4L46A 5DR9A 1KE9A 5ANEA 5EM6A 4YNEA 3VHEA 1ZAOA 3FE3A 5E4HA 1YXXA 5EHYA 3UNJA 4QMQA 3SGCA 3FQHA 4K11A 4DHFA 3GU7A 4AT4A 5HU3A 2WQEA 4PF4A 2OXXA 2J2IB 2VWZA 3BEAA 1M17A 4IW0A 4O0TA 4AW1A 1R39A 5D9HA 3RPYA 5HNGA 1M7QA 1UWHA 3R1SA 3F9NA 3FBVA 2VGOA 2IG7A 1BUHA 3QCXA 3OTVA 4RX9A 5GJGA 3QUDA 1PXMA 4K2RA 4KINA 5HGIA 3VJOA 1H00A 2QO9A 3HYHA 5K0KA 2YLFA 3TJDA 3SRVA 2YAAA 4BCKA 4ENXA 2BVAA 5AAGA 2WQNA 4JNWA 4QNYA 4BWXA 4OAUC 3COMA 4BB4A 3AMAA 3R7OA 3UO5A 4FTJA 3TIZA 1J1CA 1FGIA 3FI4A 5JKGA 3CPBA 4BDCA 5I9XA 4YHFA 2VWYA 5HD4A 2R0IA 4UWCA 4AU8A 2IW8A 5LWMA 4LM5A 4NL0A 5C4KA 2YWPA 3C1XA 3UOLA 1H08A 2F9GA 4EK3A 5CZIA 2VWXA 2JIIA 3AC5A 3NDMA 3DXQA 4NM5A 3UIMA 1OKVA 3JVRA 3VUMA 3WZKA 4FTLA 4Z7GA 3PRIA 4KIKB 4WNOA 4FKRA 3C51A 3R7IA 3TV7A 3R8LA 4AA4A 4YMJA 2HZ4A 5ANJA 4MF0A 3DT1A 4RWIA 4CTBA 1DI8A 4OBQA 4BCQA 4EOPA 4E4NA 4EYMA 5M4IA 5FBOA 4CG8A 4ITJA 3FLQA 5IQCA 4JIKA 3U51A 2VO7A 4IWPA 2FUMA 3NYOA 1KE6A 4FK3A 3FPQA 3KN6A 2V7AA 4A4LA 3WZDA 5A6OA 4ZSJA 1Q8UA 1X8BA 4WKQA 3ZO2A 5AR2A 1WBWA 4TYHA 4C4JA 3WZUA 4AGWA 2IVTA 4MD8E 4E6QA 2YIRA 4GKIA 5FD2A 2X1NA 2B0QA 2Y6MA 3GFWA 2F7ZE 2ITWA 3BLQA 3LM0A 3NIZA 3P23A 1SMHA 4U45A 4X3FC 4CEGA 5L2SA 4JBPA 1JNKA 2YIXA 5I9VA 3VS4A 3QWJA 4XYFA 2VTPA 2XF0A 3CD3A 3KULB 4HCUA 3ZEPA 4D1XA 2OWBA 2VTSA 5J95A 4BDEA 1G8SA 3EWHA 4A9YA 4FNWA 4F6SA 3LFQA 1PKGA 5IMXA 3E8NA 1OPLA 3PDTA 5JZJA 4O38A 4R7BA 4EZ5A 4BDHA 3NW5A 4UEUA 5AR3A 4R3CA 3GCQA 3U54A 2EB3A 1UU9A 2RFEA 5M51A 2OJFE 2ITPA 3EQIA 4YTIA 1ZWSA 4QMSA 3OF0A 4Y72A 1TQPA 2G01A 4PDYA 3IONA 4ANSA 2C5YA 3PJ1A 3QU0A 3DGKA 2QHMA 1Y6BA 3VW6A 3ZC5A 4BGQA 3C13A 3ZC6A 2ONLA 4BDFA 5HG7A 4J95A 5J9ZA 4PNIA 2B9FA 5AP2A 3RJCA 2W1HA 4JR7A 1T45A 4AGCA 4TWOA 4LRMA 1W84A 3EL7A 4G3CA 5HNBA 2I7QA 5FDPA 2QI8A 4O21A 1QPEA 4GU6A 5D12A 4ZTRA 5CAUA 2QCSA 2VZ6A 5LOHA 1GIIA 3NCGA 5DN3A 4HZRA 4GIIA 5EQYA 3BI6A 2VWBA 4O0UA 4YSMA 4D28A 2V7OA 3ZDUA 5L2TA 4UWBA 2PE1A 2O2UA 2O65A 4DFYA 2ITZA 3F66A 4WA9A 4KABA 1V0OA 4DGLC 4K33A 3JUHA 1E1VA 3IPHA 3MY0A 1XHAA 3DJ7A 3GU6A 2BKZA 3QD3A 5IA5A 3KF4A 2ZOQA 1IA9A 3MVHA 3JY0A 4QQ5A 4EONA 2C0TA 5AUZA 5IQHA 3LCSA 1H27A 3HV5A 3LJ2A 4YZNA 3SC1A 1SM2A 3VBYA 4G17A 3GU8A 5A14A 3L8PA 3QHWA 4FG8A 2BHEA 3DBQA 3SXSA 4DEEA 3ZM4A 2QOBA 2ZV2A 2UZNA 2I1MA 4IAIA 4S30A 2W9ZB 2HCKA 4U80A 1MRVA 1ZYSA 2ETRA 3QQHA 5F1ZA 2BZIB 4DEGA 5CAOA 1WVWA 5M09A 3TXOA 3O8PA 3UIBA 3L8VA 4K0YA 4OTQA 4EHZA 3RZBA 4FSWA 3DNEA 3LCKA 3PY3A 4R5SA 2CKEA 4IEBA 1RE8A 2E9UA 2YZLA 2VTAA 1XKKA 2JIUA 4XV9A 3COHA 4O7ZA 5CS6A 2F7EE 4YP8A 3QZFA 1Q97A 2P2IA 3NUYA 4FL1A 3BU5A 3ORXA 4MX9A 5KMMA 3GFEA 1JOWB 3BELA 2ETMA 1CMKE 4A9RA 5L6WL 3LCDA 5HHWA 4AFJA 1U59A 2GNJA 4LGHA 4XG9A 1Q8WA 5J5TA 5CYIA 4W9WA 4YHJA 4HPTE 1NVSA 1REKA 2XUUA 2YCRA 3LXKA 5M53A 1WBSA 4ZOGA 3ALNA 1H1QA 2VUWA 4FV1A 3RPSA 3E7OA 4O7VA 2ZB1A 4MHAA 3EKKA 3FJQE 2X0GA 4NJ3A 4M14A 5FM2A 3NEWA 2VTTA 3RAHA 3IDBA 1ZMVA 2ZAZA 3R21A 2A27A 1OL6A 3EQBA 4JL9A 2EB2A 4KD1A 2XIKA 4FT7A 4ID7A 2VTOA 3OBJA 4DGMA 2J9MA 2UVYA 4RJ3A 3P7CA 5EW9A 4DTKA 4TYJA 3MESA 2RFNA 2XNEA 3E8CA 2VTJA 4HPUE 4A9UA 3UQFA 4H3BA 4USEA 4O0SA 2BRHA 2C5VA 1QMZA 3AC1A 3F6XA 5I0BA 5LVOA 4BR3A 3PIYA 2GHMA 4I5PA 1YHWA 1F3MC 2HWPA 4QQCA 4DH7A 5FXRA 2IZUA 4L52A 3FKLA 4IDVA 3REPA 1W0XC 4X3JA 2WTDA 4DT8A 4GUBA 3R8MA 2PULA 1OL1A 4G9CA 4G6LA 2PMLX 4C38A 4CRSA 3FV8A 4D1SA 2YCSA 3R7YA 3UNZA 2VAGA 3TT0A 4QMVA 3R8PA 2X7OA 5EHOA 3P1AA 5EK7A 4FTAA 3KGAA 4FZFB 3W2SA 2EVAA 3C7QA 3QFVA 4RJ5A 2UZVA 4J8MA 2BRBA 5L2QA 4JRNA 3KCFA 4GK4A 2B9IA 3D7ZA 3DBFA 4L00A 3W32A 2PE2A 3G33A 3PA4A 2UZOA 3A2CA 4QTDA 4QYEA 4X2NA 2CKPA 3UC4A 4YJSA 1XO2B 4F63A 4J53A 4Q9ZA 4U97A 2V0DA 2PVJA 2YIWA 3OY1A 4XV3A 3UVPA 3VULA 4E20A 4DFZE 5GZ9A 3SA0A 4V01A 3MN3A 2JD5A 1JAMA 3OXIA 3HMNA 2VWVA 4YGAA 3LFFA 2UVXA 2XKFA 2OFUA 5C26A 1PXKA 4FTMA 3RK7A 3OEZA 5AFVA 5DEWA 4BCJA 2PL0A 2BCJA 2C5XA 2W1EA 3JVSA 3SVVA 4XRJA 4FT0A 4L67A 1HOWA 4GL9A 4YZDA 5E9EA 2VO0A 4D2RA 3W1FA 1OL7A 2OG8A 2OK1A 4QP4A 2W06A 2GQGA 4DEDA 3BBTB 4IIRA 5CU2A 5FGKA 2ESMA 4GU9A 4C35A 5FXSA 1W82A 2JFMA 4MK0A 2P0CA 4G1WA 4RMZA 4GIHA 3RALA 3ATSA 3PJ3A 4GKHA 4I93A 4R5YA 4DTBA 4EOOA 4YC6A 5KX8A 2OO8X 3HV6A 1O6KA 2UZEA 3GC9A 3MWUA 4PPBA 5EKNA 5AEPA 1WBVA 4M8TA 3KFAA 4DC2A 2R3NA 3Q9XA 1W98A 2FVDA 2GNHA 4BBMA 5L2WA 1Q8TA 4ZEGA 1ZYJA 4ACCA 3ORIA 4FR4A 4WBBB 1VZOA 5E8SA 3DNDA 4ZP5A 5JK3A 2CGUA 4ZMFA 4G2FA 3DBDA 2GS2A 3A7GA 3LVPA 1W8CA 3CJGA 5DE2A 3R1YA 2BDFA 4RJ4A 2OICA 4BRXA 2EU9A 3KKVA 3SQQA 3FMNA 1SZMA 4RVMA 2C4GA 4BCOA 2WMAA 4I24A 3V6RA 1R0EA 2CHLA 2F49A 5EYDA 5JQ5A 5JGAA 2WAJA 5IQEA 2QONA 5JGDA 4I3ZA 5AR5A 3TDVA 3HVCA 3ZM9A 5AIRA 3M11A 3Q9YA 3W8LA 3PJ2A 3HRBA 4ZLOA 4LFIA 5AP6A 3SG9A 1ZMWA 4L45A 2HWOA 4AFEA 2WMWA 2I0YA 2HZIA 2G2IA 3LCTA 5HE3A 3C0GA 3H0YA 2Z7RA 3E5AA 3KC3A 3AC4A 3KXMA 2WTJA 3QQLA 3R22A 4DEAA 4AN2A 3CPCA 3NW6A 3PXKA 2J4ZA 4F9WA 3LJ0A 3ZBXA 4DAWA 3CD8A 3RHXA 5HQ0A 1YOJA 3MJ1A 3PJ8A 2PVHA 4CFMA 4YURA 2P55A 3I6WA 5ANKA 1U54A 4N0SA 3E87A 4F0FA 3W16A 1R1WA 4IMYA 3TNPC 1OI9A 5HKMA 2JKQA 3R28A 1IRKA 3DLZA 3KU2A 4NM0A 4QYGA 2A1AB 1QL6A 3R8UA 3V3VA 5CF4A 3TUDA 2H6DA 3Q9ZA 3DK6A 2YACA 4MKCA 4F9YA 1A48A 4EUTA 4F65A 4JDJA 2JDTA 4MYGA 5A3XA 2PTKA 4M0ZA 1KSWA 1LR4A 4B99A 5KBRA 3QZIA 4IDTA 5DI1A 4ACMA 4MNFA 4D0WA 5AUTA 1JQHA 4FV2A 4QOXA 2R2PA 5JSMA 4XLVA 3EN4A 4GT3A 4DFLA 4RLKA 2PVYA 1STCE 4BCNA 1XQZA 4HVDA 2F2UA 2X2LA 3QC4A 4II5A 1UNGA 4KAOA 5AM7A 5EOLA 2G9XA 5I9UA 5LMAA 2YISA 3QZGA 4AZEA 5CANA 2XCHA 5FEEA 4FF8A 3ZTXA 1IASA 3ACJA 3NVMB 3QQKA 4C4GA 4NM7A 5DVRA 5BMSA 2PK9A 5A4EA 2VRXA 4X2KA 5C27A 3TG1A 2CKOA 2PZYA 2VTLA 3Q4CA 4E4LA 1BMKA 3ELJA 5HG5A 3EQPA 3LQ5A 5D1JA 4DH5A 4BCHA 4FG7A 4O27B 4V0GB 4YLKA 3BHTA 3H10A 4ZK5A 4OTFA 5KMJA 3LKMA 2IW9A 2RG5A 3SOAA 4FKWA 4ALVA 4OBOA 4EHGA 1W83A 4UMUA 5TR6A 2PUNA 5J9LA 3VBQA 5AIKA 4FEQA 3H9RA 5AMNA 4L9IA 4DTAA 1ZZLA 2OH4A 4DA5A 3RVGA 1YDRE 3W2QA 4FUYA 3HAVA 1AD5A 5CLPA 4BDIA 3CQWA 3E64A 3A7FA 3EZVA 4O81A 3NVKI 3ZSGA 1Q24A 4DCEA 5J7BA 5E92A 3I7BA 4AUAA 4PMTA 2XK9A 3ORKA 2GNLA 5L2IA 3WF7A 4CQEA 3R7GA 4U0IA 4F1TA 3SW7A 1BLXA 2IJMA 4IB1A 3RAKA 2QNJA 5CNOA 4C3PA 4CLIA 2DS1A 2J50A 3QKLA 3HAMA 2JC6A 3DLSA 4I0TA 1LEZA 2C1BA 5J5SA 3E62A 3R9NA 1M14A 3P5KA 4O6EA 3AC8A 4CCUA 3NNXA 3FQSA 4TRLA 4OTWA 4ZJIA 3A61A 3AOXA 1IEPA 5HTCA 4AA0A 3AT3A 5KBQA 4CVAA 3MTLA 3GXLA 2VU3A 4R7IA 4ASEA 3HA8A 1BKXA 2WPAA 5IUHA 4PMMA 1YXUA 3K5UA 2XB7A 3F3UA 3IGGA 3BHVA 3MIAA 1SNXA 3E8DA 4FV4A 3QLGA 2PUUA 1XJDA 2VWUA 3W2RA 2G1TA 3DKFA 2V55A 2B1PA 4CRLA 3O71A 3EFLA 4J97A 2GFSA 3R83A 3ZZWA 2J6MA 4FZ6A 4WNMA 3ZH8A 1ZYCA 4FSQA 4CKIA 3UG1A 3OT3A 4DBXA 2BZHB 5AR4A 1F5QA 3PY0A 3TNWA 3UQCA 3UVQA 2BILB 4MXOA 1Z57A 3DKGA 4CKRA 2PZPA 4USDA 2G2FA 5CNNA 4DITA 1JPAA 3GI3A 2NO3A 4DYMA 1PF8A 3BLHA 3GNIB 2O63A 1NY3A 3AXWA 4KSPA 3UNKA 4UWYA 3NAYA 4FTCA 3EKNA 3F3TA 2PSQA 4LGGA 4USFA 1NW1A 5IF1A 3GGFA 4PL4A 3DXPA 1CDKA 1JSVA 4MNEA 4ACDA 2ITYA 2JLDA 3O8UA 3O2MA 4DEIA 3C4WA 2ZDTA 5CTPA 4RIXA 3N4VA 4FKPA 4HGEA 1QPCA 4KA3A 3MFUA 2UW7A 1WBOA 4FNYA 3ZXZA 2BHHA 2R3LA 4PDPA 2A2AA 5AUWA 2XS0A 2CCHA 5E91A 3RPRA 4BVUA 4C2WA 5BVNA 4BDDA 3MPAA 3TACA 5JFXA 5FM3A 3F5UA 4IX4A 2GCDA 3V6SA 4EH9A 3LZBA 5IEVA 2CGXA 5IUIA 3SAYA 5CF8A 4PL5A 4CLJA 5BUEA 5B7VA 5IH6A 5IA0A 5IDPA 1LUFA 2R7BA 4F7SA 3U6JA 3DBCA 4EOQA 2PUPA 2UW9A 2YERA 4H3QA 3F5GA 2G2HA 2OH0E 4KS7A 2JDRA 3BV2A 4NFNA 3OROA 5TKDA 3TI1A 1JSTA 3BYMA 3FXXA 5CAVA 5C8KA 3ORMA 4OBPA 1YI4A 3WE8A 1XBAA 3PYYA 3NUSA 4FX3A 2C6EA 1MP8A 2WTKB 1OM1A 1RJBA 3T9TA 3VW8A 3EYHA 2IVVA 3DKCA 2R7IA 3QF9A 1H1RA 5IG1A 5A9UA 2B53A 3PY1A 3F3WA 3GBZA 1XH7A 2UW4A 3LFNA 4V05A 3S00A 4QMTA 4D9TA 4JRVA 2BDJA 2OGVA 4HYIA 1IAJA 4MQ2A 2WQOA 3OXZA 3HRCA 4FIJA 2WXVA 5EM7A 3ZO1A 1OL5A 1K9AA 2ONLC 3FKOA 5LVLA 5M44A 4NTTA 2JKMA 4TWNA 4OTIA 4AZWA 2WMUA 4LRKA 4XX9A 3UBDA 3MYGA 1R3CA 3PWDA 2QLUA 3SV0A 1FPUA 4IZ5A 3FZPA 4MEDA 4RIXB 1O6LA 2J0JA 3HMPA 3OT8A 4HCTA 3CTQA 4UMQA 3Q3BA 4X3FB 5ITAA 2ZDUA 2R5TA 3GC8A 4OTGA 4TPTA 4BKZA 3HEGA 1Q4LA 3KY2A 4NZWB 3CKWA 2OZAA 3COIA 5I5ZA 4L3JA 1H1PA 4B8MA 3FY0A 1YHSA 2GHLA 3ODYX 1UNHA 2E9NA 2H96A 4L6QA 4WNKA 4L01A 3NYNA 2W0JA 4ZZNA 2Y4PA 3QX2A 2CMWA 4MXZA 4NKAA 4RWJA 4DLJA 2PZRA 3D83A 3G5DA 4IC7A 1BL7A 3CQUA 3Q4TA 4DGGA 1ATPE 3AGLA 3ZUTA 1PMUA 1URCA 2I0EA 3CCNA 4ZZOA 5HBJA 1H07A 2EXEA 3ORZA 1U5QA 4NH1A 2LAVA 2OU7A 5TF9A 2UZWE 5DT4A 2E9OA 4RIYB 5DG5A 3BRBA 4CZTA 4HVIA 4P90A 3ITZA 4UYAA 2XKEA 1O9UA 4G5JA 5EDRA 2CNUA 2V22A 3FMDA 4FI1A 2F2CB 3UIXA 3C50A 3C9WA 2HOGA 2Q0NA 4YTHA 2QQ7A 5DMZA 4FKJA 4ZY5A 1TVOA 4QP2A 3HP2A 4ZMEA 1TQIA 4RFYA 3HLLA 2VX1A 3QTWA 3QD0A 5AUYA 2W17A 3ZFMA 4J98A 3C4CA 1B6CB 4C33A 4WSQA 5CT0A 4PMPA 3CKXA 4V04A 5KMOA 3DQXA 4EI4A 2WMVA 4RRVA 5E8VA 3VUHA 4Z7HA 4N57A 3R00A 4FYOA 4MH7A 4MTAA 3ULIA 1ZMUA 5BUJA 3PXRA 4C37A 5M4FA 3ZSIA 1Y57A 3GCSA 5GJDA 5F9EA 3MJ2A 4DT9A 2YA9A 4EH6A 2HXQA 4PMSA 3TKIA 2EXCX 5DA3A 4FEXA 4Q5EA 5EOBA 3ZMMA 4D4RA 3FZSA 3SD0A 3L8XA 3HDNA 4GJ2A 4F99A 3ZRMA 4D55A 3CGOA 1QCFA 3IKAA 2HENA 3LLTA 3THBA 4IWQA 1QPDA 2OJJA 4MBIA 4EKKA 3FLYA 3Q4ZA 3JPVA 3KF7A 3RGFA 5HORA 5CVHA 4B0GA 4GCJA 5GJFA 4M0YA 4ALWA 2WTVA 2Y0AA 3E3BX 4M66A 1UNLA 2BZJA 2J0KA 1KE5A 4YZ9A 3UIUA 5L8JA 2ITXA 3R1NA 4FKUA 5HIBA 2QO2A 5JFWA 3VBTA 3VIDA 4AW0A 3IQ7A 4UMRA 4GJ3A 3E92A 5GZAA 4WBOA 3FLZA 3IDPA 5AM6A 5IQFA 1H01A 2X2MA 2X8IA 3F2RA 1B38A 2VV9A 4O84A 2HAKA 4QT1A 4IFGA 4RWLA 3ANQA 5C01A 4KIQA 4OLIA 2JKOA 3SKCA 4AF3A 2XJ2A 4R7HA 5DPVA 4BHZA 4J96A 4IWOA 3NUPA 4GH2A 5ETFA 3VS5A 3M1SA 1PKDA 4F1OA 2P33A 2OIQA 3AMBA 4Y8DA 5CVGA 5ACKA 4ZTQA 3OHTA 3HRFA 4IBMA 2UW5A 4ZLZA 2JITA 4D2VA 3GCVA 3ZEWA 4OAVB 4D5HA 3KMWA 3FAAA 4HOKA 4A4XA 1J3HA 1S9JA 2GSFA 2R3RA 3VF9A 3S1HA 2BPMA 4EH5A 3WOWA 5E1SA 3RI1A 5IPJA 5IISA 3BQCA 3AT4A 3FL4A 4GFGA 5B2KA 4FV5A 3V04A 3KEXA 4CTCA 3QCSA 4QP7A 3FHIA 3QQGA 4TYEA 4QD6A 4M7IA 5DYJA 3N51A 5T68A 4JX7A 2JAVA 3DXNA 2HW6A 2WKMA 3NUNA 3MA3A 4GFMA 4CG9A 2G15A 3R8ZA 3S3IA 1ZLTA 4HGLA 3V5PA 5CF6A 3LPBA 4DH3A 2ZV9A 3R71A 2VWIA 3LFSA 1PHKA 5HLNA 4I6QA 4FZ7A 2KTYA 3NX8A 5HO8A 1MRYA 3DDQA 3FZTA 5GZ8A 4ZSGA 3VBWA 3R04A 4O7RA 3VRYA 4K77A 5AUVA 4EH3A 4NUSA 2QKWB 2BUJA 3GC7A 3CIKA 2JBOA 2BDWA 4X6RA 4DGOA 3OW3A 3NS9A 4HYUA 5BVDA 2RFSA 3Q4UA 1KE8A 4KNBA 2BAKA 3PUPA 3QCYA 3SDJA 4EH8A 4N4SA 3F7WA 4FL2A 2YM6A 3ORLA 4JI9A 4R8QA 2WIPA 3WF5A 2B55A 4JG6A 2ZYBA 3IS5A 4F09A 2OIDA 2QOCA 2C47A 3AC2A 1WZYA 1PYXA 2J0LA 5HX8A 5L8KA 5EDQA 3V5LA 2AYPA 2AUHA 5ANIA 5FUTA 3FUPA 3G51A 4QQJA 4BIBA 3CR0A 3NZ0A 5HIDA 4BTKA 1VYWA 4ZTSA 5TE0A 4Y5HA 4E4MA 4ARKA 3OMVA 4JDKA 2W1GA 4W4YA 3CQEA 2O5KA 3PIXA 4D5KA 2O3PA 5EI2A 4C3RA 3DAKA 5CT7A 4FZDB 4Y5QA 4I0RA 4E7WA 5KUPA 2XK8A 1GIJA 1JKSA 3DY7A 4R3PA 3II5A 4AOTA 4BGHA 3RNIA 4JS8A 3RK5A 3WYYA 5F94A 5HESA 3MIYA 4IX6A 4GFOA 3I7CA 3BCEA 1FVTA 1JSUA 2C6IA 2P4IA 1M52A 5FXQA 3EN7A 4BDGA 2C68A 2XIRA 2FGIA 4BZDA 3BYVA 2QG5A 3NCZA 1YI3A 3C0HA 2X4ZA 4QQTA 3BE2A 4X7QA 4IM2A 4YJVA 4O7TA 3QXPA 2FSTX 4LGDA 4APCA 5M07A 1UWJA 4XP0A 4AZVA 2UZDA 4AZFA 5CENA 2WQMA 4N70A 3F82A 3WI6A 4I5MA 4GEOA 2JDSA 4LQMA 4GYIA 3B8RA 3EL8A 3GU5A 4RPVA 4XEYA 3SHEA 4AXAA 4FEVA 4HGTA 4BWKA 4ASDA 3NGAA 2XIXA 2I6LA 2QU6A 4CCBA 5KCVA 2GDOA 4FSMA 4ANOA 3GC0A 5EG3A 2W1IA 4FSRA 3WYXA 5CQWA 4Q5HA 4XG3A 5HE1A 3D5UA 4NFMA 1IA8A 2XKCA 4C02A 3NR9A 5FLFA 4BCFA 4RWKA 5DWRA 2YDIA 2WTKC 2OXDA 3QKKA 5FBNC 3TNHA 4KBCA 5JZNA 4BFMA 5IEXA 1KUTA 3KXZA 2XNNA 4DE4A 3ACKA 3B8QA 4IAKA 4PTGA 3T3UA 3DPKA 4TL0A 4J1RA 5LCKA 4J8NA 4IM0A 1JVPP 5DNRA 5LARA 4D1ZA 4EOMA 4B7TA 5CEPA 4CKJA 5K4JA 2OI4X 2CN5A 4FTTA 2XM8A 2CDZA 5IDNA 3U6IA 4AGUA 3E3PA 4EOJA 2C30A 4XJ0A 4BWPA 2C5NA 2W1FA 3SX9A 1T46A 1ZY4A 2ZM4A 2C6DA 3PXZA 4WG4A 5KZIA 4EQCA 3FHRA 3BKBA 4IAYA 2CPKE 3KXGA 4QO9A 2C6TA 3DJ5A 4JLCA 5FWKK 5EI6A 3DKOA 3RAWA 4F6UA 2WNTA 5CXZA 1I09A 2C6OA 3GCUA 3VS7A 5A4CA 3VS1A 4LG4A 4O2PA 5BYZA 5JMSA 4AT3A 1GNGA 4QNAA 4LV8A 1ZXEA 4QMMA 4FVPA 1Y8GA 3H9OA 4YPSA 2BALA 2XEZA 3ZXTA 1Q3WA 2YCQA 4XP3A 1UA2A 3WE4A 4RSSA 3PZHA 3UGCA 4O86A 4JG7A 3Q53A 4WRGA 4YJUA 1JKTA 2X81A 4AACA 5JN2A 2NNWB 4ENYA 1V1KA 2B7AA 2XKDA 1WVXA 4XV2A 5CSXA 3UQGA 3ZO4A 4ANQA 4CMUA 4O82A 4F0GA 3ORNA 3LE6A 2FSMX 1DI9A 2O8YA 3IW8A 3QBNA 5CWZA 3D2KA 2R3MA 1XH6A 4JBOA 2YIQA 3DV3A 3PJCA 4IAZA 2XP2A 4H3PA 4W8EA 3I81A 5CU3A 2UUEA 4EOKA 5DT0A 3PSCA 4U81A 1P2AA 3ZUUA 4A9SA 3ZLWA 4HYHA 5M55A 5T6KA 3QUEA 4P2KA 3G2FA 2PHKA 4FICA 3LHJA 3TKHA 3H3CA 3RCJA 4AE9A 5TO8A 5IH4A 2BFXA 4IACA 1XR1A 2PUIA 5TT7A 3R9RA 2FSLX 4X6QC 4PNKA 2A4LA 3CLYA 3EMGA 4YU2A 3DTWA 2AC3A 4KSQA 1J7UA 5JQ8A 4GYGA 4DBNA 2Q83A 3SOCA 2QO7A 2QOKA 3W2PA 4B9DA 1ZYDA 2CLXA 5M4CA 3F69A 4FBXA 2JGZA 2BAJA 5E8YA 1WBTA 3PLSA 1REJA 2J5FA 4F08A 4G34A 4O1PA 2UZUE 3PTGA 2QC6A 2WTCA 3LMGA 3BGQA 1GJOA 4I5CA 3QTQA 5AP3A 1GOLA 4G3DA 4RVKA 1S9IA 3N9XA 1OUKA 5LMKA 3VN9A 1SVHA 1ZOHA 1FMOE 4KIOA 2F4JA 3QTIA 4Y95A 4ASZA 4YPDA 3ENHA 5DR2A 4EK4A 5M57A 4I1ZA 4QTBA 4RA5A 4XLIA 2XK7A 2XNBA 3F3VA 5AAEA 4P5QA 3G0FA 3ALOA 4YJRA 1FVRA 2JKKA 2OJGA 3A8WA 5HLWA 3L9PA 2BROA 3LJ1A 5C03A 4ERWA 1TQMA 4Q9SA 5E90A 4BIEA 5IMEA 3FZOA 3C4ZA 3LQ3A 2J90A 2W5AA 3MFRA 4F70A 1FBNA 5LMKC 5EH0A 3QWKA 4F64A 4JAIA 2ZV7A 3QQJA 3AG9A 2H8HA 2RG6A 4WSYA 4QYYA 1YVJA 4I4FA 1J91A 4O91A 4O7YA 2XK6A 4B6LA 4UX9A 3LFAA 1APME 1ZOEA 3F61A 4KS8A 3EFKA 2FSOX 2IW6A 5AP5A 5E8UA 4PX6A 2CJMA 3UYSA 4KIPA 3HZTA 4F4PA 1PXJA 3DZOA 4R1VA 4C62A 2WOUA 5AJQA 5LVNA 1YKRA 5DBXA 5HTBA 1HCLA 3MS9A 4ASXA 3FYKX 4NK9A 5CSPA 3QLFA 5L4QA 2W4OA 5G1XA 4CT2A 3R0TA 3F88A 3HX4A 1PXIA 4M68A 4PPAA 4IC8A 1H28A 3QXOA 3RAIA 4I20A 4C61A 3C4XA 3V8TA 2VX3A 3DAJA 3W33A 3KL8A 2YJRA 4YBKA 3ZS5A 4CZYB 4AE6A 2BKKA 4XOZA 3LMIA 3NNWA 5K3YA 2JEDA 4DEHA 4GS6A 1BX6A 4FTUA 4RC4A 2XCKA 3QC9A 5A46A 4MWIA 2VTMA 4E8AA 4HVSA 4PP7A 5KMNA 4K6ZA 2WD1A 4MF1A 4U43A 4J7BA 1MQ4A 4QMUA 2REIA 4WHZA 3EQCA 3P0MA 5AR7A 3DB6A 3AC3A 4RIWB 2C3IB 1H8FA 3E88A 4FNXA 3NYXA 4KKGA 3CY2A 3PE1A 5HCZA 5CI7A 3QTUA 4GVJA 4OW8A 4RC3A 3MH0A 4HJOA 5FTQA 2VO3A 3ATTA 3LXNA 2VTIA 3KB7A 3U6HA 2ERKA 2W1ZA 4LL0A 1G8AA 5BVKA 4D2SA 4Q2AA 5BPYA 1WVYA 4XV1A 5JFVA 1RW8A 4W9XA 2ITUA 3OCBA 4JBVA 3NMUF 1YW2A 3SXRA 2XIZA 3E93A 3FMMA 3ORPA 5HX6A 1P5EA 2OKRA 2A19B 3QAME 3G15A 2C3LA 4RX8A 4AOIA 4P7EA 4QP6A 5AX9A 4D58A 3TM0A 2JDVA 2JFLA 3QGYA 3G9LX 3ZLYA 5ICPA 3O7LB 3A7HA 4Z16A 4CNHA 5CAQA 4O1OA 4RJ6A 5I9WA 1G5SA 3ZO3A 2ZJWA 4CXAA 4FV9A 2OZAB 3FPMA 2DUVA 3MV5A 4NWMA 5M06A 1PRYA 2FH9A 4I4EA 1P4OA 5L8LA 4YR8A 5ANGA 3QALE 4EKLA 4W4XA 4AAAA 4AS0A 2XA4A 3QUPA 1PXNA 3V5QA 4ERKA 1OITA 3I79A 4FVQA 4RBLA 4MD7E 4EQUA 4UY9A 4CT1A 3OWJA 4DINA 4TYHB 2LGCA 3H4JA 3DTCA 2WMXA 3F5XA 2PVRA 4MD9E 1ERKA 5I9YA 3UZRA 2GNIA 4H1MA 5CY3A 5CEMA 3TV6A 3KVWA 3GEQA 4JDIA 4PWNA 2W9FB 3EN6A 3R2BA 5GHVA 4K1BA 2NRYA 2XK3A 4M67A 3A7IA 2X2KA 4IE9A 3FXWA 1MRUA 4YJNA 3VWAA 4E6DA 4UZHA 1NXKA 4L8MA 3MFSA 2SRCA 1KV2A 5DHJA 4ACGA 3VNTA 5JRQA 3OUKA 2BRNA 4BICA 4IANA 1OPJA 4AG8A 3HGKA 4ZTMA 2R3HA 4WT6A 5H3QA 4G6NA 5K4IA 1KWPA 4BBFA 5LVMA 4GT4A 4EJNA 3UP7A 3ZCLA 3CJFA 3NIEA 4CGAA 2J51A 4FTKA 5E8TA 3ROYA 2R3PA 2WB8A 1OIUA 4ANMA 3Q52A 4IB0A 5EHLA 5ACBC 4CFVA 3MY1A 1IG1A 4U6RA 3R30A 5HVYA 4Z55A 3KRXA 4BCPA 1PXLA 4WG3A 2R64A 3ZLXA 4Y46A 1NA7A 4QMLA 3SRVB 4UMPA 3TUBA 3ANRA 3KA0A 3MFTA 4KBKA 4YBJA 4BI0A 4JBQA 3COKA 3Q5IA 4GG7A 4O6LA 3UE4A 2ZB0A 3EN5A 4QPMA 1F0QA 5LMBA 2ITTA 3OWLA 4BCMA 5HD7A 3CSVA 1Q8ZA 5AV3A 3D7TA 3F3ZA 4FIEA 5AP0A 4A07A 2BZKB 3R9OA 3KXNA 3DB8A 5AP7A 1WCCA 3FDNA 2UV2A 2UZTA 3ZLSA 3K3IA 3CP9A 2YDKA 2BRGA 3GUBA 4EUUA 4I23A 3QD4A 4ZLYA 5KO1A 1FMKA 4R6VA 3P86A 3HUCA 4I5HA 1G3NA 5BQ0A 3UPZA 1R78A 3BHHA 5AUUA 4N6ZA 5D7AA 4G3GA 4A7CA 1VEBA 3P7AA 2QHNA 3SXFA 4RFZA 5KHXA 3CTHA 4BKYA 4EHVA 4QMNA 4X3FA 2BR1A 2CNQA 2YM7A 4F9AA 4JAJA 3UJGA 5IA1A 3TUCA 3HNGA 5CEOA 4NIFB 1GZOA 4F9BA 5K5NA 1H0VA 4M3QA 3QRTA 4ZTLA 3UTOA 2OSCA 1CTPE 2A0CX 3EIDA 3DCVA 4BYIA 4FMQA 2IVUA 5L3AA 4E26A 1IAHA 3NRMA 5KMLA 1SVGA 5I3OA 4IX3A 5C9CA 2WMTA 4KIKA 5CXHA 5IU2A 5J79A 5GINE 1U5RA 4FKGA 3HKOA 1YXVA 3HDMA 3RNYA 3U4UA 4EL9A 3M2WA 4LV5A 1DAYA 4NM3A 3FKNA 2E9PA 2O0UA 3DBEA 4I6BA 4RQKA 1AQ1A 4D2WA 4F7NA 5C1QB 3NYVA 3PIZA 2RGPA 3RINA 4IJPA 2X7GA 3HMOA 5I9ZA 4JQEA 2B9JA 3MGYA 4FKQA 4U3ZA 5TOZA 3FY2A 3OOMA 5CF5A 4L44A 3BYUA 2YM4A 2CNVA 3DDPA 4FUXA 4RFMA 3H0ZA 3OCTA 1Q61A 3D15A 1KOAA 2BMCA 3A7JA 3FZRA 2VO6A 3NW7A 1OB3A 4UXQA 4DN5A 4EWQA 2ZMDA 4WNPA 3GCPA 4NCTC 3LMHA 2F7XE 5DR6A 4IXPA 2WELA 4EOSA 3O0GA 3DQWA 4FNZA 1JBPE 3HMMA 3KMUA 4O96A 3TL8A 4LUEA 2Z7LA 2X39A 2XJ1A 3VQUA 2X4FA 4ANBA 4M84A 4ANLA 2OZOA 4IVBA 3UOKA 5M56A 1J7IA 3PLAE 2GPHA 2JIVA 3FWQA 4EQMA 2C3KA 1ZRZA 3DOGA 4EC8A 3VUGA 5HO6A 1OBGA 2OLCA 3W10A 4I6FA 3T8OA 4TWPA 4X0MA 2ITNA 2QOQA 3H9FA 2YITA 5AP4A 3R7VA 2ERZE 2UW0A 4FT3A 3GT8A 1VYZA 3K3JA 1CKPA 5H8BA 4HW7A 3ZUVA 4PRJA 1YQJA 4G6OA 3B2WA 3C5UA 4UV0A 4O0WA 2VTNA 4O0XA 3FLWA 3O51A 1WFCA 4FGBA 4GMYA 1GZNA 1XWSA 2W7XA 4S34A 4WO5A 4BN1A 5C8NA 3RM6A 1LEWA 1OKZA 2WQBA 5DLSA 5HBHA 4RT7A 3EJ1A 5EDPA 2I40A 5HICA 3VAPA 3FMJA 2YWVA 2WMBA 5HVJA 4FKVA 3MI9A 2X6EA 3NUAA 3BHYA 5LWNA 1NVQA 3G6GA 2BAQA 5AUXA 4D4VA 4MWHA 4ZIMA 3RWPA 2C3JA 4W4WA 4S32A 2V5QA 4KWPA 5A4QA 1ZZ2A 5EQEA 4IVAA 5CSVA 3BPRA 4HVHA 2PY3A 4FSNA 2AC5A 3LFBA 2EWAA 2XEYA 4P4CA 4FV8A 2QU5A 4ONAA 3UOJA 2EUFB 4YJQA 2IZTA 2HY0A 4DH8A 1H1WA 1MUOA 1CM8A 2OIBA 2QOOA 3D2IA 4FSZA 3CXWA 5A4TA 4C4FA 4M13A 4I94A 2QR8A 3IG7A 5M4UA 1ND4A 1GZKA 5AP1A 4CMOA 2RSVA 4EOLA 3P79A 4FSTA 1FQ1B 1UV5A 3BBWA 2OW3A 3QGWA 3BEGA 4FODA 5DFPA 1YOMA 2NP8A 3Q6WA 4I92A 3VUIA 4H05A 4GT5A 4AZSA 4RX5A 5EW8A 3O50A 1HCKA 4FIHA 5KKRB 4LL5A 2UW8A 4PTEA 1M2QA 4KRDA 2PMNX 2VTHA 5J87A 1UU8A 4JIAA 4DFBA 4JDHA 5DH3A 3QRUA 4U5JA 3DFCB 2QOLA 4AGDA 3G6HA 4M15A 2HIWA 4FL3A 3O23A 4ZTNA 3R9DA 3LLAA 3PP1A 4OT6A 2X6DA 4UMTA 3ERKA 1Q99A 3I4BA 4U41A 4XNEA 2WOTA 4DFXE 3EFWA 4YZMA 5HCXA 3WARA 3UZTA 3OS3A 5KKRC 3BHUA 4ANNA 3IW5A 2FO0A 2NRUA 4E5BA 2VNWA 2R0UA 3WIKA 4D4SA 1EH4A 4QPSA 2KULA 4RA4A 3MPMA 5FRIA 4AA5A 4IZAA 5CAPA 3FI3A 3QQFA 2X9FA 3EH9A 1H1SA 4EBVA 4A06A 4MBLA 5DRBA 4EWHA 4GSBA 3BWJA 4I0SA 3W18A 3FMKA 4L53A 3VUDA 2VGPA 1LPUA 2WU6A 3OY3A 2PPQA 3D5WA 4CV8A 4V0GA 2VN9A 2ZMCA 5BX0A 1E9HA 2W99B 2Z60A 1W7HA 5T3QA 4BIDA 4YO4A 2W5HA 1RQQA 5EYCA 4EBWA 4LI5A 4M69B 4DLIA 3AGMA 3OZ6A 3C0IA 3IOKA 4ZY6A 5GNKA 4AX8A 2ACXA 4JT3A 4O0VA 3VO3A 4QYHA 4F1MA 3LW0A 4KKHA 4IHPA 3Q2JA 2R3GA 3BGZA 3ZRKA 4BY9E 3L9MA 1XH9A 3UO6A 1YHVA 2PYWA 3D4QA 4A9TA 3BU3A 3RK9A 2V62A 3Q60A 3A8XA 3HMIA 4G31A 3POZA 3TZ8A 5AA8A 2CCIA 4LOQA 3R6XA 5AV1A 2VNYA 5DOSA 2OFVA 4BDBA 3OOGA 4JG8A 5FEDA 2DYLA 3ROCA 5BNJA 4ORKA 3GVUA 1UU7A 5EI8A 5KHWA 4CFUA 4BF2A 5EKOA 3LFCA 4O7LA 1AGWA 3DAEA 4RIOA 5CSWA 3PPKA 4BTMA 1PY5A 1M2RA 2Z8CA 1YXSA 2XNPA 5J8IA 4YZBA 2J5EA 2OBJA 2ETKA 4OTRA 1RDQE 4CD0A 4AOJA 4RJ7A 4OUCA 3EQGA 4MXYA 2JDOA 4HVGA 4C3FA 4X2FA 3V5WA 4CMTA 1FGKA 5L6PA 2CGVA 3TCPA 4FTRA 2JAMA 2QD9A 3I5ZA 3U55A 4QMZA 2HYYA 3RPOA 3LOKA 2DQ7X 5FTOA 2XVDA 3I0OA 4MVFA 4FIIA 2CGWA 4TT7A 3OD6X 3P78A 3UC3A 4IWDA 3GP0A 2ITQA 3GENA 4U42A 3TZMA 1Q5KA 3ZSHA 4FKLA 4BYJA 2FA2A 3MVJA 5GIPE 3OCSA 3UG2A 3L9LA 4CFNA 3MPTA 3QQUA 4YLJA 1ZOGA 3IOPA 3V8WA 3I6UA 4Y73A 4Y85A 1YXTA 3AQVA 4UZDA 3PPJA 5AV0A 3KREA 5IQGA 1Z5MA 1PMNA 3I60A 3OW4A 3PZEA 3VHKA 2Y8OA 2IWIA 1Z9XA 2YM3A 3KRLA 4QYFA 3PRFA 4FOCA 3MBLA 1Q62A 5HG8A 4QP3A 4O2ZA 2FB8A 4UALA 4EJ7A 3IK3A 5B2LA 5CSHA 3OXTA 2YLEA 3PE2A 4FG9A 3MY5A 2Y4IB 3PSDA 3KK9A 2WMQA 4PP9A 2IZRA 3R01A 4U8ZA 3V5TA 1Y6AA 5CASA 5I4NA 4KUJA 5ANOA 1B39A 5JT2A 3ZDIA 3D94A 1A9UA 4I41A 4AN9A 4FEWA 3OCGA 4IVDA 3O8TA 2GS6A 4YUQA 1OMWA 3ZRLA 4FV3A 4I21A 4MAOA 1DS5A 4OTHA 4YC3A 4ZSLA 3C4FA 4Z3VA 2VTQA 3RBWA 4FTQA 3PXYA 2DWBA 3S95A 4HZSA 4G5PA 5F95A 3AD5A 1SVEA 3Q04A 1WBPA 4L7SA 5FP5A 4BGGA 2QKRA 4C0TA 5CEQA 2C69A 5A4LA 2W1DA 3TKUA 4FKTA 1H26A 4RX7A 3VS2A 3C4EA 3BX5A 1WMKA 3ZYAA 4L3PA 5IQBA 4FTIA 2Q0BA 4BC6A 1NVRA 2RIOA 3KRWA 3OWKA 3OUNB 4XG8A 4G3FA 3A4PA 2QODA 2IZSA 5F4NA 3HV4A 2FYSA 3PVUA 4RVTA 3BZ3A 2NPQA 4J71A 4QP9A 3HECA 4YC8A 1OVEA 4JQ7A 4HGSA 5I3RA 5HU9A 4JOAA 4DH1A 2EXMA 2Y9QA 4AWIA 4C59A 4ZSEA 4DG3E 2QURA 4PL3A 2BFYA 5H2UA 3BWFA 5HVKA 5HZNA 2XK4A 5AWMA 1J7LA 2E9VA 1VJYA 4IX5A 2RF9A 4WRSA 2UW3A 3OP5A 2W96B 3NWWA 3BYSA 4RGJA 3BYOA 3FSKA 3QCQA 4XH6A 3QYZA 4XCUA 3GQLA 1SNUA 4FGRA 1KE7A 5D7VA 4ZAUA 2XRWA 4C4HA 3U9CA 1WAKA 5ETIA 4MXCA 1DAWA 3QZHA 5CX9A 3P9JA 3D0EA 3HUBA 3UVRA 4E5AX 4UXLA 4D2TA 4O22A 3G9NA 2QOIA 3TTJA 3BLRA 4XRLA 2XBAA 4EZ7A 3DU8A 3I0QA 4E93A 4RQVA 4EORA 3JR1A 2YFXA 3EN9A 1BI8A 2PVFA 4OTDA 4CFWA 2Z02A 1WBNA 4QMPA 4U44A 2XM9A 3F5PA 5BVOA 4XG7A 4RG0A 3WZJA 5CU6A 3TDWA 4FSYA 2W1CA 3ENMA 3P4KA 1A06A 3HL7A 3VUTA 4C2VA 4BBEA 1XH4A 3FC2A 3GOKA 4CFXA 4FT5A 2IPXA 1UU3A 4BI2A 3KRRA 2BIYA 4PTCA 1OIYA 4XG6A 2C6LA 2GTNA 3MSSA 3O7LD 5ANDA 4ZXTA 1V0BA 4J52A 4QP8A 2W4JA 2GTMA 5AA9A 1ZY5A 2XYUA 1H4LA 3HV3A 3LIJA 4IB5A 4UN0C 1KV1A 4K9YA 1P4FA 3TIYA 2R4BA 4AW2A 2WMSA 4E6CA 5JFSA 2YHVA 4R3RA 3VC4A 3MVMA 4P5ZA 4K18A 3ZFYA 3IECA 4ZY4A 4FA2A 4FV0A 4RVLA 4B4LA 2XBJA 4L43A 4FE2A 3ZU7A 3N4TA 1YDSE 3O17A 5HG9A 5FP6A 5CI6A 4YHTA 1U4DA 4CV9A 4IQ6A 4C7TA 2B52A 4LOPA 5IH5A 2H34A 2HK5A 5HE2A 3D5XA 4EH2A 2JBPA 3D9VA 2RKUA 5DGZA 1K2PA 5BVFA 4ZS4A 3BU6A 5K9IA 5IEYA 1CSNA 2ZM1A 3FZ1A 4UB7A 4OTPA 4BHNA 5FDXA 2B9HA 4TXCA 2GNGA 4ZZMA 3CGFA 3QTSA 2I0HA 3L1SA 5KE0A 5IQDA 5AAFA 4PDSA 3UO4A 1PMEA 4ACHA 3RPVA 5J9YA 1YDTE 4CZUA 3BQRA 3OVVA 2WZJA 3GB2A 3G0EA 4DF3A 2R3OA 3PXFA 3NNUA 1ZARA 5K5XA 4GV1A 2GS7A 2OF2A 3VJNA 4ZS0A 3R7EA 5EM8A 2YEXA 3IW4A 4IADA 3Q96A 2W4KA 4J99A 4YJTA 4QTCA 3WF6A 4PY1A 1L3RE 4JXFA 4JQ8A 2B54A 3SW4A 4WUNA 3NAXA 5ETCA 4EH7A 4YSJA 3AT2A 1GY3A 1U46A 3ID6C 4C8BA 5HNIX 2CLQA 3WF9A 4MBJA 4FEUA 3KVXA 5IA3A 4EEVA 3HA6A 4TNBA 5ETAA 3MH2A 5D41A 1URWA 4F6WA 3O96A 3R1QA 4FC0A 5CU0A 4I22A 3PP0A 4TW9A 3U8WA 5LXMA 3PSBA 4ZSAA 2XMYA 4H1JA 4F7LA 4O0RA 3R02A 4CSVA 2Z7SA 3BGPA 4C4IA 3ETAA 3CE3A 3POOA 3MW1A 4U9AA 2RFDA 4OGRA 5EYMA 3ZHPC 1J1BA 4A4OA 3PVBA 4NU1A 2YJSA 4WOVA 1UVRA 1YWRA 4TYIA 3VS0A 2PVNA 4BI1A 4R1YA 3QA0A 1OL2A 4GG5A 4FTOA 4RIWA 4D0XA 5KMKA 4F0IA 4E6AA 2P3GX 3G90X 3CY3A 4IFCA 3UMXA 1JKLA 3A99A 4S31A 3ZBFA 3KULA 2PVKA 4QTAA 2PU8A 4IAAA 4YJPA 3EQFA 3WILA 2VWWA 4IB3A 4BDKA 3KCKA 4MNEB 5FTGA 3RTPA 1CKIA 2WTWA 5M08A 3PA5A 2X9EA 3PA3A 2RL5A 3QRKA 3EOCA 4EZ3A 5A54A 5CALA 3K2LA 5JRSA 4C57A 3LFDA 2OJIA 3ZFXA 3V01A 4NW6A 2YABA 1NT2A 5KNJA 3RZFA 1OIRA 3ZOSA 4TKSA 3OG7A 3F2AA 5EM5A 3TNIA 3VUKA 4D4YA 1PMVA 2WIHA 5AR8A 3LQ8A 2PMOX 3GQIA 5FEQA 3BIZA 1UKIA 5LQFA 4X2GA 5HCYA 4NEUA 2OJ9A 3FI2A 5HTIA 3S4QA 2HZNA 3R7UA 5GIOE 4MCVA 5D10A 3TTIA 3ODZX 3UODA 1YRPA 4LMNA 4ALUA 5EW3A 1Q3DA 3EB0A 4WD5A 4KBAA 4S33A 3VS3A 3TZ9A 3MVLA 3VF8A 2XZSA 3RCDA 3IDCA 2GMXA 3KQ7A 5LJJA 4YTFA 2C6MA 1PXPA 3CEKA 3IO7A 4XMOA 1H24A 1M7NA 3IGOA 3PVWA 3D14A 4WUAA 4F9CA 1PYEA 2R3IA 2VTRA 2WTIA 1UKHA 4TY1A 4BKJA 4E1ZA 3FLSA 3MB6A 4YTCA 5IQAA 2QOHA 2HELA 2C5OA 2BTSA 2R3JA 1SYKA 4TZRA 5CQUA 3FL5A 3K5VA 4RZVA 4FV7A 3S0OA 1FVVA 4O7SA 3W55A 1OKWA 1DM2A 5CVFA 2GQSA 4Z9LA 3V5JA 2ITVA 4JJRA 4HYSA 2O64A 3LXPA 2F57A 4M69A 3TEIA 4IVCA 3M42A 3HP5A 3MDYA 1YWNA 3E7VA 2QOFA 2WGJA 3GU4A 2PVMA 2WU7A 1TKIA 5JH6A 3KRJA 4LYNA 2UZLA 3PG3A 4KRCA 5C8MA 3QTZA 1YWVA 3W8QA 3W2OA 3QTRA 3MH3A 2BRMA 3PG1A 2PVLA 4GK3A 2OXYA 4AT5A 2PE0A 4AQCA 1JWHA 3VS6A 3WF8A 5BVWA 2R3KA 4RJ8A 3MH1A 4YO6A 3UYTA 4IAFA 5IA2A 3FMLA 5BMMA 4D9UA 4BCGA 1LP4A 2VD5A 5L6OA 3KK8A 4TTHB 4BZNA 4EK5A 1O6YA 4FYNA 4FT9A 2GFCA 3QHRA 4L7FA 4UYNA 4QMXA 3I5NA 5G6VA 4AZTA 4E3CA 4BCIA 3SLSA 4ZJJA 1R0PA 4QPAA 1GZ8A 2C1AA 2YM8A 3P08A 4QMWA 3H30A 3TZ7A 1CKJA 2XIYA 4W8DA 2E2BA 5IQIA 3S2PA 3PWYA 3ORTA 3UZPA 1OBDA 3DFAA 2XYNA 5F20A 4H39A 3UMWA 3WBLA 4Y83A 4NYEA 4NT4A 4W4VA 3DZQA 5JGBA 4IJ9A 5EFQA 2XRUA 2PMIA 2X7FA 3T3VA 3VBVA 2GQRA 2WEIA 3TWJA 2XNOA 3EQRA 5BYLA 3FC1X 2C0OA 4LMUA 4M12A 4QRCA 1E1XA 4PPCA 5H9BA 2X8DA 5CEKA 2B4SB 3A62A 4XS2A 5HOAA 3DS6A 3KMMA 4MXXA 5HE0A 1K3AA 3OBGA 2P2HA 2WMRA 3NPCA 2HY81 3BE9A 3NSZA 4FIFA 4G16A 4QP1A 2YIYA 4S2ZA 4C34A 3NUUA 2Z2WA 3Q9WA 3T9IA 4DCAA 3Q2MA 5LCJA 4X21A 2ZVAA 3R2YA 2Y7JA 3PPZA 4XG4A 3TJCA 3VBXA 2XH5A 4KB8A 5E8WA 2XNGA 5BUIA 3QTXA 5E1EA 1IR3A 2YAKA 3V51A 4CQGA 5K0XA 3W2CA 3N4UA 4AN3A 3JS2A 4F7JA 1KOBA 4O7NA 4GUEA 4OT5A 2W05A 3MB7A 3UP2A 2YDJA 1U54B 2QVSE 4NCTA 5H8EA 2QLQA 5E8XA 4XBRA 3KXHA 4YJOA 5AV2A 4CYJA 5J1WA 5EQPA 4CYIA 2YN8A 4DFNA 5DEYA 3B2TA 4E5WA 5IKWA 1XBCA 4DFUA 3FI8A 5EYKA 3R9HA 2R3FA 4R78A 2GNFA 3DJ6A 3HV7A 5E8ZA 3EHAA 3JXWA 4C58A 3OC1A 4BZOA 5HO7A 2PZIA 2UW6A 1FOTA 5IUGA 4FV6A 3CC6A 3F2NA 4EH4A 2GHGA 5HI2A 4JR3A 4PUZA 4U79A 2BIKB 4B8LA 4QMOA 5E7RA 3A4OX 4GVAA 4EHEA 4NKSA 1QPJA 4XP2A 3R73A 2YM5A 4XG2A 4LRJA 2ITOA 3R63A 4QTEA 3RP9A 3JYAA 4M97A 5HBEA 1MQBA 1FINA 3IW7A 3U9NA 4YZCA 3TN8A 2IO6A 3GOPA 4O83A 4DG0E 4L3LA 4L68A 4BDAA 3NUXA 3AD4A 4ITHA 3U4WA 3V8SA 3FLNC 4LUDA 1H25A 4DEBA 1PXOA 4HNIA 4IH8A 3ULZA 1GAGA 3VRZA 4ITIA 5IA4A 1H0WA 4R77A 1XBBA 3Q32A 4NJDA 3L8SA 3RKBA 3SG8A 2J0IA 2ZM3A 3TV4A 2R9SA 4ZJVA 4WG5A 5CU4A 5JEBA 4IZ7A 4QMYA 4O0YA 1OPKA 3EFJA 4DG2E 3OFMA 3PVGA 2IN6A 3KXXA 4N6YA 1Y91A 5AADA 4NTSA 5IZFA 2CKQA 3RWQA 2WHBA 1Q8YA 3FEGA 4K8AA 4PQNA 2X8EA 3VQHA 2QR7A 3UOHA 1BYGA 4RZWA 3PFQA 2Y6OA 4UBAA 4XBUA 4EK6A 3WZEA 4E73A 4EYJA 1P14A 5A6NA 3ET7A 4FTNA 4HCVA 1M2PA 5B0XA 3LAUA 2C6KA 4IM3A 2XNMA 4FOBA 2C0IA 1Q41A 2J7TA 3NLBA 4YLLA 5KZ0A 3FMHA 4FKOA 4HNFA 3D5VA 1V0PA 1OGUA 3R8VA
chains in the Genus database with same CATH superfamily
4TN6A 2I0VA 1PW2A 4EC9A 3VVHA 4PV0A 2PWLA 4WIHA 4EK8A 2Y4IC 3F7ZA 4XOYA 3EYGA 3QL8A 1XH8A 4NW5A 4U3YA 2UZBA 3K54A 4FK6A 4YNOA 4BTJA 2J0MB 1YI6A 3E63A 5BVEA 2CN8A 4PDOA 3ZZEA 5H8GA 3D7TB 3I1AA 3MTFA 2W5BA 3DK3A 4C36A 5HIEA 3PXQA 3QKMA 3ZONA 1YOLA 4BTFA 4KKEA 4AW5A 4DDGA 5HLPA 4XHKB 4CFFA 4L42A 4XUFA 4GW8A 4OR5A 1BI7A 5J7HA 1JLUE 4LV7A 3JY9A 4BL1A 1OIQA 2H9VA 1OKYA 3UPXA 3E8EA 1L8TA 3EQHA 5FG8A 3OEFX 2GU8A 2YZAA 3IW6A 3LFEA 4TYGA 3P7BA 4MXAA 1GIHA 2WEVA 3KN5A 3MA6A 2X0QA 3QA8A 5AX3A 1XH5A 3BV3A 4H58A 4MQ1A 1JKKA 3EQDA 3QX4A 3RM7A 3U87A 4I6HA 3C5IA 5C4LA 2WFYA 4NSTA 2QG7A 1OZ1A 4FIGA 4ZTHA 5FQDC 2IVSA 2ZV8A 2YCFA 3A60A 3FQEA 2XJ0A 5J1VA 3LCOA 3FSFA 2HZ0A 3L9NA 4IZYA 3Q6UA 2OF4A 4BDJA 4GRBA 5KMIA 4RC2A 1Y8YA 2UVZA 3FYJX 4FKSA 4RIYA 4AP7A 3Q5ZA 3AD6A 4E4XA 1PJKA 2Z7QA 4FVRA 3UDBA 3RMFA 3DA6A 4G3EA 3CBLA 5BYYA 3OWPA 3CTJA 4NIFA 4APPA 5D11A 5HEZA 1BL6A 2WO6A 4C4EA 1OUYA 3QD2B 3LXLA 5B2MA 2PZ5A 3LM5A 4TWCA 4AXEA 4RLLA 4O7WA 1I44A 4FSUA 2VX0A 4EOIA 1VR2A 3FXZA 4FKIA 5CZHA 3WIGA 3OTUA 5DIAA 3RHKA 3NNVA 1OECA 5LVPA 2HXLA 3AMYA 4X2JA 1ZYLA 3QRJA 4H36A 2CSNA 3CS9A 4LOOA 4DGNA 3EZRA 3FMEA 2HW7A 5DRDA 4JX3A 5DT3A 4D2PA 4U40A 2R3QA 3TNQB 3QRIA 4FZAB 4G9RA 4GK2A 4TNDA 3QYWA 3DK7A 2BTRA 4U7ZA 5CEIA 5AV4A 4JVGA 4L46A 5DR9A 1KE9A 5ANEA 5EM6A 4YNEA 3VHEA 3TMOA 1ZAOA 3FE3A 5E4HA 1YXXA 5EHYA 3UNJA 4QMQA 3SGCA 3FQHA 4K11A 4DHFA 3GU7A 4AT4A 5HU3A 2WQEA 4PF4A 2OXXA 2J2IB 2VWZA 3BEAA 1M17A 4IW0A 4O0TA 4AW1A 1R39A 5D9HA 3RPYA 5HNGA 1M7QA 1UWHA 3R1SA 3F9NA 3FBVA 2VGOA 2IG7A 1BUHA 3QCXA 3OTVA 4RX9A 5GJGA 3QUDA 1PXMA 4K2RA 4KINA 5HGIA 3VJOA 1H00A 2QO9A 3HYHA 5K0KA 2YLFA 3TJDA 5BV3A 3SRVA 2YAAA 4BCKA 4ENXA 2BVAA 5AAGA 2WQNA 4JNWA 4QNYA 4BWXA 4OAUC 3COMA 4BB4A 3AMAA 3R7OA 3UO5A 4FTJA 3TIZA 1J1CA 1FGIA 3FI4A 5JKGA 3CPBA 4BDCA 5I9XA 4YHFA 2VWYA 1ST4A 5HD4A 2R0IA 4UWCA 4AU8A 2IW8A 5LWMA 4LM5A 4NL0A 5C4KA 2YWPA 3C1XA 3UOLA 1H08A 2F9GA 4EK3A 5CZIA 2VWXA 2JIIA 3AC5A 3NDMA 3DXQA 4NM5A 3UIMA 1OKVA 3JVRA 3VUMA 3WZKA 4FTLA 2IEWA 3PRIA 4KIKB 4WNOA 4FKRA 3C51A 3R7IA 3TV7A 4Z7GA 3R8LA 4AA4A 4YMJA 2HZ4A 5ANJA 4MF0A 3DT1A 4RWIA 4CTBA 1DI8A 4OBQA 4BCQA 4EOPA 4E4NA 4EYMA 5M4IA 5FBOA 4CG8A 4ITJA 3FLQA 5IQCA 4JIKA 3U51A 2VO7A 4IWPA 2FUMA 3NYOA 1KE6A 4FK3A 3FPQA 3KN6A 2V7AA 4A4LA 3WZDA 5A6OA 4ZSJA 1Q8UA 1X8BA 4WKQA 3ZO2A 5AR2A 1WBWA 4TYHA 3TYKA 4C4JA 3WZUA 4AGWA 2IVTA 4MD8E 4E6QA 2YIRA 4GKIA 5FD2A 2X1NA 2B0QA 2Y6MA 3GFWA 2F7ZE 2ITWA 3BLQA 3LM0A 3NIZA 2AQXA 1SMHA 3P23A 4U45A 4X3FC 4CEGA 5L2SA 4JBPA 1JNKA 2YIXA 5I9VA 3VS4A 3QWJA 4XYFA 2VTPA 2XF0A 3CD3A 3KULB 4HCUA 3ZEPA 4D1XA 2OWBA 2VTSA 5J95A 4BDEA 1G8SA 3EWHA 4A9YA 4FNWA 4F6SA 3LFQA 1PKGA 5IMXA 3E8NA 1OPLA 3PDTA 5JZJA 4O38A 4AXFA 4R7BA 4EZ5A 2IF8A 3NW5A 4UEUA 5AR3A 4R3CA 3GCQA 4BDHA 2EB3A 1UU9A 2RFEA 3U54A 5M51A 2OJFE 2ITPA 3EQIA 3VONA 4YTIA 1ZWSA 4QMSA 3OF0A 4Y72A 1TQPA 2G01A 4PDYA 3IONA 4ANSA 2C5YA 3PJ1A 3QU0A 3DGKA 2QHMA 1Y6BA 3VW6A 3ZC5A 4BGQA 3C13A 3ZC6A 2ONLA 4BDFA 5HG7A 4J95A 5J9ZA 4PNIA 2B9FA 5AP2A 3RJCA 2W1HA 4JR7A 1T45A 4AGCA 4TWOA 4LRMA 1W84A 3EL7A 4G3CA 5HNBA 1ST0A 2I7QA 5FDPA 2QI8A 4O21A 1QPEA 4GU6A 5D12A 4ZTRA 5CAUA 2QCSA 2VZ6A 5LOHA 1GIIA 3NCGA 5DN3A 4HZRA 4GIIA 5EQYA 3BI6A 2VWBA 4O0UA 4YSMA 4D28A 2V7OA 3ZDUA 5L2TA 4UWBA 2PE1A 2O2UA 2O65A 4DFYA 2ITZA 3F66A 4WA9A 4KABA 1V0OA 4DGLC 4K33A 3JUHA 1E1VA 3IPHA 3MY0A 1XHAA 3DJ7A 3GU6A 2BKZA 3QD3A 5IA5A 3KF4A 4O4DA 2ZOQA 1IA9A 3MVHA 3JY0A 4QQ5A 4EONA 2C0TA 5AUZA 5IQHA 3LCSA 1H27A 3HV5A 3LJ2A 4YZNA 3SC1A 1SM2A 3VBYA 4G17A 3GU8A 5A14A 3L8PA 3QHWA 4FG8A 2BHEA 3DBQA 3SXSA 4DEEA 3ZM4A 2QOBA 2ZV2A 2UZNA 2I1MA 4IAIA 4S30A 2W9ZB 2HCKA 4U80A 1MRVA 1ZYSA 2ETRA 3QQHA 5F1ZA 2BZIB 4DEGA 5CAOA 1WVWA 5M09A 3TXOA 3O8PA 3UIBA 3L8VA 4K0YA 4OTQA 4EHZA 3RZBA 4FSWA 3DNEA 3LCKA 3PY3A 4R5SA 2CKEA 4IEBA 1RE8A 2E9UA 2YZLA 2VTAA 1XKKA 2JIUA 4XV9A 3COHA 4O7ZA 5CS6A 2F7EE 4YP8A 3QZFA 1Q97A 2P2IA 3NUYA 4FL1A 3BU5A 3ORXA 4MX9A 5KMMA 2NYAA 3GFEA 1JOWB 3BELA 2ETMA 1CMKE 4A9RA 5L6WL 3LCDA 5HHWA 4AFJA 2XANA 1U59A 2GNJA 4LGHA 4XG9A 1Q8WA 5J5TA 5CYIA 4W9WA 4YHJA 4HPTE 1NVSA 1REKA 2XUUA 2YCRA 1TZDA 3LXKA 5M53A 1WBSA 4ZOGA 3ALNA 1H1QA 2VUWA 4FV1A 3RPSA 3E7OA 4O7VA 2ZB1A 4MHAA 3EKKA 3FJQE 2X0GA 4NJ3A 4M14A 5FM2A 3NEWA 2VTTA 3RAHA 3IDBA 1ZMVA 2ZAZA 3R21A 2A27A 1OL6A 3EQBA 4JL9A 2EB2A 4KD1A 2XIKA 4FT7A 4ID7A 2VTOA 3OBJA 4DGMA 2J9MA 2UVYA 4RJ3A 3P7CA 5EW9A 4DTKA 4TYJA 3MESA 2RFNA 3O5AA 2XNEA 3E8CA 2VTJA 4HPUE 4A9UA 3UQFA 4H3BA 4USEA 4O0SA 2BRHA 2C5VA 1QMZA 3AC1A 3F6XA 5I0BA 2XAOA 5LVOA 4BR3A 3PIYA 2GHMA 4I5PA 1YHWA 1F3MC 2HWPA 3KIOC 4QQCA 4DH7A 5FXRA 2IZUA 2X0OA 4L52A 3FKLA 4IDVA 3REPA 1W0XC 4X3JA 2WTDA 4DT8A 4GUBA 3R8MA 2PULA 1OL1A 4G9CA 4G6LA 2PMLX 4C38A 4CRSA 3FV8A 4D1SA 2YCSA 3R7YA 3UNZA 2VAGA 3TT0A 4QMVA 3R8PA 2X7OA 5EHOA 3P1AA 5EK7A 4FTAA 3W0PA 3KGAA 4FZFB 3W2SA 2EVAA 3C7QA 3QFVA 4RJ5A 2UZVA 4J8MA 2BRBA 5L2QA 4JRNA 3KCFA 4GK4A 2B9IA 3D7ZA 3DBFA 4L00A 3W32A 2PE2A 3G33A 3PA4A 2UZOA 3A2CA 4QTDA 4QYEA 4X2NA 2CKPA 3UC4A 4YJSA 1XO2B 4F63A 4J53A 4Q9ZA 4U97A 2V0DA 2PVJA 2YIWA 3OY1A 4XV3A 3UVPA 3VULA 4E20A 4DFZE 5GZ9A 3SA0A 4V01A 3NFGB 3MN3A 2JD5A 1JAMA 3OXIA 3HMNA 2VWVA 4YGAA 3LFFA 2UVXA 2XKFA 2OFUA 5C26A 1PXKA 4FTMA 3RK7A 3OEZA 5AFVA 5DEWA 4BCJA 2PL0A 2BCJA 2C5XA 2W1EA 3JVSA 3SVVA 4XRJA 4FT0A 4L67A 1HOWA 4GL9A 4YZDA 5E9EA 2VO0A 4D2RA 3W1FA 1OL7A 2OG8A 2OK1A 4QP4A 2W06A 2GQGA 4DEDA 3BBTB 4IIRA 5CU2A 5FGKA 2ESMA 4GU9A 4C35A 5FXSA 1W82A 2JFMA 4MK0A 2P0CA 4G1WA 4RMZA 4GIHA 3RALA 3ATSA 3PJ3A 4GKHA 4I93A 4R5YA 4DTBA 4EOOA 4YC6A 5KX8A 2OO8X 3HV6A 1O6KA 2UZEA 3GC9A 3MWUA 4PPBA 5EKNA 5AEPA 1WBVA 4M8TA 3KFAA 4DC2A 2R3NA 3Q9XA 1W98A 2FVDA 2GNHA 4BBMA 5L2WA 1Q8TA 4ZEGA 1ZYJA 4ACCA 3ORIA 4FR4A 4WBBB 1VZOA 5E8SA 3DNDA 4ZP5A 4MUQA 5JK3A 2CGUA 4ZMFA 4G2FA 3DBDA 2GS2A 3A7GA 3LVPA 1W8CA 3CJGA 5DE2A 3R1YA 2BDFA 4RJ4A 2OICA 4BRXA 2EU9A 3KKVA 3SQQA 3FMNA 1SZMA 2XAMA 4RVMA 2C4GA 4BCOA 2WMAA 4I24A 3V6RA 1R0EA 2CHLA 2F49A 5EYDA 5JQ5A 5JGAA 2WAJA 5IQEA 2QONA 5JGDA 4I3ZA 5AR5A 3TDVA 3HVCA 3ZM9A 5AIRA 3M11A 3Q9YA 3W8LA 3PJ2A 3HRBA 4ZLOA 4LFIA 5AP6A 3SG9A 1ZMWA 4L45A 2HWOA 4AFEA 2WMWA 2I0YA 2HZIA 2G2IA 3LCTA 5HE3A 3C0GA 3H0YA 2Z7RA 3E5AA 3KC3A 3AC4A 3KXMA 2WTJA 3QQLA 3R22A 4DEAA 4AN2A 3CPCA 3NW6A 3PXKA 2J4ZA 4F9WA 3LJ0A 3ZBXA 4DAWA 3CD8A 3RHXA 5HQ0A 1YOJA 3MJ1A 3PJ8A 1G8JA 2PVHA 4CFMA 4YURA 2P55A 3I6WA 5ANKA 1U54A 4N0SA 3E87A 4F0FA 3W16A 1R1WA 4IMYA 3TNPC 1XMLA 1OI9A 5HKMA 2JKQA 3R28A 1IRKA 3DLZA 3KU2A 4NM0A 4QYGA 2A1AB 1QL6A 3R8UA 3V3VA 5CF4A 3TUDA 2H6DA 3Q9ZA 3DK6A 2YACA 4MKCA 4F9YA 1A48A 4EUTA 4F65A 4JDJA 2JDTA 4MYGA 5A3XA 2PTKA 4M0ZA 1KSWA 1LR4A 4B99A 5KBRA 3QZIA 4IDTA 5DI1A 4ACMA 4MNFA 4D0WA 5AUTA 1JQHA 4FV2A 4QOXA 2R2PA 5JSMA 4XLVA 3EN4A 4GT3A 4DFLA 4RLKA 2PVYA 1STCE 4BCNA 1XQZA 4HVDA 2F2UA 2X2LA 3QC4A 4II5A 1UNGA 4KAOA 5AM7A 5EOLA 2G9XA 5I9UA 5LMAA 2YISA 3QZGA 4AZEA 5CANA 2XCHA 5FEEA 4FF8A 3ZTXA 1IASA 3ACJA 3NVMB 3QQKA 4C4GA 4NM7A 5DVRA 5BMSA 2PK9A 5A4EA 1TFFA 2VRXA 4X2KA 5C27A 3TG1A 2CKOA 2PZYA 2VTLA 3Q4CA 4E4LA 1BMKA 3ELJA 5HG5A 3EQPA 3LQ5A 5D1JA 4DH5A 4BCHA 4FG7A 4O27B 4V0GB 4YLKA 3BHTA 3H10A 4ZK5A 4OTFA 5KMJA 3LKMA 2IW9A 2RG5A 3SOAA 4FKWA 4ALVA 4OBOA 4EHGA 1W83A 4UMUA 5TR6A 2PUNA 5J9LA 3VBQA 5AIKA 4FEQA 3H9RA 5AMNA 4L9IA 4DTAA 1ZZLA 2OH4A 4DA5A 3RVGA 1YDRE 3W2QA 4FUYA 3HAVA 1AD5A 5CLPA 4BDIA 3CQWA 3E64A 3A7FA 3EZVA 4O81A 3NVKI 3ZSGA 1Q24A 4DCEA 5J7BA 5E92A 3I7BA 4AUAA 4PMTA 2XK9A 4AAYA 2ZFYA 3ORKA 2GNLA 5L2IA 3WF7A 4CQEA 3R7GA 4U0IA 4F1TA 3SW7A 1BLXA 2IJMA 4IB1A 3RAKA 2QNJA 5CNOA 4C3PA 4CLIA 2DS1A 2J50A 3QKLA 3HAMA 3W0MA 2JC6A 3DLSA 4I0TA 1LEZA 2C1BA 5J5SA 3E62A 3R9NA 1M14A 3P5KA 4O6EA 3AC8A 4CCUA 3NNXA 3FQSA 4TRLA 4OTWA 4ZJIA 3A61A 3AOXA 1IEPA 5HTCA 4AA0A 3AT3A 5KBQA 2XALA 4CVAA 3MTLA 3GXLA 2VU3A 4R7IA 4ASEA 3HA8A 1BKXA 2WPAA 5IUHA 4PMMA 1YXUA 3K5UA 2XB7A 3F3UA 3IGGA 3BHVA 3MIAA 1SNXA 3E8DA 4FV4A 3QLGA 2PUUA 1XJDA 2VWUA 3W2RA 2G1TA 3DKFA 2V55A 2B1PA 4CRLA 3O71A 3EFLA 4J97A 2GFSA 3R83A 3ZZWA 2J6MA 4FZ6A 4WNMA 3ZH8A 1ZYCA 4FSQA 4CKIA 3UG1A 3OT3A 4DBXA 2BZHB 5AR4A 1F5QA 3PY0A 3TNWA 3AKJA 3UQCA 3UVQA 2BILB 4MXOA 1Z57A 3DKGA 4CKRA 2PZPA 4USDA 2G2FA 5CNNA 4DITA 1JPAA 3GI3A 2NO3A 4DYMA 1PF8A 3BLHA 3GNIB 2O63A 1NY3A 3AXWA 4KSPA 3UNKA 4UWYA 3NAYA 4FTCA 3EKNA 3F3TA 2PSQA 4LGGA 4USFA 1NW1A 5IF1A 3GGFA 4PL4A 3DXPA 1CDKA 1JSVA 4MNEA 4ACDA 2ITYA 2JLDA 3O8UA 3O2MA 4DEIA 3C4WA 2ZDTA 5CTPA 4RIXA 3N4VA 4FKPA 4HGEA 1QPCA 4KA3A 3MFUA 2UW7A 1WBOA 4FNYA 3ZXZA 2BHHA 2R3LA 4PDPA 2A2AA 5AUWA 2XS0A 2CCHA 5E91A 3RPRA 4BVUA 4C2WA 5BVNA 4BDDA 3MPAA 3TACA 5JFXA 5FM3A 3F5UA 4IX4A 2GCDA 3V6SA 4EH9A 3LZBA 5IEVA 2CGXA 5IUIA 3SAYA 5CF8A 4PL5A 4CLJA 5BUEA 5B7VA 5IH6A 5IA0A 5IDPA 1LUFA 2R7BA 4F7SA 3U6JA 3DBCA 4EOQA 2PUPA 2UW9A 2YERA 4H3QA 3F5GA 2G2HA 2OH0E 4KS7A 2JDRA 3BV2A 4NFNA 3OROA 5TKDA 3TI1A 1JSTA 3BYMA 3FXXA 5CAVA 5C8KA 1W2DA 3ORMA 4OBPA 1YI4A 3WE8A 4O4BB 1XBAA 3PYYA 3NUSA 4FX3A 2C6EA 1MP8A 2WTKB 1OM1A 1RJBA 3T9TA 3VW8A 3EYHA 2IVVA 3DKCA 2R7IA 3QF9A 1H1RA 5IG1A 5A9UA 2B53A 3PY1A 3F3WA 3GBZA 1XH7A 2UW4A 3LFNA 4V05A 3S00A 4QMTA 4D9TA 4JRVA 2BDJA 2OGVA 4HYIA 1IAJA 4MQ2A 2WQOA 3OXZA 3HRCA 4FIJA 2WXVA 5EM7A 4QDEA 3ZO1A 1OL5A 1K9AA 2ONLC 3FKOA 5LVLA 5M44A 4NTTA 2JKMA 4TWNA 4OTIA 4AZWA 2WMUA 4LRKA 4XX9A 3UBDA 3MYGA 1R3CA 3PWDA 2QLUA 3SV0A 1FPUA 4IZ5A 3FZPA 4MEDA 4RIXB 1O6LA 2J0JA 3HMPA 3OT8A 4HCTA 3CTQA 4UMQA 3Q3BA 4X3FB 5ITAA 2ZDUA 2R5TA 3GC8A 4OTGA 4TPTA 4BKZA 3HEGA 1Q4LA 3KY2A 4NZWB 3CKWA 2OZAA 3COIA 5I5ZA 4L3JA 1H1PA 4B8MA 3FY0A 1YHSA 2GHLA 3ODYX 1UNHA 2E9NA 2H96A 4L6QA 4WNKA 4L01A 3NYNA 2W0JA 4ZZNA 2Y4PA 3QX2A 2CMWA 4MXZA 4NKAA 4RWJA 4DLJA 2PZRA 3D83A 3G5DA 4IC7A 1BL7A 3CQUA 3Q4TA 4DGGA 1ATPE 3AGLA 3ZUTA 1PMUA 1URCA 2I0EA 3CCNA 4ZZOA 5HBJA 1H07A 2EXEA 3ORZA 1U5QA 4NH1A 2LAVA 2OU7A 5TF9A 2UZWE 5DT4A 2E9OA 4RIYB 5DG5A 3BRBA 4CZTA 4HVIA 4P90A 3ITZA 4UYAA 2XKEA 1O9UA 4G5JA 5EDRA 2CNUA 2V22A 3FMDA 4FI1A 2F2CB 3UIXA 3C50A 3C9WA 2HOGA 2Q0NA 4YTHA 2QQ7A 5DMZA 4FKJA 4ZY5A 1TVOA 4QP2A 3HP2A 4ZMEA 1TQIA 4RFYA 3HLLA 2VX1A 3QTWA 3QD0A 5AUYA 2W17A 3ZFMA 4J98A 3C4CA 1B6CB 4C33A 4WSQA 5CT0A 4PMPA 3CKXA 4V04A 5KMOA 3DQXA 4EI4A 2WMVA 4RRVA 5E8VA 3VUHA 4Z7HA 4N57A 3R00A 4FYOA 4MH7A 4MTAA 3ULIA 1ZMUA 5BUJA 3PXRA 4C37A 5M4FA 3ZSIA 1Y57A 3GCSA 5GJDA 5F9EA 3MJ2A 4DT9A 2YA9A 4EH6A 2HXQA 4PMSA 3TKIA 2EXCX 5DA3A 4FEXA 4Q5EA 5EOBA 3ZMMA 4D4RA 3FZSA 3SD0A 3L8XA 3HDNA 4GJ2A 4F99A 3ZRMA 4D55A 3CGOA 1QCFA 3IKAA 2HENA 3LLTA 3THBA 4IWQA 1QPDA 2OJJA 4MBIA 4EKKA 3FLYA 3Q4ZA 3JPVA 3KF7A 3RGFA 4JMQA 5HORA 5CVHA 4B0GA 4GCJA 5GJFA 4M0YA 4ALWA 4LDTA 2WTVA 2Y0AA 3E3BX 4M66A 1UNLA 2BZJA 2J0KA 1KE5A 4YZ9A 3UIUA 5L8JA 2ITXA 3R1NA 4FKUA 5HIBA 2QO2A 5JFWA 3VBTA 3VIDA 4AW0A 3IQ7A 4UMRA 4GJ3A 3E92A 5GZAA 4WBOA 3FLZA 3IDPA 5AM6A 5IQFA 1H01A 2X2MA 2X8IA 3F2RA 1B38A 2VV9A 4O84A 2HAKA 4QT1A 4IFGA 4RWLA 3ANQA 5C01A 4KIQA 4OLIA 2JKOA 3SKCA 4AF3A 2XJ2A 4R7HA 5DPVA 4BHZA 3BL9A 4J96A 4IWOA 3NUPA 4GH2A 5ETFA 3VS5A 3M1SA 1PKDA 4F1OA 2P33A 2OIQA 3AMBA 4Y8DA 5CVGA 5ACKA 4ZTQA 3OHTA 3HRFA 4IBMA 2UW5A 4ZLZA 2JITA 4D2VA 3GCVA 3ZEWA 4OAVB 4D5HA 3KMWA 3FAAA 4HOKA 4A4XA 1J3HA 1S9JA 2GSFA 2R3RA 3VF9A 3S1HA 2BPMA 4EH5A 3WOWA 5E1SA 3RI1A 5IPJA 5IISA 3BQCA 3AT4A 3FL4A 4GFGA 5B2KA 4FV5A 3V04A 3KEXA 4CTCA 4DHJA 3QCSA 4QP7A 3FHIA 3QQGA 4TYEA 4QD6A 4M7IA 5DYJA 3N51A 5T68A 4JX7A 2JAVA 3DXNA 2HW6A 2WKMA 3NUNA 3MA3A 4GFMA 4CG9A 2G15A 3R8ZA 3S3IA 1ZLTA 4HGLA 3V5PA 5CF6A 3LPBA 4DH3A 2ZV9A 3R71A 2VWIA 3LFSA 1PHKA 5HLNA 4I6QA 4BJJA 4FZ7A 2KTYA 3NX8A 5HO8A 1MRYA 3W0RA 3DDQA 3FZTA 5GZ8A 4ZSGA 3VBWA 3R04A 4O7RA 3VRYA 4K77A 5AUVA 4EH3A 4NUSA 1VLRA 2QKWB 2BUJA 3GC7A 3CIKA 2JBOA 2BDWA 4X6RA 4DGOA 3OW3A 3NS9A 4HYUA 5BVDA 2RFSA 3Q4UA 1KE8A 4KNBA 2BAKA 3PUPA 3QCYA 3SDJA 4EH8A 3W0OA 4N4SA 3F7WA 4FL2A 2YM6A 3ORLA 4JI9A 4R8QA 2WIPA 3WF5A 2B55A 4JG6A 2ZYBA 3IS5A 4F09A 2OIDA 2QOCA 2C47A 3AC2A 1WZYA 1PYXA 2J0LA 4FRFA 5HX8A 5L8KA 5EDQA 3V5LA 2AYPA 2AUHA 5ANIA 5FUTA 3FUPA 3G51A 4QQJA 4BIBA 3CR0A 3NZ0A 5HIDA 4BTKA 1VYWA 4ZTSA 5TE0A 4Y5HA 4E4MA 4ARKA 3OMVA 4JDKA 2W1GA 4W4YA 3CQEA 2O5KA 3PIXA 4D5KA 2O3PA 5EI2A 4C3RA 3DAKA 5CT7A 4FZDB 4Y5QA 4I0RA 4E7WA 5KUPA 2XK8A 1GIJA 1JKSA 3DY7A 4R3PA 3II5A 4AOTA 4BGHA 3RNIA 4JS8A 3RK5A 3WYYA 5F94A 5HESA 3MIYA 4IX6A 4GFOA 3I7CA 3BCEA 1FVTA 1JSUA 2C6IA 2P4IA 1M52A 5FXQA 3EN7A 4BDGA 2C68A 2XIRA 2FGIA 4BZDA 3BYVA 2QG5A 3NCZA 1YI3A 3C0HA 2X4ZA 4QQTA 3BE2A 4X7QA 4IM2A 4YJVA 4O7TA 3QXPA 2FSTX 4LGDA 4APCA 5M07A 1UWJA 4XP0A 4AZVA 2UZDA 4AZFA 5CENA 2WQMA 4N70A 3F82A 3WI6A 4I5MA 4GEOA 2JDSA 4LQMA 4GYIA 3B8RA 3EL8A 3GU5A 4RPVA 4XEYA 3SHEA 4AXAA 4FEVA 4HGTA 4BWKA 4ASDA 3NGAA 2XIXA 2I6LA 1OGYA 2QU6A 4CCBA 5KCVA 2GDOA 4FSMA 4ANOA 3GC0A 5EG3A 4O4EA 2W1IA 4FSRA 3WYXA 5CQWA 4Q5HA 4XG3A 5HE1A 3D5UA 4NFMA 1IA8A 2XKCA 4C02A 3NR9A 5FLFA 4BCFA 4RWKA 5DWRA 2YDIA 2WTKC 2OXDA 3QKKA 5FBNC 3TNHA 4KBCA 5JZNA 4BFMA 5IEXA 1KUTA 3KXZA 2XNNA 4DE4A 3ACKA 3B8QA 4IAKA 4PTGA 3T3UA 3DPKA 4TL0A 4J1RA 5LCKA 4DDIA 4J8NA 4IM0A 1JVPP 5DNRA 5LARA 4D1ZA 4EOMA 4B7TA 5CEPA 4CKJA 5K4JA 2OI4X 2CN5A 4FTTA 2XM8A 2CDZA 5IDNA 3U6IA 4AGUA 3E3PA 4EOJA 2C30A 4XJ0A 4BWPA 2C5NA 2W1FA 3SX9A 1T46A 1ZY4A 2ZM4A 2C6DA 3PXZA 4WG4A 5KZIA 4EQCA 3FHRA 3BKBA 4IAYA 2CPKE 3KXGA 4QO9A 2C6TA 3DJ5A 4JLCA 5FWKK 5EI6A 3DKOA 3RAWA 4F6UA 2WNTA 5CXZA 1I09A 2C6OA 3GCUA 3VS7A 5A4CA 3VS1A 4LG4A 4O2PA 5BYZA 5JMSA 4AT3A 1GNGA 4QNAA 4LV8A 1ZXEA 4QMMA 4FVPA 1Y8GA 3H9OA 4YPSA 2BALA 2XEZA 3ZXTA 1Q3WA 2YCQA 4XP3A 1UA2A 3WE4A 4RSSA 3PZHA 3UGCA 4O86A 4JG7A 3Q53A 4WRGA 4YJUA 1JKTA 2X81A 4AACA 5JN2A 2NNWB 4ENYA 1V1KA 2B7AA 2XKDA 1WVXA 4XV2A 5CSXA 3UQGA 3ZO4A 4ANQA 4CMUA 4O82A 4F0GA 3ORNA 3LE6A 2FSMX 1DI9A 2O8YA 3IW8A 3QBNA 5CWZA 3D2KA 2R3MA 1XH6A 4JBOA 2YIQA 3DV3A 3PJCA 4IAZA 2XP2A 4H3PA 4W8EA 3I81A 5CU3A