3KXHA

Crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor (2-dymethylammino-4,5,6,7-tetrabromobenzoimidazol-1yl-acetic acid (k66)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
327
structure length
326
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title ATP site-directed inhibitors of protein kinase CK2: an update.
pubmed rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 326
sequence length 327
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kxhA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kxhA02
5CT7A 1DM2A 1H1RA 3FPMA 4PMSA 1GIIA 1GJOA 1TVOA 4F65A 4FZ6A 1GY3A 2GNIA 2WZJA 2VWZA 4JDKA 4JIAA 3W2CA 2XIKA 3M2WA 3ZS5A 1H28A 1YXSA 2W1CA 3DQWA 3MJ1A 3CTQA 3ZXZA 4JG8A 4II5A 4DEBA 2WTKC 1PKGA 5CEIA 2BHHA 2JDOA 4OR5A 5HKMA 3ORLA 1YVJA 3GU4A 3ZZWA 4M0YA 4ZJVA 5M4IA 4OTIA 2GNLA 1T45A 4L3LA 3PPJA 5FM3A 4O38A 5CTPA 2ITVA 4R5YA 3UNJA 3WYYA 5IZFA 5FP5A 3S1HA 5F20A 5AA9A 3QUPA 4AOJA 4P5ZA 5B2MA 4YNOA 4I3ZA 3I79A 4KBAA 4F9BA 3TCPA 4TYIA 5J5TA 1FGIA 2QR8A 3D4QA 2YABA 2YZAA 4W9XA 2XNGA 1Q5KA 1KE9A 2YM8A 3C5IA 3EL7A 2JFMA 3MN3A 3ORXA 4O86A 4MNEA 5DR9A 4BKYA 2JKMA 4BVUA 4ANQA 4FE2A 3NUAA 4KKHA 2OF4A 2ESMA 4BI2A 2YISA 5CF6A 4EH8A 4H3PA 4BZDA 1YWNA 4TWOA 1H1SA 4V05A 4WBOA 5GIOE 2RL5A 1PXOA 2FO0A 3Q53A 5B2KA 4E6QA 4PL3A 3CCNA 5ANDA 5AWMA 3QD4A 4EBVA 3ODYX 3KRRA 5EYCA 4U81A 3UQFA 3ID6C 2XBAA 3EZVA 4UMRA 2YFXA 3PVWA 3PRIA 4MBLA 2CCIA 3E87A 3PA4A 4I6QA 3UQCA 4KIKB 3COKA 4C3RA 4HPUE 3W16A 4OBOA 2OZAB 2XM9A 2OGVA 4YGAA 3W8LA 3NWWA 1J1CA 3LFQA 3G0EA 4Y46A 3VUTA 4PPCA 4ACMA 1WBVA 2WIHA 1AD5A 1Q99A 4YR8A 3MBLA 5HOAA 3EN6A 5IMXA 2C6EA 4ZSLA 3EOCA 3QQFA 5HO6A 4HVSA 3IO7A 1OPJA 3TL8A 1JKSA 4O0VA 5L4QA 2P2HA 3H30A 4F9CA 1R78A 2RF9A 4YBJA 3RNYA 4TRLA 4R7IA 3OBGA 4K2RA 4KINA 3UPZA 1Y8YA 1RW8A 3E93A 4KS7A 3SLSA 3TDWA 3MY0A 4BHZA 1Q62A 2C69A 4PUZA 1VZOA 1K3AA 3F66A 5DT3A 4CD0A 1YI6A 3TTIA 5DG5A 1P4FA 4RLLA 3TV4A 1H1PA 2QHNA 3F7ZA 4XH6A 4JR7A 4BTJA 5E8VA 2PZPA 3QYWA 4YUQA 2CNVA 2W17A 2VD5A 3BE9A 4BWXA 5IG1A 3HV7A 2YIWA 5EKOA 3EKNA 3DA6A 5ACBC 3F88A 2A19B 3OUNB 4FTNA 3NNXA 4O6LA 4B8MA 3LFSA 4PDSA 3EWHA 4PMMA 5FWKK 4S33A 5LMKC 2QO9A 4ZJIA 5BPYA 5IA4A 2J51A 4RX7A 5LVMA 1BLXA 3DOGA 4E3CA 4BCHA 4YZNA 3H0ZA 2GQRA 4OTDA 4Q5HA 4R3CA 4U6RA 4MF0A 3NUXA 3NZ0A 2YWVA 1XH6A 4XP0A 3IW6A 2C5VA 4A7CA 3H3CA 3PY0A 5F4NA 3OC1A 3W32A 4ENXA 4NUSA 5KKRB 2XCHA 5IUGA 1YXTA 4L42A 1J3HA 4X6QC 1JOWB 2X39A 3O8TA 1UU3A 2W06A 3TNIA 3A4OX 2JDSA 3MVJA 2C6KA 3VBWA 4A9YA 3L8PA 3LMIA 2I0HA 4ACHA 3CXWA 1WVXA 1XKKA 2VTMA 3AC1A 3PA5A 4IB0A 5CANA 3LPBA 3ORZA 4D9TA 2UZLA 2UUEA 2XRUA 3D0EA 3PZHA 2VO7A 4YJVA 5FEQA 4YLLA 3B2WA 4X3FA 1PJKA 5HHWA 3RK7A 3FAAA 5CT0A 3KQ7A 3OCGA 3W2QA 4DBNA 3VS0A 4QO9A 2O0UA 4IZAA 3FZRA 4J8MA 2QO2A 4OT6A 3HA6A 3PJ2A 5JGDA 5AAFA 2Y0AA 2OJIA 5D41A 4E5WA 3PSBA 1YKRA 3JXWA 3V6RA 2VGPA 1BI7A 2Y6OA 5HD7A 4D0WA 2W1ZA 3OF0A 3RPSA 4CG8A 2AC5A 5BUEA 3RPYA 2PMNX 3O23A 3KN5A 5HG5A 1PRYA 3PIZA 4AN2A 4MXYA 4L52A 3HP2A 3I81A 3E5AA 4MD7E 2OIDA 2EUFB 3BELA 4JQ8A 4EHVA 2VWYA 4PDOA 3BHTA 3L9NA 5D7VA 4DFXE 3AC8A 4EYMA 2WMAA 1B38A 4BBMA 5IUIA 4UMPA 5C4KA 4ZZOA 4OAUC 1ZYSA 1OBGA 2GDOA 4Y8DA 1SYKA 2WHBA 4ZZNA 2VUWA 2NRUA 5L6WL 4BCPA 3DDPA 5JFSA 2C5YA 2IW8A 5L8KA 2B9HA 3OD6X 4UMQA 5JSMA 5BVOA 4KIOA 4BCMA 4G3DA 4R1VA 3ZUUA 5AAEA 2ZV9A 4RX8A 5E8SA 4FGRA 1L8TA 5JGBA 4IFGA 4MYGA 4K18A 4YZDA 4LRKA 5CENA 2R3KA 3FUPA 1L3RE 2CN5A 1RDQE 2VX1A 3FLWA 5ANGA 4P7EA 1KV1A 5HO8A 4ZMEA 2GS6A 5M06A 2CKQA 2R3PA 1OM1A 2PVMA 2UW5A 3F9NA 3LCTA 3PJ8A 3N4UA 3UPXA 4OAVB 2DYLA 4AFEA 4P5QA 2QVSE 3DKCA 1FQ1B 1Q8WA 2I0YA 2B55A 4GK2A 4GYGA 1GZKA 4K11A 4NCTC 4DAWA 2YCSA 3ZFXA 5M55A 4ALUA 4PP9A 1UU9A 4EEVA 1OGUA 4DLJA 1KE7A 4HZRA 3ZO4A 4FYNA 2C6OA 3DJ6A 3CR0A 1LR4A 4I24A 4USFA 3A7HA 2JD5A 3H9FA 3UC3A 3R8VA 4BKJA 3A60A 1VYZA 3BKBA 4EOLA 4C59A 1BX6A 3C4XA 3TI1A 2VTAA 5BYLA 4X7QA 1J91A 1P2AA 4Y83A 5KZIA 3E62A 3R8PA 2JKOA 2R7BA 4AN9A 4C61A 2KTYA 4FTKA 1O6LA 3EQBA 2R0UA 3OCTA 5FP6A 4ANSA 2W0JA 3ZU7A 4WIHA 4QP7A 5JFVA 3QCYA 2OG8A 3UYTA 3ZLXA 2J0KA 3VBQA 2XA4A 2JAVA 2XRWA 3P7AA 2VTTA 3Q5IA 4RC2A 1UWJA 4S34A 4AE6A 3V8SA 4OBPA 2XIZA 2VO0A 3R9NA 3FKOA 4KAOA 1CM8A 4PMTA 3WOWA 4F09A 2XKFA 2PY3A 1WCCA 1ZWSA 3HNGA 5CU4A 3P7CA 5BVDA 2W5AA 3LJ2A 3OW3A 2PTKA 4YJRA 2OICA 2QOIA 2C3IB 3O2MA 4D2SA 3EFKA 2IWIA 3UE4A 2WU7A 3HMPA 4AW0A 4YURA 5E91A 2XNNA 3HKOA 4MXXA 4M69B 4J98A 2SRCA 3QRKA 4E20A 2JGZA 4FYOA 2CNQA 5KNJA 2QQ7A 3KRLA 4ZTHA 4WNPA 2X7OA 3F2RA 3PTGA 2OK1A 2OJFE 5E8ZA 3RZFA 5HE1A 3SW7A 2ZOQA 1SVGA 2R2PA 5DA3A 1XWSA 5HO7A 2ZMDA 4ACDA 4NZWB 3DV3A 3MTLA 1JWHA 2UZBA 3M42A 3DPKA 4NJ3A 2XIYA 1ZOGA 1VR2A 3GCPA 2PMLX 4FTRA 2EXCX 5CNOA 5M53A 3K3IA 4ZP5A 1T46A 4C8BA 3OWJA 3G33A 5CU0A 5BX0A 4CXAA 3U6JA 2Z02A 5AV2A 3CP9A 2VWXA 4GIHA 3RAKA 4AWIA 3KEXA 3BLQA 3WZEA 2BAQA 1DI9A 4GT5A 4FEVA 1H25A 4RIXB 4ARKA 4F63A 5AMNA 1OECA 4RZVA 3KF7A 2YIXA 5FXSA 2OFVA 5A9UA 3N4VA 4YSMA 2X8DA 3BU3A 3KCFA 4FKIA 3ACKA 4XBUA 2IW9A 2ZAZA 3D5WA 3MIYA 2CGVA 3R7UA 4C36A 4D4VA 2B9JA 4N4SA 3DGKA 3CY2A 1P14A 2X2MA 3U51A 4RJ5A 5E8UA 3TIZA 5HBEA 3S2PA 1NY3A 3R9DA 2IVUA 3UO5A 1F5QA 1ZYDA 4IQ6A 3F3TA 4IWQA 5CWZA 3E88A 5K5XA 5HI2A 4QPMA 4AGWA 4WUAA 4CLIA 4CQGA 4RQVA 4X3FC 4EH9A 5KX8A 1URCA 4FNXA 4BCJA 2YDKA 1IAHA 3W55A 4A9SA 4EH5A 5CAUA 3IG7A 1YHVA 4JJRA 3NIEA 4FG8A 5E8WA 5BYZA 3ZO3A 3PXQA 3AC5A 3PP1A 5DE2A 3JR1A 4FICA 5M4CA 1G8AA 4A4OA 4JAIA 4O96A 1WMKA 3FDNA 3VUGA 3QTUA 3I1AA 3UZRA 5CF4A 3R7EA 5A14A 2O3PA 2X6DA 1NVRA 4NTTA 4WD5A 4EH2A 5BYYA 3ORIA 1I09A 4DT9A 3R7IA 2RIOA 2E9NA 4E4LA 5JT2A 3R7GA 1OMWA 3NIZA 3QKMA 3DQXA 4NM0A 3PFQA 3DB6A 3TZ7A 4F7NA 5LCJA 4DYMA 3KVWA 2QG5A 4GVJA 3W2OA 4C34A 4D9UA 2FA2A 4JBOA 1Y8GA 3EQPA 4RC4A 4BCGA 3O7LB 2C4GA 2R0IA 4FV8A 2VTRA 4KKGA 3T9IA 4G6NA 4M0ZA 4DE4A 1GIJA 3D2KA 4H58A 5EDPA 5AV3A 4XV9A 2GTMA 3NCZA 5GJDA 1TQMA 2R3IA 4YTHA 3CBLA 3NEWA 5H8BA 3TV7A 4FTTA 5AP5A 1GZ8A 4U3ZA 5KMOA 3ZOSA 3MGYA 5IISA 5FM2A 2FSOX 4UYNA 4JAJA 4MNFA 5CF8A 2RKUA 4DEDA 3VF8A 1W0XC 3FMJA 4XJ0A 4A07A 1OL7A 3V5LA 5J1VA 2YHVA 1KE8A 2EB3A 1I44A 2J50A 1CKJA 5C03A 4TYJA 4D55A 3GGFA 5BVEA 2C6MA 3NW6A 3EQFA 4IWPA 2X7GA 3IKAA 3GQIA 2HY81 2JFLA 3KY2A 2H8HA 4L68A 4NIFA 4L44A 4UBAA 3ZM9A 2O8YA 1NVSA 4CFXA 5F94A 3JS2A 4QMZA 5AA8A 3MH1A 4YJNA 4G31A 3EFWA 2QOHA 1MUOA 5AUWA 3QL8A 4FNYA 3NPCA 2OIBA 2CHLA 2VWVA 2WMBA 1H07A 3BV2A 4JLCA 4V0GA 3EMGA 5AX3A 2I0EA 1H0VA 2J7TA 4IMYA 2FSMX 4UB7A 3R8ZA 3K2LA 3HV4A 3ATSA 2Y4IB 2R64A 2UZOA 1YDRE 4PTCA 3W8QA 1UA2A 2HW7A 3ZYAA 4EOIA 3BHVA 4LMUA 4C4GA 1WAKA 4FSYA 5E7RA 3EIDA 4FKVA 4YLKA 4MXZA 2B7AA 3TNHA 2F4JA 2CN8A 5KMMA 1ERKA 3KMMA 4EHZA 5JQ8A 4E4XA 2FUMA 2XNPA 4LI5A 3RAWA 3ZSIA 5EKNA 3ORMA 3DAKA 2UW7A 2J4ZA 3HMOA 3L9MA 3VUDA 2XCKA 5KBRA 4IH8A 3MTFA 2XK6A 2XVDA 3C1XA 4J8NA 3G90X 4CZYB 4HVDA 2PZ5A 5IDNA 5IQBA 3FKNA 3BPRA 2GHLA 3OXIA 5J95A 1U46A 4O0RA 2QU6A 5EM5A 3FC2A 3PY1A 1PXLA 4XYFA 3HZTA 4ZTRA 5HIBA 4ZZMA 3IDBA 2PPQA 4MKCA 3M11A 2CCHA 2V62A 3S3IA 2BDWA 4F9YA 3VS1A 1V1KA 3FZ1A 4W4WA 2HWPA 3D14A 4Z9LA 4QQTA 4BZOA 4GYIA 2XH5A 4DEAA 4FSTA 4FIHA 4I5MA 4H3BA 5IEXA 4O1OA 2UW8A 3LOKA 2O65A 1IA9A 1MRVA 3FMDA 2ETMA 2ITUA 4CSVA 5CXHA 1M2PA 4ZTNA 3FXZA 4JI9A 4HVHA 4GU9A 4IIRA 2C30A 4W4XA 4XNEA 4UEUA 4DH5A 1Q4LA 5C27A 4E7WA 4CYJA 4AG8A 3HRFA 2BRMA 3MH2A 2PE1A 3VS6A 4FIIA 2PVRA 4LV5A 3RCJA 5T68A 3SRVA 1GIHA 3VS5A 3R04A 3PP0A 4HVGA 4XOZA 4G6LA 3RAHA 2R5TA 1ZOEA 3AXWA 2BFXA 3LXPA 3NAXA 1VJYA 5EI8A 4DFLA 4AU8A 5JKGA 2WMTA 3LLAA 1GNGA 4FOBA 4JRVA 5HNIX 5L6OA 3ZC6A 2OZOA 4QP3A 3P7BA 5L2SA 3HAVA 5M56A 5I9WA 4WHZA 2GSFA 2VX0A 2YA9A 3E3PA 3OROA 4U45A 3RCDA 4ORKA 3II5A 3I5NA 4X2JA 4FTUA 3D15A 3WF9A 4CKRA 2PUIA 3KREA 4FEWA 4RLKA 5CS6A 5CZIA 5FG8A 3WE8A 4ACCA 4DG2E 4EHGA 1O6YA 4LRMA 5DFPA 2FYSA 2C3LA 3U4WA 3AC4A 4QTAA 3UVRA 4O22A 3N4TA 3MJ2A 3LMGA 5IQDA 4WRGA 1GAGA 4RX5A 3DY7A 4D2TA 3W2SA 3C0IA 3QF9A 3CPBA 4CGAA 3SV0A 2XBJA 1MQBA 3Q2JA 1ZARA 5IQAA 1Q8TA 2W1DA 1H27A 3DJ7A 1TQIA 4FSZA 2PUPA 2O63A 4C0TA 2P3GX 4F9AA 2XEYA 2XNBA 3FI2A 4ZLZA 4Z7GA 4XG2A 4G6OA 1JAMA 3DTWA 4BDAA 5E92A 3OFMA 4QTCA 3RALA 4DCAA 2RFDA 4F0IA 3C4ZA 3LXLA 3QRIA 4JNWA 3R1NA 3TKHA 3F5UA 2Y8OA 3SC1A 4YPDA 2JDTA 1LPUA 3OWKA 3GFWA 3F3VA 3ANRA 2WTVA 3GC8A 4QP4A 5HNBA 1K2PA 4NU1A 3NMUF 4FKTA 4E5BA 5IQHA 3ELJA 1ZZLA 3UDBA 4QMWA 3AT3A 3L9PA 2P33A 3A61A 5FD2A 2HIWA 3RHXA 3PDTA 3FBVA 2ZJWA 5DT0A 3W10A 2PUNA 2J9MA 1UNGA 3HDNA 4BB4A 1H08A 2UZVA 1ZAOA 2XJ1A 3DK6A 2YM4A 3DLSA 2B53A 3CKWA 4FTAA 3RK9A 1OB3A 4F1MA 2BTSA 4BCNA 2ITPA 4G3FA 2JIVA 3VJOA 2PZYA 3I6UA 3NX8A 3QFVA 1YQJA 2C47A 5EQPA 5F9EA 5J9LA 2R3FA 3QLGA 4M3QA 3R6XA 4FT0A 3A62A 4IADA 4NL0A 4FVRA 3BQRA 3TWJA 3SGCA 2ITYA 4P4CA 2BRBA 4HNIA 5IPJA 4BTKA 4YHJA 3FMHA 3BHYA 5HTCA 3HEGA 4FL1A 4EOOA 4QP9A 3R63A 2YIRA 1UV5A 4R3RA 5DWRA 1IEPA 2BIKB 3CS9A 4E4NA 2WMSA 3C5UA 1PXKA 4U40A 3R9HA 4ZTLA 2YAAA 5D1JA 2H9VA 3HYHA 2FH9A 4IB5A 2JBOA 1M2QA 4D2VA 5HE0A 3PVGA 4X21A 3D7TB 5E90A 5FTQA 3IOPA 4AZSA 4IB3A 4YO4A 4IJPA 4ZXTA 2E2BA 5CAQA 4BY9E 3WZKA 3QTRA 3NSZA 3EQIA 4GSBA 3TZ8A 4PP7A 4YSJA 4PTEA 4GG5A 3AD4A 3I7BA 5EH0A 4E6DA 3H0YA 3AOXA 4XRJA 4EK8A 4B9DA 3REPA 2WMRA 4KUJA 3NRMA 4EUUA 4WG5A 2EWAA 2F57A 4WG4A 5K9IA 2B52A 5DI1A 4UWYA 1OITA 4KA3A 2RG5A 4I1ZA 5BVKA 4BDKA 5ANIA 3MSSA 2C68A 3R02A 4EH7A 4I23A 2HZNA 3OOMA 3A8XA 1MRUA 3GCVA 3AD6A 4D1SA 3O51A 4Q9SA 4BRXA 3CPCA 4FV4A 3U6IA 4ZTMA 3DXPA 2V22A 5IQCA 1B6CB 2HK5A 3KK9A 4UY9A 3FE3A 5EFQA 2YEXA 1JSTA 4ONAA 4IVAA 1YW2A 1W84A 3RHKA 3TZ9A 2H96A 4FL3A 5I9UA 5FEDA 4J97A 4EWHA 4YU2A 1OUYA 5IF1A 4U5JA 4DLIA 4F99A 1A9UA 3PSCA 5E8XA 4NCTA 2JDRA 4FTIA 3GC0A 5LWNA 2P55A 4RG0A 3MA6A 4R6VA 4FT3A 4FUYA 4IM3A 5CEQA 4F7LA 4JDHA 4O7WA 2X1NA 3E8EA 3QU0A 3TV6A 4WSQA 1JPAA 2PE0A 3UOHA 5C8NA 4YPSA 4FEUA 2F7ZE 4FK3A 1PW2A 3TUCA 5JEBA 4UYAA 1W82A 3UYSA 5A54A 1JKTA 3QCXA 3EYGA 5ANEA 3UGCA 3D7ZA 4NEUA 3QD3A 3R8LA 4C62A 3MFUA 4APCA 4O7LA 2B4SB 3CIKA 3A7FA 3OT3A 3QBNA 3ENMA 1WZYA 5HTIA 2X4FA 1WVWA 3O96A 4B0GA 5HD4A 5AR8A 5HTBA 4NT4A 3AC2A 4C4IA 5AR7A 4DFUA 2XJ0A 5C8KA 1O9UA 5L8JA 3QXPA 2BZJA 2W1FA 3UZPA 4FR4A 4QYGA 3ZBFA 5K3YA 2WMVA 4RIYB 4WO5A 2JEDA 5DRDA 5M51A 4FOCA 3ULZA 2YM6A 3PLSA 3BI6A 4QRCA 2E9VA 4LMNA 4EC9A 2ZV2A 4C57A 3R00A 2RFEA 4TNBA 5A4TA 5AUYA 3ZRLA 5I9ZA 4QMTA 1BKXA 3RVGA 3LFCA 3NAYA 2V7AA 5IQFA 3A8WA 5FRIA 3FLQA 3VQHA 4E6AA 4MQ2A 3E8NA 4RIOA 4ZTSA 3VHEA 5CVHA 3QTSA 3VW8A 3UP7A 4BF2A 3MWUA 4LOOA 3E7VA 2X9FA 4C35A 3U55A 3EJ1A 5AM7A 3W33A 1H1WA 3GI3A 5HVKA 2CKOA 2PMOX 1ZMUA 1QPCA 3D83A 5TT7A 3VNTA 4QTDA 3Q4TA 4TKSA 3UOLA 5CF5A 4DHFA 1GZOA 4D5HA 4FV0A 3TN8A 4BYIA 4FTMA 4EH6A 4G5JA 4LFIA 1OPLA 4XUFA 3NVKI 1CSNA 2VWBA 4QMXA 4AFJA 4HGLA 4XOYA 2WQEA 4PDYA 4U79A 2GQSA 3CQEA 4EK3A 4CZUA 2C6TA 1M2RA 5DNRA 3V51A 3NR9A 3ZDIA 2OJ9A 4PRJA 2OH4A 1S9IA 3TT0A 3FXXA 5D10A 2QHMA 3NUNA 2R3GA 4RJ6A 4FIGA 4E73A 5J7BA 1FBNA 1OL6A 2QU5A 4GT4A 4X2GA 5FDXA 2A1AB 5AR4A 4FKGA 5CX9A 4KIKA 4KD1A 5HX8A 3KMWA 3LLTA 3IQ7A 3PA3A 2OZAA 3QALE 1V0BA 4FODA 4I6FA 4XBRA 5T6KA 3P23A 4IWOA 4BDGA 2HENA 4Y5QA 1CMKE 3C4WA 3LCOA 3LFDA 3F2AA 3RK5A 4ASXA 3OTVA 5HU9A 3R1YA 2OW3A 3UP2A 3QTXA 2OBJA 3W18A 4N6YA 3QTIA 5JN2A 1R1WA 2HCKA 2QD9A 3F2NA 5AAGA 1REKA 4C2WA 3R7YA 4ANOA 1PY5A 4KS8A 4USEA 3LMHA 2X8IA 3ZLYA 1STCE 2O2UA 2R7IA 5ETCA 5HLNA 4J99A 2A4LA 2GPHA 4IACA 3FI4A 1YDSE 3UO4A 4CFFA 2H34A 2R9SA 4FA2A 2XYNA 2IVVA 2BR1A 3PIYA 4CFUA 4GJ2A 3LE6A 4DGNA 2VTLA 4Y95A 4HW7A 4HCUA 3C0GA 4BIBA 3KF4A 3SW4A 3JYAA 4RVTA 3TNPC 4DEEA 5J79A 4L67A 4QNAA 3LW0A 3Q04A 2I7QA 3LVPA 3E8DA 3PYYA 4G3CA 4C2VA 4C4JA 3LM0A 3ORNA 4KNBA 4G17A 5M4UA 2RFSA 3Q5ZA 2WQBA 3MW1A 1M52A 1XH7A 4O0YA 2XK9A 1Q3WA 2C6IA 1ZYLA 5K0KA 2WMWA 5CNNA 5IKWA 4LG4A 4BCIA 2PYWA 1AQ1A 3BBWA 3R1QA 4WUNA 5HG8A 2J5FA 4EJ7A 3S00A 4IX4A 5DRBA 1Y57A 3LQ8A 4XLIA 4N6ZA 3ZUTA 2WXVA 4NFNA 1JSVA 2BIYA 4UX9A 3FV8A 2R3NA 3U9CA 1YHSA 4FTOA 4JIKA 4YJSA 4Z16A 3FZOA 5AP6A 2GHGA 3BHHA 3I60A 4DGGA 2HOGA 2WD1A 4TXCA 4LM5A 2ZVAA 4CVAA 5EHLA 4IANA 2WGJA 3ZRKA 4CFNA 4NK9A 2Q0NA 3BYOA 2VO6A 3HV5A 1YOLA 3A7JA 3QKLA 4BTMA 3I0QA 3LJ0A 4GKIA 3SD0A 5AEPA 1UNHA 2FSTX 3FQSA 2YITA 3COHA 5DH3A 4FK6A 1E9HA 3ZFMA 4AA5A 4OTHA 2C1AA 3QZHA 3QAME 3RNIA 4EOQA 3ZC5A 3KULB 4QPSA 3F6XA 4HOKA 4FIFA 4DTBA 5HLPA 2BROA 3PXRA 3QKKA 5DIAA 5GZ8A 4M67A 1PYXA 5HNGA 4HGSA 3E7OA 4I22A 5EK7A 3VS3A 4CLJA 4A9UA 1U4DA 3V8WA 4QTEA 5HORA 3OXZA 3W1FA 5LVNA 4EI4A 4BIDA 4O2ZA 5KO1A 4ALWA 5KMJA 1U5RA 1SNXA 3U4UA 3HMIA 4JDJA 2WMUA 3KRWA 3DS6A 3Q9YA 4F7JA 3RBWA 2Z2WA 5AJQA 1PYEA 1IR3A 2NO3A 4O81A 4EKKA 2XNMA 4JBVA 4AN3A 4BDIA 2B0QA 4YTIA 3DU8A 1H01A 1R0PA 2NP8A 5F95A 3EN5A 3RZBA 4D2WA 5DHJA 4H05A 2VWUA 4ITJA 3HLLA 5A4EA 4YBKA 3DBQA 3EQDA 3L9LA 1WBSA 4TWCA 4TYEA 5ETFA 1J1BA 2WQMA 5HGIA 2C3KA 4DFYA 5L3AA 1MQ4A 5EQEA 4RJ8A 1U54B 4ZTQA 4GMYA 3NUUA 3NGAA 4FV9A 4MWHA 2G2IA 3OEZA 4UN0C 3KCKA 5FGKA 3CC6A 2OLCA 3VHKA 3UIUA 3MDYA 4BDHA 4XCUA 4D0XA 2BVAA 2X8EA 3QTZA 2ETKA 4S32A 5FDPA 3C50A 4EONA 2PVLA 3VN9A 3SDJA 4I4FA 5CU2A 4F7SA 5LVOA 1M17A 4ZSEA 4Q2AA 2AC3A 2W5HA 3Q9WA 5DOSA 2CGWA 2YCQA 4QYEA 2PVKA 3TG1A 2VZ6A 4TYHB 2BKZA 3HECA 4FSQA 2YM5A 3ET7A 5AUZA 1YXUA 5EW8A 4ZJJA 3TJCA 4Q5EA 1REJA 1BUHA 4MF1A 5ANOA 5I9YA 2QCSA 4PY1A 4AUAA 4UALA 4KKEA 5EHYA 2ZM3A 3G9LX 3LHJA 2XJ2A 1KUTA 2PHKA 4O6EA 4FIEA 4R7BA 3OEFX 4UWBA 2PMIA 2RFNA 3KA0A 3QXOA 3DTCA 1Z5MA 3C0HA 3TNWA 2G9XA 4C33A 4MD9E 2R3JA 4EOKA 4IAKA 2EXEA 3NVMB 3QGYA 3ZZEA 2BRHA 4PQNA 2HWOA 2J0MB 5EQYA 3ZLSA 2PZRA 3W2RA 3GENA 2G2FA 2OKRA 3DB8A 4NFMA 2ZB0A 3Q32A 2XB7A 3BU5A 4YHTA 5EI6A 3OWPA 4RJ4A 1H0WA 1FMKA 1PMNA 3PWDA 4XG6A 4D5KA 2Z60A 4C4HA 3CSVA 1DS5A 3BGQA 1OKVA 4FSNA 3OVVA 4YJTA 4CT2A 4CG9A 4QMSA 4YC3A 1QPDA 5FBNC 4BBEA 2BZKB 4IW0A 4GK4A 4L7SA 5GJFA 4R8QA 3BGZA 1MRYA 1F0QA 2YM7A 4FTQA 4ZIMA 4CCBA 4NM7A 4CTBA 3FHRA 3AMAA 3BWJA 5CEPA 4ENYA 1Q61A 2OI4X 1LEZA 4RVMA 5EW3A 3RTPA 5IMEA 4N0SA 5LJJA 4IAAA 3EKKA 3GFEA 2WFYA 4AT3A 2VAGA 4W4VA 1WBWA 3BLHA 2GMXA 4IXPA 3MFRA 4W4YA 5J1WA 2R3QA 2QLUA 5IH4A 3A99A 5DBXA 3B2TA 4UZDA 5C8MA 5FEEA 3DAEA 4H1JA 2X2KA 3MVLA 4I20A 3FJQE 4WNMA 4E1ZA 5DR2A 1IRKA 2ONLC 3LJ1A 4FTLA 3GC7A 1FINA 2YJRA 3G2FA 3UO6A 4PF4A 5C9CA 1J7IA 2QG7A 4KRDA 3LZBA 4X2KA 2WTKB 3BGPA 3R28A 4QMPA 5ITAA 4G1WA 4M69A 3UIXA 4DG0E 2OXXA 3GCQA 3LQ5A 4AZTA 4QPAA 2VV9A 4CFVA 1R39A 5L2WA 4FZAB 2B9IA 2FSLX 3I7CA 3FL4A 1ZLTA 3RPVA 2ITXA 2QODA 3GUBA 3TDVA 2YLFA 3BU6A 3KKVA 3MFSA 4YJPA 5JMSA 3DXQA 3DZQA 2W9ZB 3VBXA 1ND4A 3L8XA 5HX6A 3O71A 4K1BA 5CI7A 4K33A 4DGOA 2BALA 2BRNA 4O0SA 3R8MA 4IVCA 3W2PA 1M7QA 3CTJA 4S30A 4AZFA 4YMJA 4UMUA 3VUMA 5BVFA 4XV1A 3ALNA 4ZLYA 4O7NA 4M15A 4DITA 4RIWB 2PSQA 4TY1A 3ITZA 5AP7A 4C3FA 4YTFA 3PE2A 3FYKX 4IZYA 2IJMA 1E1VA 4QYYA 5KMKA 1JLUE 3EN7A 3NS9A 4PX6A 3UZTA 2O5KA 3ODZX 1J7LA 2FGIA 1OKWA 4QOXA 2WEVA 2ITTA 3O0GA 4I6BA 4RIXA 4Y73A 4LUDA 4L6QA 5HG9A 4B99A 1DI8A 5KKRC 3V5PA 2WTJA 2XUUA 1YI3A 3G0FA 4EKLA 1H8FA 1CKPA 3QQUA 4BGHA 4FT9A 1W83A 4BI1A 1JBPE 2BDFA 2H6DA 2G2HA 5CVFA 4PWNA 4DFZE 4GW8A 3PLAE 4L53A 3DJ5A 3C4FA 3QC9A 1RQQA 5KUPA 3VBTA 3MH0A 3PPKA 2WQOA 3H9RA 5J5SA 4LV8A 3QZIA 2BILB 3ZEWA 4CCUA 2YDIA 3I4BA 4OTPA 4GH2A 3FLNC 5AP3A 3QX2A 4KIQA 3KRXA 4EOSA 5LOHA 1JQHA 3EQGA 4TNDA 5EI2A 4NM5A 3V01A 4AQCA 3EFLA 4JBPA 2JITA 3E3BX 5D11A 4G2FA 3VUHA 3CKXA 4ZLOA 4I0TA 2P0CA 4RMZA 5I5ZA 4HNFA 3TZMA 2C1BA 1CTPE 4JG6A 2CMWA 3KB7A 5CEOA 3KXXA 4D4YA 5B0XA 2NPQA 1GOLA 5KZ0A 2VTNA 5B7VA 5BUIA 3TKUA 2QOBA 4A4LA 5DYJA 1XO2B 4EQCA 1UKHA 2J90A 3Q52A 4GCJA 4KRCA 3AGLA 2UVZA 2HZ4A 4FT5A 3UIBA 5JGAA 4BYJA 4O0XA 2VTPA 3UC4A 2ZDTA 4ZY5A 3CE3A 4FG9A 4CTCA 5AP1A 2CLXA 4FV6A 3WZJA 3IONA 4FV5A 4O2PA 2UVXA 2VRXA 3PE1A 2QOLA 3QYZA 3O7LD 4O0WA 5CSXA 2W96B 2BAJA 3G5DA 2YIYA 4ZSGA 3QX4A 3RP9A 1QPEA 4BDDA 3TUDA 4FV1A 1A48A 3FEGA 4NWMA 4HCVA 5TE0A 3P4KA 1OL2A 4RGJA 1YWVA 3IGOA 4FGBA 4C7TA 4D2PA 3UTOA 2QKWB 2R3HA 4I94A 3OTUA 3GT8A 4I41A 2A27A 3WZUA 3D94A 2IVTA 3NYOA 1ZRZA 3ATTA 4AF3A 4ASZA 4FC0A 4C37A 3LCKA 5CSHA 1NT2A 3IECA 3CTHA 3COMA 1KE5A 4AAAA 2VTHA 4PTGA 4EORA 3RGFA 4AZVA 1Z57A 3HGKA 5L2IA 5K5NA 3KGAA 2YJSA 3KK8A 4WBBB 2V0DA 5EYMA 3V5WA 3BX5A 2YERA 3WF8A 3LKMA 2WMXA 5CSWA 2WNTA 2GS7A 2FB8A 5DEYA 4AOTA 3UOKA 4Z55A 3ACJA 5IU2A 4FKJA 3TKIA 4FKWA 3RJCA 3PG1A 1FMOE 1R0EA 3QRTA 3V5TA 4O7VA 4EWQA 2J0JA 5KCVA 4X0MA 2IN6A 5FXRA 3NUSA 3IW8A 4P2KA 5D7AA 5EDRA 4NW6A 4F08A 3QCQA 3BEAA 4RSSA 2I1MA 3HRBA 3GU7A 4FUXA 1PXJA 2RSVA 4U43A 5ANKA 3GU6A 3C9WA 5JQ5A 4L45A 5IDPA 3NYXA 3ORKA 4HJOA 4FI1A 4F6UA 5DEWA 1OL1A 1V0PA 4MH7A 3HRCA 1KWPA 1NW1A 3SXFA 1XHAA 3GCSA 2C0OA 5CVGA 2VWWA 2CDZA 3B8RA 3LFNA 1VEBA 3R0TA 1QL6A 4OTQA 5I3OA 4RFMA 1PF8A 4L9IA 4X2FA 5K4JA 4FSMA 1JVPP 2F7EE 2ZB1A 3CD3A 3R2YA 5AUTA 3KC3A 3C51A 3EN4A 3LM5A 4O0TA 2ERZE 4BCKA 3GU5A 4AW2A 2IG7A 2OJGA 2OJJA 4UV0A 3SHEA 4PL5A 2ZV7A 2PVYA 4I6HA 1Q3DA 2YDJA 3NUPA 4F70A 5LXMA 2P4IA 5IUHA 2WQNA 3LCSA 3QTWA 2VX3A 3T8OA 4WA9A 2B54A 1Q8YA 3HX4A 5M44A 4U41A 5AV1A 5A4CA 1PMUA 4ALVA 2WOTA 2W4JA 4IWDA 5KBQA 5IQIA 3GCUA 4W9WA 3E8CA 3QRUA 5M57A 4O82A 2X81A 4EBWA 3VWAA 3JVSA 4IZ7A 4F6WA 2IZUA 3MH3A 1W8CA 1V0OA 3JUHA 4RVLA 5IA3A 4NYEA 4GS6A 2QURA 4JS8A 4L00A 3AQVA 3FI8A 3S95A 5TF9A 3UMXA 4FZFB 4EYJA 1OBDA 2XK7A 5TKDA 4IAYA 5GJGA 5GINE 4S2ZA 2J2IB 3QHWA 2JIIA 3A2CA 4A9RA 3FSKA 4I5PA 5IH5A 4J95A 4N70A 3MI9A 5HVYA 5CYIA 1PHKA 3SX9A 3D2IA 3OXTA 3R7VA 2R3LA 3ZCLA 5CU3A 4RPVA 3UMWA 4ZSAA 4YC8A 4FMQA 3UG2A 5JK3A 3DBFA 3SXRA 3GOPA 4G5PA 2QKRA 1OPKA 4PMPA 3ORPA 2WPAA 5L8LA 5BVWA 5AUUA 3DT1A 3FZPA 4QMUA 4MX9A 4MNEB 2XP2A 4PDPA 4AXAA 3QQHA 2C6DA 2HXQA 1FVRA 4YZBA 4OLIA 3OW4A 2BAKA 5BVNA 2X6EA 4DFBA 3P08A 4E8AA 2LGCA 3MA3A 4MAOA 4CV8A 2PU8A 2IW6A 3HVCA 1ZYCA 2UV2A 3PXZA 2VO3A 3GXLA 4P90A 2GFCA 4YJUA 3Q6UA 3TUBA 4R77A 1XBCA 5BQ0A 4M13A 4E93A 3R2BA 4LGDA 5CAPA 2J5EA 1APME 3PJCA 4O1PA 5KMIA 2W4KA 4K9YA 1HCKA 1PXMA 4LOPA 3EL8A 3FI3A 2OXYA 3TACA 2XNEA 4HCTA 4NH1A 4UMTA 2F2CB 4EOPA 4HGTA 4YNEA 2R3MA 3QD2B 5TR6A 1UU8A 2BTRA 3F3WA 2WU6A 3IDCA 3QWKA 4GUBA 3AT2A 2B1PA 4AOIA 3DBDA 4D4SA 3QC4A 4XX9A 5A4QA 1H1QA 2YM3A 4BCFA 2W9FB 2DS1A 4FVPA 3ZMMA 4D1ZA 1NA7A 2WELA 4FTCA 3CD8A 3R30A 3EYHA 3MVHA 2QOFA 4R1YA 4UXQA 4J52A 3QQLA 2UZTA 3DBCA 3PIXA 2AYPA 4OTRA 4QYHA 3HUCA 3OMVA 4Y5HA 4TTHB 3NW5A 2W99B 4J71A 4HYIA 4QMMA 5C01A 4D58A 4QT1A 4IDTA 1HOWA 3V8TA 4NTSA 1JNKA 1UKIA 3FHIA 4EH3A 5FUTA 4C38A 3R7OA 2Y9QA 5GZAA 4K0YA 2UZWE 4CNHA 4ACGA 5E1SA 4D28A 4R5SA 2W4OA 3MY5A 4TPTA 5AIKA 3WF5A 3NNVA 5KHXA 4L3JA 1G8SA 3QA0A 2FVDA 1Q97A 3FMKA 3M1SA 3VS4A 3F5GA 2E9PA 4A9TA 2VN9A 3HV3A 5H3QA 3ANQA 3QQGA 4AZEA 5J7HA 4O7TA 3LFBA 2UZUE 4E5AX 3KXGA 2WAJA 2B9FA 3BLRA 2WIPA 5CQUA 1LEWA 4I5CA 1M7NA 3FZTA 3Q4CA 2CGUA 4CKIA 3VIDA 1KOBA 5ICPA 5BMMA 5AFVA 4BKZA 4UZHA 2QOKA 1ZYJA 4BDFA 2VWIA 2WOUA 4JR3A 2PL0A 3NYVA 3F3UA 3D7TA 4EOJA 2YACA 2QOQA 2X0GA 4QP2A 4WSYA 5I9VA 4OTGA 3MVMA 4IX3A 2CNUA 3JVRA 3SG9A 2IZSA 3GEQA 4WG3A 4RX9A 2UW4A 4CEGA 5JFXA 1SNUA 2VTIA 3AG9A 3UVPA 2YCRA 3WZDA 4CZTA 1DAWA 4LRJA 5AX9A 3TXOA 3CY3A 5L2QA 3EHAA 2PVFA 3FMMA 4L8MA 4X3FB 4DTKA 5H9BA 4JT3A 4IVBA 3KXZA 4FBXA 4LGGA 1Q24A 3SOAA 3DKFA 4ANBA 4GG7A 2EVAA 4M7IA 3QA8A 4JDIA 4H3QA 2QR7A 2Y4IC 3DKOA 3DFCB 3QTQA 4FF8A 1IG1A 4BC6A 4XV2A 4Z3VA 4NM3A 4DC2A 1RJBA 4O7SA 3FLSA 3MB6A 1YDTE 4IFCA 5EOLA 4XG3A 3KVXA 4GFGA 3Q9XA 3SVVA 4U9AA 4U8ZA 2BCJA 1WVYA 2HYYA 2JKQA 5HCXA 3VC4A 3QHRA 4QMNA 2WO6A 1UWHA 3AC3A 3OHTA 3RPRA 4F6SA 3SG8A 5E8TA 4M8TA 3MB7A 2E9UA 4OTWA 3IW7A 4GK3A 4AGCA 3FMNA 1FVVA 2OWBA 1K9AA 3POOA 4MEDA 4R7HA 4E4MA 1TQPA 3N51A 1UU7A 3EQHA 3HDMA 4FKRA 4A4XA 3G51A 4FV3A 4EZ3A 3LXNA 3E63A 2NRYA 5CY3A 3R9RA 1FGKA 2PK9A 4QQJA 3V5QA 4MXCA 5LVPA 4I5HA 4CMUA 2ZMCA 1U5QA 1KSWA 5IEYA 4M14A 4DCEA 5L6PA 4TWPA 4F1TA 5GZ9A 1ZY5A 4PPAA 3FKLA 3NNWA 4QP6A 5EDQA 5HCYA 3WIGA 3C7QA 3LFFA 4Y85A 3VS7A 4XLVA 3WI6A 4BFMA 4FKOA 3P78A 2C6LA 3IW5A 4FT7A 4K8AA 5AUVA 3V04A 5AADA 4L7FA 1SZMA 3CGFA 4RJ3A 1B39A 4FSWA 4JL9A 5FBOA 4EOMA 3FL5A 4D4RA 2PVNA 2KULA 4ZS4A 5CASA 3LIJA 2ONLA 4RIYA 4ZSJA 4IBMA 3WIKA 3R9OA 3VAPA 2OXDA 4USDA 3FPQA 4FSUA 3RKBA 3Q6WA 4KSPA 2HZ0A 4MHAA 3KRJA 1QPJA 3MPMA 3AGMA 3K54A 4E6CA 3D5XA 3MV5A 3AMBA 2NNWB 1IA8A 1WFCA 5FXQA 1SMHA 5IQGA 4CFMA 1PKDA 5A6OA 1KV2A 3QUDA 3LCDA 5H8GA 4DEGA 4EZ5A 5J9ZA 3AD5A 4TZRA 3AMYA 2JIUA 4RFZA 5GNKA 3UBDA 4AE9A 4EUTA 2PULA 3PSDA 2IO6A 4BDEA 4WNKA 3VQUA 3IGGA 3QZFA 1DAYA 1Y6BA 4O7ZA 3ZBXA 4TT7A 2G1TA 2QC6A 4IAFA 3TIYA 4NSTA 4F64A 4TW9A 4GIIA 2JBPA 2XEZA 4G9RA 4WT6A 5JRQA 3ZO1A 3HUBA 1G5SA 4YZ9A 3VUKA 2XK4A 4GU6A 3ZDUA 1BYGA 1XH4A 4YZMA 3C4CA 2C0TA 4IC8A 3GU8A 2C5NA 3EB0A 4EZ7A 4FKSA 1CDKA 2Q0BA 3QGWA 3ULIA 3F69A 1BMKA 3BV3A 3WE4A 4FEXA 4M97A 4GT3A 3NW7A 4RA5A 4YO6A 2PVHA 5A6NA 3NCGA 4IHPA 3F5PA 3QWJA 5LARA 3WYXA 4V01A 3O8PA 4JVGA 3DFAA 4GVAA 2GNGA 3DLZA 3P1AA 5ACKA 3C13A 4L43A 3MIAA 2XM8A 4IE9A 3NDMA 3IPHA 4QMOA 3WARA 2W05A 3PWYA 4YLJA 1YXVA 1XQZA 4GV1A 3K5VA 5AV0A 4G3GA 5AP4A 2J6MA 4EHEA 5FLFA 2G15A 4O84A 5LWMA 1OIYA 4RQKA 4QMVA 4X3JA 4OGRA 4DTAA 4ZY4A 4JX7A 5M09A 3ZEPA 5KHWA 4CRSA 3UODA 5HESA 4JQ7A 4K77A 4CFWA 2WMQA 2F49A 3DKGA 4RWJA 2XMYA 3BIZA 3JY0A 3EN9A 4KWPA 4XG4A 5EG3A 5HICA 3ZUVA 5BNJA 2VTJA 1G3NA 2CKPA 4O83A 1YHWA 2J0IA 4B8LA 2VGOA 3GP0A 4JQEA 1YRPA 3PZEA 5CQWA 4ZS0A 5CEMA 1WBOA 4OUCA 3LAUA 3O17A 2OH0E 5CI6A 5E9EA 1W98A 3QD0A 5EM6A 2WTDA 4KBCA 2I6LA 4MBIA 3PXKA 3ZSGA 4HZSA 5KMLA 4DGMA 2PWLA 4MTAA 3Q4UA 3ETAA 5EM8A 4JBQA 4QNYA 5ETAA 3U9NA 1VYWA 2IZRA 4LUEA 4U0IA 4PV0A 3ZO2A 4W8EA 5C1QB 2JLDA 3PJ1A 4BI0A 4BZNA 3COIA 4TL0A 3BZ3A 4FZ7A 2PVJA 5HIDA 1Z9XA 3DK7A 4FNZA 2ZM1A 4W8DA 5I0BA 4IX5A 4O7YA 3ROCA 3U54A 4ITHA 3Q60A 3E92A 4NKAA 4MQ1A 4MWIA 4GFOA 1YXXA 3FQEA 4I0SA 2WTCA 3LFEA 4DEIA 5BMSA 4XV3A 4HPTE 2X9EA 5AIRA 5HE3A 3QZGA 5KMNA 1OL5A 3OY1A 4FKUA 4EK5A 4O91A 4LYNA 4XG9A 4U3YA 2VTSA 4FIJA 4ZY6A 3L1SA 4FG7A 3EQRA 4M12A 5A4LA 4NJDA 4IVDA 4Y72A 2UW0A 4D1XA 3ZH8A 4FZDB 4AT5A 3BWFA 1PXNA 5DT4A 3FLYA 4IAIA 3SKCA 2CLQA 2ERKA 4MXAA 5HIEA 2GS2A 4E26A 5HEZA 4RA4A 4X6RA 4HYHA 4TYGA 1Q8ZA 3EH9A 4DH7A 3FMEA 2Y7JA 2Z7LA 2UZDA 3QCSA 3IOKA 3DDQA 4ITIA 4CYIA 3BQCA 2ETRA 4XP2A 4G34A 5HQ0A 5IA2A 3I6WA 3F5XA 4BHNA 3S0OA 4BGQA 3OCSA 2BPMA 3DXNA 3H4JA 4G9CA 5JZNA 3FYJX 2XK3A 3SXSA 4PPBA 4QMLA 4XS2A 4HGEA 4JG7A 4RC3A 4ZEGA 3VO3A 2W5BA 1BL6A 4FKPA 4QYFA 5IA1A 1PXPA 5GIPE 2HELA 3BEGA 3KULA 5HLWA 3POZA 3FY0A 5F1ZA 2BFYA 2Y6MA 3ZXTA 2V7OA 1MP8A 3DCVA 4C02A 4B4LA 4NW5A 5JZJA 1PMEA 3VULA 1H26A 4MD8E 3G15A 2HY0A 2XYUA 1HCLA 2F9GA 3FLZA 3KU2A 3KXNA 3VF9A 1OZ1A 1UNLA 2QOCA 5M08A 4ZOGA 2JKKA 3FXWA 4XRLA 2X4ZA 2JAMA 1FOTA 1URWA 1FVTA 4CKJA 4IJ9A 3R8UA 5E4HA 5A3XA 4MBJA 3HP5A 4EQMA 4CQEA 1TKIA 2GQGA 2GU8A 2ITOA 3OS3A 4IX6A 4M66A 4BWKA 2A0CX 3F82A 3I5ZA 1M14A 5AP0A 5M4FA 5CLPA 5DPVA 4RWKA 5AP2A 4BBFA 4BGGA 1J7UA 2CKEA 4C4FA 5EM7A 1A06A 4BN1A 3MPTA 4I93A 4IB1A 4DH1A 1U54A 5G6VA 3T3UA 1F3MC 5DVRA 3PVBA 1H00A 4ANNA 5IA5A 5AV4A 5HBJA 4BDBA 3U87A 3OOGA 2WB8A 3ERKA 3RINA 2QONA 5DMZA 2OU7A 4Q9ZA 3DK3A 3GVUA 4DT8A 2RGPA 3BYVA 3ORTA 4ZMFA 1S9JA 2QOOA 2YWPA 5CEKA 4NIFB 4GFMA 1LUFA 2F7XE 4KIPA 4TYHA 5JFWA 3UJGA 1XH9A 2X7FA 2ZV8A 3IK3A 2PUUA 3OZ6A 2GNFA 4EL9A 1ZY4A 1EH4A 2CGXA 3CJFA 3FY2A 4RBLA 1JSUA 3ZTXA 2OFUA 3H9OA 2W1GA 3PXYA 2Y4PA 4RWIA 4YTCA 5BUJA 4XEYA 3CGOA 3HA8A 3R21A 4LGHA 4V0GB 3F7WA 2O64A 2ITWA 2YCFA 4XP3A 2R3OA 2YZLA 4QP1A 1Q41A 2EXMA 3JY9A 4G3EA 4M84A 1LP4A 4YZCA 5FQDC 5L2TA 2ITNA 2CJMA 3CEKA 2OIQA 2BZHB 4DN5A 2J0LA 2BKKA 3GOKA 3IW4A 3NUYA 3JPVA 1XJDA 3CQUA 3RWQA 4YJOA 4WKQA 3RAIA 4LL0A 2RG6A 5J9YA 4F4PA 1QCFA 5K0XA 5KE0A 3MFTA 3PRFA 2ACXA 3RM6A 2P2IA 2BRGA 4FV7A 5LMAA 3VBYA 3QRJA 4BICA 2Z8CA 3BRBA 4AP7A 5DGZA 1BL7A 3DBEA 3DZOA 5LMBA 3KMUA 2Z7QA 4X2NA 3FZSA 3VS2A 3P9JA 1R3CA 2Z7RA 3BE2A 3PG3A 3MS9A 4UXLA 1OVEA 3RMFA 3PXFA 4V04A 4FL2A 4AW5A 3LXKA 3F61A 4FTJA 2E9OA 3FMLA 5M07A 2HXLA 3CQWA 4JOAA 3IS5A 4HYSA 4IAZA 4BWPA 2IVSA 2YAKA 3DAJA 5C4LA 4S31A 4O7RA 2CPKE 1YI4A 3FWQA 3P86A 4H39A 1OUKA 4M68A 2DQ7X 2UW3A 3OWLA 2XF0A 3BHUA 5EW9A 3OG7A 2VU3A 4AGUA 3G9NA 3N9XA 1GZNA 5D9HA 3S4QA 5I4NA 1YOMA 2CSNA 1OIUA 3G6GA 5HBHA 3VVHA 4APPA 4EQUA 5JH6A 5K4IA 4Z7HA 3R22A 4DF3A 2ZDUA 3HMMA 3B8QA 4GRBA 4F0GA 1CKIA 3SRVB 1OKZA 4RT7A 5C26A 1RE8A 4KB8A 3A7GA 5HU3A 4BIEA 2ITZA 2Z7SA 3IDPA 5IA0A 1Y6AA 3GB2A 3KXHA 2WEIA 4GL9A 5CSVA 4YP8A 4BL1A 5IEVA 3D9VA 3T9TA 5AUXA 2ZYBA 1XH8A 4DEHA 2V5QA 4MXOA 4BTFA 4AA4A 2UW6A 3MYGA 3OT8A 1JKKA 1FPUA 2UW9A 3OBJA 3QUEA 4IDVA 1SVHA 1KOAA 4ANLA 2G01A 2GCDA 4EK6A 3WBLA 1E1XA 4U42A 3U6HA 2GTNA 1IASA 2QO7A 3NYNA 2GNHA 3KFAA 3L8SA 3ZM4A 4O21A 4F0FA 4CMOA 4H36A 4J1RA 3UQGA 3R71A 4ZAUA 5TOZA 4BDCA 4QMYA 4F9WA 4IM0A 5J8IA 4PL4A 2XZSA 2GFSA 3FC1X 4RRVA 3VRYA 3MESA 4OW8A 5DN3A 3E64A 3BYSA 3GQLA 2YLEA 4G16A 3Q3BA 4LL5A 1OIRA 5D12A 1PMVA 5AR5A 4CMTA 4MK0A 3O8UA 4O27B 3KL8A 3RPOA 4DGLC 5HCZA 4RJ7A 4RIWA 3F3ZA 3VW6A 2W1IA 3GC9A 4FVQA 2F2UA 2DWBA 2BHEA 5G1XA 4DA5A 4QQ5A 4U97A 3V6SA 2AUHA 2X2LA 3DNDA 4JRNA 4B6LA 2JC6A 4L3PA 3G6HA 3TJDA 4R78A 5HE2A 1UVRA 3PJ3A 2XIRA 4LQMA 4BCOA 4GUEA 3V5JA 3R1SA 1IAJA 4MCVA 3RWPA 3ENHA 2BUJA 2HW6A 3K5UA 3ZSHA 3OP5A 4GKHA 2IZTA 1U59A 3FSFA 3UG1A 2GNJA 4A06A 4AW1A 4I0RA 4ERKA 4I92A 1NXKA 2C5OA 4RFYA 1AGWA 2XKEA 2Q83A 4IZ5A 1Y91A 2XKCA 4D2RA 4OBQA 3Q2MA 2QLQA 3TEIA 2R4BA 4NKSA 4KABA 4CT1A 3ZONA 1YWRA 4MVFA 4O0UA 4ZK5A 3BYMA 4XMOA 5GHVA 5ETIA 5EHOA 4PNIA 3BCEA 5CXZA 4WOVA 1SM2A 5CU6A 3SQQA 3WF7A 3UNKA 2VTQA 4F1OA 5T3QA 3QQJA 5LQFA 2UZEA 1H4LA 2XIXA 4R3PA 3RI1A 2I40A 3BBTB 1NVQA 4H1MA 4RZWA 3R01A 4YHFA 5E8YA 5LCKA 3ZFYA 3D5UA 3UVQA 2EB2A 2QI8A 5CSPA 4EH4A 5IH6A 3TM0A 1WBPA 4LOQA 1O6KA 1XBAA 2HAKA 2UZNA 4AT4A 4UWCA 4IC7A 3KN6A 4L46A 3V3VA 2WTIA 5I3RA 3Q96A 3WILA 2ITQA 4OT5A 3ZLWA 4RVKA 4EJNA 1KE6A 4AX8A 5LVLA 4FSRA 3VJNA 3PVUA 3SAYA 1ZMVA 1WBNA 4K6ZA 2W1HA 3VUIA 4FEQA 3SA0A 2ZM4A 3T3VA 1SVEA 4IM2A 4DH8A 3ALOA 4CRLA 2VTOA 5I9XA 4N57A 3GNIB 2PE2A 3HMNA 4ID7A 2BZIB 5FTOA 3BYUA 1XR1A 1ZXEA 3EFJA 4B7TA 3UNZA 4WNOA 4QD6A 1BI8A 3Q4ZA 1PXIA 5LMKA 4FV2A 1X8BA 4KBKA 5HVJA 4YJQA 4GEOA 5FTGA 2YN8A 1YOJA 4FKLA 2GHMA 3R73A 2C5XA 3QLFA 5A46A 2REIA 5AR3A 2OSCA 2VNYA 5J87A 4C4EA 3A7IA 5HG7A 3LFAA 4QP8A 2XNOA 4AACA 2VNWA 4DBXA 3EZRA 3GBZA 2BDJA 4ASDA 2EU9A 4I21A 4AA0A 4EK4A 2C3JA 4U44A 3K3JA 4HYUA 1ZMWA 4BCQA 4JX3A 3NNUA 2OO8X 4KSQA 1ZZ2A 4RWLA 4I4EA 5EYDA 2XS0A 2XKDA 5TO8A 5HZNA 2V55A 1XBBA 5H8EA 4L01A 1P5EA 5E1EA 5CALA 3L8VA 5ANJA 1WBTA 2LAVA 4AGDA 4PNKA 3HV6A 5AM6A 3R83A 4C58A 4WRSA 2OF2A 4XG8A 2BMCA 5CZHA 4DINA 5DLSA 5IQEA 3THBA 3O50A 3OCBA 5JRSA 3P79A 4IEBA 2A2AA 3C4EA 3HL7A 4QMQA 2YIQA 1OIQA 5EOBA 1P4OA 4ERWA 4U7ZA 4TWNA 4ASEA 4GJ3A 3HAMA 3KXMA 2QNJA 4FX3A 1ZOHA 1H24A 1Q8UA 4U80A 3UOJA 1OKYA 2WTWA 4J53A 4XG7A 4DG3E 4DH3A 2DUVA 3U8WA 3QQKA 5CAOA 3VRZA 3ROYA 2I0VA 4CV9A 4BR3A 5CAVA 4TN6A 4FKQA 4QQCA 5EYKA 4J7BA 5H2UA 3H10A 3VBVA 4DFNA 3PUPA 3DNEA 2IPXA 4XHKB 2W1EA 4BDJA 3P5KA 4AS0A 3OUKA 1XH5A 1JKLA 2C0IA 2XK8A 3Q9ZA 3SOCA 4C3PA 3TTJA 2WKMA 3CJGA 2R3RA 3MPAA 4QTBA 3LQ3A 3CLYA 4OTFA 4ANMA 4JXFA 1W7HA 1QMZA 2PZIA 2UVYA 2HZIA 2W7XA 3OY3A 4J96A 3EQCA 3TNQB 3ZRMA 3ZHPC 3AT4A 3RM7A 4YC6A 5DR6A 3A4PA 3D5VA 3PY3A 3NLBA 3UIMA 3PPZA 3FQHA 3MY1A 4EC8A 1OI9A 3I0OA 4FNWA 4HVIA 5AR2A 3WF6A 1ATPE 4AZWA 5B2LA 3P0MA 2JDVA
chains in the Genus database with same CATH superfamily
5CT7A 1DM2A 1H1RA 3FPMA 4PMSA 1GIIA 1GJOA 1TVOA 4F65A 4FZ6A 1GY3A 2GNIA 2WZJA 1W2DA 2VWZA 4JDKA 4JIAA 3W2CA 2XIKA 3M2WA 3ZS5A 1H28A 1YXSA 2W1CA 3DQWA 3MJ1A 3CTQA 3ZXZA 4JG8A 4II5A 4DEBA 2WTKC 1PKGA 5CEIA 2BHHA 2JDOA 4OR5A 5HKMA 3ORLA 1YVJA 3GU4A 3ZZWA 4M0YA 4ZJVA 5M4IA 4OTIA 2GNLA 1T45A 4L3LA 3PPJA 5FM3A 4O38A 5CTPA 2ITVA 4R5YA 3UNJA 3WYYA 5IZFA 5FP5A 3S1HA 5F20A 5AA9A 3QUPA 4AOJA 4P5ZA 5B2MA 4YNOA 4I3ZA 3I79A 4F78A 4KBAA 4F9BA 3TCPA 4TYIA 5J5TA 1FGIA 2XAMA 2QR8A 3D4QA 2YABA 2YZAA 4W9XA 2XNGA 1Q5KA 1KE9A 2YM8A 3C5IA 3EL7A 2JFMA 3MN3A 3ORXA 4O86A 4MNEA 5DR9A 4BKYA 2JKMA 4BVUA 4ANQA 4FE2A 3NUAA 4KKHA 2OF4A 2ESMA 4BI2A 2YISA 5CF6A 4EH8A 4H3PA 4BZDA 1YWNA 4TWOA 1H1SA 4V05A 4WBOA 5GIOE 2RL5A 1PXOA 2FO0A 3Q53A 5B2KA 4E6QA 4PL3A 3CCNA 5ANDA 5AWMA 3QD4A 4EBVA 3ODYX 3KRRA 5EYCA 4U81A 3UQFA 3ID6C 2XBAA 3EZVA 4UMRA 2YFXA 3PVWA 3PRIA 4MBLA 2CCIA 3E87A 3PA4A 4I6QA 3UQCA 4KIKB 3COKA 3AKLA 4C3RA 4HPUE 3W16A 4OBOA 2OZAB 2XM9A 2OGVA 4YGAA 3W8LA 3NWWA 1J1CA 3LFQA 3G0EA 4Y46A 3VUTA 4PPCA 4ACMA 1WBVA 2WIHA 1AD5A 1Q99A 4YR8A 2XARA 3MBLA 5HOAA 3EN6A 5IMXA 2C6EA 4ZSLA 3EOCA 3QQFA 5HO6A 4HVSA 3IO7A 1OPJA 3TL8A 1JKSA 4O0VA 5L4QA 2P2HA 3H30A 4F9CA 1R78A 2RF9A 4YBJA 3RNYA 4TRLA 4R7IA 3OBGA 4K2RA 4KINA 3UPZA 1Y8YA 1RW8A 3E93A 4KS7A 3SLSA 3TDWA 3MY0A 4BHZA 1Q62A 2C69A 4PUZA 1VZOA 1K3AA 3F66A 5DT3A 4CD0A 1YI6A 3TTIA 5DG5A 1P4FA 4RLLA 3TV4A 1H1PA 2QHNA 3F7ZA 4XH6A 4JR7A 4BTJA 5E8VA 2PZPA 3QYWA 4YUQA 2CNVA 2W17A 2VD5A 3BE9A 4BWXA 5IG1A 3HV7A 2YIWA 5EKOA 3EKNA 3DA6A 5ACBC 3F88A 2A19B 3OUNB 4FTNA 3NNXA 4O6LA 4B8MA 3LFSA 4PDSA 3EWHA 4PMMA 5FWKK 4S33A 5LMKC 2QO9A 4ZJIA 5BPYA 5IA4A 2J51A 4RX7A 5LVMA 1BLXA 3DOGA 4E3CA 4BCHA 4YZNA 3H0ZA 2GQRA 4OTDA 4Q5HA 3BL7A 4R3CA 4U6RA 4MF0A 3NUXA 3NZ0A 2YWVA 1XH6A 4XP0A 3IW6A 2C5VA 4A7CA 3H3CA 3PY0A 5F4NA 3OC1A 3W32A 4ENXA 4NUSA 5KKRB 2XCHA 5IUGA 1YXTA 4L42A 1J3HA 4X6QC 1JOWB 2X39A 3O8TA 1UU3A 2W06A 3TNIA 3A4OX 2JDSA 3MVJA 2C6KA 3VBWA 4A9YA 3L8PA 3LMIA 2I0HA 4ACHA 3CXWA 1WVXA 1XKKA 2VTMA 3AC1A 3PA5A 4IB0A 5CANA 3LPBA 3ORZA 4D9TA 2UZLA 2UUEA 2XRUA 3D0EA 3PZHA 2VO7A 4YJVA 5FEQA 4YLLA 3B2WA 4X3FA 1PJKA 5HHWA 3RK7A 3FAAA 5CT0A 3KQ7A 3OCGA 3W2QA 4DBNA 3VS0A 4QO9A 2O0UA 4IZAA 3FZRA 4J8MA 2QO2A 4OT6A 3HA6A 3PJ2A 5JGDA 5AAFA 2Y0AA 2OJIA 5D41A 4MUQA 4E5WA 3PSBA 1YKRA 3JXWA 3V6RA 2VGPA 1BI7A 2Y6OA 5HD7A 4D0WA 2W1ZA 3OF0A 3RPSA 4CG8A 2AC5A 5BUEA 3RPYA 2PMNX 3O23A 3KN5A 4DDIA 5HG5A 1PRYA 3PIZA 4AN2A 4MXYA 4L52A 3HP2A 3I81A 3E5AA 4MD7E 2OIDA 2EUFB 3BELA 4JQ8A 4EHVA 2VWYA 4PDOA 3BHTA 3L9NA 5D7VA 4DFXE 3AC8A 4EYMA 2WMAA 1B38A 4BBMA 5IUIA 4UMPA 5C4KA 4ZZOA 4OAUC 1ZYSA 1OBGA 2GDOA 4Y8DA 1SYKA 2WHBA 4ZZNA 2VUWA 2NRUA 5L6WL 4BCPA 3DDPA 5JFSA 2C5YA 2IW8A 5L8KA 2B9HA 3OD6X 4UMQA 5JSMA 5BVOA 4KIOA 4BCMA 4G3DA 4R1VA 3ZUUA 5AAEA 2ZV9A 4RX8A 5E8SA 4FGRA 1L8TA 5JGBA 4IFGA 4MYGA 4K18A 4YZDA 4LRKA 5CENA 2R3KA 3FUPA 1L3RE 2CN5A 1RDQE 2VX1A 3FLWA 5ANGA 4P7EA 1KV1A 5HO8A 4ZMEA 2GS6A 5M06A 2CKQA 2R3PA 1OM1A 2PVMA 2UW5A 3F9NA 3LCTA 3PJ8A 3N4UA 3UPXA 4OAVB 1W2FA 2DYLA 4AFEA 4P5QA 2QVSE 3W0MA 3DKCA 3W0NA 1FQ1B 1Q8WA 2I0YA 2B55A 4GK2A 4GYGA 1GZKA 4K11A 4NCTC 4DAWA 2YCSA 3TMOA 3ZFXA 5M55A 4ALUA 4PP9A 1UU9A 4EEVA 1OGUA 4DLJA 1KE7A 4HZRA 3ZO4A 4FYNA 1G8KA 2C6OA 3DJ6A 3CR0A 1LR4A 4I24A 4USFA 3A7HA 2JD5A 3H9FA 3UC3A 3R8VA 4BKJA 3A60A 1VYZA 3BKBA 3PFYA 4EOLA 4C59A 1BX6A 3C4XA 3TI1A 2VTAA 5BYLA 4X7QA 1J91A 1P2AA 4Y83A 5KZIA 3E62A 3R8PA 2JKOA 2R7BA 4AN9A 4C61A 2KTYA 4FTKA 1O6LA 3EQBA 2R0UA 3OCTA 5FP6A 4ANSA 2W0JA 3ZU7A 4WIHA 4QP7A 5JFVA 3UDTA 3QCYA 2OG8A 3UYTA 3ZLXA 2J0KA 3VBQA 2XA4A 2JAVA 2XRWA 3P7AA 2VTTA 3Q5IA 4RC2A 1UWJA 4S34A 4AE6A 3V8SA 4OBPA 4AXDA 2XIZA 2VO0A 3R9NA 3FKOA 4KAOA 1CM8A 4PMTA 3WOWA 4F09A 2XKFA 2PY3A 1WCCA 1ZWSA 3HNGA 5CU4A 3P7CA 5BVDA 2W5AA 3LJ2A 3OW3A 2PTKA 4YJRA 2OICA 2QOIA 2C3IB 3O2MA 4D2SA 3EFKA 2IWIA 3UE4A 2WU7A 3HMPA 4AW0A 4YURA 5E91A 2XNNA 3HKOA 4MXXA 2X0QA 4M69B 4J98A 2SRCA 3QRKA 4E20A 2JGZA 4FYOA 2CNQA 5KNJA 2QQ7A 3KRLA 4ZTHA 4WNPA 2X7OA 3F2RA 3PTGA 2OK1A 2OJFE 5E8ZA 3RZFA 5HE1A 3SW7A 2ZOQA 1SVGA 3VONA 2R2PA 5DA3A 1XWSA 5HO7A 2ZMDA 4ACDA 4NZWB 3DV3A 3MTLA 1JWHA 2UZBA 3M42A 3DPKA 4NJ3A 2XIYA 1ZOGA 1VR2A 3GCPA 2PMLX 4FTRA 2EXCX 5CNOA 5M53A 3K3IA 4ZP5A 1T46A 4C8BA 3OWJA 3G33A 5CU0A 5BX0A 4CXAA 3U6JA 2Z02A 5AV2A 3CP9A 2VWXA 4GIHA 3RAKA 4AWIA 3KEXA 3BLQA 3WZEA 2BAQA 1DI9A 4GT5A 4FEVA 1H25A 4RIXB 4ARKA 4F63A 5AMNA 1OECA 4RZVA 3KF7A 2YIXA 5FXSA 2OFVA 5A9UA 2XANA 3N4VA 4YSMA 2X8DA 3BU3A 3KCFA 4FKIA 3ACKA 4XBUA 2IW9A 2ZAZA 3D5WA 3MIYA 2CGVA 3R7UA 4C36A 4D4VA 2B9JA 4N4SA 3DGKA 3CY2A 3TYKA 1P14A 2X2MA 3U51A 4RJ5A 5E8UA 3TIZA 5HBEA 3S2PA 1NY3A 3R9DA 2IVUA 3UO5A 1F5QA 1ZYDA 4IQ6A 3F3TA 4IWQA 5CWZA 3E88A 5K5XA 5HI2A 4QPMA 4AGWA 4WUAA 4CLIA 4CQGA 4AQKA 4RQVA 4X3FC 4EH9A 5KX8A 1URCA 4FNXA 4BCJA 2YDKA 1IAHA 3W55A 4A9SA 4EH5A 5CAUA 3IG7A 1YHVA 4JJRA 3NIEA 4FG8A 5E8WA 5BYZA 3ZO3A 3PXQA 3AC5A 3PP1A 5DE2A 3JR1A 4FICA 5M4CA 1G8AA 4A4OA 4JAIA 4O96A 1WMKA 3FDNA 3VUGA 3QTUA 3I1AA 3UZRA 5CF4A 3R7EA 5A14A 3AKJA 2O3PA 2X6DA 1NVRA 4NTTA 4WD5A 4EH2A 5BYYA 3ORIA 1I09A 4DT9A 3R7IA 2RIOA 2E9NA 4E4LA 5JT2A 3R7GA 1OMWA 3NIZA 3QKMA 3DQXA 4NM0A 3PFQA 3DB6A 3TZ7A 4F7NA 5LCJA 4DYMA 3KVWA 2QG5A 4GVJA 3W2OA 4C34A 4D9UA 3O5AA 2FA2A 4JBOA 1Y8GA 3EQPA 4RC4A 4BCGA 3O7LB 2C4GA 2R0IA 4FV8A 2VTRA 4KKGA 3T9IA 4G6NA 4M0ZA 4DE4A 1GIJA 3D2KA 4H58A 5EDPA 5AV3A 4XV9A 2GTMA 3NCZA 4O4EA 1TQMA 2R3IA 4YTHA 3CBLA 5GJDA 3NEWA 5H8BA 3TV7A 4FTTA 5AP5A 1GZ8A 4U3ZA 5KMOA 3ZOSA 3MGYA 5IISA 5FM2A 2FSOX 4UYNA 4JAJA 4MNFA 5CF8A 2RKUA 4DEDA 3VF8A 1W0XC 3FMJA 4XJ0A 4A07A 1OL7A 3V5LA 5J1VA 2YHVA 1KE8A 2EB3A 1I44A 2J50A 1CKJA 5C03A 4TYJA 4D55A 3GGFA 5BVEA 2C6MA 3NW6A 3EQFA 4IWPA 2X7GA 3IKAA 3GQIA 2HY81 2JFLA 3KY2A 2H8HA 4L68A 4NIFA 4L44A 4UBAA 3ZM9A 2O8YA 1NVSA 4CFXA 5F94A 3JS2A 4QMZA 5AA8A 3MH1A 4YJNA 4G31A 3EFWA 2QOHA 1MUOA 5AUWA 3QL8A 4FNYA 3NPCA 2OIBA 2CHLA 2VWVA 2WMBA 1H07A 3BV2A 4JLCA 4V0GA 3EMGA 5AX3A 2I0EA 1H0VA 2J7TA 4IMYA 2FSMX 4UB7A 3R8ZA 3K2LA 3HV4A 3ATSA 2Y4IB 2R64A 2UZOA 1YDRE 4PTCA 3W8QA 1UA2A 2HW7A 3ZYAA 4EOIA 3BHVA 4LMUA 4C4GA 1WAKA 4FSYA 5E7RA 3EIDA 4FKVA 4YLKA 4MXZA 2B7AA 3TNHA 2F4JA 2CN8A 5KMMA 1ERKA 3KMMA 4EHZA 5JQ8A 4E4XA 2FUMA 2XNPA 4LI5A 3RAWA 3ZSIA 5EKNA 3ORMA 3DAKA 2UW7A 2J4ZA 3HMOA 3L9MA 3VUDA 2XCKA 5KBRA 4IH8A 3MTFA 2XK6A 2XVDA 3C1XA 4J8NA 3G90X 4CZYB 4HVDA 2PZ5A 5IDNA 5IQBA 3FKNA 3BPRA 2GHLA 3OXIA 5J95A 1VLRA 1U46A 4O0RA 2QU6A 5EM5A 3FC2A 3PY1A 1PXLA 4XYFA 3HZTA 4ZTRA 5HIBA 4ZZMA 3IDBA 2PPQA 4MKCA 3M11A 2CCHA 2V62A 3S3IA 2BDWA 4F9YA 3VS1A 1V1KA 3FZ1A 4W4WA 2HWPA 3D14A 4Z9LA 4QQTA 4BZOA 4GYIA 2XH5A 4DEAA 4FSTA 4FIHA 4I5MA 4H3BA 5IEXA 4O1OA 2UW8A 3LOKA 2O65A 1IA9A 1MRVA 3FMDA 2ETMA 2ITUA 4CSVA 5CXHA 1M2PA 4ZTNA 3FXZA 4JI9A 4HVHA 4GU9A 4IIRA 2C30A 4W4XA 4XNEA 4UEUA 4DH5A 1Q4LA 5C27A 4E7WA 4CYJA 4AG8A 3HRFA 2BRMA 3MH2A 2PE1A 3VS6A 4FIIA 2PVRA 4LV5A 3RCJA 5T68A 3SRVA 1GIHA 3VS5A 3R04A 3PP0A 4HVGA 4XOZA 4G6LA 3RAHA 2R5TA 1ZOEA 3AXWA 2BFXA 3LXPA 3NAXA 1VJYA 5EI8A 2A98A 4DFLA 4AU8A 5JKGA 3PUFC 2WMTA 3LLAA 1GNGA 4FOBA 4JRVA 5HNIX 5L6OA 3ZC6A 2OZOA 4QP3A 3P7BA 5L2SA 3HAVA 5M56A 5I9WA 4WHZA 2GSFA 2VX0A 2YA9A 3E3PA 3OROA 4U45A 3RCDA 4ORKA 3II5A 3I5NA 4X2JA 4FTUA 3D15A 3WF9A 4CKRA 2PUIA 3KREA 4FEWA 4AXEA 4RLKA 5CS6A 5CZIA 5FG8A 3WE8A 4ACCA 4DG2E 4EHGA 1O6YA 4LRMA 5DFPA 2FYSA 2C3LA 3U4WA 3AC4A 4QTAA 3UVRA 4O22A 3N4TA 3MJ2A 3LMGA 5IQDA 4WRGA 1GAGA 4RX5A 3DY7A 4D2TA 3W2SA 3C0IA 3QF9A 3CPBA 4CGAA 3SV0A 2XBJA 1MQBA 3Q2JA 1ZARA 5IQAA 1Q8TA 2W1DA 1H27A 3DJ7A 1TQIA 4FSZA 2PUPA 2O63A 4C0TA 2P3GX 4F9AA 1OGYA 2XEYA 2XNBA 3FI2A 4ZLZA 4Z7GA 4XG2A 4G6OA 1JAMA 3DTWA 4BDAA 5E92A 3OFMA 4QTCA 3RALA 4DCAA 2RFDA 4F0IA 3C4ZA 3LXLA 3QRIA 4JNWA 3R1NA 3TKHA 4QDEA 3F5UA 2Y8OA 3SC1A 4YPDA 2JDTA 1LPUA 3OWKA 3GFWA 3F3VA 3ANRA 2WTVA 3GC8A 4QP4A 5HNBA 1K2PA 4NU1A 3NMUF 4FKTA 4E5BA 5IQHA 3ELJA 1ZZLA 3UDBA 4QMWA 3AT3A 3L9PA 2P33A 3A61A 5FD2A 2HIWA 3RHXA 3PDTA 3FBVA 2ZJWA 5DT0A 3W10A 2PUNA 2J9MA 1UNGA 3HDNA 4BB4A 1H08A 2UZVA 1ZAOA 2XJ1A 3DK6A 2YM4A 3DLSA 2B53A 3CKWA 4FTAA 3RK9A 1OB3A 4F1MA 2BTSA 4BCNA 3UDSA 2ITPA 4G3FA 2JIVA 3VJOA 2PZYA 3I6UA 3NX8A 3QFVA 1YQJA 2C47A 5EQPA 5F9EA 5J9LA 2R3FA 3QLGA 4M3QA 3R6XA 4FT0A 3A62A 4IADA 4NL0A 4FVRA 3BQRA 3TWJA 3SGCA 2ITYA 4P4CA 2BRBA 4HNIA 5IPJA 4BTKA 4YHJA 3FMHA 3BHYA 5HTCA 3HEGA 4FL1A 4EOOA 4QP9A 3R63A 2YIRA 1UV5A 4R3RA 5DWRA 1IEPA 2BIKB 3CS9A 4E4NA 2WMSA 3C5UA 1PXKA 4U40A 3R9HA 4ZTLA 2YAAA 5D1JA 2H9VA 3HYHA 2FH9A 4IB5A 2JBOA 1M2QA 4D2VA 5HE0A 3PVGA 4X21A 3D7TB 5E90A 3ML1A 5FTQA 3IOPA 4AZSA 4IB3A 4YO4A 4IJPA 4ZXTA 2E2BA 5CAQA 4BY9E 3WZKA 3QTRA 3NSZA 3EQIA 4GSBA 3TZ8A 4PP7A 4YSJA 4PTEA 4GG5A 3AD4A 3I7BA 5EH0A 4E6DA 3H0YA 3AOXA 4XRJA 4EK8A 4B9DA 3REPA 2WMRA 4KUJA 3NRMA 4EUUA 4WG5A 2EWAA 3NFFB 2F57A 4WG4A 5K9IA 2B52A 5DI1A 4UWYA 1OITA 4KA3A 3NFGB 2RG5A 4I1ZA 5BVKA 4BDKA 5ANIA 3MSSA 2C68A 3R02A 4EH7A 4I23A 2HZNA 3OOMA 3A8XA 1MRUA 3GCVA 3AD6A 4D1SA 3O51A 4Q9SA 4BRXA 3CPCA 4FV4A 3U6IA 4ZTMA 3DXPA 2V22A 5IQCA 1B6CB 2HK5A 3KK9A 4UY9A 3FE3A 5EFQA 2YEXA 1JSTA 4ONAA 4IVAA 1YW2A 1W84A 3RHKA 3TZ9A 2H96A 4FL3A 5I9UA 5FEDA 4J97A 4EWHA 4YU2A 1OUYA 5IF1A 4U5JA 4DLIA 4F99A 1A9UA 3PSCA 5E8XA 4NCTA 4DHJA 1TZDA 2JDRA 4FTIA 3GC0A 5LWNA 2P55A 4RG0A 3MA6A 4R6VA 4FT3A 4FUYA 4IM3A 5CEQA 4F7LA 4O4BB 4JDHA 4O7WA 4DDGA 2X1NA 3E8EA 3QU0A 3TV6A 4WSQA 1JPAA 2PE0A 3UOHA 5C8NA 4YPSA 4FEUA 2F7ZE 4FK3A 1PW2A 3TUCA 5JEBA 4UYAA 1W82A 3UYSA 5A54A 1JKTA 3QCXA 3EYGA 5ANEA 3UGCA 3D7ZA 4NEUA 3QD3A 3R8LA 4C62A 3MFUA 4APCA 4O7LA 2B4SB 3CIKA 3A7FA 3OT3A 3QBNA 3ENMA 1WZYA 5HTIA 2X4FA 1WVWA 4QDVA 3O96A 4B0GA 5HD4A 5AR8A 5HTBA 2ZFYA 4NT4A 3AC2A 4C4IA 5AR7A 4DFUA 2XJ0A 5C8KA 1O9UA 5L8JA 3QXPA 2BZJA 2W1FA 3UZPA 4FR4A 4QYGA 3ZBFA 5K3YA 2WMVA 4RIYB 4WO5A 2JEDA 5DRDA 5M51A 4FOCA 3ULZA 2YM6A 3PLSA 3BI6A 4QRCA 2E9VA 4LMNA 4EC9A 2ZV2A 4C57A 3R00A 2RFEA 4TNBA 5A4TA 5AUYA 3ZRLA 5I9ZA 4FRFA 4QMTA 1BKXA 3RVGA 3LFCA 3NAYA 2V7AA 5IQFA 3A8WA 5FRIA 3FLQA 3VQHA 4E6AA 4MQ2A 3E8NA 4RIOA 4ZTSA 3VHEA 2XALA 5CVHA 3QTSA 3VW8A 3UP7A 4BF2A 3MWUA 4LOOA 3E7VA 2X9FA 4C35A 3U55A 3EJ1A 5AM7A 3W33A 1H1WA 3GI3A 5HVKA 2CKOA 2PMOX 1ZMUA 1QPCA 3D83A 5TT7A 3VNTA 4QTDA 3P5JC 3Q4TA 4TKSA 3UOLA 5CF5A 4DHFA 1GZOA 4D5HA 4FV0A 3TN8A 4BYIA 4FTMA 4EH6A 4G5JA 4LFIA 1OPLA 4XUFA 3NVKI 1CSNA 2VWBA 4QMXA 4AFJA 4HGLA 4XOYA 2WQEA 4PDYA 4U79A 2GQSA 3CQEA 4EK3A 4CZUA 2C6TA 1M2RA 5DNRA 3V51A 3NR9A 3ZDIA 2OJ9A 4PRJA 2OH4A 1S9IA 3TT0A 3FXXA 5D10A 2QHMA 3NUNA 2R3GA 4RJ6A 4FIGA 4E73A 5J7BA 1FBNA 1OL6A 2QU5A 4GT4A 4X2GA 5FDXA 2A1AB 5AR4A 4FKGA 5CX9A 4KIKA 4AXCA 4KD1A 5HX8A 3KMWA 3LLTA 3IQ7A 3PA3A 2OZAA 3QALE 1V0BA 4FODA 4I6FA 4XBRA 5T6KA 3P23A 4IWOA 4BDGA 2HENA 4Y5QA 1CMKE 3C4WA 3LCOA 3LFDA 3F2AA 3RK5A 4ASXA 3OTVA 5HU9A 3R1YA 2OW3A 3UP2A 3QTXA 2OBJA 3W18A 4N6YA 3QTIA 5JN2A 1R1WA 2HCKA 2QD9A 3F2NA 5AAGA 1REKA 4C2WA 3R7YA 4ANOA 1PY5A 4KS8A 4USEA 3LMHA 2X8IA 3ZLYA 1STCE 2O2UA 2R7IA 5ETCA 5HLNA 4J99A 2A4LA 2GPHA 4IACA 3FI4A 1YDSE 3UO4A 4CFFA 2H34A 4I6LA 2R9SA 4FA2A 2XYNA 2IVVA 2BR1A 3PIYA 4CFUA 4GJ2A 3LE6A 4DGNA 2VTLA 4Y95A 4HW7A 4HCUA 3C0GA 4BIBA 3KF4A 3SW4A 3JYAA 4RVTA 3TNPC 4DEEA 5J79A 4L67A 4QNAA 3LW0A 3Q04A 2I7QA 3LVPA 3E8DA 3PYYA 4G3CA 4C2VA 4C4JA 3LM0A 3ORNA 4KNBA 4G17A 5M4UA 2RFSA 3Q5ZA 2WQBA 3MW1A 1M52A 1XH7A 4O0YA 2XK9A 1Q3WA 2C6IA 1ZYLA 5K0KA 2WMWA 5CNNA 5IKWA 4LG4A 4BCIA 2PYWA 1AQ1A 3BBWA 3R1QA 4WUNA 5HG8A 2J5FA 4EJ7A 3S00A 4IX4A 5DRBA 1Y57A 3LQ8A 4XLIA 4N6ZA 3ZUTA 2WXVA 4NFNA 1JSVA 2BIYA 4UX9A 3FV8A 2R3NA 3U9CA 1YHSA 4FTOA 4JIKA 4YJSA 4Z16A 4BJJB 3FZOA 5AP6A 2GHGA 3BHHA 3I60A 4DGGA 2HOGA 2WD1A 4TXCA 4LM5A 2ZVAA 4CVAA 5EHLA 4IANA 2WGJA 3ZRKA 4CFNA 4NK9A 2Q0NA 3BYOA 2VO6A 3HV5A 1YOLA 3A7JA 3QKLA 4BTMA 3I0QA 3LJ0A 4GKIA 3SD0A 5AEPA 1UNHA 2FSTX 3FQSA 2YITA 3COHA 5DH3A 4FK6A 1E9HA 3ZFMA 4AA5A 4OTHA 2C1AA 3QZHA 3QAME 3RNIA 4EOQA 3ZC5A 3KULB 4QPSA 3F6XA 4HOKA 4FIFA 4DTBA 5HLPA 2BROA 3PXRA 3QKKA 5DIAA 5GZ8A 3W0SA 4M67A 1PYXA 5HNGA 4HGSA 3E7OA 4I22A 5EK7A 3VS3A 4CLJA 4A9UA 1U4DA 3V8WA 4QTEA 5HORA 3OXZA 3W1FA 5LVNA 4EI4A 4BIDA 4O2ZA 5KO1A 4ALWA 5KMJA 1U5RA 1SNXA 3U4UA 3HMIA 4JDJA 2WMUA 3KRWA 3DS6A 3Q9YA 4F7JA 3RBWA 2Z2WA 5AJQA 1PYEA 1IR3A 2NO3A 4O81A 4EKKA 2XNMA 4JBVA 4AN3A 4BDIA 2B0QA 4YTIA 3DU8A 1H01A 1R0PA 2NP8A 5F95A 3EN5A 3RZBA 4D2WA 5DHJA 4H05A 2VWUA 4ITJA 3HLLA 5A4EA 4YBKA 3DBQA 3EQDA 3L9LA 1WBSA 4TWCA 4TYEA 5ETFA 1J1BA 2WQMA 5HGIA 2C3KA 4DFYA 5L3AA 1MQ4A 5EQEA 4RJ8A 1U54B 4ZTQA 4GMYA 3NUUA 3NGAA 4FV9A 4MWHA 2G2IA 3OEZA 4UN0C 4JMQA 3KCKA 5FGKA 3CC6A 2OLCA 3VHKA 3UIUA 3MDYA 4BDHA 4XCUA 4D0XA 2BVAA 2X8EA 3QTZA 2ETKA 4S32A 5FDPA 3C50A 4EONA 2PVLA 3VN9A 3SDJA 4I4FA 5CU2A 4F7SA 5LVOA 1M17A 4ZSEA 1XMMA 4Q2AA 2AC3A 2W5HA 3Q9WA 5DOSA 2CGWA 2YCQA 4QYEA 3W0OA 2PVKA 3TG1A 2VZ6A 4TYHB 2BKZA 3HECA 4FSQA 2YM5A 3ET7A 5AUZA 4O4DA 1YXUA 5EW8A 4ZJJA 3TJCA 4Q5EA 1REJA 1BUHA 4MF1A 5ANOA 5I9YA 2QCSA 4PY1A 4AUAA 4UALA 4KKEA 5EHYA 2ZM3A 3G9LX 3LHJA 2XJ2A 1KUTA 2PHKA 4O6EA 4FIEA 4R7BA 3OEFX 4UWBA 2PMIA 2RFNA 3KA0A 3QXOA 3DTCA 1Z5MA 3C0HA 3TNWA 2G9XA 4C33A 4MD9E 2R3JA 4EOKA 4IAKA 2EXEA 3NVMB 3QGYA 3ZZEA 2BRHA 4PQNA 2HWOA 2J0MB 5EQYA 3ZLSA 2PZRA 3W2RA 3GENA 2G2FA 2OKRA 3DB8A 4NFMA 2ZB0A 3Q32A 2XB7A 3BU5A 4YHTA 5EI6A 3OWPA 2AEGA 4RJ4A 1H0WA 1FMKA 1PMNA 3PWDA 4XG6A 4D5KA 2Z60A 4C4HA 3CSVA 1DS5A 3BGQA 1OKVA 4FSNA 3OVVA 4YJTA 4CT2A 4CG9A 4QMSA 4YC3A 1QPDA 5FBNC 4BBEA 2BZKB 1ST0A 4IW0A 4GK4A 4L7SA 5GJFA 4R8QA 3BGZA 1MRYA 1F0QA 2YM7A 4FTQA 4ZIMA 4CCBA 4NM7A 4CTBA 3FHRA 3AMAA 3BWJA 5CEPA 4ENYA 1Q61A 2OI4X 1LEZA 4RVMA 5EW3A 3RTPA 5IMEA 4N0SA 5LJJA 4IAAA 3EKKA 3GFEA 2WFYA 4AT3A 2VAGA 4W4VA 1WBWA 3BLHA 2X0OA 2GMXA 4IXPA 3MFRA 4W4YA 5J1WA 2R3QA 2QLUA 5IH4A 3A99A 5DBXA 3B2TA 4UZDA 5C8MA 5FEEA 3DAEA 4H1JA 2X2KA