3KXMA

Crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor k74
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
326
structure length
326
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP site-directed inhibitors of protein kinase CK2: an update.
pubmed rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
molecule keywords Casein kinase II subunit alpha
total genus 109
structure length 326
sequence length 326
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3kxmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3kxmA02
3KULA 1ZY4A 4YSMA 4G6LA 4FUXA 2JLDA 3BHTA 3OF0A 1YDRE 4L42A 3GP0A 4LRJA 3Q4ZA 1UA2A 5BVFA 4XX9A 1O9UA 3ORPA 5IA0A 2ITUA 3VWAA 3ZLXA 3GGFA 2IZUA 5EQEA 3REPA 4L7FA 4EZ3A 2J7TA 3DK3A 3VJOA 2VU3A 1M14A 1GIHA 3TIYA 3DK6A 4DHFA 4XP0A 2WMTA 3CD3A 4LFIA 1H1WA 2C4GA 5HTIA 3F7WA 4FL1A 3T3VA 4DFXE 1R0PA 2JKQA 2OKRA 3VNTA 2G2HA 5M4IA 2X7OA 4KINA 4I6QA 4QMOA 1KE7A 2ITYA 2OICA 4O0TA 4YJRA 3S2PA 2HY81 3UPXA 5DT4A 2R3MA 2WQNA 4DYMA 2Z7SA 3PSDA 2XKEA 4NH1A 4YC3A 4BCKA 3PJ2A 2UW7A 1BYGA 3OG7A 3PXFA 4HVGA 1UVRA 4J98A 3WZKA 2WPAA 5EHLA 1ND4A 4HZSA 4L52A 4NTTA 3FE3A 4I21A 3HDNA 5HG5A 3SW4A 4Z7GA 5KMNA 1ERKA 2X81A 4J8NA 2QNJA 3G6GA 5DPVA 3PVBA 3FL5A 3GXLA 4IB3A 4GUBA 4M3QA 2HY0A 4R1YA 5EHYA 3SV0A 3V5QA 2J0MB 4FOBA 3GU8A 4LRKA 3C4CA 4RG0A 2IZTA 3S3IA 3KFAA 3VS2A 3LHJA 5AV4A 5JFXA 4QP4A 4WKQA 4DFLA 5GIOE 2R2PA 3AT3A 4J52A 4YJVA 4D9UA 3HMNA 4FNWA 5KKRC 4GL9A 3UODA 3RHKA 4XV3A 3I4BA 4D4YA 4QO9A 2BALA 4O27B 3B2WA 4DTKA 2IG7A 2BTSA 2QR8A 1OKYA 4CFXA 2R3LA 4USFA 4ARKA 4NEUA 2HK5A 3R9NA 2WMAA 3E93A 3M11A 2F2CB 4E6CA 4RIYA 3AC3A 3QAME 5ANJA 4ZP5A 4O7YA 4KSPA 1IRKA 1SM2A 4FIEA 3FMNA 4IZYA 5IU2A 4O0VA 5AP4A 3H3CA 5IPJA 2CKEA 3PFQA 4JL9A 3F2AA 4YJUA 5KMOA 2W1DA 5L2WA 3E8EA 4F0GA 4W9WA 4FKVA 5BVNA 2W1HA 3N9XA 3COKA 2V55A 2PVJA 3PXKA 3CJGA 3TV4A 3TDVA 5ETIA 3F3ZA 3WF7A 2WTJA 1XR1A 4D5KA 1JKSA 4BKZA 4JG8A 3EQCA 4IFCA 5A46A 3O51A 3VC4A 3EFJA 4NUSA 4C02A 1G8AA 2HAKA 4Y5HA 4EH9A 1UNLA 4PMMA 5EHOA 4ZXTA 1SVGA 1P5EA 5FG8A 4QT1A 2FYSA 3AOXA 3FYKX 3ZXTA 2VZ6A 5A4LA 5CSPA 1J1CA 4R78A 3UBDA 2ONLA 3D7TA 2WMUA 4BICA 4N6ZA 3U6IA 2Y9QA 2OH4A 2OF4A 3I81A 2FSOX 4KBAA 4F6UA 5EKOA 3ALNA 4TYJA 4AACA 3G9LX 5H8GA 4GKHA 2OZOA 4I94A 3FZRA 3QRTA 5D10A 4LYNA 5C9CA 3GC7A 2W9FB 5TT7A 3TJDA 3R2YA 3EL8A 5FP6A 4B9DA 2Z7QA 4BDKA 5I5ZA 5J9ZA 4EH8A 5JEBA 4CMOA 4XEYA 4R6VA 1Q61A 5A4QA 2WMXA 5E8SA 4EONA 2VTRA 4NU1A 2YIWA 4QYGA 3QA8A 4L43A 5AX9A 1J7LA 3EYHA 3D15A 3PA4A 1ZZLA 4AZTA 2B0QA 5HTBA 4GK4A 3ZFXA 3CQEA 2W4OA 1T46A 5LVOA 3QTQA 3ZRLA 2NO3A 3MY1A 4YO6A 2Z7RA 5K4JA 2IPXA 3L8VA 3PRIA 5I4NA 4EBWA 4R3CA 4AA5A 3HRBA 3WF5A 1TQIA 3FC2A 2WGJA 3CGFA 5AJQA 2HELA 4PMTA 3QL8A 1PYXA 5DH3A 2O5KA 4HPTE 4I4EA 4C3FA 2GFSA 2GDOA 2X0GA 4C57A 3BLQA 3UOLA 5IMXA 4X21A 2XK4A 3GNIB 1OBGA 2O0UA 5E1EA 4BIBA 3FMLA 3D83A 5EKNA 5IA3A 3HDMA 1A9UA 3HMIA 3RPSA 1OL1A 1H1SA 2Y4IC 1H07A 2WOTA 5AV2A 3COMA 2W5HA 1YXXA 2R3IA 1SZMA 4GG5A 4O21A 1VR2A 2F49A 3W55A 4KRCA 3D7TB 5CEQA 2Y7JA 3AMAA 3OOMA 4BDIA 2OW3A 5L8LA 5CNNA 4ASEA 3R9RA 2QOCA 5ACBC 4O0UA 5EK7A 2GNGA 2EU9A 2Q0BA 4WHZA 4C36A 5FTGA 2Z2WA 1SNUA 4PTCA 4GV1A 3G33A 2I0VA 3WILA 2JBPA 2XUUA 3MGYA 4PX6A 4U5JA 1OPKA 3NUPA 3QA0A 5IA2A 3BKBA 4DH7A 2F4JA 3V6RA 4LGGA 1WVWA 1PMEA 3R7UA 1UU9A 2VWYA 3LFAA 4EI4A 4HYSA 5HE1A 1IASA 1G5SA 3VW8A 4L3LA 3DDQA 3P79A 3QYWA 3IGGA 2BMCA 2WTIA 3Q3BA 4GYIA 4JVGA 4K6ZA 3VULA 5FTQA 1YOJA 5EM7A 4BTKA 4OAVB 3DBFA 3KRRA 1OM1A 5KMMA 1BUHA 4KKHA 4O0XA 4DCEA 4A4XA 3ZCLA 2QOFA 2VV9A 2WQBA 2KULA 2H34A 2RFSA 3IW4A 3V5JA 3ODYX 2QURA 1NVQA 2X1NA 3FI2A 3OXTA 5HX8A 4NKAA 5I0BA 3NNWA 3DFAA 2BKKA 4FEVA 4EH3A 2PHKA 4FKTA 3U6HA 5FEEA 2OJIA 4P7EA 4I1ZA 3PE2A 3ZH8A 4EQUA 3KREA 3RKBA 4I0RA 2GS2A 5I9ZA 1DI9A 3PXYA 4IX4A 4IX5A 4CLJA 3R8LA 2UW8A 2ZYBA 5IQFA 4OTPA 4BWPA 2PZIA 4CZYB 4QMMA 4X0MA 5FXRA 4DGMA 1RW8A 2NPQA 3FQSA 5B2KA 3DJ6A 2HENA 3CP9A 4A9YA 3TWJA 3ZUVA 3FZSA 3KC3A 2F2UA 3N51A 2B52A 3DBCA 5AUVA 4QTCA 3R22A 3QQLA 2O3PA 4KS7A 4R3PA 3TNQB 4RSSA 4AS0A 1PHKA 4BF2A 1OL5A 2ZDUA 2DYLA 4IJPA 3PY1A 2HYYA 4TWNA 4U80A 5HBHA 4BI2A 1KOBA 3PP0A 4DH8A 5LMKA 3BBWA 2VGPA 3LFFA 5FTOA 2G15A 3RPYA 3P86A 4KB8A 3ZU7A 3OWJA 2OWBA 3IDBA 5TF9A 2HXLA 3EQFA 3FQEA 3DLZA 3C13A 3SC1A 2NNWB 1W0XC 4JI9A 4AGWA 3PG1A 1AQ1A 4H39A 4DAWA 4I22A 1E1VA 5AAEA 3MESA 4RX9A 2P55A 3CS9A 2QD9A 1B39A 1H0WA 1OUKA 5H2UA 4B0GA 4QTAA 5ANDA 3A7FA 5T3QA 3NW5A 4F63A 4YNEA 1HOWA 4OLIA 4HGTA 3SXRA 5HVYA 4IB5A 3MIAA 3ZO1A 4GJ3A 4E8AA 2JEDA 2OI4X 4RPVA 4BB4A 4YTHA 2PZPA 3KCKA 3VAPA 1ZRZA 2R3RA 3NWWA 2FSMX 2QOBA 5DVRA 2PUUA 3ZSHA 2OZAA 3MV5A 3HA8A 4DG2E 5IKWA 4O82A 4BBEA 5K5XA 3QLGA 4BC6A 2QG5A 2XM9A 3Q9ZA 3Q2JA 3UQFA 1UU8A 2W1EA 4NCTA 2V5QA 3V51A 3QUPA 4RVLA 3RTPA 2X6EA 4DEGA 4R5SA 5CEIA 4RJ8A 3WIGA 2VWWA 3IONA 1IAHA 2C6IA 1GZOA 2PSQA 4LGHA 2VWBA 2BIKB 2CKPA 5KHWA 3FLYA 2R0IA 4RJ4A 4ZOGA 4C4IA 4LGDA 2ZM1A 4L01A 1Q41A 2C68A 4IBMA 2XIKA 2P3GX 3HLLA 4Z55A 2PULA 3I60A 4QTDA 3LFEA 5LWMA 3NAXA 4LG4A 5LVMA 3BX5A 3Q53A 2PUPA 4QMZA 3PWYA 5JKGA 3HUCA 3RAHA 5FXSA 3PA5A 3FKNA 3CBLA 4PTGA 1FVTA 4F9AA 4MF0A 2X9FA 4FE2A 3HRCA 4ZTHA 3NNVA 1PRYA 2OO8X 3DU8A 4UALA 5M08A 1M2PA 3BV3A 5IH6A 4TZRA 4CQEA 1H0VA 4F9BA 3ZO3A 4J95A 3A62A 3Q96A 2W4JA 5JGDA 3FI3A 4O7TA 5AADA 2F57A 3EMGA 3FZTA 3R02A 4O0YA 4K8AA 4A9TA 4QMPA 3T9IA 4BGGA 5M55A 2DQ7X 4APCA 1H27A 5L8KA 1WZYA 3VS1A 3D14A 2EWAA 2XNEA 2UZTA 4LOPA 1E9HA 5AM6A 5HIDA 4AN9A 3UQCA 3AC8A 3HV5A 3PVWA 4O6EA 4FYOA 5K3YA 3ZRMA 3LCTA 5AUUA 2WU6A 3AC4A 4EZ5A 3SOAA 3S00A 3H0YA 4O7VA 1OZ1A 4KKGA 4Z16A 4YNOA 5IEYA 1W84A 3CTHA 2W5AA 5IA5A 1X8BA 1YOLA 5BX0A 3MFSA 5CF8A 3NVMB 2FH9A 5DI1A 1UU7A 4I5CA 4UXLA 4ASXA 4BCIA 5KBRA 3OS3A 2WO6A 3QUDA 3UZTA 3D0EA 5GJGA 4F9CA 3SA0A 4S32A 2OLCA 3LJ1A 4MX9A 4YZNA 3QQJA 5CYIA 3ORNA 4I4FA 4CV9A 3QD0A 4FV8A 3IDPA 5KZ0A 2XZSA 4G31A 2REIA 2HOGA 3NW6A 2VTAA 4O7ZA 4WNPA 1IA9A 4C4HA 5DNRA 4L45A 3P7AA 4AP7A 4F7JA 2BRGA 4KD1A 1PKDA 1WAKA 2VTJA 3CPBA 3QQKA 5CZHA 4D2VA 2XNOA 2W99B 2BAQA 5HU9A 2WTCA 2YDIA 3MH2A 3Q9WA 3VUMA 4UX9A 2VTTA 3TKUA 1PXIA 3A61A 3RAKA 5E90A 1QMZA 2IN6A 2PVNA 1OIUA 4AA0A 1BKXA 4IZ5A 4EUUA 4FT0A 4DFZE 4V0GB 4U41A 4YJSA 2WTKC 5T68A 2YHVA 5DYJA 3MA6A 1S9JA 4Z7HA 1FGIA 2QC6A 2XM8A 3HYHA 1YXUA 4FK6A 1J1BA 4AE6A 3EOCA 3COIA 3MPMA 3JS2A 4HVIA 2PMIA 4IIRA 4DH5A 4UWBA 5F4NA 3F5XA 3F9NA 3CJFA 5JH6A 1K2PA 3N4VA 2XBJA 4FKWA 5DWRA 2QKRA 2OF2A 3GI3A 3NIEA 2OIBA 2V7OA 4FV3A 4PY1A 5AP0A 1UNGA 1WBPA 2PWLA 5IUGA 4H3BA 4XCUA 3H30A 5H8BA 5JN2A 4AZSA 2R3JA 4WUAA 3HV4A 4K0YA 5CNOA 3ZEWA 2Z8CA 1Y57A 4BCGA 4L44A 4YO4A 5FLFA 4U81A 3NNUA 2YM3A 4FKRA 1JKKA 4I5MA 4TNBA 3NUSA 3V8SA 4M0YA 3V01A 4A7CA 2CN8A 4BYIA 3AT2A 2HZIA 3RM7A 3LJ2A 2VX3A 5A3XA 4UB7A 5HVKA 2J50A 5AMNA 3G15A 2LAVA 3A7HA 3QHWA 3TTJA 2XIXA 4ZK5A 3NR9A 4IE9A 1FMKA 2UW0A 2ITWA 1XO2B 4PDPA 3R0TA 3HEGA 4Y5QA 4J71A 4X2KA 2X7GA 4NWMA 1QCFA 2R3KA 3F88A 4FR4A 3FQHA 4YJPA 4QP7A 4QMLA 4JG7A 2YISA 3E62A 2ZV2A 4AT4A 3NYOA 5KZIA 1AGWA 2ETRA 2UZWE 3FSFA 4O1PA 4OTWA 5AX3A 2Q0NA 2VO3A 3GCUA 3FLQA 3GU5A 3QYZA 5B7VA 3R9DA 4E5WA 2DWBA 2JITA 1V0PA 4PPBA 1Y8GA 4FSNA 1WFCA 4R77A 3C4WA 4CFFA 4OTRA 5IG1A 4QQTA 2ACXA 3BBTB 5DHJA 4DEBA 2VTIA 4ZTMA 4F1TA 2WMWA 3IW8A 3O8UA 5LCKA 3C0IA 4MBLA 4L7SA 3PPJA 2ZMCA 1Q99A 2H6DA 5EYMA 3ZLWA 3LW0A 2QR7A 4QMXA 3MH0A 2C5OA 3RVGA 4LRMA 4M67A 2BVAA 3DFCB 1TQPA 2QU6A 4IWOA 2X9EA 4XH6A 1KWPA 3EL7A 4GFGA 2OG8A 4AW2A 4CG8A 1Y91A 4OW8A 3F3VA 4NZWB 3POZA 3F61A 4WOVA 4H1MA 4XS2A 3LM0A 5HLNA 3E88A 5E92A 4PMSA 2I7QA 3V5LA 3CY3A 4ACDA 3IO7A 5CU4A 4QMYA 4CFUA 1U4DA 3GFEA 3PVGA 4FI1A 4C2VA 4YLLA 2EVAA 4C8BA 3MFRA 2ITPA 4KRDA 4D2RA 3DAEA 3KMWA 5E8ZA 3F82A 4M69A 3Q52A 3UVQA 4QPAA 4RJ5A 2C0IA 4X3FB 4JDKA 4Y85A 4RZWA 1H4LA 2CN5A 2CCHA 4DGLC 5BUJA 1MRVA 4YLKA 4JIKA 4YR8A 5AAFA 3FZ1A 3UYSA 3V5PA 5CU2A 4DG3E 4E6QA 4WRGA 3MY5A 3LMIA 2PVLA 3FY0A 3ORKA 3FI4A 3I1AA 5C01A 3R7OA 4HW7A 3OMVA 5DLSA 4MHAA 3W16A 5L2IA 2ZM4A 3C1XA 3DJ5A 3SG9A 4IAZA 1V0BA 4BDJA 5CANA 4C4GA 3TZ9A 3L8SA 3RK5A 3OW4A 3B8QA 3O23A 4WBOA 4M13A 2YJRA 5AUWA 4MEDA 4TY1A 4GK2A 1OKWA 3ZM4A 3IW5A 3RWQA 2CLQA 2IZSA 3KRWA 4JBOA 3NYVA 3LQ5A 3WIKA 4CTBA 4XG6A 1O6LA 5ANIA 2PVMA 4XHKB 4ORKA 4EYMA 4KA3A 3KULB 4CV8A 3D5XA 2BZKB 1YOMA 4UYNA 5BYLA 2FSTX 4EK3A 2GHGA 4JX7A 3UOJA 5C27A 4QP1A 3LOKA 3EQPA 2OFUA 4XG3A 5IF1A 3BYSA 1XQZA 4GT4A 5CT7A 5ANOA 2V7AA 3D2KA 3SW7A 4QMWA 5CAPA 3G9NA 5AIRA 1PMNA 3EN7A 1FPUA 5CEMA 4QP3A 3KF7A 4QPSA 3WI6A 4O83A 3ZLSA 3CKWA 3W2OA 3LXPA 2PL0A 5HCYA 2W17A 2GS6A 3QKMA 3WARA 1WBWA 2NP8A 2YAKA 5J5SA 4ZSEA 3C4XA 3VUTA 3WE4A 3PWDA 5M06A 2JDRA 2P33A 4WNOA 3QLFA 5A54A 1YHVA 4JDJA 3V6SA 2C5XA 3JXWA 3LFDA 2QLQA 2FO0A 2UZBA 2WAJA 3D5UA 4TN6A 2IJMA 3VVHA 4ASDA 4I0SA 4O0SA 3OXZA 4BYJA 4FT5A 1RE8A 3QCSA 3UP7A 1H28A 3W2PA 3Q5IA 5HCZA 4WT6A 1LPUA 2BRBA 3O50A 3OY3A 4DFUA 4FV9A 1JVPP 2R7BA 3OT3A 4P5ZA 3MDYA 5D9HA 2WMQA 4RIXB 4GFOA 4FIFA 5IDNA 1XH5A 5CVFA 4L3JA 3DLSA 2C0TA 3CTJA 4I6FA 5CSHA 5CXZA 5LMAA 1ZMUA 3TN8A 2XB7A 4BCPA 4QP9A 4K77A 2Y6MA 3WBLA 2J0KA 1U59A 4KIOA 4S2ZA 2YLEA 2E9UA 4LL0A 3UMXA 1XWSA 4QTBA 3ITZA 2VNWA 3E3BX 3NAYA 4EOOA 1OKZA 4ZTNA 3H10A 3VQUA 3TDWA 5A4TA 3C4EA 5ETCA 3ULIA 4YTIA 1ZLTA 4NSTA 4CZTA 3QTWA 2Y4IB 3QC9A 4LUDA 3VIDA 1WBVA 3VS4A 3ZTXA 5I3RA 3OY1A 4D5HA 2CJMA 3TL8A 5BYZA 1JSTA 2B9HA 4OAUC 4OBOA 3FL4A 4TYGA 4XMOA 4ZLYA 5DFPA 4WO5A 5E8TA 5ETAA 3UOHA 3O7LD 2DS1A 5T6KA 4MXOA 1REKA 4AU8A 4NCTC 5FXQA 5EYKA 3BU6A 4EOQA 2RGPA 1CKPA 3EFWA 2R3FA 2UZDA 1L8TA 2G2FA 3SOCA 4RGJA 4M14A 5EM5A 4HGLA 2BFXA 3OT8A 4J8MA 1B38A 4GW8A 3QBNA 4O0RA 5HI2A 4DTAA 3AC5A 3W2RA 3ATSA 1MP8A 2XNMA 3NYXA 3FPMA 4GH2A 4MXXA 4RJ7A 3QCXA 4RVMA 1NT2A 4TYHB 5L2QA 3EFKA 3E7VA 3ZRKA 3Q9XA 2I40A 5JZNA 2UW5A 1YHWA 4I24A 4HNFA 2C0OA 4IMYA 2JFMA 4BCQA 4C34A 4EQMA 4FV7A 3S1HA 3JY0A 2J9MA 3W32A 3EZVA 4BDBA 2ITZA 5LWNA 3QZFA 4LOQA 2RKUA 2VWVA 3BIZA 3HMPA 5JRQA 1FVVA 2OJ9A 2Y8OA 1XH6A 4NFMA 1PXMA 4XRJA 3VBTA 3HMOA 2GTMA 3HAVA 4J97A 4BDHA 5KMLA 3P9JA 1GZ8A 2XP2A 4BY9E 3C0GA 3THBA 3QQGA 3D2IA 2A4LA 4C62A 4NM7A 5I3OA 5L6PA 1ZY5A 1CTPE 3FZPA 4JQ7A 3KK8A 5BMSA 1XH4A 3LCDA 2R3GA 3QQFA 4B8MA 4AGDA 4E20A 3QRJA 4G17A 4XYFA 5DMZA 4BWKA 5M56A 2W1CA 2JIVA 1PW2A 4USDA 4NIFA 5IH4A 3PDTA 4UYAA 1H00A 4RIXA 3D9VA 3R8ZA 1V0OA 4ITIA 1YXVA 5GJFA 4EWQA 5AR5A 4IEBA 3EYGA 3MVJA 3UC4A 4GS6A 3E7OA 3PIZA 5AR4A 3PYYA 5JRSA 4Y46A 5C4KA 3A8XA 2OIDA 2PY3A 4XBUA 2OXDA 5E8UA 3FSKA 2Z7LA 3K5UA 3QZHA 4JDHA 4YHFA 5E91A 3I0OA 4G34A 5J95A 1QPDA 3UIUA 1FBNA 5DR9A 1AD5A 3HA6A 4LM5A 5DE2A 3HKOA 2C6DA 4EC9A 2Q83A 2YEXA 3ZDIA 1KOAA 4MKCA 2YJSA 3FMEA 5E8YA 4J53A 1FVRA 4X2GA 2QCSA 2YCSA 3KVXA 4HGSA 4D9TA 3DNDA 4IWDA 5F95A 2A27A 5A6NA 5H9BA 4JLCA 3MJ2A 3NZ0A 3R7VA 1U5RA 2ETKA 3TUBA 3FXXA 2W1GA 2XKFA 4QP2A 3ELJA 5K0XA 5EYCA 5IQDA 4IX6A 4C37A 3N4TA 5IQAA 2RG6A 3L9NA 4DA5A 4PDOA 4GG7A 3SRVA 3NGAA 1KUTA 5E7RA 3GQLA 3UVRA 3W18A 1YDTE 4G16A 3UQGA 4XJ0A 4CLIA 3ZZEA 1GZNA 1O6YA 2WTDA 4FTKA 4CRSA 4MAOA 2UW4A 3P0MA 1UKIA 3C5IA 3L8PA 4E4XA 1G3NA 4IM3A 3RK9A 4A4OA 3I6WA 4RJ3A 4AFJA 5HO6A 2E9NA 1ZAOA 3A7GA 2JAMA 4C0TA 3TNIA 1STCE 1WBTA 2J2IB 4B99A 1V1KA 2WQEA 4A9UA 4D58A 2ITNA 4V04A 3ZZWA 3C51A 4IADA 1JAMA 3JY9A 2XNPA 4IVAA 3T8OA 2UW9A 2XK9A 4XV1A 1VJYA 5AR7A 3ZSGA 3FMMA 4FKGA 4AAAA 4W4YA 1A48A 5IUIA 4PL3A 2I0YA 4B8LA 2UZLA 2H9VA 3FXWA 3MBLA 4MWHA 4C4FA 4RA5A 3MW1A 4EZ7A 3RPVA 3AXWA 5FM2A 3EN6A 4BGQA 3UP2A 3BEAA 3BGQA 3ENMA 3I79A 1GOLA 2O65A 1OIYA 3CPCA 2JGZA 5HX6A 3JUHA 3GBZA 5B2LA 3EN9A 3TCPA 4DLJA 3GC0A 5IQGA 2PMLX 5TOZA 3EFLA 3FUPA 4UBAA 3MPTA 1TVOA 3KKVA 4XG7A 4G3GA 2VX1A 3I6UA 3GUBA 4MK0A 3ZXZA 4PMPA 3LPBA 3ZC6A 1JWHA 1WVYA 1YQJA 3EQRA 4D2TA 5AIKA 3VUGA 2ITQA 2WOUA 4FV4A 4G9CA 4HCVA 2OXYA 1NVRA 4GU9A 4FF8A 3QTZA 4F9YA 1XH7A 4YJNA 4MXCA 5BMMA 3F5PA 2R7IA 5F94A 4JXFA 3KK9A 3K54A 2AUHA 3CQWA 4IJ9A 4WD5A 3HV6A 1F5QA 1DS5A 4IC8A 5L6OA 2C47A 3BU3A 4TTHB 2UZNA 4WSYA 1QPCA 2QI8A 3OTVA 4YC8A 4H05A 3EKKA 1MQ4A 4X6RA 2ZJWA 2PVYA 4FTQA 4YSJA 1UWJA 3R2BA 4MNEB 2RFEA 5LQFA 3QTXA 1BX6A 4TPTA 4C33A 1PMUA 3VBVA 2YIRA 1VEBA 3FMKA 3GB2A 3TV6A 5CALA 4K33A 4RJ6A 4E4LA 3QF9A 3U55A 4MVFA 3C50A 1J91A 3Q4CA 1FOTA 4DN5A 2V62A 3IQ7A 3RNIA 2J0IA 4FYNA 3TZ7A 2WKMA 5HNGA 4CYJA 3RAIA 3OWPA 4AQCA 4ZS4A 4FA2A 3AMBA 1KE6A 2PE2A 3PG3A 4OTGA 4BFMA 1HCKA 2BAKA 4RX7A 1UNHA 2HWOA 4L6QA 3VUHA 2VWXA 4FSMA 5FEDA 3L1SA 3LIJA 2R3HA 2XK8A 3E87A 4RZVA 4F6SA 5JT2A 1FGKA 4CFVA 4AN2A 3QZGA 2F7XE 4OBPA 2YITA 1VYWA 1XH9A 1M7NA 1IEPA 1OBDA 3QQUA 1MRYA 3HX4A 3TKIA 2XKDA 4KWPA 4WNMA 4DEAA 5FBOA 4E3CA 4F09A 3HL7A 3O7LB 3TUDA 4KIKA 4OT6A 4E5BA 3OHTA 3MTLA 1OL7A 4O22A 3FBVA 4DG0E 2AC3A 5D7AA 5AR2A 3U9NA 4DFBA 4ZMEA 5HVJA 5IA4A 3UOKA 4BN1A 3PXRA 5L6WL 4EK5A 3KXZA 3ORIA 4PQNA 4NK9A 3GOKA 4NFNA 1DI8A 3F3TA 4U3ZA 2XNGA 2IVUA 4KBKA 5I9UA 3KRLA 5G6VA 4GUEA 1OPJA 3POOA 4RMZA 3P23A 3I7BA 3Q4UA 3ZFMA 3HRFA 1MQBA 2WD1A 4ZSLA 2PZYA 3ZC5A 3EJ1A 3KL8A 3ZONA 2XBAA 2O2UA 4CQGA 3NVKI 2ZVAA 3Q4TA 4BHZA 2GQGA 4XRLA 3RCDA 4JAJA 4JR7A 1XJDA 4K2RA 3FI8A 2WFYA 4BDGA 3A8WA 3H9FA 4I5HA 2QLUA 3E8DA 4BDDA 1LEWA 2W05A 1BL7A 3E92A 3IGOA 3LAUA 2X2KA 2I0HA 3SXFA 2JIUA 1OL6A 2W4KA 5A6OA 3IK3A 4W4XA 4EOSA 5BQ0A 5CEOA 3GU6A 4RWJA 2UZOA 2V0DA 3A2CA 3IW7A 3QQHA 4TKSA 4C3PA 4ENXA 4MNEA 2C6MA 1GJOA 4M15A 5EM8A 3CY2A 3ZYAA 4RC3A 1UKHA 4U0IA 4FV6A 5CWZA 5HCXA 4IX3A 2CNVA 4FTLA 5DGZA 4GVAA 5CI7A 5J1VA 4TT7A 4R1VA 5LVNA 1YDSE 4BTMA 5AUZA 2XJ1A 2YACA 3O2MA 3SVVA 2X4FA 3PA3A 4BTJA 4F0IA 4L67A 4CCUA 1BI8A 3BV2A 4BGHA 4C35A 3SG8A 2XEZA 2YIQA 4Y72A 3P1AA 3QALE 4Y73A 4YUQA 3ROYA 4CZUA 4BCMA 3VBXA 5BVDA 4RBLA 5EI8A 4BZDA 2VTHA 1J3HA 4EJNA 3VO3A 4USEA 3R28A 3K2LA 5I9YA 1TKIA 1YWNA 2QG7A 5BUEA 2J4ZA 4EOPA 3R7GA 4FKUA 1F0QA 3R8PA 5DT3A 4EOIA 4G1WA 3ACKA 4RIWA 3W8LA 2WTVA 4XUFA 2PE0A 5AP3A 4MD9E 3IDCA 1J7IA 5EQPA 3UO5A 1LR4A 4XG8A 2WZJA 4QMVA 3QRUA 3GT8A 3U87A 5IDPA 4YHJA 5D11A 3MTFA 3BYUA 4WRSA 3BYOA 3Q9YA 4O38A 4NW5A 5HLWA 2QHNA 5FGKA 4EKKA 4DTBA 4QRCA 2R5TA 3QGYA 5J79A 4OT5A 5EW9A 4M8TA 4CGAA 3OWKA 1H26A 5IQEA 3E3PA 4FIHA 4QYFA 1IAJA 4PNIA 2OJJA 4I6HA 5M51A 2FB8A 4ALWA 3BGPA 3SD0A 1PYEA 3ANQA 5CVHA 2YWPA 2A2AA 4XP3A 4EBVA 4KIKB 3OCSA 3CIKA 2BHEA 4FVPA 4DITA 5TR6A 5HZNA 3NSZA 2RF9A 3O8TA 4AGCA 5J9LA 2J5EA 2R0UA 3OUNB 3OOGA 3CXWA 4FSTA 3VS0A 3DXQA 1Z5MA 2B53A 4BHNA 3R1YA 2G2IA 2YZAA 3AQVA 4DINA 1KE9A 4FNZA 2BRMA 1NA7A 3S0OA 1P14A 2C3KA 3H0ZA 5HNIX 5HE2A 1SMHA 3HV3A 1Q8UA 4MD7E 2R3OA 4QQ5A 1L3RE 3DQWA 4IHPA 5AUTA 4ACGA 3ATTA 1JNKA 4FTIA 4XV9A 4EH6A 4EKLA 2VO6A 4MTAA 3ZLYA 4GKIA 2IW8A 4BI0A 3EIDA 5FDPA 3FDNA 4C4JA 2ZV7A 2P2IA 2YERA 4QMSA 1Q4LA 3R73A 2VD5A 3TV7A 1F3MC 3FLSA 3U9CA 3ZOSA 4NL0A 2WTWA 3FYJX 2I1MA 3MVHA 5F9EA 5IMEA 4DT9A 1SYKA 4BR3A 3OZ6A 3QTUA 1Z9XA 4B4LA 3WOWA 2YDKA 4I20A 3UIMA 2WU7A 4X2JA 5AUXA 3TI1A 1ZYCA 4QMNA 5K9IA 2PMOX 2NRUA 3GU7A 2WMSA 2E9OA 2ITTA 1OGUA 4I23A 2P2HA 4FTTA 4L53A 2O63A 4U3YA 3V04A 2HCKA 2X8EA 3R7EA 4CNHA 3R8UA 3HV7A 3RHXA 3ROCA 4S30A 2PK9A 2KTYA 2C6KA 1M2QA 3PLAE 3R8VA 4E4MA 1LEZA 3BE2A 4N4SA 3SHEA 4PV0A 5ANGA 4O1OA 1XBAA 3TTIA 3QU0A 2G1TA 2PVRA 2R3NA 2Y0AA 3IKAA 2J90A 4MWIA 4E4NA 4PWNA 1GNGA 4XBRA 5EW8A 2VTPA 2A1AB 4I3ZA 3QFVA 2BTRA 4FKIA 4N6YA 4OTHA 4DEHA 2ESMA 5LJJA 2RFDA 2QU5A 1QPEA 3DZQA 4H3QA 2UV2A 1OL2A 4JQEA 5CVGA 3MY0A 4DEIA 4AOIA 4FEUA 5JK3A 3ORZA 4V0GA 5DEWA 2J0LA 1DAWA 2ZV8A 2CSNA 3CC6A 3EQBA 2OJFE 2VTMA 3P08A 4HVDA 4JBPA 3LCOA 4IXPA 3WZDA 4R8QA 4TWPA 3RZBA 4DF3A 5KO1A 3QHRA 3C5UA 3ANRA 2R4BA 4EK8A 5D12A 1YI4A 5LVLA 3AMYA 4NM3A 4DE4A 2X39A 3VRYA 4PF4A 2W9ZB 5BVKA 5IQBA 3PXZA 2UVYA 5E8WA 5L3AA 5C8NA 3BE9A 1ZOEA 3MVMA 3DKCA 3FLNC 3WZUA 4FG8A 5HQ0A 4FKSA 3BQRA 3OBJA 5HO8A 1IA8A 3ULZA 4F7NA 3TM0A 4FODA 4YBJA 4WG4A 2GS7A 3PIXA 5EH0A 3ZEPA 1LP4A 2UW6A 2CLXA 3LFQA 4ZTLA 5HESA 4EK6A 1PXKA 1Z57A 3DB6A 5HBJA 2X2MA 1JQHA 4KS8A 2BHHA 4L00A 4OTQA 3U51A 4FG9A 4I92A 2W06A 2XCHA 3QKLA 4IVDA 5CU6A 5JSMA 1P2AA 3HP2A 4WUNA 2FGIA 2XA4A 1BL6A 3DKOA 3LQ8A 4TRLA 3K5VA 2ZV9A 5KMJA 2BCJA 3LM5A 4GIIA 4CRLA 1KE8A 2WMVA 2UVZA 4AZVA 3HZTA 3WYYA 3ZS5A 2C1BA 2X8IA 4FZDB 4XG2A 2E2BA 4ACCA 5AAGA 2IW9A 3F5UA 4FZFB 4W8DA 4YGAA 4M0ZA 2R3QA 2WIPA 4BCFA 3R83A 3BQCA 2YM8A 4KKEA 3I0QA 4FIJA 3NDMA 4JJRA 2GFCA 4YMJA 3D7ZA 3QTRA 4OGRA 4RVKA 4FTCA 3V5TA 4HCUA 4RC2A 4EHVA 5JZJA 4EYJA 5KHXA 4YURA 4CMUA 5CAVA 1SNXA 1OMWA 2XRUA 4ZLOA 2RSVA 1CM8A 2YCQA 3W33A 2ONLC 2OGVA 5FM3A 3CCNA 4PPAA 5HG8A 4QQCA 4A4LA 4O7LA 1R0EA 3FKLA 1CKIA 3DOGA 4W8EA 5H3QA 4NIFB 4L8MA 2ZDTA 2PVKA 4X2FA 5CU3A 3ALOA 3O96A 5IEVA 3PUPA 4CFMA 2CGWA 1ZYLA 4FTRA 3CKXA 1R39A 4O84A 4BIDA 3L8XA 1YI6A 4X3FC 2BDFA 3LE6A 4CYIA 3NEWA 2JDOA 1Q3DA 5F20A 5IH5A 3KB7A 3FPQA 2GNFA 3KXGA 4TNDA 1Q8YA 3LXLA 3LFNA 2A19B 4EC8A 4ZY6A 3PY0A 1R78A 4LL5A 1XH8A 3GOPA 5HICA 4UV0A 4FGBA 2HXQA 4ZY4A 3R71A 1PMVA 4FUYA 5CAUA 3KXXA 5CEKA 4GYGA 3RWPA 1KV1A 3R6XA 3ZFYA 2PZRA 4ZMFA 4U9AA 4D28A 4H58A 1O6KA 2I0EA 4F64A 4YZ9A 3FZOA 4FV5A 1HCLA 3RBWA 2FA2A 2JFLA 3OC1A 3JVSA 4I41A 3SAYA 4D4SA 2OXXA 3L9PA 2QOLA 4EHGA 1PXOA 4BIEA 3PVUA 3V8TA 2GHLA 2C6TA 5TE0A 3OP5A 3TACA 2YM7A 4CG9A 4FSUA 4XOYA 4EUTA 2QOHA 4HYIA 1ZYSA 4GK3A 5LMBA 3R1QA 4G3CA 5FD2A 3UJGA 3BWJA 4GSBA 1Q24A 3QWJA 4ANSA 3O0GA 4WBBB 2EXEA 3VN9A 3ZUTA 3OBGA 2ZB0A 3HGKA 4H36A 4R5YA 4QP8A 3QTSA 4K11A 4AGUA 2V22A 4FC0A 4ZTSA 4RWKA 4EHEA 2YM4A 2X8DA 2F7EE 3FJQE 4MF1A 4O0WA 3FAAA 5EOBA 4EL9A 2XYNA 3QKKA 2E9VA 1U54A 3DDPA 4MCVA 3ZSIA 3U4UA 4U42A 3II5A 3W1FA 3DK7A 3NCZA 4XNEA 5E4HA 4UXQA 4QMUA 2OK1A 3VS3A 2JAVA 4AT5A 1KE5A 1ZXEA 4F6WA 3MN3A 4M12A 4PTEA 4ZSGA 4FSWA 4LI5A 2GQSA 3QX4A 4QNYA 3LLTA 3P78A 4IANA 4KUJA 2JKOA 3E5AA 4P90A 3TXOA 5AA9A 2CCIA 5GZAA 3ENHA 3LVPA 5GNKA 3ZHPC 4C2WA 3O71A 2XVDA 3VBYA 5HD7A 4DFYA 3HP5A 2R9SA 2Y6OA 2W1FA 4D0XA 2XRWA 1ZWSA 3ERKA 4CMTA 4AZEA 4UMPA 4Z3VA 1M17A 4MXAA 4KABA 3RI1A 3TUCA 1YWRA 3MFTA 4YZCA 3ZO2A 4IB0A 1I44A 2HW7A 2VTQA 3Q60A 3PXQA 3UZPA 2XF0A 3E63A 2JKKA 1NW1A 4RQKA 1PXLA 3QUEA 5B0XA 4EJ7A 4G2FA 3DBQA 4TYHA 2PVFA 2BILB 4GJ2A 2PTKA 4RA4A 1JSUA 4ANLA 4FZ6A 5LOHA 4FTMA 3VS6A 3EH9A 4DH3A 4Y95A 2QKWB 1ZMVA 3KA0A 3R7IA 3TG1A 3BWFA 1RDQE 4O91A 4IB1A 1JLUE 3W10A 5HORA 4S33A 3BEGA 4FT9A 4FGRA 2VRXA 2PU8A 2AC5A 2HZ0A 4K9YA 3RALA 3DXNA 1ATPE 4M66A 4JQ8A 5KNJA 4CCBA 2SRCA 3DGKA 4HZRA 4ANNA 3JPVA 5ANKA 2GCDA 3BYVA 2HZ4A 5AR8A 2C6OA 1YKRA 4EH7A 2XYUA 2YIXA 2ZMDA 4Q2AA 4HOKA 3LFCA 2YZLA 1U5QA 2VWUA 5I9WA 3SGCA 1IG1A 1OITA 3NNXA 3NUYA 3AC1A 3QD3A 4EHZA 2IW6A 3EQIA 4YJQA 5KMKA 4DEEA 1Q5KA 5H8EA 1XBBA 2QOQA 3D5WA 4D1ZA 5D7VA 5CENA 4FVRA 3RZFA 3MI9A 4GVJA 4K1BA 3I7CA 5DEYA 2JD5A 5DN3A 4CXAA 4QTEA 5KX8A 4YZMA 3MB6A 3BCEA 3EN5A 3Q6UA 2JBOA 2JIIA 4IM2A 2GSFA 2UW3A 5FP5A 3MYGA 3ACJA 2C6EA 5DA3A 1YHSA 3MB7A 1UU3A 1ZYDA 5HO7A 3FLWA 3QD2B 4IDVA 5ANEA 3W2SA 3M2WA 5HE0A 3NW7A 4FMQA 4AW5A 3E64A 5IUHA 5J5TA 1W7HA 3RCJA 4MNFA 2OFVA 5BUIA 2BZIB 2XCKA 3KXHA 3QTIA 4RIOA 4YJOA 4U8ZA 5CAOA 4W4VA 1APME 3UNJA 2O64A 2W96B 3VJNA 4F9WA 5FUTA 3WF6A 3QX2A 4NTSA 4OR5A 4DGNA 1WBNA 3SXSA 3KGAA 2QO7A 4D4RA 5IQHA 3LLAA 3UC3A 2BDJA 1DM2A 3I5NA 4RWIA 4F0FA 4C38A 2VX0A 4N57A 1OPLA 3SKCA 1W8CA 1G8SA 3QC4A 4DCAA 4FL3A 4IAIA 3LQ3A 2ZOQA 4X3FA 4M69B 3F2NA 2YM5A 1H8FA 3AGMA 3FMDA 3BRBA 4I0TA 4RT7A 3UO6A 4RIWB 3R8MA 4FT7A 4GT3A 4ZIMA 4PDYA 3BLRA 2GNHA 5CF4A 2IWIA 1H24A 4ZAUA 5J7HA 1JBPE 1VZOA 5EDPA 5AR3A 3R63A 4CFWA 4K18A 4OUCA 5E9EA 3DB8A 4DBXA 3WZJA 4KIPA 3UMWA 3AD5A 4R3RA 3VQHA 4TWOA 3M1SA 4BDCA 3BHVA 2QQ7A 4G5PA 4GMYA 4ANBA 2G9XA 1J7UA 2YDJA 4BDFA 3TJCA 4I5PA 4FX3A 1Q62A 3GFWA 3KVWA 3R7YA 3FKOA 4AOJA 3RM6A 2ZB1A 4A9SA 4F7LA 2J0JA 4EOJA 5JQ5A 4IWQA 4V01A 2QOOA 3QXOA 3CEKA 1K3AA 4HCTA 5CZIA 5GJDA 4D1XA 5C26A 3KN5A 2BIYA 5EG3A 3VBWA 5A9UA 3DTWA 2VUWA 3RPRA 4DH1A 3R21A 3KMUA 5J8IA 3KY2A 4GRBA 1KV2A 4FIIA 4LV5A 5AWMA 5KE0A 3U54A 2UZEA 1NVSA 4LUEA 2A0CX 2IVVA 5HNBA 4GFMA 5JFWA 3LZBA 4W4WA 2O8YA 2YM6A 1GIIA 5M4UA 3CTQA 1OUYA 5EQYA 1P4FA 3GC8A 4H1JA 1WCCA 1OECA 3Q5ZA 3VF8A 4BZNA 4HVSA 4QP6A 5C4LA 2H8HA 2CHLA 1I09A 2YA9A 5KMIA 2WELA 3UE4A 4JT3A 3DKGA 5FBNC 3PSBA 1GAGA 4GCJA 5EM6A 4G6OA 5BVOA 4F70A 4UY9A 2BRHA 4F4PA 3JVRA 3L9MA 2WMRA 3NMUF 3FMJA 2BROA 2CDZA 2GMXA 3RGFA 4RFYA 4AZFA 4C3RA 4Q9SA 3BHHA 4E1ZA 3DKFA 4HVHA 1SVHA 4FKQA 4O2ZA 4C59A 4ZJVA 3PJ1A 5HGIA 4I93A 4FSRA 3PIYA 2GNLA 3BHYA 4FEWA 5AV1A 3D94A 4ZS0A 2BUJA 1PF8A 4NJDA 4F08A 2G01A 4L9IA 5HD4A 4JG6A 4S34A 4TYIA 4PL4A 5GIPE 3LFSA 5HLPA 2ERZE 5JMSA 2VAGA 3WE8A 2QODA 1Q3WA 4E93A 3EKNA 3GCPA 5HG7A 4ACHA 5JGAA 5JFSA 3KRJA 3DZOA 4JRNA 4AG8A 2X4ZA 4GEOA 4YP8A 5DRBA 4Q5HA 3FHRA 3BPRA 4PDSA 4CKJA 3VRZA 4LMUA 4XV2A 4AXAA 4YU2A 4ZSAA 5AA8A 5F1ZA 4TWCA 2B9FA 4MH7A 3ORTA 3N4UA 3UYTA 2VO7A 4BL1A 4ERKA 3F6XA 1REJA 3DNEA 3PJ3A 5CSWA 4D2WA 5CY3A 3VF9A 5CASA 4JR3A 4CVAA 2CGVA 3B2TA 3I5ZA 1WBSA 3OUKA 3DPKA 2X6DA 5AP1A 2VNYA 3TNPC 4NW6A 1ZZ2A 3LMGA 4G3DA 5B2MA 4LMNA 3A7IA 4M7IA 4RX8A 2GNJA 4FT3A 4U43A 3GEQA 5G1XA 3RPOA 4ACMA 3QXPA 1SVEA 2QONA 4BCNA 4ZLZA 2JKMA 2BR1A 4Y8DA 4RX5A 4ZY5A 4FBXA 3PY3A 5M4CA 3DAKA 1H08A 3B8RA 3UTOA 4FL2A 4FSZA 2PUIA 4MXYA 2XIYA 2VO0A 3QGWA 2CKOA 5CQWA 2OSCA 4QMTA 3DAJA 4CSVA 4FEXA 1M7QA 4FV2A 3VW6A 4IZ7A 2X2LA 2JDTA 3C0HA 4BRXA 1H1RA 3ET7A 1W83A 3BZ3A 3VBQA 3ZMMA 3H9RA 5DOSA 4L46A 2F7ZE 3UO4A 5LMKC 3UNKA 3PTGA 1P4OA 2C30A 2OIQA 4PUZA 4PNKA 1OI9A 4IAAA 1OVEA 5DR2A 1CSNA 4KBCA 5CXHA 2PVHA 5A14A 1T45A 3BHUA 4DLIA 1URWA 2XIRA 5M4FA 4NJ3A 3DY7A 1GIJA 4ZZMA 3NUAA 2QOKA 4DFNA 3ZDUA 3HNGA 4R7IA 3G51A 4QYYA 2B9IA 3O17A 4ANOA 2PMNX 3P7CA 4YZDA 4D2SA 3UDBA 4OTIA 5M44A 4KAOA 5EDRA 4ZTRA 2XKCA 4FTNA 4FTOA 5CX9A 4EOLA 3EQHA 2FUMA 3TIZA 5AM7A 5HBEA 4YZBA 3GCQA 3Q32A 2VTNA 5HKMA 4M68A 5IISA 4KNBA 3R1SA 4IDTA 5E8XA 2HW6A 5AV0A 4EH4A 1YI3A 3GENA 3QCQA 4FNXA 5AEPA 4ID7A 5DBXA 1Y8YA 1M2RA 1QL6A 4P4CA 1PJKA 3W2CA 2XK3A 2DUVA 4BBMA 5D1JA 3PPKA 2CKQA 2XNNA 3MH1A 3Q04A 4MBIA 3DT1A 3NPCA 2PPQA 2C3IB 3BELA 4HGEA 5DRDA 4QNAA 4FV1A 4QQJA 2ETMA 4C4EA 2CPKE 3F7ZA 4AOTA 2E9PA 2NRYA 3FC1X 4RRVA 4B6LA 4F1MA 3A7JA 3D5VA 5AFVA 2C69A 4UZHA 3F2RA 1BLXA 4RQVA 4YJTA 3A4PA 3IS5A 4F1OA 2F9GA 4X3JA 4FSYA 5GINE 4PPCA 4YPSA 3HAMA 5KUPA 3QRKA 4H3PA 3G5DA 2WQOA 1MUOA 1U46A 2J5FA 3MIYA 5AP5A 5ITAA 1JKLA 3C9WA 4U7ZA 4Y83A 4B7TA 2I6LA 2B1PA 3MVLA 2OZAB 3MWUA 4BCHA 2RIOA 1Y6BA 3NUNA 4U6RA 2C3LA 2GPHA 4WA9A 1Q8TA 5EI6A 3WYXA 4J99A 4AE9A 5AP7A 3AGLA 3DQXA 4EQCA 5E8VA 3KXNA 4U44A 4JIAA 3H4JA 2BPMA 4WSQA 2OU7A 5ICPA 4AW1A 2R3PA 2YAAA 5A4EA 2ITVA 4TW9A 5DG5A 4FZAB 3TZ8A 4HNIA 2CNUA 4M97A 2EB2A 4F7SA 3TT0A 1CDKA 2P4IA 2UUEA 4EH2A 4BZOA 4EOKA 2RL5A 1Q8ZA 3KQ7A 3V8WA 3PJ8A 3NIZA 4DC2A 3SQQA 2ITOA 3HVCA 4Q9ZA 3GCSA 4HYHA 4X7QA 5M53A 2IVTA 2JDVA 2WNTA 4XP2A 4C58A 2ZM3A 2BFYA 5ETFA 2YWVA 4G9RA 2WHBA 3F3WA 1B6CB 2VTSA 2WIHA 3HECA 2J51A 2XH5A 5CSXA 2XK6A 2PUNA 3IOKA 3O8PA 1H01A 4P2KA 3R01A 2WEIA 1PKGA 3W2QA 4HYUA 3A99A 4RFZA 4AUAA 3JYAA 4O2PA 3ORXA 5IQIA 3FXZA 3QWKA 4IAYA 1H1QA 5EFQA 4G3FA 3LCKA 4YLJA 4ALUA 3DA6A 4M84A 5J1WA 5CSVA 3F69A 2CNQA 4FVQA 5AUYA 2WEVA 4GT5A 4CTCA 3KXMA 3ZM9A 3MJ1A 3NX8A 4UMRA 4MXZA 2B55A 3RK7A 5CLPA 4FKOA 4BWXA 4CT1A 4EORA 4G6NA 3EWHA 5HIEA 2XEYA 3U6JA 3OXIA 4X2NA 3ZUUA 3R9OA 2BRNA 5EDQA 5CF6A 2QOIA 2R64A 2Y4PA 1YXSA 3BU5A 3EQGA 4IFGA 5CTPA 5CU0A 2OJGA 2YIYA 2WXVA 5GHVA 3RAWA 4QMQA 5GZ8A 5LCJA 1EH4A 5TKDA 3MSSA 3EZRA 4CD0A 4G3EA 3MFUA 3FV8A 3HUBA 5IA1A 3LMHA 3PE1A 4ZJIA 1ZYJA 4DBNA 3UNZA 4AW0A 2JDSA 2PYWA 1WMKA 5C1QB 2VWZA 3PSCA 3PPZA 5HOAA 5KBQA 3P7BA 3M42A 2PE1A 5J9YA 2C5NA 3F5GA 3AC2A 3RNYA 4DGGA 5D41A 3RINA 4O7RA 3K3JA 1M52A 3UIBA 3DS6A 1R1WA 4IH8A 5CEPA 5JQ8A 3DV3A 3NLBA 4RIYB 5HEZA 3WF8A 4XLIA 4YHTA 5L8JA 3GCVA 3IECA 3L9LA 1FINA 4MQ2A 3IOPA 3KN6A 4V05A 4X6QC 2YCFA 4PP9A 4E26A 2B4SB 3DBDA 1YVJA 3FHIA 4IAKA 4AA4A 5HTCA 4LOOA 3R30A 4A07A 4LQMA 4FEQA 5ACKA 3SDJA 4AFEA 3W8QA 4CKRA 3E8NA 4AX8A 4UMUA 3UVPA 4OTDA 5M57A 2BZHB 4S31A 3EN4A 2PZ5A 4FV0A 2ZAZA 3EHAA 1H25A 2EB3A 4N0SA 2RG5A 3CD8A 2GHMA 3AT4A 3EB0A 3K3IA 4JDIA 1W82A 4UMQA 5FQDC 2YABA 3R9HA 4APPA 4BBFA 1YXTA 1UWHA 3OFMA 4U40A 5C8KA 3ZBFA 5BNJA 5K0KA 3VUDA 3PRFA 4ZZNA 5I9VA 4FOCA 2VWIA 4U45A 3UG1A 2C6LA 4XG4A 3MH3A 4E73A 3C4ZA 4D2PA 4ALVA 3DTCA 4O7NA 2IVSA 4P5QA 4L68A 3CR0A 4BDAA 4MYGA 4RLLA 5C8MA 4ZEGA 3HMMA 3MS9A 4BTFA 4AZWA 5L2TA 3FWQA 1KSWA 3WZEA 1ZARA 1JSVA 1ZMWA 2B54A 3LXKA 1XKKA 3KRXA 3QCYA 3GVUA 4E5AX 4BI1A 4YC6A 3LJ0A 4EWHA 2FVDA 5BYYA 5HE3A 3OVVA 2JC6A 1MRUA 3LKMA 4XG9A 4TYEA 4A06A 3TZMA 4TL0A 4PP7A 4RC4A 5EOLA 3F66A 4DEDA 4JRVA 1E1XA 4FKJA 4QYHA 2W1ZA 5E1SA 4ZSJA 3U4WA 5KKRB 3UZRA 2C5VA 3OCTA 5LVPA 5CT0A 3BGZA 1JOWB 3DJ7A 3LXNA 3P5KA 3IG7A 3OEZA 4W9XA 5CQUA 5K4IA 4TXCA 4QD6A 1PXJA 4PRJA 3VUKA 5DT0A 1IR3A 1FMOE 4RFMA 3SRVB 4BVUA 2QVSE 2XNBA 4UEUA 3PZHA 4FICA 3RP9A 4IACA 1URCA 3WF9A 2UVXA 3Q6WA 4D0WA 4ASZA 3OCBA 5IQCA 4WG5A 3SX9A 5CAQA 4C7TA 2YCRA 5L4QA 1FQ1B 3LCSA 4IC7A 4YPDA 4FIGA 1BI7A 1Q8WA 2EXCX 3QD4A 4RVTA 4ZZOA 5AP2A 5J7BA 4FTJA 4GIHA 4WG3A 3TNHA 5HHWA 3C4FA 3GC9A 2BAJA 2FSLX 2LGCA 4IM0A 2C3JA 3ID6C 4FG7A 4HPUE 2ITXA 5FEQA 4BKYA 1WVXA 1CKJA 4MD8E 4LV8A 3PP1A 4U79A 1XBCA 2BKZA 4UZDA 3KEXA 2CGUA 5K5NA 1RJBA 3R04A 4ANMA 3ORLA 4D1SA 2Z02A 3KMMA 4J7BA 2QO2A 2VGOA 2OBJA 2XK7A 3NYNA 4EH5A 2EUFB 4I6BA 4EOMA 4IWPA 2AYPA 5HIBA 1PXPA 4IW0A 1TQMA 1RQQA 4L3PA 3CSVA 1ZOGA 3NCGA 4FKPA 4BCOA 2UZVA 2P0CA 2YN8A 1YW2A 3GQIA 4EEVA 4J96A 1JKTA 2GTNA 5L2SA 3VHKA 2XJ0A 3H9OA 3OWLA 3QZIA 3LFBA 3A60A 3S95A 1BMKA 3FMHA 4WNKA 4IAFA 3FEGA 1GZKA 4ENYA 2ERKA 5BVEA 3KF4A 4J1RA 4F99A 3GU4A 3R00A 1GY3A 4NYEA 3V3VA 3OCGA 2H96A 4QPMA 3AD6A 1QPJA 2W1IA 4CEGA 3NS9A 5LXMA 4FKLA 3BLHA 3TEIA 3Q2MA 5BVWA 1PY5A 4BCJA 4DGOA 1W98A 5TO8A 3A4OX 2C5YA 1DAYA 2GQRA 3G2FA 4E6DA 4O7SA 2VTLA 3S4QA 5EI2A 1U54B 4FSQA 4CT2A 3MPAA 5JGBA 2WTKB 3VUIA 3ZO4A 4ERWA 4UN0C 4ONAA 4BDEA 5BPYA 4ITHA 3OTUA 2IZRA 3DXPA 4Q5EA 4AN3A 3KU2A 5HU3A 4UMTA 3UIXA 3U8WA 4II5A 4ITJA 3NRMA 3SLSA 3G6HA 3ODZX 4E7WA 4EK4A 1XHAA 4FZ7A 3FLZA 4GU6A 4YTCA 3D4QA 4FNYA 4KSQA 2XS0A 3VS5A 1JPAA 3P4KA 4WIHA 4ZTQA 4JBQA 2EXMA 4HJOA 3G0FA 2WB8A 5M09A 3C7QA 1OIRA 5I9XA 4AWIA 1OKVA 4IVCA 3G0EA 3F3UA 4G5JA 3OW3A 3T9TA 1YRPA 4OBQA 4MQ1A 1H1PA 5IZFA 3RJCA 2B7AA 3TNWA 3DCVA 4ZJJA 4O7WA 4YBKA 4C61A 4D55A 5GZ9A 3R1NA 3OD6X 2W5BA 1Q97A 4XLVA 3G90X 4AF3A 5CF5A 4KIQA 2BZJA 4D4VA 4CFNA 2VTOA 2XJ2A 5HG9A 4Z9LA 4A9RA 3MA3A 4IQ6A 1NY3A 2CMWA 3OEFX 5AP6A 3UGCA 3VHEA 4O86A 4R7BA 4O6LA 4DT8A 5J87A 4JNWA 4NT4A 4JAIA 5IEXA 3CGOA 3OROA 3CE3A 3DBEA 5FDXA 3E8CA 4JX3A 1K9AA 4RWLA 2XMYA 4IZAA 5KCVA 4IVBA 4OTFA 4R7HA 5LARA 2C1AA 2QO9A 2QHMA 3CLYA 5C03A 3KCFA 2J6MA 1UV5A 1ZOHA 2YFXA 3CQUA 2VN9A 3PZEA 2W0JA 3UPZA 3ZBXA 4QOXA 2CGXA 1S9IA 4FTUA 1NXKA 1WBOA 2IO6A 4JBVA 4N70A 3BI6A 1R3CA 4RLKA 5A4CA 3NUXA 4NM0A 1Y6AA 3TKHA 4CKIA 2WMBA 2HIWA 5CS6A 4ANQA 2WQMA 2W7XA 2X7FA 1A06A 5JFVA 2RFNA 3COHA 4FK3A 3IPHA 2YLFA 5CI6A 3IW6A 4BKJA 3UG2A 3PLSA 1YWVA 4FTAA 5M07A 4E6AA 3FY2A 2XIZA 3ORMA 4QYEA 5FWKK 4O81A 4NM5A 4YTFA 3NUUA 3VS7A 5AV3A 3AG9A 5FRIA 4JOAA 3ETAA 3EQDA 1CMKE 2Z60A 4XOZA 3RMFA 3JR1A 4PL5A 2OH0E 3BYMA 5EW3A 4UWCA 2HWPA 3QRIA 4MBJA 4O96A 4U97A 5DR6A 1OB3A 3AD4A 5EYDA 1PXNA 2GNIA 1OIQA 3V5WA 2BDWA 3PJCA 1LUFA 4JS8A 1VYZA 2B9JA 2GU8A 4NKSA 5DIAA 3T3UA 4F65A 4AT3A 4UWYA 2UZUE 2HZNA
chains in the Genus database with same CATH superfamily
3KULA 1ZY4A 4YSMA 4G6LA 4FUXA 2JLDA 3BHTA 3OF0A 1YDRE 4L42A 3GP0A 4LRJA 3Q4ZA 1UA2A 5BVFA 4XX9A 1O9UA 3ORPA 5IA0A 2ITUA 3VWAA 3ZLXA 3GGFA 2IZUA 5EQEA 3REPA 4L7FA 4EZ3A 2J7TA 3DK3A 3VJOA 2VU3A 1M14A 1GIHA 3TIYA 3DK6A 4DHFA 4XP0A 2WMTA 3CD3A 4LFIA 1H1WA 2C4GA 5HTIA 3F7WA 4FL1A 3T3VA 4DFXE 1R0PA 2JKQA 2OKRA 3VNTA 2G2HA 5M4IA 2X7OA 4KINA 4I6QA 4QMOA 1KE7A 2ITYA 1W2FA 2OICA 4O0TA 4YJRA 2HY81 3S2PA 3UPXA 5DT4A 2R3MA 2WQNA 4DYMA 2Z7SA 3PSDA 2XKEA 4NH1A 4YC3A 4BCKA 3PJ2A 3W0QA 2UW7A 1BYGA 3OG7A 3PXFA 4HVGA 1UVRA 4J98A 3WZKA 2WPAA 5EHLA 1ND4A 4HZSA 4L52A 4NTTA 3FE3A 4I21A 3HDNA 5HG5A 3SW4A 4Z7GA 5KMNA 1ERKA 2X81A 4J8NA 2QNJA 3G6GA 5DPVA 3PVBA 3FL5A 3GXLA 4IB3A 4GUBA 3UDSA 4M3QA 2HY0A 4R1YA 5EHYA 3SV0A 3V5QA 2J0MB 4FOBA 3GU8A 4LRKA 3C4CA 4RG0A 2IZTA 3S3IA 3KFAA 3VS2A 3LHJA 5AV4A 5JFXA 4QP4A 4WKQA 4DFLA 5GIOE 2R2PA 3AT3A 4J52A 4YJVA 4D9UA 3HMNA 4FNWA 5KKRC 4GL9A 3UODA 3RHKA 4XV3A 3I4BA 4D4YA 4QO9A 2BALA 4O27B 3B2WA 4DTKA 2IG7A 2BTSA 2QR8A 1OKYA 4CFXA 2R3LA 4USFA 1VLRA 4O4DA 4ARKA 4NEUA 2HK5A 3R9NA 2WMAA 3E93A 3M11A 2F2CB 4E6CA 4RIYA 3AC3A 3QAME 5ANJA 4ZP5A 4O7YA 4KSPA 1IRKA 1SM2A 4FIEA 3FMNA 4IZYA 5IU2A 4O0VA 5AP4A 3H3CA 5IPJA 2CKEA 3PFQA 4JL9A 3F2AA 4YJUA 5KMOA 2W1DA 5L2WA 3E8EA 4F0GA 4W9WA 4FKVA 5BVNA 2W1HA 3N9XA 3COKA 2V55A 2PVJA 2AQXA 3PXKA 3CJGA 4DHJA 3TV4A 3TDVA 5ETIA 3F3ZA 3WF7A 2WTJA 1XR1A 4D5KA 1JKSA 4BKZA 4JG8A 3EQCA 4IFCA 5A46A 3O51A 3VC4A 3EFJA 4NUSA 4C02A 1G8AA 2HAKA 4Y5HA 4EH9A 1UNLA 4PMMA 5EHOA 4ZXTA 1SVGA 1P5EA 5FG8A 4QT1A 2FYSA 3AOXA 3FYKX 3ZXTA 2VZ6A 5A4LA 5CSPA 1J1CA 4R78A 3UBDA 2ONLA 3D7TA 2WMUA 4BICA 4N6ZA 2XANA 3U6IA 2Y9QA 2OH4A 2OF4A 3I81A 2FSOX 4KBAA 4F6UA 5EKOA 3ALNA 4TYJA 4AACA 3G9LX 5H8GA 4GKHA 2OZOA 4I94A 3FZRA 3QRTA 5D10A 4LYNA 5C9CA 3GC7A 2W9FB 5TT7A 3TJDA 3R2YA 3EL8A 5FP6A 4B9DA 2Z7QA 4BDKA 5I5ZA 5J9ZA 4EH8A 5JEBA 4CMOA 4XEYA 4R6VA 1Q61A 5A4QA 2WMXA 5E8SA 4EONA 2VTRA 4NU1A 2YIWA 4QYGA 3QA8A 4L43A 5AX9A 1J7LA 3EYHA 3D15A 3PA4A 1ZZLA 4AZTA 2B0QA 5HTBA 4GK4A 3ZFXA 3CQEA 2W4OA 1T46A 5LVOA 3QTQA 3ZRLA 2NO3A 3MY1A 4YO6A 2Z7RA 5K4JA 2IPXA 3L8VA 3PRIA 5I4NA 4EBWA 4R3CA 4AA5A 3HRBA 3TYKA 3WF5A 1TQIA 3FC2A 2WGJA 3CGFA 5AJQA 2HELA 4PMTA 3QL8A 1PYXA 5DH3A 2O5KA 4HPTE 4I4EA 4C3FA 2GFSA 2GDOA 2X0GA 4C57A 3BLQA 3UOLA 5IMXA 4X21A 2XK4A 3GNIB 1OBGA 2O0UA 5E1EA 4BIBA 3FMLA 3D83A 5EKNA 5IA3A 3HDMA 1A9UA 3HMIA 3RPSA 1OL1A 1H1SA 2Y4IC 1H07A 2WOTA 5AV2A 3COMA 2W5HA 1YXXA 2R3IA 1SZMA 4GG5A 4O21A 1VR2A 2F49A 3W55A 4KRCA 3D7TB 5CEQA 2Y7JA 3AMAA 3OOMA 4BDIA 2OW3A 5L8LA 5CNNA 4ASEA 3R9RA 2QOCA 5ACBC 4O0UA 5EK7A 2GNGA 2EU9A 2Q0BA 4WHZA 4C36A 5FTGA 2Z2WA 1SNUA 4PTCA 4GV1A 3G33A 2I0VA 3WILA 2JBPA 2XUUA 3MGYA 4PX6A 4U5JA 1OPKA 3NUPA 3QA0A 5IA2A 3BKBA 4DH7A 2F4JA 3V6RA 4LGGA 1WVWA 1PMEA 3R7UA 1UU9A 2VWYA 3LFAA 4EI4A 4HYSA 5HE1A 1IASA 1G5SA 3VW8A 4L3LA 3DDQA 3P79A 3QYWA 3IGGA 2BMCA 2WTIA 3Q3BA 4GYIA 4JVGA 4K6ZA 3VULA 5FTQA 1YOJA 5EM7A 4BTKA 4OAVB 2IF8A 3DBFA 3KRRA 1OM1A 5KMMA 1BUHA 4KKHA 4O0XA 4DCEA 4A4XA 3ZCLA 2QOFA 2VV9A 2WQBA 2KULA 2H34A 2RFSA 3IW4A 3V5JA 3ODYX 2QURA 1NVQA 2X1NA 3FI2A 3OXTA 5HX8A 4NKAA 5I0BA 3NNWA 3DFAA 2BKKA 4FEVA 4EH3A 2PHKA 4FKTA 3U6HA 5FEEA 2OJIA 4P7EA 4I1ZA 3PE2A 2IEWA 3ZH8A 4EQUA 3KREA 3RKBA 4I0RA 2GS2A 5I9ZA 1DI9A 3PXYA 4IX4A 4IX5A 4CLJA 3R8LA 2UW8A 2ZYBA 5IQFA 4OTPA 4BWPA 2PZIA 4CZYB 4QMMA 4X0MA 5FXRA 4DGMA 1RW8A 2NPQA 3FQSA 5B2KA 3DJ6A 2HENA 3CP9A 4A9YA 3TWJA 3ZUVA 3FZSA 3KC3A 2F2UA 3N51A 2B52A 3DBCA 5AUVA 4QTCA 3R22A 3QQLA 2O3PA 4KS7A 4R3PA 3TNQB 4RSSA 4AS0A 1PHKA 4BF2A 1OL5A 2ZDUA 2DYLA 4IJPA 3PY1A 2HYYA 4TWNA 4U80A 5HBHA 4BI2A 1KOBA 3PP0A 4DH8A 5LMKA 3BBWA 2VGPA 3LFFA 5FTOA 2G15A 3RPYA 3P86A 4KB8A 3ZU7A 3OWJA 2OWBA 3IDBA 5TF9A 2HXLA 3EQFA 3FQEA 3DLZA 3C13A 3SC1A 2NNWB 1W0XC 4JI9A 4AGWA 3PG1A 1AQ1A 4H39A 4DAWA 4I22A 1E1VA 5AAEA 3MESA 4RX9A 2P55A 3CS9A 2QD9A 1B39A 1H0WA 1OUKA 5H2UA 4B0GA 4QTAA 5ANDA 3A7FA 5T3QA 3NW5A 4F63A 4YNEA 1HOWA 4OLIA 4HGTA 3SXRA 5HVYA 4IB5A 3MIAA 3ZO1A 4GJ3A 3AKJA 4E8AA 2JEDA 2OI4X 4RPVA 4BB4A 4YTHA 2PZPA 3KCKA 3VAPA 1ZRZA 2R3RA 3NWWA 2FSMX 2QOBA 5DVRA 2PUUA 3ZSHA 2OZAA 3MV5A 3HA8A 4DG2E 5IKWA 4O82A 4BBEA 5K5XA 3QLGA 4O4CA 2QG5A 2XM9A 3Q9ZA 4BC6A 3Q2JA 3UQFA 1UU8A 2W1EA 4NCTA 3BLAA 2V5QA 3V51A 3QUPA 4RVLA 3RTPA 2X6EA 4DEGA 4R5SA 5CEIA 4RJ8A 3WIGA 2VWWA 3IONA 1IAHA 2C6IA 1XMMA 1GZOA 2PSQA 4LGHA 2VWBA 2BIKB 2CKPA 5KHWA 3FLYA 2R0IA 4RJ4A 4ZOGA 4C4IA 4LGDA 2ZM1A 4L01A 1Q41A 2C68A 4IBMA 2XIKA 2P3GX 3HLLA 4Z55A 2PULA 3I60A 4QTDA 3LFEA 5LWMA 3NAXA 4LG4A 5LVMA 3BX5A 3Q53A 2PUPA 4QMZA 3PWYA 5JKGA 3HUCA 3RAHA 5FXSA 3PA5A 3FKNA 3CBLA 4PTGA 1FVTA 4F9AA 4MF0A 2X9FA 4FE2A 3HRCA 4ZTHA 3NNVA 1PRYA 2OO8X 3DU8A 4UALA 5M08A 1M2PA 3BV3A 5IH6A 4TZRA 4CQEA 1H0VA 4F9BA 3ZO3A 4J95A 3A62A 3Q96A 2W4JA 5JGDA 3FI3A 4O7TA 5AADA 2F57A 3EMGA 3FZTA 3R02A 4O0YA 4K8AA 4A9TA 4QMPA 3T9IA 4BGGA 5M55A 2DQ7X 4APCA 1H27A 5L8KA 1WZYA 3VS1A 3D14A 2EWAA 2XNEA 2UZTA 4LOPA 1E9HA 5AM6A 5HIDA 4AN9A 3UQCA 3AC8A 3HV5A 3PVWA 4O6EA 4FYOA 5K3YA 3ZRMA 3LCTA 5AUUA 4O4EA 2WU6A 3AC4A 4EZ5A 3SOAA 3S00A 3H0YA 4O7VA 1OZ1A 4KKGA 4Z16A 4YNOA 5IEYA 1W84A 3CTHA 2W5AA 5IA5A 1X8BA 1YOLA 5BX0A 3MFSA 5CF8A 3NVMB 2FH9A 5DI1A 1UU7A 4I5CA 4UXLA 4ASXA 4BCIA 5KBRA 3OS3A 2WO6A 3QUDA 3UZTA 3D0EA 5GJGA 4F9CA 3SA0A 4S32A 2OLCA 3LJ1A 4MX9A 4YZNA 3QQJA 5CYIA 3ORNA 4I4FA 4CV9A 3QD0A 4FV8A 3IDPA 5KZ0A 2XZSA 4G31A 2REIA 2HOGA 3NW6A 2VTAA 4O7ZA 4WNPA 1IA9A 4C4HA 5DNRA 4L45A 3P7AA 4AP7A 4F7JA 2BRGA 4KD1A 1PKDA 1WAKA 2VTJA 3CPBA 3QQKA 5CZHA 4D2VA 2XNOA 2W99B 2BAQA 5HU9A 2WTCA 2YDIA 3MH2A 3Q9WA 3VUMA 5BV3A 4UX9A 2VTTA 3TKUA 1PXIA 3A61A 3RAKA 3O5AA 5E90A 1QMZA 2IN6A 2PVNA 1OIUA 4AA0A 1BKXA 4IZ5A 4EUUA 4FT0A 4DFZE 4V0GB 4U41A 4YJSA 2WTKC 5T68A 2YHVA 5DYJA 3MA6A 1S9JA 4Z7HA 1FGIA 2QC6A 2XM8A 3HYHA 1YXUA 4FK6A 1J1BA 4AE6A 3EOCA 3COIA 3MPMA 3JS2A 4HVIA 2PMIA 4IIRA 4DH5A 4UWBA 5F4NA 3PFYA 3F5XA 3F9NA 3CJFA 5JH6A 1K2PA 3N4VA 2XBJA 4FKWA 5DWRA 2QKRA 2OF2A 3GI3A 3NIEA 2OIBA 2V7OA 4FV3A 4PY1A 5AP0A 1UNGA 1WBPA 2PWLA 5IUGA 4H3BA 4XCUA 3H30A 5H8BA 5JN2A 4AZSA 2R3JA 4WUAA 3HV4A 4K0YA 5CNOA 3ZEWA 2Z8CA 1Y57A 4BCGA 4L44A 4YO4A 5FLFA 4U81A 3NNUA 2YM3A 4FKRA 1JKKA 4I5MA 4TNBA 3NUSA 3V8SA 4M0YA 3V01A 4A7CA 2CN8A 4BYIA 3AT2A 2HZIA 3RM7A 3LJ2A 2VX3A 5A3XA 4UB7A 5HVKA 2XAOA 2J50A 5AMNA 3G15A 2LAVA 3A7HA 3QHWA 3TTJA 2XIXA 4ZK5A 3NR9A 4IE9A 1FMKA 2UW0A 2ITWA 1XO2B 4PDPA 3R0TA 3HEGA 4Y5QA 4J71A 4X2KA 2X7GA 4NWMA 1QCFA 2R3KA 3F88A 4FR4A 3FQHA 4YJPA 4QP7A 4QMLA 4JG7A 2YISA 3E62A 2ZV2A 4AT4A 3NYOA 5KZIA 1AGWA 2ETRA 2UZWE 3FSFA 4O1PA 4OTWA 5AX3A 2Q0NA 2VO3A 3GCUA 3FLQA 3GU5A 3QYZA 5B7VA 3R9DA 4E5WA 2DWBA 2JITA 1V0PA 4PPBA 1Y8GA 4FSNA 1WFCA 4R77A 3C4WA 4CFFA 4OTRA 5IG1A 4QQTA 2ACXA 3BBTB 5DHJA 4DEBA 2VTIA 4ZTMA 4F1TA 2WMWA 3IW8A 3O8UA 5LCKA 3C0IA 4MBLA 4L7SA 3PPJA 2ZMCA 1Q99A 2H6DA 5EYMA 3ZLWA 4DHZA 3LW0A 2QR7A 4QMXA 3MH0A 2C5OA 3RVGA 4LRMA 4M67A 2BVAA 3DFCB 1TQPA 2QU6A 4IWOA 2X9EA 4XH6A 1KWPA 3EL7A 4GFGA 2OG8A 4AW2A 4CG8A 1Y91A 4OW8A 3F3VA 4NZWB 3POZA 3F61A 4WOVA 4H1MA 4XS2A 3LM0A 5HLNA 3E88A 5E92A 4PMSA 2I7QA 3V5LA 3CY3A 4ACDA 3IO7A 5CU4A 4QMYA 4CFUA 1U4DA 3GFEA 3PVGA 4FI1A 4C2VA 4YLLA 2EVAA 4C8BA 3MFRA 2ITPA 4KRDA 4D2RA 3DAEA 3KMWA 5E8ZA 3F82A 4M69A 3Q52A 3UVQA 4QPAA 4RJ5A 2C0IA 4X3FB 4JDKA 4Y85A 4RZWA 1H4LA 2CN5A 2CCHA 4DGLC 5BUJA 1MRVA 4YLKA 4JIKA 3UDZA 4YR8A 5AAFA 3FZ1A 3UYSA 3V5PA 5CU2A 4DG3E 4E6QA 4WRGA 3MY5A 3LMIA 2PVLA 3FY0A 3ORKA 3FI4A 3I1AA 5C01A 3R7OA 4HW7A 3P5JC 3OMVA 5DLSA 4MHAA 3W16A 1G8KA 5L2IA 2ZM4A 3C1XA 3DJ5A 3SG9A 4IAZA 1V0BA 4BDJA 5CANA 4C4GA 3TZ9A 3L8SA 3RK5A 3OW4A 3B8QA 3O23A 4WBOA 4M13A 2YJRA 5AUWA 4MEDA 4TY1A 4GK2A 1OKWA 3ZM4A 3IW5A 3RWQA 2CLQA 2IZSA 3KRWA 4JBOA 3NYVA 3LQ5A 3WIKA 4CTBA 4XG6A 1O6LA 5ANIA 2PVMA 4XHKB 4ORKA 4EYMA 4KA3A 3KULB 4CV8A 3D5XA 2BZKB 1YOMA 4UYNA 5BYLA 2FSTX 4EK3A 2GHGA 4JX7A 3UOJA 5C27A 4QP1A 3LOKA 3EQPA 2OFUA 4XG3A 5IF1A 3BYSA 1XQZA 4GT4A 5CT7A 3W0RA 5ANOA 2V7AA 3D2KA 3SW7A 4QMWA 5CAPA 3G9NA 5AIRA 1PMNA 3EN7A 1FPUA 5CEMA 4QP3A 3KF7A 4QPSA 3WI6A 4O83A 3ZLSA 3CKWA 3W2OA 3LXPA 2PL0A 5HCYA 2W17A 2GS6A 3QKMA 3WARA 1WBWA 2NP8A 2YAKA 5J5SA 4ZSEA 3C4XA 3VUTA 3WE4A 3PWDA 5M06A 2JDRA 2P33A 4WNOA 3QLFA 5A54A 1YHVA 4JDJA 3V6SA 2C5XA 3JXWA 3LFDA 2QLQA 2FO0A 2UZBA 2WAJA 3D5UA 4TN6A 2IJMA 3VVHA 4ASDA 4I0SA 4O0SA 3OXZA 4FJVA 4BYJA 4FT5A 1RE8A 3QCSA 3UP7A 1H28A 3W2PA 3Q5IA 5HCZA 4WT6A 1LPUA 2BRBA 3PUFC 3O50A 3OY3A 4DFUA 4FV9A 1JVPP 2R7BA 3OT3A 4P5ZA 3MDYA 5D9HA 2WMQA 4RIXB 4GFOA 4FIFA 5IDNA 1XH5A 5CVFA 4L3JA 3DLSA 2C0TA 3CTJA 4I6FA 5CSHA 5CXZA 5LMAA 1ZMUA 3TN8A 2XB7A 4BCPA 4QP9A 4K77A 2Y6MA 3WBLA 2J0KA 1U59A 4KIOA 4S2ZA 2YLEA 2E9UA 4LL0A 3UMXA 1XWSA 4QTBA 3ITZA 2VNWA 3E3BX 3NAYA 4EOOA 1OKZA 4ZTNA 3H10A 3VQUA 3TDWA 5A4TA 3C4EA 5ETCA 3ULIA 4YTIA 1ZLTA 4NSTA 4CZTA 3QTWA 2Y4IB 3QC9A 4LUDA 3VIDA 4AAYA 1WBVA 3VS4A 3ZTXA 5I3RA 3OY1A 4D5HA 2CJMA 3TL8A 5BYZA 1JSTA 2B9HA 4OAUC 4OBOA 3FL4A 4TYGA 4XMOA 4ZLYA 5DFPA 4WO5A 5E8TA 5ETAA 3UOHA 3O7LD 2DS1A 5T6KA 4MXOA 1REKA 4AU8A 4NCTC 5FXQA 5EYKA 3BU6A 4EOQA 2RGPA 1CKPA 3EFWA 2R3FA 2UZDA 1L8TA 2G2FA 3SOCA 4RGJA 4M14A 5EM5A 4HGLA 2BFXA 3OT8A 4J8MA 1B38A 4GW8A 3QBNA 4O0RA 5HI2A 4DTAA 3AC5A 3W2RA 3ATSA 1MP8A 2XNMA 3NYXA 2NYAA 3FPMA 4GH2A 4MXXA 4RJ7A 3QCXA 4RVMA 1NT2A 4TYHB 5L2QA 3EFKA 3E7VA 3ZRKA 3Q9XA 2I40A 5JZNA 2UW5A 1YHWA 4I24A 4HNFA 2C0OA 4IMYA 2JFMA 4BCQA 4C34A 4EQMA 4FV7A 3S1HA 3JY0A 2J9MA 3W32A 3EZVA 4BDBA 2ITZA 5LWNA 3QZFA 4LOQA 2RKUA 2VWVA 3BIZA 3HMPA 5JRQA 1FVVA 2OJ9A 2Y8OA 1XH6A 4NFMA 1PXMA 4XRJA 3VBTA 3HMOA 2GTMA 3HAVA 4J97A 4BDHA 5KMLA 3P9JA 1GZ8A 2XP2A 4BY9E 3C0GA 3THBA 3QQGA 3D2IA 2A4LA 4C62A 4NM7A 5I3OA 5L6PA 1ZY5A 4QEBA 1CTPE 3FZPA 4JQ7A 3KK8A 5BMSA 1XH4A 3LCDA 2R3GA 3QQFA 4B8MA 4AGDA 4E20A 3QRJA 4G17A 4XYFA 5DMZA 4BWKA 5M56A 2W1CA 2JIVA 1PW2A 4USDA 4NIFA 5IH4A 3PDTA 4UYAA 1H00A 4RIXA 3D9VA 3R8ZA 1V0OA 4ITIA 1YXVA 5GJFA 4EWQA 5AR5A 4IEBA 3EYGA 3MVJA 3UC4A 4GS6A 3E7OA 3PIZA 5AR4A 3PYYA 5JRSA 4Y46A 5C4KA 3A8XA 2OIDA 2PY3A 4XBUA 2OXDA 5E8UA 3FSKA 2Z7LA 3K5UA 3QZHA 4JDHA 4YHFA 5E91A 3I0OA 4G34A 5J95A 1QPDA 3UIUA 1FBNA 5DR9A 1AD5A 3HA6A 4LM5A 5DE2A 3HKOA 2C6DA 4EC9A 2Q83A 2YEXA 3ZDIA 1KOAA 4MKCA 2YJSA 3FMEA 5E8YA 4J53A 1FVRA 4X2GA 2QCSA 2YCSA 3KVXA 4HGSA 4D9TA 3DNDA 4IWDA 5F95A 2A27A 5A6NA 5H9BA 4JLCA 3MJ2A 3NZ0A 3R7VA 1U5RA 2ETKA 3TUBA 3FXXA 2W1GA 2XKFA 4QP2A 3ELJA 5K0XA 5EYCA 5IQDA 4IX6A 4C37A 3N4TA 5IQAA 2RG6A 3L9NA 4DA5A 4PDOA 4GG7A 3SRVA 3NGAA 1KUTA 5E7RA 3GQLA 3UVRA 3W18A 1YDTE 4G16A 3UQGA 4XJ0A 4CLIA 3ZZEA 1GZNA 1O6YA 2WTDA 4FTKA 4CRSA 4MAOA 2UW4A 3P0MA 1UKIA 3C5IA 3L8PA 4E4XA 1G3NA 4IM3A 3RK9A 4A4OA 3I6WA 4RJ3A 4AFJA 5HO6A 2E9NA 1ZAOA 3A7GA 2JAMA 4C0TA 3TNIA 1STCE 1WBTA 2J2IB 4B99A 1V1KA 2WQEA 4A9UA 4D58A 2ITNA 4V04A 3ZZWA 3C51A 4IADA 1JAMA 3JY9A 2XNPA 4IVAA 3T8OA 2UW9A 2XK9A 4XV1A 1VJYA 5AR7A 3ZSGA 3FMMA 4FKGA 4AAAA 4W4YA 1A48A 1ST4A 5IUIA 4PL3A 2I0YA 4B8LA 2UZLA 2H9VA 3FXWA 3UDTA 3MBLA 4MWHA 4C4FA 4RA5A 3MW1A 4EZ7A 3RPVA 3AXWA 5FM2A 3EN6A 4BGQA 3UP2A 3BEAA 3BGQA 3ENMA 3I79A 1GOLA 2O65A 1OIYA 4FRFA 3CPCA 2JGZA 5HX6A 3JUHA 3GBZA 5B2LA 3EN9A 3TCPA 4DLJA 3GC0A 5IQGA 2PMLX 5TOZA 3EFLA 3FUPA 4UBAA 3MPTA 1TVOA 3KKVA 4XG7A 4G3GA 2VX1A 3I6UA 4AQKA 3GUBA 4MK0A 3ZXZA 4PMPA 3LPBA 3ZC6A 1JWHA 1WVYA 1YQJA 3EQRA 4D2TA 5AIKA 3VUGA 2ITQA 2WOUA 4FV4A 4G9CA 4HCVA 2OXYA 1NVRA 4GU9A 4FF8A 3QTZA 4F9YA 1XH7A 4YJNA 4MXCA 5BMMA 3F5PA 2R7IA 5F94A 4JXFA 3KK9A 3K54A 2AUHA 3CQWA 4IJ9A 4WD5A 3HV6A 1F5QA 1DS5A 4IC8A 5L6OA 2C47A 3BU3A 4TTHB 2UZNA 4WSYA 1QPCA 2QI8A 3OTVA 4YC8A 4H05A 3EKKA 1MQ4A 4X6RA 2ZJWA 2PVYA 4FTQA 4YSJA 1UWJA 3R2BA 4MNEB 2RFEA 5LQFA 3QTXA 1BX6A 4TPTA 4C33A 1PMUA 3VBVA 2YIRA 1VEBA 3FMKA 3GB2A 3TV6A 5CALA 4K33A 4RJ6A 4E4LA 3QF9A 3U55A 4MVFA 3C50A 1J91A 3Q4CA 1FOTA 4DN5A 2V62A 3IQ7A 3RNIA 2J0IA 4FYNA 3TZ7A 2WKMA 5HNGA 4CYJA 3RAIA 3NFFB 3OWPA 4AQCA 4ZS4A 4FA2A 3AMBA 1KE6A 2PE2A 3PG3A 4OTGA 4BFMA 1HCKA 2BAKA 4RX7A 1UNHA 2HWOA 4L6QA 3VUHA 2VWXA 4FSMA 5FEDA 3L1SA 3LIJA 2R3HA 2XK8A 3E87A 4RZVA 4F6SA 5JT2A 1FGKA 4CFVA 4AN2A 3QZGA 2F7XE 4OBPA 2YITA 3W0SA 1VYWA 1XH9A 1M7NA 1IEPA 1OBDA 3QQUA 1MRYA 3HX4A 3TKIA 2XKDA 4KWPA 4WNMA 4DEAA 5FBOA 4E3CA 4F09A 3HL7A 3O7LB 3TUDA 4KIKA 4OT6A 4E5BA 3OHTA 3MTLA 1OL7A 4O22A 3FBVA 4DG0E 2AC3A 5D7AA 5AR2A 3U9NA 4DFBA 4ZMEA 5HVJA 5IA4A 3UOKA 4BN1A 3PXRA 5L6WL 4EK5A 3KXZA 3ORIA 4PQNA 4NK9A 4LV7A 3GOKA 4NFNA 1DI8A 3F3TA 4U3ZA 2XNGA 2IVUA 4KBKA 5I9UA 3KRLA 5G6VA 4GUEA 1OPJA 3POOA 4RMZA 3P23A 3I7BA 3Q4UA 3ZFMA 3HRFA 1MQBA 2WD1A 4ZSLA 2PZYA 3NFGB 3ZC5A 3EJ1A 3KL8A 3ZONA 2XBAA 2O2UA 4CQGA 3NVKI 2ZVAA 3Q4TA 4BHZA 2GQGA 4XRLA 3RCDA 4JAJA 4JR7A 1XJDA 4K2RA 3FI8A 2WFYA 4BDGA 3A8WA 3H9FA 4I5HA 2QLUA 3E8DA 4BDDA 1LEWA 2W05A 1BL7A 3E92A 3IGOA 3LAUA 2X2KA 2I0HA 3SXFA 2JIUA 1OL6A 2W4KA 5A6OA 3IK3A 4W4XA 4EOSA 5BQ0A 5CEOA 3GU6A 4RWJA 2UZOA 2V0DA 3A2CA 3IW7A 3QQHA 4TKSA 4C3PA 4ENXA 4MNEA 3TMOA 2C6MA 1GJOA 4M15A 5EM8A 3CY2A 3ZYAA 4RC3A 1UKHA 4U0IA 4FV6A 5CWZA 5HCXA 4IX3A 2CNVA 2XALA 4FTLA 5DGZA 4GVAA 5CI7A 5J1VA 4TT7A 4R1VA 5LVNA 1YDSE 4BTMA 5AUZA 2XJ1A 2YACA 3O2MA 3SVVA 2X4FA 3PA3A 4BTJA 4F0IA 4L67A 4CCUA 1BI8A 3BV2A 4BGHA 4C35A 3SG8A 2XEZA 1W2CA 2YIQA 4Y72A 3P1AA 3QALE 4Y73A 4YUQA 3ROYA 4CZUA 4BCMA 3VBXA 5BVDA 4RBLA 5EI8A 4BZDA 2VTHA 1J3HA 4EJNA 3VO3A 4USEA 3R28A 3K2LA 5I9YA 1TKIA 1YWNA 2QG7A 5BUEA 2J4ZA 4EOPA 3R7GA 4FKUA 1F0QA 3R8PA 5DT3A 4EOIA 4G1WA 3ACKA 4RIWA 3W8LA 2WTVA 4XUFA 2PE0A 5AP3A 4MD9E 3IDCA 1J7IA 5EQPA 3UO5A 1LR4A 4XG8A 2WZJA 4QMVA 3QRUA 3GT8A 3U87A 5IDPA 4YHJA 5D11A 3MTFA 3BYUA 4WRSA 3BYOA 3VONA 3Q9YA 4O38A 4NW5A 5HLWA 2QHNA 5FGKA 4EKKA 4DTBA 4QRCA 2R5TA 3QGYA 5J79A 4OT5A 5EW9A 4M8TA 4CGAA 3OWKA 1H26A 5IQEA 3E3PA 4FIHA 4QYFA 1IAJA 4PNIA 2OJJA 4I6HA 5M51A 2FB8A 4ALWA 3BGPA 3SD0A 1PYEA 3ANQA 5CVHA