3KXOA

An orally active inhibitor bound at the active site of hpgds
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutathione-requiring prostaglandin D synthase
publication title Discovery of an oral potent selective inhibitor of hematopoietic prostaglandin D synthase
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 72
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3kxoA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3kxoA01
19GSA 3TKSC 1G7OA 1XFLA 2H0GA 2P5RA 4GF0A 1SU9A 5DQSA 1FVJA 4MF7A 2YCDA 4Z7XA 5D8IA 1SK1A 3OR5A 1UC7A 1B48A 4Q5FA 1PA3A 1XW5A 5KN0A 1GP1A 1M9AA 4ML6A 2PMTA 1V58A 1XW9A 3C1RA 2CVBA 3Q74A 3PR8A 3A2VA 4MCUA 1R5AA 5CAXA 3ERGA 3S9FA 4N0VA 1Z7RA 3EE2A 2VAFA 4YAVA 3KCMA 1GWCA 4H86A 2HI7A 5DVBA 3M9JA 4PTSA 3ED3A 3O6TA 1JLWA 2B5XA 1A2MA 4GLTA 1F3BA 5G31A 4ECBA 5IPHA 3M9KA 3TOUA 1ZGNA 1ZYQB 1WE0A 1YKAA 3DIEA 3E3EA 4NV5A 4NV2A 3VI7A 4ZB6A 2LTKA 3KM6A 4MK3A 4OD7A 4KSMA 4BL7A 4DSQA 3FHKA 1PL2A 1XXUA 1M0UA 5INYA 3TGZA 2GS3A 2DIZA 3N5OA 2TIRA 2E0QA 4GSNA 10GSA 3GYKA 2LNSA 4MH2A 1ILOA 5CRGA 1AAZA 2IFQA 4EDYA 1WMJA 4IS0A 1VGLA 4ZXGA 1TRUA 2R3XA 5IQYA 4BVXB 4F0CA 3TKSE 1U88A 1GNEA 5IMDA 4E8EA 4MZBA 1NHOA 3FR3A 1M2DA 4GXZA 3VPTA 1LU4A 2O87A 1JLVA 2I4AA 2AHEA 2XBQA 3ZVJD 1B4PA 1PX6A 2PVQA 1ZCPA 1QXHA 1AXDA 2YJ7A 3FZAA 4AF2A 3D5JA 1ON4A 1A8LA 1EGOA 1EOGA 2M72A 1DE1A 4KDYA 2XPDA 5JCGA 22GSA 3M8NA 1XWAA 1URMA 4JRRA 1OVNA 4D73A 3IHQA 2KHPA 3D4MA 4L8EA 3GTUB 1EP7A 3E0UA 1FW1A 2KLXA 2C1YA 5E59A 5D9XA 2OADA 3L9SA 4TN8A 2X8CA 2F3MA 2TRCP 2VD1A 5GSTA 2C8UA 2G2QA 3TJBA 1XWKA 5DAKA 2PVOC 4BVYA 2DJ0A 1QK8A 3LXTA 4Q5QA 2N5BA 2JZSA 3P2AA 3TKQA 2O85A 4ML1A 2FA4A 1KEBA 1XWCA 1K0MA 3ERFA 5ECQB 2X8GA 2FA8A 2OE3A 5ECHB 4PURA 4EO3A 4GQFA 1SL0B 5H5RA 1GSDA 3BD2A 1AQWA 2YZHA 4XRAA 3KTLA 3RBTA 4V1Ag 4Q5NA 9GSSA 2H74A 4HI7A 3TKRA 2XC2A 5CNWA 3HJPA 2H76A 2WRTA 2H1GA 5DDLA 3GH6A 1THXA 2N5FA 4KSOA 3H93A 3I6AA 2HRAA 4TR3A 2H1AA 3ZRDA 4EL1A 2FD3A 2B3SA 4PQ1A 1OYJA 4BWQA 2PU9C 2RM6A 5JWRB 4J2FA 4WR4A 3DVXA 2B5YA 2CX3A 3DEXA 5B8BA 1U87A 2MYGA 4KGIA 2YZUA 2MMZA 5G2ZA 3TJKA 3VPQA 2EIOA 4PQIA 1Z3EA 1WPIA 5G30A 4ECCA 2K8SA 2P5QA 1VF3A 3Q18A 3PH9A 3LGCA 3WD6A 1XWBA 1M2AA 1X5DA 2L5OA 2CAQA 1UVZA 4IQAA 2IMEA 2GTUA 4F2IA 5A4UA 3CRUA 4ZILA 2HSNB 4LL4B 2LQQA 2VLUA 1B9XC 1FB6A 2RUFA 1K0BA 4JR6A 2C80A 1SK2A 1IYHA 2R5GA 3CRTA 2PBJA 2VLTA 2GVPA 1GH2A 4K2DA 1QQ2A 2C0EA 1HQOA 2VL2C 1BEDA 3F4TA 3HZ8A 2JACA 5IMFA 3F3RA 4CDOA 1T4YA 13GSA 2YWOA 4XIHA 3FZ4A 2WS2A 4MZWA 17GSA 4GSTA 3L4NA 2H1BA 4EDZA 2VIMA 3ZIVA 1J08A 4IP1A 1BAYA 4RQRA 5LNKe 3UBLA 2IMIA 2IPAA 5KN3A 3JCML 5IMZA 3TJJA 5DQYA 5HR3A 2LKUA 4PGTA 3ISOA 2H72A 2HYXA 3GMFA 5C00A 3UBKA 4K0GA 4QL7A 4I8BA 4RUVA 1T00A 2EC4A 3FR9A 2ALBA 2CVDA 2DJ2A 1TJDA 4YQUA 4USSA 2H30A 2K18A 3QFAC 2EIRA 3FRCA 4L0WA 4RI6A 4KA0A 4GSSA 3WT1A 3IC4A 3HJMA 4GTUA 3IK7A 6GSXA 2VM2A 5AISA 2FWHA 1TI1A 2L59A 2F9SA 3HDCA 1SENA 1K0OA 1SD8A 3VWVA 2HFDA 2YNXA 3C7MA 3P7XA 5IIZA 2AV4A 2E2GA 3CSIA 5IO2A 1I5GA 2WULA 2I81A 2WZ9A 5G5FA 3ZFLA 5KN1A 4IBPA 4PQHA 2GQLA 3HXSA 1K0NA 2XPEA 4EKZA 1EV9A 4LA1A 2D2ZA 3UIWA 4O7HA 3UAPA 3APSA 3ERWA 3DMLA 4LMVA 4MDCA 4F03A 3FZ5A 1DSBA 2HSMB 4IW9A 5JCWA 3PGTA 3IPZA 2LRTA 5JWQB 5IO0A 3EWLA 1Q4JA 3HVXA 1ST9A 1X9MB 1FAAA 1SK0A 2HXKA 2KUCA 2GZZA 1HNAA 3APQA 4TXVA 3CSJA 1JZWA 1O7UA 2FY6A 3IBHA 5EL8A 1SJIA 2A2RA 2ON7A 4IVFA 2IWTA 4JR4A 4TXOB 2VO4A 2H0IA 3KZQA 1Y6EA 4RI7A 4PXOA 5ECOB 2HRKA 4L5LA 3HJOA 5AIVA 3NIVA 2F51A 1Z9HA 4G0LA 1PN9A 3J7Yb 5ECMB 2YWMA 2AAWA 3D21A 1TXXA 1PL1A 5A4VA 5GZZB 4EF0A 5KEJA 2CT6A 2H1DA 1OE8A 4N0ZA 2XBIA 4WKWA 1PKZA 5IPGA 3WGXA 3F6FA 3VWXA 3J7Yk 4OFNA 2GSRA 1N8JA 3QMXA 4DEJA 3KTBA 1GUKA 4FIWA 1SJZA 3TKSA 3D6IA 5ABRA 2LQOA 2QSIA 3GH9A 2MBSA 3ZIJA 5HQPA 1TK5B 3ZZXA 2KP2A 3EINA 3EC3A 5GSSA 3ZFBA 2O89A 1DE2A 1ERUA 2JZRA 1SYRA 2YV7A 4CW9A 4WETA 8GSSA 1BX9A 3MAKA 2GZYA 2HQTA 2TRXA 3QAWA 2HSYA 4HJ2A 1OC9B 3GNJA 4ZBAA 1NW2A 3TJFA 1B8XA 5ID2B 1X9WB 2IMFA 3IV4A 2H73A 5J9BA 1F2EA 5JCUA 2HZEA 3R3EA 2WGRA 4V2LA 2CV4A 3IA1A 2C0DA 3F4RA 1MEKA 5D93A 3DKSA 3FZ9A 3TUEA 2C0FA 1XZOA 2H19A 3N9JA 2K6VA 4BPYA 4K7NA 2R2JA 2REMA 1MDIA 2B7JA 4FH8A 3MSZA 1BYEA 4ILFA 1LJRA 2B6MA 1GULA 3QAGA 3VFIA 4DSRA 3KIJA 2GSTA 1R26A 5B7CA 1EV4A 1PSQA 5AGYA 3ZMLA 1T1VA 2QKEA 2YOIA 5G1LA 4POLA 1A23A 2GQMA 2JL4A 7GSSA 1GL8A 1OE7A 1YF0A 4HQSA 1ZOFA 4V2MA 1TU7A 5DALB 5F0GA 3KP8A 2VOCA 3LYKA 3M0FA 1AIUA 2O8VB 5ECRB 2OA7A 5ELAA 3GX8A 5H5QA 1W4VA 2CAIA 3CTFA 2BJXA 2V6KA 5ECKB 5J4UA 3MDKA 2GSQA 3HD5A 3KJYA 2FHEA 2LSTA 2XHFA 2MMAA 4DSSB 1NSWA 1TK0B 3WGDA 4F0BA 1K3OA 3GN3A 1ZMAA 5JWOB 2X99A 1JZDA 4IN0A 3A2WA 3GUSA 3VLNA 2I9HA 3LXZA 3LYPA 1Z6NA 1HNBA 4JBBA 4TR1A 4V2NA 2IMDA 4IELA 2NDOA 3UMAA 2OKAA 4AJ6A 4OCEA 2HRNA 5J5NA 4HS1A 2V32A 1E6BA 1T7PB 3TB2A 1T4ZA 5CYYA 1GSUA 1AQXA 4BWSA 4G9HA 1H75A 4LL1B 2G0FA 4NXIA 3EMXA 2LS5A 2YN1A 1THOA 2VCXA 3HY2A 2LV3A 2H6ZA 2I3YA 4MZCA 4GQCA 2L5LA 1XW6A 4FYBA 16GSA 3A3TA 5J3RA 2CQ9A 2H6XA 1PX7A 4V1Ap 5DJMA 2B7KA 1O85A 3SBCA 2IL3A 4I2TA 1F37A 1TRWA 4G2EA 5KN2A 4PUFC 3MWHA 4N30A 3RPNA 3TOTA 1Z6MA 3CBUA 3VK9A 1GNWA 1ABAA 1TKDB 1XIYA 4XS4B 4G0KA 3EVIA 3GSTA 1GUMA 1O8XA 5HR1A 2ON5A 2VCZA 1WWJA 2VL3A 1K3YA 1GTAA 4J56E 1OKDA 4Q5RA 3QOUA 3L9VA 4I97A 2HRFA 3KP9A 3F9UA 3QPMA 2L6DA 1O73A 2MBTA 3UJ1A 5CP1A 1K0CA 1SL1B 4ISDA 3LQ7A 1TDIA 5HR0A 4OCFA 1TK8B 2F8FA 5LCZA 2A2SA 3LWAA 3H8QA 1WRYA 1YQ1A 1X5CA 2K8VA 4FQUA 2VUPA 3GFKA 2L6CA 12GSA 3LORA 1AC1A 3FY7A 3D22A 3GV1A 2WJUA 5IMCA 2VL9A 2NVLA 6GSTA 3ME7A 4EXJA 1X0RA 3QFBC 1XOAA 1R5PA 5DBQA 1TP9A 2PWJA 3VI5A 4MPGA 3KMOA 2L4CA 3Q6OA 1U3AA 1GSFA 3CTGA 3FR6A 2PN8A 18GSA 5F8BA 1HYUA 4X0XA 1CQHA 4I2UA 3BCIA 4KDXA 4P3YB 1BQ7A 2HLSA 1T8EB 3ZTLA 5IMVA 3ZMKA 1FG4A 3DWVA 5C04A 3C1SA 4KCAA 3KGKA 2WDUA 1YEPA 1R7HA 3ZYWA 5AN1A 4K9ZA 1G0TA 2RIIA 1PQNA 4K6XA 5EPFA 2L57A 4ZB9A 2GGTA 4TKYA 3L0HA 4AJ7A 3RDWA 5H5SA 5IM9A 2MMOA 1YF1A 2GLRA 2UZ8A 2IFQB 3W8SA 2BMXA 2YANA 2O7KA 1XPVA 4BVXA 2OE0A 4MJAA 5IMAA 4E8HA 5ECLB 1J9BA 3O76A 4HEA2 3BBYA 1NHYA 3CYNA 4MP4A 1S3DA 3MNGA 4WEYA 3G7IA 2VLVA 1KNGA 1DBYA 2H66A 3IAS2 1DUGA 1GSQA 4HQZA 1ML6A 3O3TA 3ZREA 4K1FA 14GSA 2FNOA 4KH7A 1G6YA 3H4KA 1YKCA 4I5QA 4IHUA 11GSA 4LMWA 2PPTA 4IJIA 3HZ4A 4F82A 1O81A 4YQVA 3ZVJA 1K0DA 2IIYA 2B1KA 1EWXA 1M9BA 2HZFA 3IK9A 1XVWA 2IJYA 5ECNB 1PGTA 4D73B 1ZL9A 3GTUA 5CRHA 1NM3A 4OWYA 2OE1A 2NPBA 4X43A 3U5RE 2R6KA 6GSYA 2ES7A 1MDKA 3WT2A 5D9VA 5ECIB 2V41A 3KEBA 4N11A 3US3A 5DAKB 1TW9A 4MJEA 2VCQA 2DMLA 2R4VA 1GTUA 3GX0A 2J9HA 4XRDA 2QGVA 2CZ2A 4MF6A 3TRPA 3DVWA 1Z7PA 3A5WA 2LJRA 4MA9A 1GLQA 2C4JA 1C72A 5HR2A 3BJ5A 3GRXA 3GA4A 1TTZA 1G6WA 2MMNA 3GURA 3HCZA 4O32A 4IGJA 2YP6A 1A0FA 1O8WA 2VCTA 2OBKA 5CREA 2JZTA 3UL3A 1OC3A 3G7JA 5IOXA 4KF9A 1EGRA 3D4TA 3IC8A 1PRXA 1WOUA 2E2MA 2GSSA 2GT5A 1Y25A 3QR6A 1XVQA 5HFIA 1S3CA 4K7IA 3APOA 1KBNA 4MJBA 4FYUA 1ERTA 2OJLA 5ECSA 4WXTA 3QCPA 3GIXA 1QGVA 4GRFA 4JEDA 5HFGA 5FWGA 1XBSA 2M80A 2C0GA 2I1UA 4MPFA 5BMUA 1ZYEA 1VF2A 3EYTA 5D96A 1X5EA 4ZL7A 3F6DA 3KH9A 4NHZA 5B6MA 5B8AA 5J41A 4YH2A 3HYPA 4X1UA 3HA9A 5IOWA 2FWFA 3HVVA 4O92A 4POKA 1R4WA 3LFLA 3CMIA 2ZNMA 3RAZA 2DIYA 2CVKA 2NTOA 3GL5A 3WGEA 1MD3A 3K8NA 3IR4A 4KW6A 1K0AA 4TR4A 5F05A 4XS6A 2C3NA 3PPUA 2AYTA 2V1MA 1J0FA 3NOFA 1FVKA 2P31A 1GTIA 2ZCTA 3SWLA 3H1NA 1EEJA 1MDJA 3I43A 5G5EA 2V6OA 1I9DA 4ECIA 2HSHA 2AJQB 1BJXA 4MJCA 3H79A 4HU9A 3ZL5A 3CSHA 3V1WA 4MLYA 3KH7A 3EMPA 4POMA 4IJ3A 1BG5A 1VF1A 1F3AA 3GKXA 3GKNA 3U6VA 1WP0A 2LRNA 4G0IA 1QFNA 1EOHA 2J23A 2DJJA 1B4QA 4MMMA 1AQVA 3DRNA 1ACVA 4AGSA 3NZNA 4HZ2A 4GCIA 1CQGA 3M1GA 1IYIA 1JZOA 4ZBDA 1PKWA 4HZ4A 1SKSB 3FEUA 1ZZYA 2LUSA 3E9JB 3GL3A 2R37A 2DJKA 1ERWA 3P90A 1XOBA 2WCIA 1U6TA 3R2QA 4K8MA 1B9YC 4MF5A 1GSEA 5FHIA 4PX1A 4IKHA 1U3IA 1S3AA 2X8HA 2CZ3A 3BCKA 4HJMA 1A24A 1QMVA 1YEXA 2N5AA 5D9WA 4XCSA 3P8WA 4KB3A 1AUCA 4K7OA 5F07A 5EY6A 3TRQA 5E4WA 2GZPA 4KDUA 5GAND 3M3MA 2WFCA 4OFTA 1SD9A 2FGXA 3EU4A 3GKMA 1H4OA 2H01A 4GWRA 1V40A 1RK4A 4WBJA 3F3QA 4JE1A 4OO5A 2FWEA 6GSUA 2HT9A 1EZKA 6GSVA 1YZXA 3VURA 2LEGA 1FB0A 4G10A 3EU3A 2AUVA 2LRCA 1FOVA 1OC8A 3LEFA 2YV9A 3D0ZA 2L4QA 4TR0A 3GKKA 1V57A 2M46A 4TVEA 5HFKA 2PGTA 3FK8A 1WJKA 2HSMA 4NAXA 3C71A 4EC0A 3TCOA 2NBSA 2DSAA 1XCCA 1MD4A 1UA5A 3FYGA 4PUAA 3CXGA 3ZITA 3ME8A 2YJHA 1TU8A 1RQMA 2FLSA 2KP1A 2LJKA 4ZIJA 1TOFA 4PNFA 1ERVA 1E2YA 4TXOA 1SKWB 1USBA 3PINA 1M99A 2VCVA 4TW5A 1JFUA 1FHEA 3ZLPA 3QAVA 3KD0A 2YWIA 2HRKB 4WBRD 3LSZA 1HNCA 2AB6A 3QD9A 1K3LA 3IOSA 4OO4A 2C3TA 2RLIA 3DXBA 2H75A 3HVSA 4IQ1A 2OBIA 2ZUPA 3I69A 4ZBBA 4ZB8A 2K9FA 4POBA 1FO5A 3IRAA 1HD2A 4BA7A 2JU5A 5FT3A 2HE3A 3RPPA 4HU7A 4YQMA 4G19A 3UVHA 4HDEA 3F0IA 2DBCA 4LLRA 4XHMA 1V98A 2DLXA 1GSYA 3DGQA 4NWYA 1TRSA 3IAM2 3FKFA 5J9CA 5A5KA 4QQ7A 3IE3A 2DJ1A 2B1LA 1GLPA 1W89A 2C3QA 1OC9A 4PNGA 3RHBA 2X64A 2JADA 4NHWA 1SKRB 2CA8A 4I6XA 1VF4A 5ID2A 3F8UA 1LBKA 4OMVA 2DJ3A 3F4SA 3UOMA 3F63A 4IP6A 5A4WA 1A8YA 3LJRA 2PERA 20GSA 5B6NA 2HZEB 2H6YA 2GQKA 4KNDA 3W8JA 1EEMA 6GSWA 1X9SB 5D73A 2VL2A 2IN3A 2JSZA 1SL2B 4OFMA 4L5OA 4O5RA 2H0HA 3L9UA 5L71A 4BL7B 4XS1A 3L78A 1F6MC 1EP8A 4KUNA 4EUYA 3QDNA 4CHSA 2FWGA 2OACA 4ACSA 5D9TA 2B5EA 1OKTA 4WF4A 3GHAA 1UN2A 3IXRA 4EVMA 2V2GA 2RM5A 1JHBA 2DC5A 4YAPA 3Q19A 3UEMA 4QL9A 3RHCA 3TJGA 5CRWA 5CRDA 1Q98A 1PD21 5DALA 2H70A 1AW9A 2JSYA 3LG6A 4KE3A 2EIQA 2GT6A 4L0UA 4JU5A 2PUKC 1GUHA 5GAPD 4HUAA 1GRXA 3C73A 3KXOA 3AY8A 5ENUA 2GDRA 1RW1A 4MH3A 3C8EA 1TRVA 4NMUA 1QUWA 3W6GA 4ULXA 5LD0A 2H71A 2DMMA 4TRXA 4MABA 1SJ6A 4DSSA 2CX4A 2WB9A 1PMTA 4WR5A 4WF5A 5F06A 4KCEA 1A0RP 3A2XA 3KMNA 1Z5YE 1TI3A 2FCHA 1YJ6A 2BTOT 1G7EA 5G1KA 5DJLA 4F9ZA 1V2AA 2LJAA 4ZL8A 4RQXA 4FYCA 3FW2A 5AIXA 4NPBA 4DVCA 3G7YA 4JZQA 3BOAA 1OAZA 3TRXA 4KAEA 5EVOA 4AJ8A 4TR1B 3UVTA 5DCHA 4BVYB 2YWNA 2A4VA 3HKRA 2F8AA 2VCWA 3EURA 2YPMA 3TKPA 5CO3A 4J57E 1A2JA 1M2BA 2QC7A 3UARA 1N2AA 1M7TA 2KOKA 1F9MA 1V9WA 5DCGA 1GTBA 3WYWA 1YDKA 3HHVA 5ECPB 4XTSA 2MZCA 4N10A 3VWUA 4HOJA 2HNLA 3IDVA 1SYXA 2FUG2 2RUEA 4XS4A 5ELGA 4ID0A 4ZL9A 3G9BA 6GSSA 1XWGA 2VM1A 2IMKA 2E7PA 3I9V2 3DD3A 5COHA 1A2LA 1MTCA 3TDGA 4K0NA 4KX4A 1YY7A 3GSSA 2VD0A 3DYRA 1T3BA 2P0GA 2Z9SA 4TOPA 1JZRA 2H8LA 1GSSA 2LNTA 3VWWA 1O6JA 1VRSD 4EE0A 1WIKA 4ECJA 1KTEA 4FO5A
chains in the Genus database with same CATH superfamily
19GSA 3TKSC 1G7OA 1XFLA 2H0GA 2P5RA 4GF0A 1SU9A 5DQSA 1FVJA 4MF7A 2YCDA 4Z7XA 5D8IA 1SK1A 3OR5A 1UC7A 1B48A 4Q5FA 1PA3A 1XW5A 5KN0A 1GP1A 1M9AA 4ML6A 2PMTA 1V58A 1XW9A 3C1RA 2CVBA 3Q74A 4CY6A 3PR8A 3A2VA 4MCUA 1R5AA 5CAXA 3ERGA 3S9FA 4N0VA 1Z7RA 3EE2A 2VAFA 4YAVA 3KCMA 1GWCA 1PN0A 4H86A 2HI7A 5DVBA 3RFRC 3M9JA 4PTSA 4Z2UA 3ED3A 3O6TA 1JLWA 2B5XA 1A2MA 4GLTA 1F3BA 5G31A 4ECBA 5IPHA 3M9KA 3TOUA 1ZGNA 1ZYQB 1WE0A 5J4VA 1YKAA 3DIEA 3E3EA 4NV5A 4NV2A 2H1LA 3VI7A 4ZB6A 2LTKA 3KM6A 4MK3A 4OD7A 4KSMA 4BL7A 4DSQA 3FHKA 1PL2A 1XXUA 1M0UA 5INYA 3TGZA 2GS3A 2DIZA 3N5OA 2TIRA 2E0QA 4GSNA 10GSA 3GYKA 2LNSA 4ICYA 4MH2A 1ILOA 5CRGA 1AAZA 2IFQA 4EDYA 1WMJA 4IS0A 1VGLA 4ZXGA 1TRUA 2R3XA 5IQYA 4BVXB 4F0CA 3TKSE 1U88A 1GNEA 5IMDA 4E8EA 4MZBA 1NHOA 3FR3A 1M2DA 4GXZA 3VPTA 1LU4A 2O87A 1JLVA 2I4AA 2AHEA 2XBQA 3ZVJD 1B4PA 1PX6A 2PVQA 3IHGA 1ZCPA 1QXHA 1AXDA 2YJ7A 3FZAA 4AF2A 3D5JA 1ON4A 1A8LA 1EGOA 1EOGA 2M72A 1DE1A 4KDYA 2XPDA 5JCGA 22GSA 3M8NA 1XWAA 1URMA 4JRRA 1OVNA 4D73A 3IHQA 2KHPA 2DKHA 3D4MA 4L8EA 3GTUB 1EP7A 3E0UA 1FW1A 2KLXA 2C1YA 4X4JA 5E59A 5D9XA 2OADA 3L9SA 4TN8A 2X8CA 2F3MA 2TRCP 2VD1A 5GSTA 2C8UA 2G2QA 3TJBA 1XWKA 5DAKA 2R0CA 2PVOC 4BVYA 2DJ0A 1QK8A 3LXTA 4Q5QA 2N5BA 2EFDA 2JZSA 3P2AA 3TKQA 5KOWA 4O5UA 2O85A 4ML1A 2FA4A 1KEBA 1M3JA 1XWCA 1K0MA 3ERFA 5ECQB 2X8GA 2FA8A 2OE3A 5ECHB 4PURA 4EO3A 4GQFA 1SL0B 5H5RA 1GSDA 3BD2A 1AQWA 2YZHA 4XRAA 3KTLA 3RBTA 4V1Ag 4Q5NA 9GSSA 2H74A 4HI7A 3TKRA 2XC2A 5CNWA 3HJPA 1YVLA 2H76A 2WRTA 2H1GA 5DDLA 3GH6A 1THXA 2N5FA 4KSOA 3H93A 3I6AA 2HRAA 4TR3A 2H1AA 3ZRDA 4EL1A 2FD3A 2B3SA 4PQ1A 1OYJA 4BWQA 2PU9C 2RM6A 5JWRB 4J2FA 4WR4A 3DVXA 2B5YA 5BMUB 2CX3A 3DEXA 5B8BA 1U87A 2MYGA 4KGIA 2YZUA 2MMZA 5G2ZA 3TJKA 3VPQA 2EIOA 4PQIA 1Z3EA 1WPIA 5G30A 4ECCA 2K8SA 2P5QA 1VF3A 3Q18A 3PH9A 3LGCA 3WD6A 1XWBA 1M2AA 1X5DA 2L5OA 2CAQA 1UVZA 4IQAA 2IMEA 2GTUA 4F2IA 5A4UA 3CRUA 4ZILA 2HSNB 4LL4B 1N25A 2LQQA 2VLUA 1B9XC 1FB6A 2RUFA 1K0BA 4JR6A 2C80A 1SK2A 1IYHA 2R5GA 3CRTA 2PBJA 2VLTA 2GVPA 1GH2A 4K2DA 3EPTA 1QQ2A 2C0EA 1HQOA 2VL2C 1BEDA 3F4TA 3HZ8A 2JACA 5IMFA 3F3RA 4CDOA 1T4YA 13GSA 2YWOA 4XIHA 3FZ4A 2WS2A 4MZWA 17GSA 4GSTA 3L4NA 2H1BA 4EDZA 2VIMA 3ZIVA 1J08A 1ZYPA 4IP1A 1BAYA 4RQRA 5LNKe 3UBLA 5A34B 2IMIA 2IPAA 5KN3A 3JCML 5IMZA 3TJJA 5DQYA 5HR3A 2LKUA 4PGTA 3ISOA 2H72A 2WW2A 2HYXA 3GMFA 5C00A 3UBKA 4K0GA 4QL7A 4I8BA 4RUVA 1T00A 2EC4A 3FR9A 2ALBA 2CVDA 2DJ2A 5A1NB 1TJDA 4YQUA 4USSA 2H30A 2K18A 3QFAC 2EIRA 3FRCA 4L0WA 4RI6A 4KA0A 4GSSA 2O36A 3WT1A 3IC4A 3HJMA 4GTUA 3IK7A 6GSXA 2VM2A 5AISA 2FWHA 1TI1A 3A5IA 2L59A 2F9SA 3HDCA 1SENA 1K0OA 1SD8A 3VWVA 2HFDA 2YNXA 3C7MA 3P7XA 5IIZA 2AV4A 2E2GA 3CSIA 5IO2A 1I5GA 2WULA 2I81A 2WZ9A 5G5FA 3ZFLA 5KN1A 4IBPA 4YKGA 4PQHA 2GQLA 3HXSA 1K0NA 2XPEA 4EKZA 1EV9A 4LA1A 2D2ZA 3UIWA 4O7HA 3UAPA 1FOHA 5A5HB 3APSA 3ERWA 3DMLA 4LMVA 4MDCA 4F03A 3FZ5A 1DSBA 2HSMB 4IW9A 5JCWA 3PGTA 3IPZA 2LRTA 5JWQB 1S4BP 5IO0A 3EWLA 1Q4JA 3HVXA 1ST9A 1X9MB 1FAAA 1SK0A 2HXKA 2KUCA 2GZZA 1HNAA 3APQA 4TXVA 3CSJA 1JZWA 1O7UA 4GDFA 2FY6A 3IBHA 5EL8A 1SJIA 2A2RA 2ON7A 4IVFA 2IWTA 4JR4A 4TXOB 2VO4A 2H0IA 3KZQA 1Y6EA 4RI7A 2UV8G 4PXOA 2R0PA 4MNNA 5ECOB 1BF5A 2HRKA 4L5LA 4EIQA 3HJOA 5AIVA 3NIVA 2F51A 1Z9HA 4G0LA 1PN9A 3J7Yb 5ECMB 2YWMA 2AAWA 3D21A 1TXXA 1PL1A 4CY8A 5A4VA 5GZZB 4EF0A 5KEJA 2CT6A 2H1DA 1OE8A 4N0ZA 2XBIA 4WKWA 1PKZA 5IPGA 4Z2TA 3WGXA 3F6FA 3VWXA 3J7Yk 4OFNA 2GSRA 1N8JA 3QMXA 4DEJA 3KTBA 1TXUA 1GUKA 4FIWA 1SJZA 3TKSA 3D6IA 5ABRA 2LQOA 2QSIA 3GH9A 2MBSA 3ZIJA 5HQPA 1TK5B 3ZZXA 2KP2A 3EINA 3EC3A 5GSSA 3ZFBA 2O89A 1DE2A 1ERUA 2JZRA 1SYRA 2YV7A 4CW9A 4WETA 8GSSA 1BX9A 3MAKA 2GZYA 2HQTA 2TRXA 3QAWA 2HSYA 4G01A 4HJ2A 1OC9B 3GNJA 4ZBAA 1NW2A 3TJFA 1B8XA 5ID2B 1X9WB 2IMFA 3IV4A 2H73A 4E68A 1F2EA 5J9BA 5JCUA 2HZEA 3R3EA 2WGRA 4V2LA 2CV4A 3IA1A 2QA1A 2C0DA 3F4RA 1MEKA 5D93A 3DKSA 3FZ9A 3TUEA 2C0FA 1XZOA 2H19A 2OT3A 3N9JA 2K6VA 4BPYA 4PI0C 4K7NA 2R2JA 2REMA 1MDIA 2B7JA 4FH8A 3MSZA 1BYEA 4ILFA 1LJRA 2B6MA 1GULA 3QAGA 3VFIA 5KOXA 4DSRA 3KIJA 2GSTA 1R26A 5B7CA 1EV4A 1PSQA 5AGYA 3ZMLA 1T1VA 2QKEA 2YOIA 5G1LA 4POLA 1A23A 2GQMA 2JL4A 7GSSA 1GL8A 1OE7A 1YF0A 4HQSA 1ZOFA 4V2MA 1TU7A 5DALB 5F0GA 3KP8A 2VOCA 4N3ZA 3LYKA 3M0FA 1AIUA 2O8VB 5ECRB 2OA7A 5ELAA 3GX8A 5H5QA 1W4VA 2CAIA 3CTFA 4PI2C 2BJXA 2V6KA 5ECKB 5J4UA 3MDKA 2GSQA 3HD5A 3KJYA 2WW1A 2FHEA 2LSTA 2XHFA 2MMAA 4DSSB 1NSWA 1TK0B 2X49A 3WGDA 4F0BA 1K3OA 3GN3A 1ZMAA 5JWOB 2X99A 1JZDA 4IN0A 3A2WA 3GUSA 3VLNA 2I9HA 3LXZA 3LYPA 1Z6NA 1SVMA 1SVOA 1HNBA 4JBBA 4TR1A 4V2NA 2IMDA 4IELA 2NDOA 3UMAA 2OKAA 2VKZG 4AJ6A 4OCEA 2HRNA 5J5NA 4HS1A 2V32A 1E6BA 1T7PB 3TB2A 1T4ZA 2O3EA 1GSUA 5CYYA 1AQXA 4BWSA 4G9HA 1H75A 4LL1B 2G0FA 4NXIA 3EMXA 2LS5A 2YN1A 1THOA 2VCXA 3HY2A 2LV3A 2H6ZA 2I3YA 4MZCA 4GQCA 2L5LA 1XW6A 4FYBA 16GSA 3A3TA 5J3RA 2CQ9A 2H6XA 1PX7A 4V1Ap 5DJMA 2B7KA 4W66A 1O85A 3SBCA 2IL3A 4I2TA 1F37A 1TRWA 4G2EA 5KN2A 4PUFC 3MWHA 4N30A 3RPNA 3TOTA 1Z6MA 3CBUA 3VK9A 1GNWA 4AKXB 1ABAA 1TKDB 4Z2RA 1XIYA 4XS4B 4G0KA 3EVIA 3GSTA 1GUMA 1O8XA 5HR1A 2ON5A 2EFEA 2VCZA 1WWJA 2VL3A 1K3YA 1GTAA 4J56E 5BRTA 2WVXA 1OKDA 4Q5RA 3QOUA 3L9VA 4I97A 2HRFA 3TU3B 1S3RA 3KP9A 3F9UA 3QPMA 2L6DA 1O73A 3FMWA 2MBTA 3UJ1A 5CP1A 1K0CA 1SL1B 4ISDA 3LQ7A 1TDIA 5HR0A 4OCFA 1TK8B 2F8FA 5LCZA 3HMJG 2A2SA 4QMKA 3LWAA 3H8QA 1WRYA 1YQ1A 1X5CA 2K8VA 4FQUA 2VUPA 3GFKA 2L6CA 12GSA 3LORA 1AC1A 3FY7A 3D22A 3GV1A 2WJUA 5IMCA 2VL9A 2NVLA 6GSTA 3ME7A 4EXJA 1X0RA 3QFBC 1XOAA 1R5PA 2A4HA 5DBQA 1TP9A 2PWJA 3VI5A 4MPGA 3KMOA 2L4CA 3Q6OA 1U3AA 1GSFA 3CTGA 3FR6A 2PN8A 18GSA 5F8BA 1HYUA 4X0XA 1CQHA 4I2UA 3BCIA 4KDXA 4P3YB 4K5SA 1BQ7A 2HLSA 1T8EB 3ZTLA 5IMVA 2X4AA 3ZMKA 1FG4A 3DWVA 5C04A 3C1SA 4KCAA 3KGKA 2WDUA 1YEPA 1R7HA 3ZYWA 5AN1A 1M3IA 1G0TA 4K9ZA 2RIIA 1PQNA 4K6XA 5EPFA 2L57A 4ZB9A 2GGTA 4TKYA 3L0HA 4AJ7A 3RDWA 4BIKA 5H5SA 5IM9A 2MMOA 1YF1A 2GLRA 2UZ8A 2IFQB 3W8SA 2BMXA 2YANA 2O7KA 1XPVA 4BVXA 2OE0A 4MJAA 5IMAA 4E8HA 5ECLB 1J9BA 3O76A 4HEA2 3BBYA 1NHYA 3CYNA 4MP4A 1S3DA 3MNGA 4WEYA 3G7IA 2VLVA 1KNGA 1DBYA 2H66A 3IAS2 1DUGA 1GSQA 4HQZA 1ML6A 3O3TA 3ZREA 4K1FA 3MIXA 14GSA 2FNOA 4KH7A 4FXYP 1G6YA 3H4KA 1YKCA 4I5QA 4IHUA 11GSA 4LMWA 2PPTA 4IJIA 3HZ4A 4F82A 1O81A 4YQVA 3ZVJA 1K0DA 2IIYA 2B1KA 1EWXA 1M9BA 2HZFA 3IK9A 4AI6A 1XVWA 2IJYA 5ECNB 1PGTA 4D73B 1ZL9A 3GTUA 5CRHA 1NM3A 4OWYA 2OE1A 2NPBA 4X43A 3U5RE 2R6KA 6GSYA 2ES7A 4EIPA 2WW0A 1MDKA 3WT2A 5D9VA 5ECIB 2V41A 3KEBA 4N11A 3US3A 5DAKB 1TW9A 4MJEA 2VCQA 2DMLA 2R4VA 1GTUA 3GX0A 2J9HA 4XRDA 2QGVA 2CZ2A 4MF6A 3TRPA 3DVWA 1Z7PA 3A5WA 2LJRA 4MA9A 1GLQA 2C4JA 1C72A 5HR2A 3BJ5A 3GRXA 3GA4A 1TTZA 1G6WA 1XG8A 2MMNA 3GURA 3HCZA 4O32A 4IGJA 2YP6A 1A0FA 1O8WA 2VCTA 2OBKA 5CREA 2JZTA 3UL3A 1OC3A 3G7JA 5IOXA 4KF9A 1EGRA 3D4TA 3IC8A 1PRXA 1WOUA 2E2MA 2GSSA 2GT5A 1Y25A 3QR6A 1XVQA 3MYDA 5HFIA 1S3CA 4K7IA 3APOA 1KBNA 4MJBA 4FYUA 1ERTA 2OJLA 5ECSA 4WXTA 3QCPA 1YEWC 3GIXA 1QGVA 4GRFA 4JEDA 2O5VA 5HFGA 5FWGA 1XBSA 2M80A 2C0GA 2I1UA 4MPFA 5BMUA 1ZYEA 1VF2A 3EYTA 5D96A 1X5EA 4ZL7A 3F6DA 3KH9A 4AKGA 4NHZA 5B6MA 5B8AA 5J41A 4YH2A 3HYPA 2WZSA 4X1UA 3HA9A 5IOWA 2FWFA 3HVVA 4O92A 4POKA 1R4WA 3LFLA 3CMIA 2ZNMA 3RAZA 2DIYA 2CVKA 2NTOA 3GL5A 3WGEA 1MD3A 3K8NA 3IR4A 4KW6A 1K0AA 4TR4A 5F05A 4XS6A 2C3NA 1Y1UA 2HSNA 3PPUA 2AYTA 2V1MA 1J0FA 3NOFA 1FVKA 2P31A 1GTIA 2ZCTA 4ZB7A 3SWLA 3H1NA 1EEJA 1MDJA 3I43A 5G5EA 2V6OA 1I9DA 4ECIA 4PHZC 2HSHA 2AJQB 1BJXA 4MJCA 3H79A 4HU9A 3ZL5A 3CSHA 3V1WA 4MLYA 3KH7A 3EMPA 4POMA 4IJ3A 1BG5A 1VF1A 1F3AA 3GKXA 3GKNA 3U6VA 1WP0A 2LRNA 4G0IA 1QFNA 1EOHA 2J23A 2DJJA 1B4QA 4MMMA 4HSCX 1AQVA 3DRNA 1ACVA 4AGSA 3NZNA 4YKFA 4HZ2A 4GCIA 1CQGA 2A2PA 3M1GA 2WVYA 1IYIA 3LW9A 1JZOA 4ZBDA 2EFCA 1PKWA 4HZ4A 5A34A 1SKSB 3FEUA 1ZZYA 2LUSA 3E9JB 3GL3A 2R37A 2DJKA 1ERWA 3P90A 1XOBA 2WCIA 1U6TA 3R2QA 5J40A 4K8MA 1B9YC 4MF5A 1GSEA 5FHIA 4PX1A 4IKHA 1U3IA 1S3AA 1ZYNA 5A1NA 2X8HA 2CZ3A 3BCKA 4HJMA 1A24A 1QMVA 1YEXA 2N5AA 5D9WA 4XCSA 3P8WA 4KB3A 1AUCA 4K7OA 5F07A 5EY6A 3TRQA 5E4WA 2GZPA 4KDUA 5GAND 3M3MA 2WFCA 4OFTA 1SD9A 2FGXA 3EU4A 3GKMA 1H4OA 2H01A 4GWRA 1V40A 1RK4A 4WBJA 3F3QA 4JE1A 4OO5A 2FWEA 6GSUA 2HT9A 1EZKA 6GSVA 1YZXA 3VURA 2LEGA 1FB0A 4G10A 3EU3A 2AUVA 2LRCA 1FOVA 1OC8A 3LEFA 2EFHA 2YV9A 3D0ZA 2L4QA 4TR0A 3GKKA 1V57A 2M46A 4TVEA 5A5HA 5HFKA 2PGTA 3FK8A 1WJKA 2HSMA 4NAXA 3C71A 4EC0A 3TCOA 2NBSA 4AKIA 3CWGA 2DSAA 1XCCA 1MD4A 1UA5A 3FYGA 4PUAA 3CXGA 3ZITA 3ME8A 2YJHA 1TU8A 1RQMA 2FLSA 2KP1A 4O5QA 2LJKA 4ZIJA 1TOFA 3RGBC 4PNFA 1ERVA 1E2YA 4TXOA 1SKWB 1USBA 3PINA 1M99A 2VCVA 4TW5A 1JFUA 1FHEA 3ZLPA 3QAVA 3KD0A 2YWIA 2HRKB 4WBRD 3LSZA 1HNCA 2AB6A 3QD9A 1K3LA 3IOSA 4OO4A 2R0GA 2C3TA 2RLIA 2DKIA 3DXBA 2H75A 3HVSA 4IQ1A 5J47A 2OBIA 3CQFA 2ZUPA 3I69A 4ZBBA 4ZB8A 2K9FA 4POBA 1FO5A 3IRAA 1HD2A 4BA7A 2JU5A 5FT3A 2HE3A 3RPPA 4HU7A 4YQMA 4G19A 3UVHA 4HDEA 3F0IA 2DBCA 4LLRA 4XHMA 1V98A 2DLXA 1GSYA 3DGQA 4NWYA 1TRSA 3IAM2 3FKFA 1I1IP 5J9CA 5A5KA 4QQ7A 3IE3A 5J4YA 2DJ1A 2B1LA 1GLPA 1W89A 2C3QA 1OC9A 4PNGA 3RHBA 2X64A 2JADA 3HVNA 4NHWA 1SKRB 2CA8A 4I6XA 1VF4A 5ID2A 3F8UA 1LBKA 4OMVA 2DJ3A 3F4SA 3UOMA 3F63A 4IP6A 5A4WA 1A8YA 3LJRA 2PERA 20GSA 2WW3A 5B6NA 1SVLA 2HZEB 2H6YA 2GQKA 4KNDA 3W8JA 4A5PA 1EEMA 6GSWA 1X9SB 5D73A 2VL2A 2IN3A 2JSZA 1SL2B 4OFMA 4L5OA 4O5RA 2H0HA 3L9UA 5L71A 4BL7B 4XS1A 3L78A 1F6MC 1EP8A 4KUNA 4EUYA 4AKHA 3QDNA 4CHSA 2FWGA 2OACA 4ACSA 5D9TA 2B5EA 1OKTA 4K2XA 4WF4A 3GHAA 1UN2A 3IXRA 4EVMA 2V2GA 2RM5A 1JHBA 2DC5A 4YAPA 3Q19A 3UEMA 4QL9A 3RHCA 3TJGA 5CRWA 5CRDA 1Q98A 1PD21 2QA2A 5DALA 2H70A 1AW9A 2JSYA 3LG6A 4KE3A 2EIQA 2GT6A 4L0UA 4JU5A 2PUKC 1GUHA 5GAPD 4HUAA 4K5RA 1GRXA 3C73A 3KXOA 3AY8A 5ENUA 2GDRA 1RW1A 4MH3A 3C8EA 1TRVA 4NMUA 1QUWA 3W6GA 4ULXA 5LD0A 2H71A 2DMMA 4TRXA 4MABA 1SJ6A 2WVZA 4DSSA 2CX4A 2WB9A 1PMTA 4WR5A 4WF5A 1PFOA 5F06A 4KCEA 1A0RP 3A2XA 3KMNA 1Z5YE 1TI3A 2FCHA 1YJ6A 2BTOT 1G7EA 5G1KA 5DJLA 4F9ZA 1V2AA 2LJAA 4ZL8A 4RQXA 4FYCA 3FW2A 5AIXA 4NPBA 4DVCA 3G7YA 4JZQA 3BOAA 1OAZA 3TRXA 4KAEA 5EVOA 4AJ8A 4TR1B 3UVTA 5DCHA 4BVYB 2YWNA 2A4VA 3HKRA 2F8AA 2VCWA 3EURA 2YPMA 3TKPA 5CO3A 4J57E 1A2JA 1M2BA 2QC7A 3UARA 1N2AA 1M7TA 2KOKA 1F9MA 1V9WA 5DCGA 1BG1A 1GTBA 3WYWA 1YDKA 3HHVA 5ECPB 4XTSA 2MZCA 4N10A 3VWUA 3CHXC 4HOJA 2HNLA 3IDVA 1SYXA 2FUG2 2RUEA 4XS4A 5ELGA 4ID0A 4ZL9A 3G9BA 6GSSA 1XWGA 2VM1A 2IMKA 2E7PA 3I9V2 3DD3A 5COHA 1A2LA 1MTCA 3TDGA 4K0NA 2WVXB 4KX4A 1YY7A 3GSSA 2VD0A 3DYRA 1T3BA 2P0GA 2Z9SA 4TOPA 1JZRA 2H8LA 1GSSA 2LNTA 3VWWA 1O6JA 1VRSD 4EE0A 1WIKA 4ECJA 1KTEA 4FO5A
chains in the Genus database with same CATH topology
19GSA 3TKSC 1G7OA 1XFLA 2H0GA 2P5RA 4GF0A 1SU9A 5DQSA 1FVJA 4MF7A 2YCDA 4Z7XA 5D8IA 1SK1A 3OR5A 1UC7A 1B48A 4Q5FA 1PA3A 1XW5A 5KN0A 1GP1A 1M9AA 4ML6A 2PMTA 1V58A 1XW9A 3C1RA 2CVBA 3Q74A 4CY6A 3PR8A 3A2VA 4MCUA 1R5AA 5CAXA 3ERGA 3S9FA 4N0VA 1Z7RA 3EE2A 2VAFA 4YAVA 3KCMA 1GWCA 1PN0A 4H86A 2HI7A 5DVBA 3M9JA 4PTSA 4Z2UA 3ED3A 3O6TA 1JLWA 2B5XA 1A2MA 4GLTA 1F3BA 5G31A 4ECBA 5IPHA 3M9KA 3TOUA 1ZGNA 1ZYQB 1WE0A 5J4VA 1YKAA 3DIEA 3E3EA 4NV5A 4NV2A 2H1LA 3VI7A 4ZB6A 2LTKA 3KM6A 4MK3A 4OD7A 4KSMA 4BL7A 4DSQA 3FHKA 1PL2A 1XXUA 1M0UA 5INYA 3TGZA 2GS3A 2DIZA 3N5OA 2TIRA 2E0QA 4GSNA 10GSA 3GYKA 2LNSA 4ICYA 4MH2A 1ILOA 5CRGA 1AAZA 2IFQA 4EDYA 1WMJA 4IS0A 1VGLA 4ZXGA 1TRUA 2R3XA 5IQYA 4BVXB 4F0CA 3TKSE 1U88A 1GNEA 5IMDA 4E8EA 4MZBA 1NHOA 3FR3A 1M2DA 4GXZA 3VPTA 1LU4A 2O87A 1JLVA 2I4AA 2AHEA 2XBQA 3ZVJD 1B4PA 1PX6A 2PVQA 3IHGA 1ZCPA 1QXHA 1AXDA 2YJ7A 3FZAA 4AF2A 3D5JA 1ON4A 1A8LA 1EGOA 1EOGA 2M72A 1DE1A 4KDYA 2XPDA 5JCGA 22GSA 3M8NA 1XWAA 1URMA 4JRRA 1OVNA 4D73A 3IHQA 2KHPA 2DKHA 3D4MA 4L8EA 3GTUB 1EP7A 3E0UA 1FW1A 2KLXA 2C1YA 4X4JA 5E59A 5D9XA 2OADA 3L9SA 4TN8A 2X8CA 2F3MA 2TRCP 2VD1A 5GSTA 2C8UA 2G2QA 3TJBA 1XWKA 5DAKA 2R0CA 2PVOC 4BVYA 2DJ0A 1QK8A 3LXTA 4Q5QA 2N5BA 2EFDA 2JZSA 3P2AA 3TKQA 5KOWA 4O5UA 2O85A 4ML1A 2FA4A 1KEBA 1XWCA 1K0MA 3ERFA 5ECQB 2X8GA 2FA8A 2OE3A 5ECHB 4PURA 4EO3A 4GQFA 1SL0B 5H5RA 1GSDA 3BD2A 1AQWA 2YZHA 4XRAA 3KTLA 3RBTA 4V1Ag 4Q5NA 9GSSA 2H74A 4HI7A 3TKRA 2XC2A 5CNWA 3HJPA 1YVLA 2H76A 2WRTA 2H1GA 5DDLA 3GH6A 1THXA 2N5FA 4KSOA 3H93A 3I6AA 2HRAA 4TR3A 2H1AA 3ZRDA 4EL1A 2FD3A 2B3SA 4PQ1A 1OYJA 4BWQA 2PU9C 2RM6A 5JWRB 4J2FA 4WR4A 3DVXA 2B5YA 5BMUB 2CX3A 3DEXA 5B8BA 1U87A 2MYGA 4KGIA 2YZUA 2MMZA 5G2ZA 3TJKA 3VPQA 2EIOA 4PQIA 1Z3EA 1WPIA 5G30A 4ECCA 2K8SA 2P5QA 1VF3A 3Q18A 3PH9A 3LGCA 3WD6A 1XWBA 1M2AA 1X5DA 2L5OA 2CAQA 1UVZA 4IQAA 2IMEA 2GTUA 4F2IA 5A4UA 3CRUA 4ZILA 2HSNB 4LL4B 1N25A 2LQQA 2VLUA 1B9XC 1FB6A 2RUFA 1K0BA 4JR6A 2C80A 1SK2A 1IYHA 2R5GA 3CRTA 2PBJA 2VLTA 2GVPA 1GH2A 4K2DA 3EPTA 1QQ2A 2C0EA 1HQOA 2VL2C 1BEDA 3F4TA 3HZ8A 2JACA 5IMFA 3F3RA 4CDOA 1T4YA 13GSA 2YWOA 4XIHA 3FZ4A 2WS2A 4MZWA 17GSA 4GSTA 3L4NA 2H1BA 4EDZA 2VIMA 3ZIVA 1J08A 1ZYPA 4IP1A 1BAYA 4RQRA 5LNKe 3UBLA 5A34B 2IMIA 2IPAA 5KN3A 3JCML 5IMZA 3TJJA 5DQYA 5HR3A 2LKUA 4PGTA 3ISOA 2H72A 2HYXA 3GMFA 5C00A 3UBKA 4K0GA 4QL7A 4I8BA 4RUVA 1T00A 2EC4A 3FR9A 2ALBA 2CVDA 2DJ2A 5A1NB 1TJDA 4YQUA 4USSA 2H30A 2K18A 3QFAC 2EIRA 3FRCA 4L0WA 4RI6A 4KA0A 4GSSA 3WT1A 3IC4A 3HJMA 4GTUA 3IK7A 6GSXA 2VM2A 5AISA 2FWHA 1TI1A 3A5IA 2L59A 2F9SA 3HDCA 1SENA 1K0OA 1SD8A 3VWVA 2HFDA 2YNXA 3C7MA 3P7XA 5IIZA 2AV4A 2E2GA 3CSIA 5IO2A 1I5GA 2WULA 2I81A 2WZ9A 5G5FA 3ZFLA 5KN1A 4IBPA 4YKGA 4PQHA 2GQLA 3HXSA 1K0NA 2XPEA 4EKZA 1EV9A 4LA1A 2D2ZA 3UIWA 4O7HA 3UAPA 1FOHA 5A5HB 3APSA 3ERWA 3DMLA 4LMVA 4MDCA 4F03A 3FZ5A 1DSBA 2HSMB 4IW9A 5JCWA 3PGTA 3IPZA 2LRTA 5JWQB 5IO0A 3EWLA 1Q4JA 3HVXA 1ST9A 1X9MB 1FAAA 1SK0A 2HXKA 2KUCA 2GZZA 1HNAA 3APQA 4TXVA 3CSJA 1JZWA 1O7UA 4GDFA 2FY6A 3IBHA 5EL8A 1SJIA 2A2RA 2ON7A 4IVFA 2IWTA 4JR4A 4TXOB 2VO4A 2H0IA 3KZQA 1Y6EA 4RI7A 2UV8G 4PXOA 2R0PA 4MNNA 5ECOB 1BF5A 2HRKA 4L5LA 4EIQA 3HJOA 5AIVA 3NIVA 2F51A 1Z9HA 4G0LA 1PN9A 3J7Yb 5ECMB 2YWMA 2AAWA 3D21A 1TXXA 1PL1A 4CY8A 5A4VA 5GZZB 4EF0A 5KEJA 2CT6A 2H1DA 1OE8A 4N0ZA 2XBIA 4WKWA 1PKZA 5IPGA 4Z2TA 3WGXA 3F6FA 3VWXA 3J7Yk 4OFNA 2GSRA 1N8JA 3QMXA 4DEJA 3KTBA 1TXUA 1GUKA 4FIWA 1SJZA 3TKSA 3D6IA 5ABRA 2LQOA 2QSIA 3GH9A 2MBSA 3ZIJA 5HQPA 1TK5B 3ZZXA 2KP2A 3EINA 3EC3A 5GSSA 3ZFBA 2O89A 1DE2A 1ERUA 2JZRA 1SYRA 2YV7A 4CW9A 4WETA 8GSSA 1BX9A 3MAKA 2GZYA 2HQTA 2TRXA 3QAWA 2HSYA 4G01A 4HJ2A 1OC9B 3GNJA 4ZBAA 1NW2A 3TJFA 1B8XA 5ID2B 1X9WB 2IMFA 3IV4A 2H73A 4E68A 1F2EA 5J9BA 5JCUA 2HZEA 3R3EA 2WGRA 4V2LA 2CV4A 3IA1A 2QA1A 2C0DA 3F4RA 1MEKA 5D93A 3DKSA 3FZ9A 3TUEA 2C0FA 1XZOA 2H19A 2OT3A 3N9JA 2K6VA 4BPYA 4K7NA 2R2JA 2REMA 1MDIA 2B7JA 4FH8A 3MSZA 1BYEA 4ILFA 1LJRA 2B6MA 1GULA 3QAGA 3VFIA 5KOXA 4DSRA 3KIJA 2GSTA 1R26A 5B7CA 1EV4A 1PSQA 5AGYA 3ZMLA 1T1VA 2QKEA 2YOIA 5G1LA 4POLA 1A23A 2GQMA 2JL4A 7GSSA 1GL8A 1OE7A 1YF0A 4HQSA 1ZOFA 4V2MA 1TU7A 5DALB 5F0GA 3KP8A 2VOCA 4N3ZA 3LYKA 3M0FA 1AIUA 2O8VB 5ECRB 2OA7A 5ELAA 3GX8A 5H5QA 1W4VA 2CAIA 3CTFA 2BJXA 2V6KA 5ECKB 5J4UA 3MDKA 2GSQA 3HD5A 3KJYA 2FHEA 2LSTA 2XHFA 2MMAA 4DSSB 1NSWA 1TK0B 2X49A 3WGDA 4F0BA 1K3OA 3GN3A 1ZMAA 5JWOB 2X99A 1JZDA 4IN0A 3A2WA 3GUSA 3VLNA 2I9HA 3LXZA 3LYPA 1Z6NA 1SVMA 1SVOA 1HNBA 4JBBA 4TR1A 4V2NA 2IMDA 4IELA 2NDOA 3UMAA 2OKAA 2VKZG 4AJ6A 4OCEA 2HRNA 5J5NA 4HS1A 2V32A 1E6BA 1T7PB 3TB2A 1T4ZA 5CYYA 1GSUA 1AQXA 4BWSA 4G9HA 1H75A 4LL1B 2G0FA 4NXIA 3EMXA 2LS5A 2YN1A 1THOA 2VCXA 3HY2A 2LV3A 2H6ZA 2I3YA 4MZCA 4GQCA 2L5LA 1XW6A 4FYBA 16GSA 3A3TA 5J3RA 2CQ9A 2H6XA 1PX7A 4V1Ap 5DJMA 2B7KA 4W66A 1O85A 3SBCA 2IL3A 4I2TA 1F37A 1TRWA 4G2EA 5KN2A 4PUFC 3MWHA 4N30A 3RPNA 3TOTA 1Z6MA 3CBUA 3VK9A 1GNWA 4AKXB 1ABAA 1TKDB 4Z2RA 1XIYA 4XS4B 4G0KA 3EVIA 3GSTA 1GUMA 1O8XA 5HR1A 2ON5A 2EFEA 2VCZA 1WWJA 2VL3A 1K3YA 1GTAA 4J56E 5BRTA 1OKDA 4Q5RA 3QOUA 3L9VA 4I97A 2HRFA 3TU3B 3KP9A 3F9UA 3QPMA 2L6DA 1O73A 3FMWA 2MBTA 3UJ1A 5CP1A 1K0CA 1SL1B 4ISDA 3LQ7A 1TDIA 5HR0A 4OCFA 1TK8B 2F8FA 5LCZA 3HMJG 2A2SA 4QMKA 3LWAA 3H8QA 1WRYA 1YQ1A 1X5CA 2K8VA 4FQUA 2VUPA 3GFKA 2L6CA 12GSA 3LORA 1AC1A 3FY7A 3D22A 3GV1A 2WJUA 5IMCA 2VL9A 2NVLA 6GSTA 3ME7A 4EXJA 1X0RA 3QFBC 1XOAA 1R5PA 2A4HA 5DBQA 1TP9A 2PWJA 3VI5A 4MPGA 3KMOA 2L4CA 3Q6OA 1U3AA 1GSFA 3CTGA 3FR6A 2PN8A 18GSA 5F8BA 1HYUA 4X0XA 1CQHA 4I2UA 3BCIA 4KDXA 4P3YB 4K5SA 1BQ7A 2HLSA 1T8EB 3ZTLA 5IMVA 2X4AA 3ZMKA 1FG4A 3DWVA 5C04A 3C1SA 4KCAA 3KGKA 2WDUA 1YEPA 1R7HA 3ZYWA 5AN1A 4K9ZA 1G0TA 2RIIA 1PQNA 4K6XA 5EPFA 2L57A 4ZB9A 2GGTA 4TKYA 3L0HA 4AJ7A 3RDWA 5H5SA 5IM9A 2MMOA 1YF1A 2GLRA 2UZ8A 2IFQB 3W8SA 2BMXA 2YANA 2O7KA 1XPVA 4BVXA 2OE0A 4MJAA 5IMAA 4E8HA 5ECLB 1J9BA 3O76A 4HEA2 3BBYA 1NHYA 3CYNA 4MP4A 1S3DA 3MNGA 4WEYA 3G7IA 2VLVA 1KNGA 1DBYA 2H66A 3IAS2 1DUGA 1GSQA 4HQZA 1ML6A 3O3TA 3ZREA 4K1FA 3MIXA 14GSA 2FNOA 4KH7A 1G6YA 3H4KA 1YKCA 4I5QA 4IHUA 11GSA 4LMWA 2PPTA 4IJIA 3HZ4A 4F82A 1O81A 4YQVA 3ZVJA 1K0DA 2IIYA 2B1KA 1EWXA 1M9BA 2HZFA 3IK9A 4AI6A 1XVWA 2IJYA 5ECNB 1PGTA 4D73B 1ZL9A 3GTUA 5CRHA 1NM3A 4OWYA 2OE1A 2NPBA 4X43A 3U5RE 2R6KA 6GSYA 2ES7A 4EIPA 1MDKA 3WT2A 5D9VA 5ECIB 2V41A 3KEBA 4N11A 3US3A 5DAKB 1TW9A 4MJEA 2VCQA 2DMLA 2R4VA 1GTUA 3GX0A 2J9HA 4XRDA 2QGVA 2CZ2A 4MF6A 3TRPA 3DVWA 1Z7PA 3A5WA 2LJRA 4MA9A 1GLQA 2C4JA 1C72A 5HR2A 3BJ5A 3GRXA 3GA4A 1TTZA 1G6WA 2MMNA 3GURA 3HCZA 4O32A 4IGJA 2YP6A 1A0FA 1O8WA 2VCTA 2OBKA 5CREA 2JZTA 3UL3A 1OC3A 3G7JA 5IOXA 4KF9A 1EGRA 3D4TA 3IC8A 1PRXA 1WOUA 2E2MA 2GSSA 2GT5A 1Y25A 3QR6A 1XVQA 3MYDA 5HFIA 1S3CA 4K7IA 3APOA 1KBNA 4MJBA 4FYUA 1ERTA 2OJLA 5ECSA 4WXTA 3QCPA 3GIXA 1QGVA 4GRFA 4JEDA 2O5VA 5HFGA 5FWGA 1XBSA 2M80A 2C0GA 2I1UA 4MPFA 5BMUA 1ZYEA 1VF2A 3EYTA 5D96A 1X5EA 4ZL7A 3F6DA 3KH9A 4AKGA 4NHZA 5B6MA 5B8AA 5J41A 4YH2A 3HYPA 4X1UA 3HA9A 5IOWA 2FWFA 3HVVA 4O92A 4POKA 1R4WA 3LFLA 3CMIA 2ZNMA 3RAZA 2DIYA 2CVKA 2NTOA 3GL5A 3WGEA 1MD3A 3K8NA 3IR4A 4KW6A 1K0AA 4TR4A 5F05A 4XS6A 2C3NA 1Y1UA 2HSNA 3PPUA 2AYTA 2V1MA 1J0FA 3NOFA 1FVKA 2P31A 1GTIA 2ZCTA 4ZB7A 3SWLA 3H1NA 1EEJA 1MDJA 3I43A 5G5EA 2V6OA 1I9DA 4ECIA 2HSHA 2AJQB 1BJXA 4MJCA 3H79A 4HU9A 3ZL5A 3CSHA 3V1WA 4MLYA 3KH7A 3EMPA 4POMA 4IJ3A 1BG5A 1VF1A 1F3AA 3GKXA 3GKNA 3U6VA 1WP0A 2LRNA 4G0IA 1QFNA 1EOHA 2J23A 2DJJA 1B4QA 4MMMA 1AQVA 3DRNA 1ACVA 4AGSA 3NZNA 4YKFA 4HZ2A 4GCIA 1CQGA 2A2PA 3M1GA 1IYIA 3LW9A 1JZOA 4ZBDA 2EFCA 1PKWA 4HZ4A 5A34A 1SKSB 3FEUA 1ZZYA 2LUSA 3E9JB 3GL3A 2R37A 2DJKA 1ERWA 3P90A 1XOBA 2WCIA 1U6TA 3R2QA 5J40A 4K8MA 1B9YC 4MF5A 1GSEA 5FHIA 4PX1A 4IKHA 1U3IA 1S3AA 1ZYNA 5A1NA 2X8HA 2CZ3A 3BCKA 4HJMA 1A24A 1QMVA 1YEXA 2N5AA 5D9WA 4XCSA 3P8WA 4KB3A 1AUCA 4K7OA 5F07A 5EY6A 3TRQA 5E4WA 2GZPA 4KDUA 5GAND 3M3MA 2WFCA 4OFTA 1SD9A 2FGXA 3EU4A 3GKMA 1H4OA 2H01A 4GWRA 1V40A 1RK4A 4WBJA 3F3QA 4JE1A 4OO5A 2FWEA 6GSUA 2HT9A 1EZKA 6GSVA 1YZXA 3VURA 2LEGA 1FB0A 4G10A 3EU3A 2AUVA 2LRCA 1FOVA 1OC8A 3LEFA 2EFHA 2YV9A 3D0ZA 2L4QA 4TR0A 3GKKA 1V57A 2M46A 4TVEA 5A5HA 5HFKA 2PGTA 3FK8A 1WJKA 2HSMA 4NAXA 3C71A 4EC0A 3TCOA 2NBSA 4AKIA 3CWGA 2DSAA 1XCCA 1MD4A 1UA5A 3FYGA 4PUAA 3CXGA 3ZITA 3ME8A 2YJHA 1TU8A 1RQMA 2FLSA 2KP1A 4O5QA 2LJKA 4ZIJA 1TOFA 4PNFA 1ERVA 1E2YA 4TXOA 1SKWB 1USBA 3PINA 1M99A 2VCVA 4TW5A 1JFUA 1FHEA 3ZLPA 3QAVA 3KD0A 2YWIA 2HRKB 4WBRD 3LSZA 1HNCA 2AB6A 3QD9A 1K3LA 3IOSA 4OO4A 2R0GA 2C3TA 2RLIA 2DKIA 3DXBA 2H75A 3HVSA 4IQ1A 5J47A 2OBIA 2ZUPA 3I69A 4ZBBA 4ZB8A 2K9FA 4POBA 1FO5A 3IRAA 1HD2A 4BA7A 2JU5A 5FT3A 2HE3A 3RPPA 4HU7A 4YQMA 4G19A 3UVHA 4HDEA 3F0IA 2DBCA 4LLRA 4XHMA 1V98A 2DLXA 1GSYA 3DGQA 4NWYA 1TRSA 3IAM2 3FKFA 5J9CA 5A5KA 4QQ7A 3IE3A 5J4YA 2DJ1A 2B1LA 1GLPA 1W89A 2C3QA 1OC9A 4PNGA 3RHBA 2X64A 2JADA 4NHWA 1SKRB 2CA8A 4I6XA 1VF4A 5ID2A 3F8UA 1LBKA 4OMVA 2DJ3A 3F4SA 3UOMA 3F63A 4IP6A 5A4WA 1A8YA 3LJRA 2PERA 20GSA 5B6NA 1SVLA 2HZEB 2H6YA 2GQKA 4KNDA 3W8JA 4A5PA 1EEMA 6GSWA 1X9SB 5D73A 2VL2A 2IN3A 2JSZA 1SL2B 4OFMA 4L5OA 4O5RA 2H0HA 3L9UA 5L71A 4BL7B 4XS1A 3L78A 1F6MC 1EP8A 4KUNA 4EUYA 4AKHA 3QDNA 4CHSA 2FWGA 2OACA 4ACSA 5D9TA 2B5EA 1OKTA 4K2XA 4WF4A 3GHAA 1UN2A 3IXRA 4EVMA 2V2GA 2RM5A 1JHBA 2DC5A 4YAPA 3Q19A 3UEMA 4QL9A 3RHCA 3TJGA 5CRWA 5CRDA 1Q98A 1PD21 2QA2A 5DALA 2H70A 1AW9A 2JSYA 3LG6A 4KE3A 2EIQA 2GT6A 4L0UA 4JU5A 2PUKC 1GUHA 5GAPD 4HUAA 4K5RA 1GRXA 3C73A 3KXOA 3AY8A 5ENUA 2GDRA 1RW1A 4MH3A 3C8EA 1TRVA 4NMUA 1QUWA 3W6GA 4ULXA 5LD0A 2H71A 2DMMA 4TRXA 4MABA 1SJ6A 4DSSA 2CX4A 2WB9A 1PMTA 4WR5A 4WF5A 5F06A 4KCEA 1A0RP 3A2XA 3KMNA 1Z5YE 1TI3A 2FCHA 1YJ6A 2BTOT 1G7EA 5G1KA 5DJLA 4F9ZA 1V2AA 2LJAA 4ZL8A 4RQXA 4FYCA 3FW2A 5AIXA 4NPBA 4DVCA 3G7YA 4JZQA 3BOAA 1OAZA 3TRXA 4KAEA 5EVOA 4AJ8A 4TR1B 3UVTA 5DCHA 4BVYB 2YWNA 2A4VA 3HKRA 2F8AA 2VCWA 3EURA 2YPMA 3TKPA 5CO3A 4J57E 1A2JA 1M2BA 2QC7A 3UARA 1N2AA 1M7TA 2KOKA 1F9MA 1V9WA 5DCGA 1BG1A 1GTBA 3WYWA 1YDKA 3HHVA 5ECPB 4XTSA 2MZCA 4N10A 3VWUA 4HOJA 2HNLA 3IDVA 1SYXA 2FUG2 2RUEA 4XS4A 5ELGA 4ID0A 4ZL9A 3G9BA 6GSSA 1XWGA 2VM1A 2IMKA 2E7PA 3I9V2 3DD3A 5COHA 1A2LA 1MTCA 3TDGA 4K0NA 4KX4A 1YY7A 3GSSA 2VD0A 3DYRA 1T3BA 2P0GA 2Z9SA 4TOPA 1JZRA 2H8LA 1GSSA 2LNTA 3VWWA 1O6JA 1VRSD 4EE0A 1WIKA 4ECJA 1KTEA 4FO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 19GS A;  3TKS C;  1G7O A;  1XFL A;  2H0G A;  2P5R A;  4GF0 A;  1SU9 A;  5DQS A;  1FVJ A;  4MF7 A;  2YCD A;  4Z7X A;  5D8I A;  1SK1 A;  3OR5 A;  1UC7 A;  1B48 A;  4Q5F A;  1PA3 A;  1XW5 A;  5KN0 A;  1GP1 A;  1M9A A;  4ML6 A;  2PMT A;  1V58 A;  1XW9 A;  3C1R A;  2CVB A;  3Q74 A;  3PR8 A;  3A2V A;  4MCU A;  1R5A A;  5CAX A;  3ERG A;  3S9F A;  4N0V A;  1Z7R A;  3EE2 A;  2VAF A;  4YAV A;  3KCM A;  1GWC A;  4H86 A;  2HI7 A;  5DVB A;  3M9J A;  4PTS A;  3ED3 A;  3O6T A;  1JLW A;  2B5X A;  1A2M A;  4GLT A;  1F3B A;  5G31 A;  4ECB A;  5IPH A;  3M9K A;  3TOU A;  1ZGN A;  1ZYQ B;  1WE0 A;  1YKA A;  3DIE A;  3E3E A;  4NV5 A;  4NV2 A;  3VI7 A;  4ZB6 A;  2LTK A;  3KM6 A;  4MK3 A;  4OD7 A;  4KSM A;  4BL7 A;  4DSQ A;  3FHK A;  1PL2 A;  1XXU A;  1M0U A;  5INY A;  3TGZ A;  2GS3 A;  2DIZ A;  3N5O A;  2TIR A;  2E0Q A;  4GSN A;  10GS A;  3GYK A;  2LNS A;  4MH2 A;  1ILO A;  5CRG A;  1AAZ A;  2IFQ A;  4EDY A;  1WMJ A;  4IS0 A;  1VGL A;  4ZXG A;  1TRU A;  2R3X A;  5IQY A;  4BVX B;  4F0C A;  3TKS E;  1U88 A;  1GNE A;  5IMD A;  4E8E A;  4MZB A;  1NHO A;  3FR3 A;  1M2D A;  4GXZ A;  3VPT A;  1LU4 A;  2O87 A;  1JLV A;  2I4A A;  2AHE A;  2XBQ A;  3ZVJ D;  1B4P A;  1PX6 A;  2PVQ A;  1ZCP A;  1QXH A;  1AXD A;  2YJ7 A;  3FZA A;  4AF2 A;  3D5J A;  1ON4 A;  1A8L A;  1EGO A;  1EOG A;  2M72 A;  1DE1 A;  4KDY A;  2XPD A;  5JCG A;  22GS A;  3M8N A;  1XWA A;  1URM A;  4JRR A;  1OVN A;  4D73 A;  3IHQ A;  2KHP A;  3D4M A;  4L8E A;  3GTU B;  1EP7 A;  3E0U A;  1FW1 A;  2KLX A;  2C1Y A;  5E59 A;  5D9X A;  2OAD A;  3L9S A;  4TN8 A;  2X8C A;  2F3M A;  2TRC P;  2VD1 A;  5GST A;  2C8U A;  2G2Q A;  3TJB A;  1XWK A;  5DAK A;  2PVO C;  4BVY A;  2DJ0 A;  1QK8 A;  3LXT A;  4Q5Q A;  2N5B A;  2JZS A;  3P2A A;  3TKQ A;  2O85 A;  4ML1 A;  2FA4 A;  1KEB A;  1XWC A;  1K0M A;  3ERF A;  5ECQ B;  2X8G A;  2FA8 A;  2OE3 A;  5ECH B;  4PUR A;  4EO3 A;  4GQF A;  1SL0 B;  5H5R A;  1GSD A;  3BD2 A;  1AQW A;  2YZH A;  4XRA A;  3KTL A;  3RBT A;  4V1A g;  4Q5N A;  9GSS A;  2H74 A;  4HI7 A;  3TKR A;  2XC2 A;  5CNW A;  3HJP A;  2H76 A;  2WRT A;  2H1G A;  5DDL A;  3GH6 A;  1THX A;  2N5F A;  4KSO A;  3H93 A;  3I6A A;  2HRA A;  4TR3 A;  2H1A A;  3ZRD A;  4EL1 A;  2FD3 A;  2B3S A;  4PQ1 A;  1OYJ A;  4BWQ A;  2PU9 C;  2RM6 A;  5JWR B;  4J2F A;  4WR4 A;  3DVX A;  2B5Y A;  2CX3 A;  3DEX A;  5B8B A;  1U87 A;  2MYG A;  4KGI A;  2YZU A;  2MMZ A;  5G2Z A;  3TJK A;  3VPQ A;  2EIO A;  4PQI A;  1Z3E A;  1WPI A;  5G30 A;  4ECC A;  2K8S A;  2P5Q A;  1VF3 A;  3Q18 A;  3PH9 A;  3LGC A;  3WD6 A;  1XWB A;  1M2A A;  1X5D A;  2L5O A;  2CAQ A;  1UVZ A;  4IQA A;  2IME A;  2GTU A;  4F2I A;  5A4U A;  3CRU A;  4ZIL A;  2HSN B;  4LL4 B;  2LQQ A;  2VLU A;  1B9X C;  1FB6 A;  2RUF A;  1K0B A;  4JR6 A;  2C80 A;  1SK2 A;  1IYH A;  2R5G A;  3CRT A;  2PBJ A;  2VLT A;  2GVP A;  1GH2 A;  4K2D A;  1QQ2 A;  2C0E A;  1HQO A;  2VL2 C;  1BED A;  3F4T A;  3HZ8 A;  2JAC A;  5IMF A;  3F3R A;  4CDO A;  1T4Y A;  13GS A;  2YWO A;  4XIH A;  3FZ4 A;  2WS2 A;  4MZW A;  17GS A;  4GST A;  3L4N A;  2H1B A;  4EDZ A;  2VIM A;  3ZIV A;  1J08 A;  4IP1 A;  1BAY A;  4RQR A;  5LNK e;  3UBL A;  2IMI A;  2IPA A;  5KN3 A;  3JCM L;  5IMZ A;  3TJJ A;  5DQY A;  5HR3 A;  2LKU A;  4PGT A;  3ISO A;  2H72 A;  2HYX A;  3GMF A;  5C00 A;  3UBK A;  4K0G A;  4QL7 A;  4I8B A;  4RUV A;  1T00 A;  2EC4 A;  3FR9 A;  2ALB A;  2CVD A;  2DJ2 A;  1TJD A;  4YQU A;  4USS A;  2H30 A;  2K18 A;  3QFA C;  2EIR A;  3FRC A;  4L0W A;  4RI6 A;  4KA0 A;  4GSS A;  3WT1 A;  3IC4 A;  3HJM A;  4GTU A;  3IK7 A;  6GSX A;  2VM2 A;  5AIS A;  2FWH A;  1TI1 A;  2L59 A;  2F9S A;  3HDC A;  1SEN A;  1K0O A;  1SD8 A;  3VWV A;  2HFD A;  2YNX A;  3C7M A;  3P7X A;  5IIZ A;  2AV4 A;  2E2G A;  3CSI A;  5IO2 A;  1I5G A;  2WUL A;  2I81 A;  2WZ9 A;  5G5F A;  3ZFL A;  5KN1 A;  4IBP A;  4PQH A;  2GQL A;  3HXS A;  1K0N A;  2XPE A;  4EKZ A;  1EV9 A;  4LA1 A;  2D2Z A;  3UIW A;  4O7H A;  3UAP A;  3APS A;  3ERW A;  3DML A;  4LMV A;  4MDC A;  4F03 A;  3FZ5 A;  1DSB A;  2HSM B;  4IW9 A;  5JCW A;  3PGT A;  3IPZ A;  2LRT A;  5JWQ B;  5IO0 A;  3EWL A;  1Q4J A;  3HVX A;  1ST9 A;  1X9M B;  1FAA A;  1SK0 A;  2HXK A;  2KUC A;  2GZZ A;  1HNA A;  3APQ A;  4TXV A;  3CSJ A;  1JZW A;  1O7U A;  2FY6 A;  3IBH A;  5EL8 A;  1SJI A;  2A2R A;  2ON7 A;  4IVF A;  2IWT A;  4JR4 A;  4TXO B;  2VO4 A;  2H0I A;  3KZQ A;  1Y6E A;  4RI7 A;  4PXO A;  5ECO B;  2HRK A;  4L5L A;  3HJO A;  5AIV A;  3NIV A;  2F51 A;  1Z9H A;  4G0L A;  1PN9 A;  3J7Y b;  5ECM B;  2YWM A;  2AAW A;  3D21 A;  1TXX A;  1PL1 A;  5A4V A;  5GZZ B;  4EF0 A;  5KEJ A;  2CT6 A;  2H1D A;  1OE8 A;  4N0Z A;  2XBI A;  4WKW A;  1PKZ A;  5IPG A;  3WGX A;  3F6F A;  3VWX A;  3J7Y k;  4OFN A;  2GSR A;  1N8J A;  3QMX A;  4DEJ A;  3KTB A;  1GUK A;  4FIW A;  1SJZ A;  3TKS A;  3D6I A;  5ABR A;  2LQO A;  2QSI A;  3GH9 A;  2MBS A;  3ZIJ A;  5HQP A;  1TK5 B;  3ZZX A;  2KP2 A;  3EIN A;  3EC3 A;  5GSS A;  3ZFB A;  2O89 A;  1DE2 A;  1ERU A;  2JZR A;  1SYR A;  2YV7 A;  4CW9 A;  4WET A;  8GSS A;  1BX9 A;  3MAK A;  2GZY A;  2HQT A;  2TRX A;  3QAW A;  2HSY A;  4HJ2 A;  1OC9 B;  3GNJ A;  4ZBA A;  1NW2 A;  3TJF A;  1B8X A;  5ID2 B;  1X9W B;  2IMF A;  3IV4 A;  2H73 A;  5J9B A;  1F2E A;  5JCU A;  2HZE A;  3R3E A;  2WGR A;  4V2L A;  2CV4 A;  3IA1 A;  2C0D A;  3F4R A;  1MEK A;  5D93 A;  3DKS A;  3FZ9 A;  3TUE A;  2C0F A;  1XZO A;  2H19 A;  3N9J A;  2K6V A;  4BPY A;  4K7N A;  2R2J A;  2REM A;  1MDI A;  2B7J A;  4FH8 A;  3MSZ A;  1BYE A;  4ILF A;  1LJR A;  2B6M A;  1GUL A;  3QAG A;  3VFI A;  4DSR A;  3KIJ A;  2GST A;  1R26 A;  5B7C A;  1EV4 A;  1PSQ A;  5AGY A;  3ZML A;  1T1V A;  2QKE A;  2YOI A;  5G1L A;  4POL A;  1A23 A;  2GQM A;  2JL4 A;  7GSS A;  1GL8 A;  1OE7 A;  1YF0 A;  4HQS A;  1ZOF A;  4V2M A;  1TU7 A;  5DAL B;  5F0G A;  3KP8 A;  2VOC A;  3LYK A;  3M0F A;  1AIU A;  2O8V B;  5ECR B;  2OA7 A;  5ELA A;  3GX8 A;  5H5Q A;  1W4V A;  2CAI A;  3CTF A;  2BJX A;  2V6K A;  5ECK B;  5J4U A;  3MDK A;  2GSQ A;  3HD5 A;  3KJY A;  2FHE A;  2LST A;  2XHF A;  2MMA A;  4DSS B;  1NSW A;  1TK0 B;  3WGD A;  4F0B A;  1K3O A;  3GN3 A;  1ZMA A;  5JWO B;  2X99 A;  1JZD A;  4IN0 A;  3A2W A;  3GUS A;  3VLN A;  2I9H A;  3LXZ A;  3LYP A;  1Z6N A;  1HNB A;  4JBB A;  4TR1 A;  4V2N A;  2IMD A;  4IEL A;  2NDO A;  3UMA A;  2OKA A;  4AJ6 A;  4OCE A;  2HRN A;  5J5N A;  4HS1 A;  2V32 A;  1E6B A;  1T7P B;  3TB2 A;  1T4Z A;  5CYY A;  1GSU A;  1AQX A;  4BWS A;  4G9H A;  1H75 A;  4LL1 B;  2G0F A;  4NXI A;  3EMX A;  2LS5 A;  2YN1 A;  1THO A;  2VCX A;  3HY2 A;  2LV3 A;  2H6Z A;  2I3Y A;  4MZC A;  4GQC A;  2L5L A;  1XW6 A;  4FYB A;  16GS A;  3A3T A;  5J3R A;  2CQ9 A;  2H6X A;  1PX7 A;  4V1A p;  5DJM A;  2B7K A;  1O85 A;  3SBC A;  2IL3 A;  4I2T A;  1F37 A;  1TRW A;  4G2E A;  5KN2 A;  4PUF C;  3MWH A;  4N30 A;  3RPN A;  3TOT A;  1Z6M A;  3CBU A;  3VK9 A;  1GNW A;  1ABA A;  1TKD B;  1XIY A;  4XS4 B;  4G0K A;  3EVI A;  3GST A;  1GUM A;  1O8X A;  5HR1 A;  2ON5 A;  2VCZ A;  1WWJ A;  2VL3 A;  1K3Y A;  1GTA A;  4J56 E;  1OKD A;  4Q5R A;  3QOU A;  3L9V A;  4I97 A;  2HRF A;  3KP9 A;  3F9U A;  3QPM A;  2L6D A;  1O73 A;  2MBT A;  3UJ1 A;  5CP1 A;  1K0C A;  1SL1 B;  4ISD A;  3LQ7 A;  1TDI A;  5HR0 A;  4OCF A;  1TK8 B;  2F8F A;  5LCZ A;  2A2S A;  3LWA A;  3H8Q A;  1WRY A;  1YQ1 A;  1X5C A;  2K8V A;  4FQU A;  2VUP A;  3GFK A;  2L6C A;  12GS A;  3LOR A;  1AC1 A;  3FY7 A;  3D22 A;  3GV1 A;  2WJU A;  5IMC A;  2VL9 A;  2NVL A;  6GST A;  3ME7 A;  4EXJ A;  1X0R A;  3QFB C;  1XOA A;  1R5P A;  5DBQ A;  1TP9 A;  2PWJ A;  3VI5 A;  4MPG A;  3KMO A;  2L4C A;  3Q6O A;  1U3A A;  1GSF A;  3CTG A;  3FR6 A;  2PN8 A;  18GS A;  5F8B A;  1HYU A;  4X0X A;  1CQH A;  4I2U A;  3BCI A;  4KDX A;  4P3Y B;  1BQ7 A;  2HLS A;  1T8E B;  3ZTL A;  5IMV A;  3ZMK A;  1FG4 A;  3DWV A;  5C04 A;  3C1S A;  4KCA A;  3KGK A;  2WDU A;  1YEP A;  1R7H A;  3ZYW A;  5AN1 A;  4K9Z A;  1G0T A;  2RII A;  1PQN A;  4K6X A;  5EPF A;  2L57 A;  4ZB9 A;  2GGT A;  4TKY A;  3L0H A;  4AJ7 A;  3RDW A;  5H5S A;  5IM9 A;  2MMO A;  1YF1 A;  2GLR A;  2UZ8 A;  2IFQ B;  3W8S A;  2BMX A;  2YAN A;  2O7K A;  1XPV A;  4BVX A;  2OE0 A;  4MJA A;  5IMA A;  4E8H A;  5ECL B;  1J9B A;  3O76 A;  4HEA 2;  3BBY A;  1NHY A;  3CYN A;  4MP4 A;  1S3D A;  3MNG A;  4WEY A;  3G7I A;  2VLV A;  1KNG A;  1DBY A;  2H66 A;  3IAS 2;  1DUG A;  1GSQ A;  4HQZ A;  1ML6 A;  3O3T A;  3ZRE A;  4K1F A;  14GS A;  2FNO A;  4KH7 A;  1G6Y A;  3H4K A;  1YKC A;  4I5Q A;  4IHU A;  11GS A;  4LMW A;  2PPT A;  4IJI A;  3HZ4 A;  4F82 A;  1O81 A;  4YQV A;  3ZVJ A;  1K0D A;  2IIY A;  2B1K A;  1EWX A;  1M9B A;  2HZF A;  3IK9 A;  1XVW A;  2IJY A;  5ECN B;  1PGT A;  4D73 B;  1ZL9 A;  3GTU A;  5CRH A;  1NM3 A;  4OWY A;  2OE1 A;  2NPB A;  4X43 A;  3U5R E;  2R6K A;  6GSY A;  2ES7 A;  1MDK A;  3WT2 A;  5D9V A;  5ECI B;  2V41 A;  3KEB A;  4N11 A;  3US3 A;  5DAK B;  1TW9 A;  4MJE A;  2VCQ A;  2DML A;  2R4V A;  1GTU A;  3GX0 A;  2J9H A;  4XRD A;  2QGV A;  2CZ2 A;  4MF6 A;  3TRP A;  3DVW A;  1Z7P A;  3A5W A;  2LJR A;  4MA9 A;  1GLQ A;  2C4J A;  1C72 A;  5HR2 A;  3BJ5 A;  3GRX A;  3GA4 A;  1TTZ A;  1G6W A;  2MMN A;  3GUR A;  3HCZ A;  4O32 A;  4IGJ A;  2YP6 A;  1A0F A;  1O8W A;  2VCT A;  2OBK A;  5CRE A;  2JZT A;  3UL3 A;  1OC3 A;  3G7J A;  5IOX A;  4KF9 A;  1EGR A;  3D4T A;  3IC8 A;  1PRX A;  1WOU A;  2E2M A;  2GSS A;  2GT5 A;  1Y25 A;  3QR6 A;  1XVQ A;  5HFI A;  1S3C A;  4K7I A;  3APO A;  1KBN A;  4MJB A;  4FYU A;  1ERT A;  2OJL A;  5ECS A;  4WXT A;  3QCP A;  3GIX A;  1QGV A;  4GRF A;  4JED A;  5HFG A;  5FWG A;  1XBS A;  2M80 A;  2C0G A;  2I1U A;  4MPF A;  5BMU A;  1ZYE A;  1VF2 A;  3EYT A;  5D96 A;  1X5E A;  4ZL7 A;  3F6D A;  3KH9 A;  4NHZ A;  5B6M A;  5B8A A;  5J41 A;  4YH2 A;  3HYP A;  4X1U A;  3HA9 A;  5IOW A;  2FWF A;  3HVV A;  4O92 A;  4POK A;  1R4W A;  3LFL A;  3CMI A;  2ZNM A;  3RAZ A;  2DIY A;  2CVK A;  2NTO A;  3GL5 A;  3WGE A;  1MD3 A;  3K8N A;  3IR4 A;  4KW6 A;  1K0A A;  4TR4 A;  5F05 A;  4XS6 A;  2C3N A;  3PPU A;  2AYT A;  2V1M A;  1J0F A;  3NOF A;  1FVK A;  2P31 A;  1GTI A;  2ZCT A;  3SWL A;  3H1N A;  1EEJ A;  1MDJ A;  3I43 A;  5G5E A;  2V6O A;  1I9D A;  4ECI A;  2HSH A;  2AJQ B;  1BJX A;  4MJC A;  3H79 A;  4HU9 A;  3ZL5 A;  3CSH A;  3V1W A;  4MLY A;  3KH7 A;  3EMP A;  4POM A;  4IJ3 A;  1BG5 A;  1VF1 A;  1F3A A;  3GKX A;  3GKN A;  3U6V A;  1WP0 A;  2LRN A;  4G0I A;  1QFN A;  1EOH A;  2J23 A;  2DJJ A;  1B4Q A;  4MMM A;  1AQV A;  3DRN A;  1ACV A;  4AGS A;  3NZN A;  4HZ2 A;  4GCI A;  1CQG A;  3M1G A;  1IYI A;  1JZO A;  4ZBD A;  1PKW A;  4HZ4 A;  1SKS B;  3FEU A;  1ZZY A;  2LUS A;  3E9J B;  3GL3 A;  2R37 A;  2DJK A;  1ERW A;  3P90 A;  1XOB A;  2WCI A;  1U6T A;  3R2Q A;  4K8M A;  1B9Y C;  4MF5 A;  1GSE A;  5FHI A;  4PX1 A;  4IKH A;  1U3I A;  1S3A A;  2X8H A;  2CZ3 A;  3BCK A;  4HJM A;  1A24 A;  1QMV A;  1YEX A;  2N5A A;  5D9W A;  4XCS A;  3P8W A;  4KB3 A;  1AUC A;  4K7O A;  5F07 A;  5EY6 A;  3TRQ A;  5E4W A;  2GZP A;  4KDU A;  5GAN D;  3M3M A;  2WFC A;  4OFT A;  1SD9 A;  2FGX A;  3EU4 A;  3GKM A;  1H4O A;  2H01 A;  4GWR A;  1V40 A;  1RK4 A;  4WBJ A;  3F3Q A;  4JE1 A;  4OO5 A;  2FWE A;  6GSU A;  2HT9 A;  1EZK A;  6GSV A;  1YZX A;  3VUR A;  2LEG A;  1FB0 A;  4G10 A;  3EU3 A;  2AUV A;  2LRC A;  1FOV A;  1OC8 A;  3LEF A;  2YV9 A;  3D0Z A;  2L4Q A;  4TR0 A;  3GKK A;  1V57 A;  2M46 A;  4TVE A;  5HFK A;  2PGT A;  3FK8 A;  1WJK A;  2HSM A;  4NAX A;  3C71 A;  4EC0 A;  3TCO A;  2NBS A;  2DSA A;  1XCC A;  1MD4 A;  1UA5 A;  3FYG A;  4PUA A;  3CXG A;  3ZIT A;  3ME8 A;  2YJH A;  1TU8 A;  1RQM A;  2FLS A;  2KP1 A;  2LJK A;  4ZIJ A;  1TOF A;  4PNF A;  1ERV A;  1E2Y A;  4TXO A;  1SKW B;  1USB A;  3PIN A;  1M99 A;  2VCV A;  4TW5 A;  1JFU A;  1FHE A;  3ZLP A;  3QAV A;  3KD0 A;  2YWI A;  2HRK B;  4WBR D;  3LSZ A;  1HNC A;  2AB6 A;  3QD9 A;  1K3L A;  3IOS A;  4OO4 A;  2C3T A;  2RLI A;  3DXB A;  2H75 A;  3HVS A;  4IQ1 A;  2OBI A;  2ZUP A;  3I69 A;  4ZBB A;  4ZB8 A;  2K9F A;  4POB A;  1FO5 A;  3IRA A;  1HD2 A;  4BA7 A;  2JU5 A;  5FT3 A;  2HE3 A;  3RPP A;  4HU7 A;  4YQM A;  4G19 A;  3UVH A;  4HDE A;  3F0I A;  2DBC A;  4LLR A;  4XHM A;  1V98 A;  2DLX A;  1GSY A;  3DGQ A;  4NWY A;  1TRS A;  3IAM 2;  3FKF A;  5J9C A;  5A5K A;  4QQ7 A;  3IE3 A;  2DJ1 A;  2B1L A;  1GLP A;  1W89 A;  2C3Q A;  1OC9 A;  4PNG A;  3RHB A;  2X64 A;  2JAD A;  4NHW A;  1SKR B;  2CA8 A;  4I6X A;  1VF4 A;  5ID2 A;  3F8U A;  1LBK A;  4OMV A;  2DJ3 A;  3F4S A;  3UOM A;  3F63 A;  4IP6 A;  5A4W A;  1A8Y A;  3LJR A;  2PER A;  20GS A;  5B6N A;  2HZE B;  2H6Y A;  2GQK A;  4KND A;  3W8J A;  1EEM A;  6GSW A;  1X9S B;  5D73 A;  2VL2 A;  2IN3 A;  2JSZ A;  1SL2 B;  4OFM A;  4L5O A;  4O5R A;  2H0H A;  3L9U A;  5L71 A;  4BL7 B;  4XS1 A;  3L78 A;  1F6M C;  1EP8 A;  4KUN A;  4EUY A;  3QDN A;  4CHS A;  2FWG A;  2OAC A;  4ACS A;  5D9T A;  2B5E A;  1OKT A;  4WF4 A;  3GHA A;  1UN2 A;  3IXR A;  4EVM A;  2V2G A;  2RM5 A;  1JHB A;  2DC5 A;  4YAP A;  3Q19 A;  3UEM A;  4QL9 A;  3RHC A;  3TJG A;  5CRW A;  5CRD A;  1Q98 A;  1PD2 1;  5DAL A;  2H70 A;  1AW9 A;  2JSY A;  3LG6 A;  4KE3 A;  2EIQ A;  2GT6 A;  4L0U A;  4JU5 A;  2PUK C;  1GUH A;  5GAP D;  4HUA A;  1GRX A;  3C73 A;  3KXO A;  3AY8 A;  5ENU A;  2GDR A;  1RW1 A;  4MH3 A;  3C8E A;  1TRV A;  4NMU A;  1QUW A;  3W6G A;  4ULX A;  5LD0 A;  2H71 A;  2DMM A;  4TRX A;  4MAB A;  1SJ6 A;  4DSS A;  2CX4 A;  2WB9 A;  1PMT A;  4WR5 A;  4WF5 A;  5F06 A;  4KCE A;  1A0R P;  3A2X A;  3KMN A;  1Z5Y E;  1TI3 A;  2FCH A;  1YJ6 A;  2BTO T;  1G7E A;  5G1K A;  5DJL A;  4F9Z A;  1V2A A;  2LJA A;  4ZL8 A;  4RQX A;  4FYC A;  3FW2 A;  5AIX A;  4NPB A;  4DVC A;  3G7Y A;  4JZQ A;  3BOA A;  1OAZ A;  3TRX A;  4KAE A;  5EVO A;  4AJ8 A;  4TR1 B;  3UVT A;  5DCH A;  4BVY B;  2YWN A;  2A4V A;  3HKR A;  2F8A A;  2VCW A;  3EUR A;  2YPM A;  3TKP A;  5CO3 A;  4J57 E;  1A2J A;  1M2B A;  2QC7 A;  3UAR A;  1N2A A;  1M7T A;  2KOK A;  1F9M A;  1V9W A;  5DCG A;  1GTB A;  3WYW A;  1YDK A;  3HHV A;  5ECP B;  4XTS A;  2MZC A;  4N10 A;  3VWU A;  4HOJ A;  2HNL A;  3IDV A;  1SYX A;  2FUG 2;  2RUE A;  4XS4 A;  5ELG A;  4ID0 A;  4ZL9 A;  3G9B A;  6GSS A;  1XWG A;  2VM1 A;  2IMK A;  2E7P A;  3I9V 2;  3DD3 A;  5COH A;  1A2L A;  1MTC A;  3TDG A;  4K0N A;  4KX4 A;  1YY7 A;  3GSS A;  2VD0 A;  3DYR A;  1T3B A;  2P0G A;  2Z9S A;  4TOP A;  1JZR A;  2H8L A;  1GSS A;  2LNT A;  3VWW A;  1O6J A;  1VRS D;  4EE0 A;  1WIK A;  4ECJ A;  1KTE A;  4FO5 A; 
#chains in the Genus database with same CATH topology
 19GS A;  3TKS C;  1G7O A;  1XFL A;  2H0G A;  2P5R A;  4GF0 A;  1SU9 A;  5DQS A;  1FVJ A;  4MF7 A;  2YCD A;  4Z7X A;  5D8I A;  1SK1 A;  3OR5 A;  1UC7 A;  1B48 A;  4Q5F A;  1PA3 A;  1XW5 A;  5KN0 A;  1GP1 A;  1M9A A;  4ML6 A;  2PMT A;  1V58 A;  1XW9 A;  3C1R A;  2CVB A;  3Q74 A;  4CY6 A;  3PR8 A;  3A2V A;  4MCU A;  1R5A A;  5CAX A;  3ERG A;  3S9F A;  4N0V A;  1Z7R A;  3EE2 A;  2VAF A;  4YAV A;  3KCM A;  1GWC A;  1PN0 A;  4H86 A;  2HI7 A;  5DVB A;  3RFR C;  3M9J A;  4PTS A;  4Z2U A;  3ED3 A;  3O6T A;  1JLW A;  2B5X A;  1A2M A;  4GLT A;  1F3B A;  5G31 A;  4ECB A;  5IPH A;  3M9K A;  3TOU A;  1ZGN A;  1ZYQ B;  1WE0 A;  5J4V A;  1YKA A;  3DIE A;  3E3E A;  4NV5 A;  4NV2 A;  2H1L A;  3VI7 A;  4ZB6 A;  2LTK A;  3KM6 A;  4MK3 A;  4OD7 A;  4KSM A;  4BL7 A;  4DSQ A;  3FHK A;  1PL2 A;  1XXU A;  1M0U A;  5INY A;  3TGZ A;  2GS3 A;  2DIZ A;  3N5O A;  2TIR A;  2E0Q A;  4GSN A;  10GS A;  3GYK A;  2LNS A;  4ICY A;  4MH2 A;  1ILO A;  5CRG A;  1AAZ A;  2IFQ A;  4EDY A;  1WMJ A;  4IS0 A;  1VGL A;  4ZXG A;  1TRU A;  2R3X A;  5IQY A;  4BVX B;  4F0C A;  3TKS E;  1U88 A;  1GNE A;  5IMD A;  4E8E A;  4MZB A;  1NHO A;  3FR3 A;  1M2D A;  4GXZ A;  3VPT A;  1LU4 A;  2O87 A;  1JLV A;  2I4A A;  2AHE A;  2XBQ A;  3ZVJ D;  1B4P A;  1PX6 A;  2PVQ A;  3IHG A;  1ZCP A;  1QXH A;  1AXD A;  2YJ7 A;  3FZA A;  4AF2 A;  3D5J A;  1ON4 A;  1A8L A;  1EGO A;  1EOG A;  2M72 A;  1DE1 A;  4KDY A;  2XPD A;  5JCG A;  22GS A;  3M8N A;  1XWA A;  1URM A;  4JRR A;  1OVN A;  4D73 A;  3IHQ A;  2KHP A;  2DKH A;  3D4M A;  4L8E A;  3GTU B;  1EP7 A;  3E0U A;  1FW1 A;  2KLX A;  2C1Y A;  4X4J A;  5E59 A;  5D9X A;  2OAD A;  3L9S A;  4TN8 A;  2X8C A;  2F3M A;  2TRC P;  2VD1 A;  5GST A;  2C8U A;  2G2Q A;  3TJB A;  1XWK A;  5DAK A;  2R0C A;  2PVO C;  4BVY A;  2DJ0 A;  1QK8 A;  3LXT A;  4Q5Q A;  2N5B A;  2EFD A;  2JZS A;  3P2A A;  3TKQ A;  5KOW A;  4O5U A;  2O85 A;  4ML1 A;  2FA4 A;  1KEB A;  1M3J A;  1XWC A;  1K0M A;  3ERF A;  5ECQ B;  2X8G A;  2FA8 A;  2OE3 A;  5ECH B;  4PUR A;  4EO3 A;  4GQF A;  1SL0 B;  5H5R A;  1GSD A;  3BD2 A;  1AQW A;  2YZH A;  4XRA A;  3KTL A;  3RBT A;  4V1A g;  4Q5N A;  9GSS A;  2H74 A;  4HI7 A;  3TKR A;  2XC2 A;  5CNW A;  3HJP A;  1YVL A;  2H76 A;  2WRT A;  2H1G A;  5DDL A;  3GH6 A;  1THX A;  2N5F A;  4KSO A;  3H93 A;  3I6A A;  2HRA A;  4TR3 A;  2H1A A;  3ZRD A;  4EL1 A;  2FD3 A;  2B3S A;  4PQ1 A;  1OYJ A;  4BWQ A;  2PU9 C;  2RM6 A;  5JWR B;  4J2F A;  4WR4 A;  3DVX A;  2B5Y A;  5BMU B;  2CX3 A;  3DEX A;  5B8B A;  1U87 A;  2MYG A;  4KGI A;  2YZU A;  2MMZ A;  5G2Z A;  3TJK A;  3VPQ A;  2EIO A;  4PQI A;  1Z3E A;  1WPI A;  5G30 A;  4ECC A;  2K8S A;  2P5Q A;  1VF3 A;  3Q18 A;  3PH9 A;  3LGC A;  3WD6 A;  1XWB A;  1M2A A;  1X5D A;  2L5O A;  2CAQ A;  1UVZ A;  4IQA A;  2IME A;  2GTU A;  4F2I A;  5A4U A;  3CRU A;  4ZIL A;  2HSN B;  4LL4 B;  1N25 A;  2LQQ A;  2VLU A;  1B9X C;  1FB6 A;  2RUF A;  1K0B A;  4JR6 A;  2C80 A;  1SK2 A;  1IYH A;  2R5G A;  3CRT A;  2PBJ A;  2VLT A;  2GVP A;  1GH2 A;  4K2D A;  3EPT A;  1QQ2 A;  2C0E A;  1HQO A;  2VL2 C;  1BED A;  3F4T A;  3HZ8 A;  2JAC A;  5IMF A;  3F3R A;  4CDO A;  1T4Y A;  13GS A;  2YWO A;  4XIH A;  3FZ4 A;  2WS2 A;  4MZW A;  17GS A;  4GST A;  3L4N A;  2H1B A;  4EDZ A;  2VIM A;  3ZIV A;  1J08 A;  1ZYP A;  4IP1 A;  1BAY A;  4RQR A;  5LNK e;  3UBL A;  5A34 B;  2IMI A;  2IPA A;  5KN3 A;  3JCM L;  5IMZ A;  3TJJ A;  5DQY A;  5HR3 A;  2LKU A;  4PGT A;  3ISO A;  2H72 A;  2WW2 A;  2HYX A;  3GMF A;  5C00 A;  3UBK A;  4K0G A;  4QL7 A;  4I8B A;  4RUV A;  1T00 A;  2EC4 A;  3FR9 A;  2ALB A;  2CVD A;  2DJ2 A;  5A1N B;  1TJD A;  4YQU A;  4USS A;  2H30 A;  2K18 A;  3QFA C;  2EIR A;  3FRC A;  4L0W A;  4RI6 A;  4KA0 A;  4GSS A;  2O36 A;  3WT1 A;  3IC4 A;  3HJM A;  4GTU A;  3IK7 A;  6GSX A;  2VM2 A;  5AIS A;  2FWH A;  1TI1 A;  3A5I A;  2L59 A;  2F9S A;  3HDC A;  1SEN A;  1K0O A;  1SD8 A;  3VWV A;  2HFD A;  2YNX A;  3C7M A;  3P7X A;  5IIZ A;  2AV4 A;  2E2G A;  3CSI A;  5IO2 A;  1I5G A;  2WUL A;  2I81 A;  2WZ9 A;  5G5F A;  3ZFL A;  5KN1 A;  4IBP A;  4YKG A;  4PQH A;  2GQL A;  3HXS A;  1K0N A;  2XPE A;  4EKZ A;  1EV9 A;  4LA1 A;  2D2Z A;  3UIW A;  4O7H A;  3UAP A;  1FOH A;  5A5H B;  3APS A;  3ERW A;  3DML A;  4LMV A;  4MDC A;  4F03 A;  3FZ5 A;  1DSB A;  2HSM B;  4IW9 A;  5JCW A;  3PGT A;  3IPZ A;  2LRT A;  5JWQ B;  1S4B P;  5IO0 A;  3EWL A;  1Q4J A;  3HVX A;  1ST9 A;  1X9M B;  1FAA A;  1SK0 A;  2HXK A;  2KUC A;  2GZZ A;  1HNA A;  3APQ A;  4TXV A;  3CSJ A;  1JZW A;  1O7U A;  4GDF A;  2FY6 A;  3IBH A;  5EL8 A;  1SJI A;  2A2R A;  2ON7 A;  4IVF A;  2IWT A;  4JR4 A;  4TXO B;  2VO4 A;  2H0I A;  3KZQ A;  1Y6E A;  4RI7 A;  2UV8 G;  4PXO A;  2R0P A;  4MNN A;  5ECO B;  1BF5 A;  2HRK A;  4L5L A;  4EIQ A;  3HJO A;  5AIV A;  3NIV A;  2F51 A;  1Z9H A;  4G0L A;  1PN9 A;  3J7Y b;  5ECM B;  2YWM A;  2AAW A;  3D21 A;  1TXX A;  1PL1 A;  4CY8 A;  5A4V A;  5GZZ B;  4EF0 A;  5KEJ A;  2CT6 A;  2H1D A;  1OE8 A;  4N0Z A;  2XBI A;  4WKW A;  1PKZ A;  5IPG A;  4Z2T A;  3WGX A;  3F6F A;  3VWX A;  3J7Y k;  4OFN A;  2GSR A;  1N8J A;  3QMX A;  4DEJ A;  3KTB A;  1TXU A;  1GUK A;  4FIW A;  1SJZ A;  3TKS A;  3D6I A;  5ABR A;  2LQO A;  2QSI A;  3GH9 A;  2MBS A;  3ZIJ A;  5HQP A;  1TK5 B;  3ZZX A;  2KP2 A;  3EIN A;  3EC3 A;  5GSS A;  3ZFB A;  2O89 A;  1DE2 A;  1ERU A;  2JZR A;  1SYR A;  2YV7 A;  4CW9 A;  4WET A;  8GSS A;  1BX9 A;  3MAK A;  2GZY A;  2HQT A;  2TRX A;  3QAW A;  2HSY A;  4G01 A;  4HJ2 A;  1OC9 B;  3GNJ A;  4ZBA A;  1NW2 A;  3TJF A;  1B8X A;  5ID2 B;  1X9W B;  2IMF A;  3IV4 A;  2H73 A;  4E68 A;  1F2E A;  5J9B A;  5JCU A;  2HZE A;  3R3E A;  2WGR A;  4V2L A;  2CV4 A;  3IA1 A;  2QA1 A;  2C0D A;  3F4R A;  1MEK A;  5D93 A;  3DKS A;  3FZ9 A;  3TUE A;  2C0F A;  1XZO A;  2H19 A;  2OT3 A;  3N9J A;  2K6V A;  4BPY A;  4PI0 C;  4K7N A;  2R2J A;  2REM A;  1MDI A;  2B7J A;  4FH8 A;  3MSZ A;  1BYE A;  4ILF A;  1LJR A;  2B6M A;  1GUL A;  3QAG A;  3VFI A;  5KOX A;  4DSR A;  3KIJ A;  2GST A;  1R26 A;  5B7C A;  1EV4 A;  1PSQ A;  5AGY A;  3ZML A;  1T1V A;  2QKE A;  2YOI A;  5G1L A;  4POL A;  1A23 A;  2GQM A;  2JL4 A;  7GSS A;  1GL8 A;  1OE7 A;  1YF0 A;  4HQS A;  1ZOF A;  4V2M A;  1TU7 A;  5DAL B;  5F0G A;  3KP8 A;  2VOC A;  4N3Z A;  3LYK A;  3M0F A;  1AIU A;  2O8V B;  5ECR B;  2OA7 A;  5ELA A;  3GX8 A;  5H5Q A;  1W4V A;  2CAI A;  3CTF A;  4PI2 C;  2BJX A;  2V6K A;  5ECK B;  5J4U A;  3MDK A;  2GSQ A;  3HD5 A;  3KJY A;  2WW1 A;  2FHE A;  2LST A;  2XHF A;  2MMA A;  4DSS B;  1NSW A;  1TK0 B;  2X49 A;  3WGD A;  4F0B A;  1K3O A;  3GN3 A;  1ZMA A;  5JWO B;  2X99 A;  1JZD A;  4IN0 A;  3A2W A;  3GUS A;  3VLN A;  2I9H A;  3LXZ A;  3LYP A;  1Z6N A;  1SVM A;  1SVO A;  1HNB A;  4JBB A;  4TR1 A;  4V2N A;  2IMD A;  4IEL A;  2NDO A;  3UMA A;  2OKA A;  2VKZ G;  4AJ6 A;  4OCE A;  2HRN A;  5J5N A;  4HS1 A;  2V32 A;  1E6B A;  1T7P B;  3TB2 A;  1T4Z A;  2O3E A;  1GSU A;  5CYY A;  1AQX A;  4BWS A;  4G9H A;  1H75 A;  4LL1 B;  2G0F A;  4NXI A;  3EMX A;  2LS5 A;  2YN1 A;  1THO A;  2VCX A;  3HY2 A;  2LV3 A;  2H6Z A;  2I3Y A;  4MZC A;  4GQC A;  2L5L A;  1XW6 A;  4FYB A;  16GS A;  3A3T A;  5J3R A;  2CQ9 A;  2H6X A;  1PX7 A;  4V1A p;  5DJM A;  2B7K A;  4W66 A;  1O85 A;  3SBC A;  2IL3 A;  4I2T A;  1F37 A;  1TRW A;  4G2E A;  5KN2 A;  4PUF C;  3MWH A;  4N30 A;  3RPN A;  3TOT A;  1Z6M A;  3CBU A;  3VK9 A;  1GNW A;  4AKX B;  1ABA A;  1TKD B;  4Z2R A;  1XIY A;  4XS4 B;  4G0K A;  3EVI A;  3GST A;  1GUM A;  1O8X A;  5HR1 A;  2ON5 A;  2EFE A;  2VCZ A;  1WWJ A;  2VL3 A;  1K3Y A;  1GTA A;  4J56 E;  5BRT A;  2WVX A;  1OKD A;  4Q5R A;  3QOU A;  3L9V A;  4I97 A;  2HRF A;  3TU3 B;  1S3R A;  3KP9 A;  3F9U A;  3QPM A;  2L6D A;  1O73 A;  3FMW A;  2MBT A;  3UJ1 A;  5CP1 A;  1K0C A;  1SL1 B;  4ISD A;  3LQ7 A;  1TDI A;  5HR0 A;  4OCF A;  1TK8 B;  2F8F A;  5LCZ A;  3HMJ G;  2A2S A;  4QMK A;  3LWA A;  3H8Q A;  1WRY A;  1YQ1 A;  1X5C A;  2K8V A;  4FQU A;  2VUP A;  3GFK A;  2L6C A;  12GS A;  3LOR A;  1AC1 A;  3FY7 A;  3D22 A;  3GV1 A;  2WJU A;  5IMC A;  2VL9 A;  2NVL A;  6GST A;  3ME7 A;  4EXJ A;  1X0R A;  3QFB C;  1XOA A;  1R5P A;  2A4H A;  5DBQ A;  1TP9 A;  2PWJ A;  3VI5 A;  4MPG A;  3KMO A;  2L4C A;  3Q6O A;  1U3A A;  1GSF A;  3CTG A;  3FR6 A;  2PN8 A;  18GS A;  5F8B A;  1HYU A;  4X0X A;  1CQH A;  4I2U A;  3BCI A;  4KDX A;  4P3Y B;  4K5S A;  1BQ7 A;  2HLS A;  1T8E B;  3ZTL A;  5IMV A;  2X4A A;  3ZMK A;  1FG4 A;  3DWV A;  5C04 A;  3C1S A;  4KCA A;  3KGK A;  2WDU A;  1YEP A;  1R7H A;  3ZYW A;  5AN1 A;  1M3I A;  1G0T A;  4K9Z A;  2RII A;  1PQN A;  4K6X A;  5EPF A;  2L57 A;  4ZB9 A;  2GGT A;  4TKY A;  3L0H A;  4AJ7 A;  3RDW A;  4BIK A;  5H5S A;  5IM9 A;  2MMO A;  1YF1 A;  2GLR A;  2UZ8 A;  2IFQ B;  3W8S A;  2BMX A;  2YAN A;  2O7K A;  1XPV A;  4BVX A;  2OE0 A;  4MJA A;  5IMA A;  4E8H A;  5ECL B;  1J9B A;  3O76 A;  4HEA 2;  3BBY A;  1NHY A;  3CYN A;  4MP4 A;  1S3D A;  3MNG A;  4WEY A;  3G7I A;  2VLV A;  1KNG A;  1DBY A;  2H66 A;  3IAS 2;  1DUG A;  1GSQ A;  4HQZ A;  1ML6 A;  3O3T A;  3ZRE A;  4K1F A;  3MIX A;  14GS A;  2FNO A;  4KH7 A;  4FXY P;  1G6Y A;  3H4K A;  1YKC A;  4I5Q A;  4IHU A;  11GS A;  4LMW A;  2PPT A;  4IJI A;  3HZ4 A;  4F82 A;  1O81 A;  4YQV A;  3ZVJ A;  1K0D A;  2IIY A;  2B1K A;  1EWX A;  1M9B A;  2HZF A;  3IK9 A;  4AI6 A;  1XVW A;  2IJY A;  5ECN B;  1PGT A;  4D73 B;  1ZL9 A;  3GTU A;  5CRH A;  1NM3 A;  4OWY A;  2OE1 A;  2NPB A;  4X43 A;  3U5R E;  2R6K A;  6GSY A;  2ES7 A;  4EIP A;  2WW0 A;  1MDK A;  3WT2 A;  5D9V A;  5ECI B;  2V41 A;  3KEB A;  4N11 A;  3US3 A;  5DAK B;  1TW9 A;  4MJE A;  2VCQ A;  2DML A;  2R4V A;  1GTU A;  3GX0 A;  2J9H A;  4XRD A;  2QGV A;  2CZ2 A;  4MF6 A;  3TRP A;  3DVW A;  1Z7P A;  3A5W A;  2LJR A;  4MA9 A;  1GLQ A;  2C4J A;  1C72 A;  5HR2 A;  3BJ5 A;  3GRX A;  3GA4 A;  1TTZ A;  1G6W A;  1XG8 A;  2MMN A;  3GUR A;  3HCZ A;  4O32 A;  4IGJ A;  2YP6 A;  1A0F A;  1O8W A;  2VCT A;  2OBK A;  5CRE A;  2JZT A;  3UL3 A;  1OC3 A;  3G7J A;  5IOX A;  4KF9 A;  1EGR A;  3D4T A;  3IC8 A;  1PRX A;  1WOU A;  2E2M A;  2GSS A;  2GT5 A;  1Y25 A;  3QR6 A;  1XVQ A;  3MYD A;  5HFI A;  1S3C A;  4K7I A;  3APO A;  1KBN A;  4MJB A;  4FYU A;  1ERT A;  2OJL A;  5ECS A;  4WXT A;  3QCP A;  1YEW C;  3GIX A;  1QGV A;  4GRF A;  4JED A;  2O5V A;  5HFG A;  5FWG A;  1XBS A;  2M80 A;  2C0G A;  2I1U A;  4MPF A;  5BMU A;  1ZYE A;  1VF2 A;  3EYT A;  5D96 A;  1X5E A;  4ZL7 A;  3F6D A;  3KH9 A;  4AKG A;  4NHZ A;  5B6M A;  5B8A A;  5J41 A;  4YH2 A;  3HYP A;  2WZS A;  4X1U A;  3HA9 A;  5IOW A;  2FWF A;  3HVV A;  4O92 A;  4POK A;  1R4W A;  3LFL A;  3CMI A;  2ZNM A;  3RAZ A;  2DIY A;  2CVK A;  2NTO A;  3GL5 A;  3WGE A;  1MD3 A;  3K8N A;  3IR4 A;  4KW6 A;  1K0A A;  4TR4 A;  5F05 A;  4XS6 A;  2C3N A;  1Y1U A;  2HSN A;  3PPU A;  2AYT A;  2V1M A;  1J0F A;  3NOF A;  1FVK A;  2P31 A;  1GTI A;  2ZCT A;  4ZB7 A;  3SWL A;  3H1N A;  1EEJ A;  1MDJ A;  3I43 A;  5G5E A;  2V6O A;  1I9D A;  4ECI A;  4PHZ C;  2HSH A;  2AJQ B;  1BJX A;  4MJC A;  3H79 A;  4HU9 A;  3ZL5 A;  3CSH A;  3V1W A;  4MLY A;  3KH7 A;  3EMP A;  4POM A;  4IJ3 A;  1BG5 A;  1VF1 A;  1F3A A;  3GKX A;  3GKN A;  3U6V A;  1WP0 A;  2LRN A;  4G0I A;  1QFN A;  1EOH A;  2J23 A;  2DJJ A;  1B4Q A;  4MMM A;  4HSC X;  1AQV A;  3DRN A;  1ACV A;  4AGS A;  3NZN A;  4YKF A;  4HZ2 A;  4GCI A;  1CQG A;  2A2P A;  3M1G A;  2WVY A;  1IYI A;  3LW9 A;  1JZO A;  4ZBD A;  2EFC A;  1PKW A;  4HZ4 A;  5A34 A;  1SKS B;  3FEU A;  1ZZY A;  2LUS A;  3E9J B;  3GL3 A;  2R37 A;  2DJK A;  1ERW A;  3P90 A;  1XOB A;  2WCI A;  1U6T A;  3R2Q A;  5J40 A;  4K8M A;  1B9Y C;  4MF5 A;  1GSE A;  5FHI A;  4PX1 A;  4IKH A;  1U3I A;  1S3A A;  1ZYN A;  5A1N A;  2X8H A;  2CZ3 A;  3BCK A;  4HJM A;  1A24 A;  1QMV A;  1YEX A;  2N5A A;  5D9W A;  4XCS A;  3P8W A;  4KB3 A;  1AUC A;  4K7O A;  5F07 A;  5EY6 A;  3TRQ A;  5E4W A;  2GZP A;  4KDU A;  5GAN D;  3M3M A;  2WFC A;  4OFT A;  1SD9 A;  2FGX A;  3EU4 A;  3GKM A;  1H4O A;  2H01 A;  4GWR A;  1V40 A;  1RK4 A;  4WBJ A;  3F3Q A;  4JE1 A;  4OO5 A;  2FWE A;  6GSU A;  2HT9 A;  1EZK A;  6GSV A;  1YZX A;  3VUR A;  2LEG A;  1FB0 A;  4G10 A;  3EU3 A;  2AUV A;  2LRC A;  1FOV A;  1OC8 A;  3LEF A;  2EFH A;  2YV9 A;  3D0Z A;  2L4Q A;  4TR0 A;  3GKK A;  1V57 A;  2M46 A;  4TVE A;  5A5H A;  5HFK A;  2PGT A;  3FK8 A;  1WJK A;  2HSM A;  4NAX A;  3C71 A;  4EC0 A;  3TCO A;  2NBS A;  4AKI A;  3CWG A;  2DSA A;  1XCC A;  1MD4 A;  1UA5 A;  3FYG A;  4PUA A;  3CXG A;  3ZIT A;  3ME8 A;  2YJH A;  1TU8 A;  1RQM A;  2FLS A;  2KP1 A;  4O5Q A;  2LJK A;  4ZIJ A;  1TOF A;  3RGB C;  4PNF A;  1ERV A;  1E2Y A;  4TXO A;  1SKW B;  1USB A;  3PIN A;  1M99 A;  2VCV A;  4TW5 A;  1JFU A;  1FHE A;  3ZLP A;  3QAV A;  3KD0 A;  2YWI A;  2HRK B;  4WBR D;  3LSZ A;  1HNC A;  2AB6 A;  3QD9 A;  1K3L A;  3IOS A;  4OO4 A;  2R0G A;  2C3T A;  2RLI A;  2DKI A;  3DXB A;  2H75 A;  3HVS A;  4IQ1 A;  5J47 A;  2OBI A;  3CQF A;  2ZUP A;  3I69 A;  4ZBB A;  4ZB8 A;  2K9F A;  4POB A;  1FO5 A;  3IRA A;  1HD2 A;  4BA7 A;  2JU5 A;  5FT3 A;  2HE3 A;  3RPP A;  4HU7 A;  4YQM A;  4G19 A;  3UVH A;  4HDE A;  3F0I A;  2DBC A;  4LLR A;  4XHM A;  1V98 A;  2DLX A;  1GSY A;  3DGQ A;  4NWY A;  1TRS A;  3IAM 2;  3FKF A;  1I1I P;  5J9C A;  5A5K A;  4QQ7 A;  3IE3 A;  5J4Y A;  2DJ1 A;  2B1L A;  1GLP A;  1W89 A;  2C3Q A;  1OC9 A;  4PNG A;  3RHB A;  2X64 A;  2JAD A;  3HVN A;  4NHW A;  1SKR B;  2CA8 A;  4I6X A;  1VF4 A;  5ID2 A;  3F8U A;  1LBK A;  4OMV A;  2DJ3 A;  3F4S A;  3UOM A;  3F63 A;  4IP6 A;  5A4W A;  1A8Y A;  3LJR A;  2PER A;  20GS A;  2WW3 A;  5B6N A;  1SVL A;  2HZE B;  2H6Y A;  2GQK A;  4KND A;  3W8J A;  4A5P A;  1EEM A;  6GSW A;  1X9S B;  5D73 A;  2VL2 A;  2IN3 A;  2JSZ A;  1SL2 B;  4OFM A;  4L5O A;  4O5R A;  2H0H A;  3L9U A;  5L71 A;  4BL7 B;  4XS1 A;  3L78 A;  1F6M C;  1EP8 A;  4KUN A;  4EUY A;  4AKH A;  3QDN A;  4CHS A;  2FWG A;  2OAC A;  4ACS A;  5D9T A;  2B5E A;  1OKT A;  4K2X A;  4WF4 A;  3GHA A;  1UN2 A;  3IXR A;  4EVM A;  2V2G A;  2RM5 A;  1JHB A;  2DC5 A;  4YAP A;  3Q19 A;  3UEM A;  4QL9 A;  3RHC A;  3TJG A;  5CRW A;  5CRD A;  1Q98 A;  1PD2 1;  2QA2 A;  5DAL A;  2H70 A;  1AW9 A;  2JSY A;  3LG6 A;  4KE3 A;  2EIQ A;  2GT6 A;  4L0U A;  4JU5 A;  2PUK C;  1GUH A;  5GAP D;  4HUA A;  4K5R A;  1GRX A;  3C73 A;  3KXO A;  3AY8 A;  5ENU A;  2GDR A;  1RW1 A;  4MH3 A;  3C8E A;  1TRV A;  4NMU A;  1QUW A;  3W6G A;  4ULX A;  5LD0 A;  2H71 A;  2DMM A;  4TRX A;  4MAB A;  1SJ6 A;  2WVZ A;  4DSS A;  2CX4 A;  2WB9 A;  1PMT A;  4WR5 A;  4WF5 A;  1PFO A;  5F06 A;  4KCE A;  1A0R P;  3A2X A;  3KMN A;  1Z5Y E;  1TI3 A;  2FCH A;  1YJ6 A;  2BTO T;  1G7E A;  5G1K A;  5DJL A;  4F9Z A;  1V2A A;  2LJA A;  4ZL8 A;  4RQX A;  4FYC A;  3FW2 A;  5AIX A;  4NPB A;  4DVC A;  3G7Y A;  4JZQ A;  3BOA A;  1OAZ A;  3TRX A;  4KAE A;  5EVO A;  4AJ8 A;  4TR1 B;  3UVT A;  5DCH A;  4BVY B;  2YWN A;  2A4V A;  3HKR A;  2F8A A;  2VCW A;  3EUR A;  2YPM A;  3TKP A;  5CO3 A;  4J57 E;  1A2J A;  1M2B A;  2QC7 A;  3UAR A;  1N2A A;  1M7T A;  2KOK A;  1F9M A;  1V9W A;  5DCG A;  1BG1 A;  1GTB A;  3WYW A;  1YDK A;  3HHV A;  5ECP B;  4XTS A;  2MZC A;  4N10 A;  3VWU A;  3CHX C;  4HOJ A;  2HNL A;  3IDV A;  1SYX A;  2FUG 2;  2RUE A;  4XS4 A;  5ELG A;  4ID0 A;  4ZL9 A;  3G9B A;  6GSS A;  1XWG A;  2VM1 A;  2IMK A;  2E7P A;  3I9V 2;  3DD3 A;  5COH A;  1A2L A;  1MTC A;  3TDG A;  4K0N A;  2WVX B;  4KX4 A;  1YY7 A;  3GSS A;  2VD0 A;  3DYR A;  1T3B A;  2P0G A;  2Z9S A;  4TOP A;  1JZR A;  2H8L A;  1GSS A;  2LNT A;  3VWW A;  1O6J A;  1VRS D;  4EE0 A;  1WIK A;  4ECJ A;  1KTE A;  4FO5 A; 
#chains in the Genus database with same CATH homology
 19GS A;  3TKS C;  1G7O A;  1XFL A;  2H0G A;  2P5R A;  4GF0 A;  1SU9 A;  5DQS A;  1FVJ A;  4MF7 A;  2YCD A;  4Z7X A;  5D8I A;  1SK1 A;  3OR5 A;  1UC7 A;  1B48 A;  4Q5F A;  1PA3 A;  1XW5 A;  5KN0 A;  1GP1 A;  1M9A A;  4ML6 A;  2PMT A;  1V58 A;  1XW9 A;  3C1R A;  2CVB A;  3Q74 A;  4CY6 A;  3PR8 A;  3A2V A;  4MCU A;  1R5A A;  5CAX A;  3ERG A;  3S9F A;  4N0V A;  1Z7R A;  3EE2 A;  2VAF A;  4YAV A;  3KCM A;  1GWC A;  1PN0 A;  4H86 A;  2HI7 A;  5DVB A;  3M9J A;  4PTS A;  4Z2U A;  3ED3 A;  3O6T A;  1JLW A;  2B5X A;  1A2M A;  4GLT A;  1F3B A;  5G31 A;  4ECB A;  5IPH A;  3M9K A;  3TOU A;  1ZGN A;  1ZYQ B;  1WE0 A;  5J4V A;  1YKA A;  3DIE A;  3E3E A;  4NV5 A;  4NV2 A;  2H1L A;  3VI7 A;  4ZB6 A;  2LTK A;  3KM6 A;  4MK3 A;  4OD7 A;  4KSM A;  4BL7 A;  4DSQ A;  3FHK A;  1PL2 A;  1XXU A;  1M0U A;  5INY A;  3TGZ A;  2GS3 A;  2DIZ A;  3N5O A;  2TIR A;  2E0Q A;  4GSN A;  10GS A;  3GYK A;  2LNS A;  4ICY A;  4MH2 A;  1ILO A;  5CRG A;  1AAZ A;  2IFQ A;  4EDY A;  1WMJ A;  4IS0 A;  1VGL A;  4ZXG A;  1TRU A;  2R3X A;  5IQY A;  4BVX B;  4F0C A;  3TKS E;  1U88 A;  1GNE A;  5IMD A;  4E8E A;  4MZB A;  1NHO A;  3FR3 A;  1M2D A;  4GXZ A;  3VPT A;  1LU4 A;  2O87 A;  1JLV A;  2I4A A;  2AHE A;  2XBQ A;  3ZVJ D;  1B4P A;  1PX6 A;  2PVQ A;  3IHG A;  1ZCP A;  1QXH A;  1AXD A;  2YJ7 A;  3FZA A;  4AF2 A;  3D5J A;  1ON4 A;  1A8L A;  1EGO A;  1EOG A;  2M72 A;  1DE1 A;  4KDY A;  2XPD A;  5JCG A;  22GS A;  3M8N A;  1XWA A;  1URM A;  4JRR A;  1OVN A;  4D73 A;  3IHQ A;  2KHP A;  2DKH A;  3D4M A;  4L8E A;  3GTU B;  1EP7 A;  3E0U A;  1FW1 A;  2KLX A;  2C1Y A;  4X4J A;  5E59 A;  5D9X A;  2OAD A;  3L9S A;  4TN8 A;  2X8C A;  2F3M A;  2TRC P;  2VD1 A;  5GST A;  2C8U A;  2G2Q A;  3TJB A;  1XWK A;  5DAK A;  2R0C A;  2PVO C;  4BVY A;  2DJ0 A;  1QK8 A;  3LXT A;  4Q5Q A;  2N5B A;  2EFD A;  2JZS A;  3P2A A;  3TKQ A;  5KOW A;  4O5U A;  2O85 A;  4ML1 A;  2FA4 A;  1KEB A;  1XWC A;  1K0M A;  3ERF A;  5ECQ B;  2X8G A;  2FA8 A;  2OE3 A;  5ECH B;  4PUR A;  4EO3 A;  4GQF A;  1SL0 B;  5H5R A;  1GSD A;  3BD2 A;  1AQW A;  2YZH A;  4XRA A;  3KTL A;  3RBT A;  4V1A g;  4Q5N A;  9GSS A;  2H74 A;  4HI7 A;  3TKR A;  2XC2 A;  5CNW A;  3HJP A;  1YVL A;  2H76 A;  2WRT A;  2H1G A;  5DDL A;  3GH6 A;  1THX A;  2N5F A;  4KSO A;  3H93 A;  3I6A A;  2HRA A;  4TR3 A;  2H1A A;  3ZRD A;  4EL1 A;  2FD3 A;  2B3S A;  4PQ1 A;  1OYJ A;  4BWQ A;  2PU9 C;  2RM6 A;  5JWR B;  4J2F A;  4WR4 A;  3DVX A;  2B5Y A;  5BMU B;  2CX3 A;  3DEX A;  5B8B A;  1U87 A;  2MYG A;  4KGI A;  2YZU A;  2MMZ A;  5G2Z A;  3TJK A;  3VPQ A;  2EIO A;  4PQI A;  1Z3E A;  1WPI A;  5G30 A;  4ECC A;  2K8S A;  2P5Q A;  1VF3 A;  3Q18 A;  3PH9 A;  3LGC A;  3WD6 A;  1XWB A;  1M2A A;  1X5D A;  2L5O A;  2CAQ A;  1UVZ A;  4IQA A;  2IME A;  2GTU A;  4F2I A;  5A4U A;  3CRU A;  4ZIL A;  2HSN B;  4LL4 B;  1N25 A;  2LQQ A;  2VLU A;  1B9X C;  1FB6 A;  2RUF A;  1K0B A;  4JR6 A;  2C80 A;  1SK2 A;  1IYH A;  2R5G A;  3CRT A;  2PBJ A;  2VLT A;  2GVP A;  1GH2 A;  4K2D A;  3EPT A;  1QQ2 A;  2C0E A;  1HQO A;  2VL2 C;  1BED A;  3F4T A;  3HZ8 A;  2JAC A;  5IMF A;  3F3R A;  4CDO A;  1T4Y A;  13GS A;  2YWO A;  4XIH A;  3FZ4 A;  2WS2 A;  4MZW A;  17GS A;  4GST A;  3L4N A;  2H1B A;  4EDZ A;  2VIM A;  3ZIV A;  1J08 A;  1ZYP A;  4IP1 A;  1BAY A;  4RQR A;  5LNK e;  3UBL A;  5A34 B;  2IMI A;  2IPA A;  5KN3 A;  3JCM L;  5IMZ A;  3TJJ A;  5DQY A;  5HR3 A;  2LKU A;  4PGT A;  3ISO A;  2H72 A;  2HYX A;  3GMF A;  5C00 A;  3UBK A;  4K0G A;  4QL7 A;  4I8B A;  4RUV A;  1T00 A;  2EC4 A;  3FR9 A;  2ALB A;  2CVD A;  2DJ2 A;  5A1N B;  1TJD A;  4YQU A;  4USS A;  2H30 A;  2K18 A;  3QFA C;  2EIR A;  3FRC A;  4L0W A;  4RI6 A;  4KA0 A;  4GSS A;  3WT1 A;  3IC4 A;  3HJM A;  4GTU A;  3IK7 A;  6GSX A;  2VM2 A;  5AIS A;  2FWH A;  1TI1 A;  3A5I A;  2L59 A;  2F9S A;  3HDC A;  1SEN A;  1K0O A;  1SD8 A;  3VWV A;  2HFD A;  2YNX A;  3C7M A;  3P7X A;  5IIZ A;  2AV4 A;  2E2G A;  3CSI A;  5IO2 A;  1I5G A;  2WUL A;  2I81 A;  2WZ9 A;  5G5F A;  3ZFL A;  5KN1 A;  4IBP A;  4YKG A;  4PQH A;  2GQL A;  3HXS A;  1K0N A;  2XPE A;  4EKZ A;  1EV9 A;  4LA1 A;  2D2Z A;  3UIW A;  4O7H A;  3UAP A;  1FOH A;  5A5H B;  3APS A;  3ERW A;  3DML A;  4LMV A;  4MDC A;  4F03 A;  3FZ5 A;  1DSB A;  2HSM B;  4IW9 A;  5JCW A;  3PGT A;  3IPZ A;  2LRT A;  5JWQ B;  5IO0 A;  3EWL A;  1Q4J A;  3HVX A;  1ST9 A;  1X9M B;  1FAA A;  1SK0 A;  2HXK A;  2KUC A;  2GZZ A;  1HNA A;  3APQ A;  4TXV A;  3CSJ A;  1JZW A;  1O7U A;  4GDF A;  2FY6 A;  3IBH A;  5EL8 A;  1SJI A;  2A2R A;  2ON7 A;  4IVF A;  2IWT A;  4JR4 A;  4TXO B;  2VO4 A;  2H0I A;  3KZQ A;  1Y6E A;  4RI7 A;  2UV8 G;  4PXO A;  2R0P A;  4MNN A;  5ECO B;  1BF5 A;  2HRK A;  4L5L A;  4EIQ A;  3HJO A;  5AIV A;  3NIV A;  2F51 A;  1Z9H A;  4G0L A;  1PN9 A;  3J7Y b;  5ECM B;  2YWM A;  2AAW A;  3D21 A;  1TXX A;  1PL1 A;  4CY8 A;  5A4V A;  5GZZ B;  4EF0 A;  5KEJ A;  2CT6 A;  2H1D A;  1OE8 A;  4N0Z A;  2XBI A;  4WKW A;  1PKZ A;  5IPG A;  4Z2T A;  3WGX A;  3F6F A;  3VWX A;  3J7Y k;  4OFN A;  2GSR A;  1N8J A;  3QMX A;  4DEJ A;  3KTB A;  1TXU A;  1GUK A;  4FIW A;  1SJZ A;  3TKS A;  3D6I A;  5ABR A;  2LQO A;  2QSI A;  3GH9 A;  2MBS A;  3ZIJ A;  5HQP A;  1TK5 B;  3ZZX A;  2KP2 A;  3EIN A;  3EC3 A;  5GSS A;  3ZFB A;  2O89 A;  1DE2 A;  1ERU A;  2JZR A;  1SYR A;  2YV7 A;  4CW9 A;  4WET A;  8GSS A;  1BX9 A;  3MAK A;  2GZY A;  2HQT A;  2TRX A;  3QAW A;  2HSY A;  4G01 A;  4HJ2 A;  1OC9 B;  3GNJ A;  4ZBA A;  1NW2 A;  3TJF A;  1B8X A;  5ID2 B;  1X9W B;  2IMF A;  3IV4 A;  2H73 A;  4E68 A;  1F2E A;  5J9B A;  5JCU A;  2HZE A;  3R3E A;  2WGR A;  4V2L A;  2CV4 A;  3IA1 A;  2QA1 A;  2C0D A;  3F4R A;  1MEK A;  5D93 A;  3DKS A;  3FZ9 A;  3TUE A;  2C0F A;  1XZO A;  2H19 A;  2OT3 A;  3N9J A;  2K6V A;  4BPY A;  4K7N A;  2R2J A;  2REM A;  1MDI A;  2B7J A;  4FH8 A;  3MSZ A;  1BYE A;  4ILF A;  1LJR A;  2B6M A;  1GUL A;  3QAG A;  3VFI A;  5KOX A;  4DSR A;  3KIJ A;  2GST A;  1R26 A;  5B7C A;  1EV4 A;  1PSQ A;  5AGY A;  3ZML A;  1T1V A;  2QKE A;  2YOI A;  5G1L A;  4POL A;  1A23 A;  2GQM A;  2JL4 A;  7GSS A;  1GL8 A;  1OE7 A;  1YF0 A;  4HQS A;  1ZOF A;  4V2M A;  1TU7 A;  5DAL B;  5F0G A;  3KP8 A;  2VOC A;  4N3Z A;  3LYK A;  3M0F A;  1AIU A;  2O8V B;  5ECR B;  2OA7 A;  5ELA A;  3GX8 A;  5H5Q A;  1W4V A;  2CAI A;  3CTF A;  2BJX A;  2V6K A;  5ECK B;  5J4U A;  3MDK A;  2GSQ A;  3HD5 A;  3KJY A;  2FHE A;  2LST A;  2XHF A;  2MMA A;  4DSS B;  1NSW A;  1TK0 B;  2X49 A;  3WGD A;  4F0B A;  1K3O A;  3GN3 A;  1ZMA A;  5JWO B;  2X99 A;  1JZD A;  4IN0 A;  3A2W A;  3GUS A;  3VLN A;  2I9H A;  3LXZ A;  3LYP A;  1Z6N A;  1SVM A;  1SVO A;  1HNB A;  4JBB A;  4TR1 A;  4V2N A;  2IMD A;  4IEL A;  2NDO A;  3UMA A;  2OKA A;  2VKZ G;  4AJ6 A;  4OCE A;  2HRN A;  5J5N A;  4HS1 A;  2V32 A;  1E6B A;  1T7P B;  3TB2 A;  1T4Z A;  5CYY A;  1GSU A;  1AQX A;  4BWS A;  4G9H A;  1H75 A;  4LL1 B;  2G0F A;  4NXI A;  3EMX A;  2LS5 A;  2YN1 A;  1THO A;  2VCX A;  3HY2 A;  2LV3 A;  2H6Z A;  2I3Y A;  4MZC A;  4GQC A;  2L5L A;  1XW6 A;  4FYB A;  16GS A;  3A3T A;  5J3R A;  2CQ9 A;  2H6X A;  1PX7 A;  4V1A p;  5DJM A;  2B7K A;  4W66 A;  1O85 A;  3SBC A;  2IL3 A;  4I2T A;  1F37 A;  1TRW A;  4G2E A;  5KN2 A;  4PUF C;  3MWH A;  4N30 A;  3RPN A;  3TOT A;  1Z6M A;  3CBU A;  3VK9 A;  1GNW A;  4AKX B;  1ABA A;  1TKD B;  4Z2R A;  1XIY A;  4XS4 B;  4G0K A;  3EVI A;  3GST A;  1GUM A;  1O8X A;  5HR1 A;  2ON5 A;  2EFE A;  2VCZ A;  1WWJ A;  2VL3 A;  1K3Y A;  1GTA A;  4J56 E;  5BRT A;  1OKD A;  4Q5R A;  3QOU A;  3L9V A;  4I97 A;  2HRF A;  3TU3 B;  3KP9 A;  3F9U A;  3QPM A;  2L6D A;  1O73 A;  3FMW A;  2MBT A;  3UJ1 A;  5CP1 A;  1K0C A;  1SL1 B;  4ISD A;  3LQ7 A;  1TDI A;  5HR0 A;  4OCF A;  1TK8 B;  2F8F A;  5LCZ A;  3HMJ G;  2A2S A;  4QMK A;  3LWA A;  3H8Q A;  1WRY A;  1YQ1 A;  1X5C A;  2K8V A;  4FQU A;  2VUP A;  3GFK A;  2L6C A;  12GS A;  3LOR A;  1AC1 A;  3FY7 A;  3D22 A;  3GV1 A;  2WJU A;  5IMC A;  2VL9 A;  2NVL A;  6GST A;  3ME7 A;  4EXJ A;  1X0R A;  3QFB C;  1XOA A;  1R5P A;  2A4H A;  5DBQ A;  1TP9 A;  2PWJ A;  3VI5 A;  4MPG A;  3KMO A;  2L4C A;  3Q6O A;  1U3A A;  1GSF A;  3CTG A;  3FR6 A;  2PN8 A;  18GS A;  5F8B A;  1HYU A;  4X0X A;  1CQH A;  4I2U A;  3BCI A;  4KDX A;  4P3Y B;  4K5S A;  1BQ7 A;  2HLS A;  1T8E B;  3ZTL A;  5IMV A;  2X4A A;  3ZMK A;  1FG4 A;  3DWV A;  5C04 A;  3C1S A;  4KCA A;  3KGK A;  2WDU A;  1YEP A;  1R7H A;  3ZYW A;  5AN1 A;  4K9Z A;  1G0T A;  2RII A;  1PQN A;  4K6X A;  5EPF A;  2L57 A;  4ZB9 A;  2GGT A;  4TKY A;  3L0H A;  4AJ7 A;  3RDW A;  5H5S A;  5IM9 A;  2MMO A;  1YF1 A;  2GLR A;  2UZ8 A;  2IFQ B;  3W8S A;  2BMX A;  2YAN A;  2O7K A;  1XPV A;  4BVX A;  2OE0 A;  4MJA A;  5IMA A;  4E8H A;  5ECL B;  1J9B A;  3O76 A;  4HEA 2;  3BBY A;  1NHY A;  3CYN A;  4MP4 A;  1S3D A;  3MNG A;  4WEY A;  3G7I A;  2VLV A;  1KNG A;  1DBY A;  2H66 A;  3IAS 2;  1DUG A;  1GSQ A;  4HQZ A;  1ML6 A;  3O3T A;  3ZRE A;  4K1F A;  3MIX A;  14GS A;  2FNO A;  4KH7 A;  1G6Y A;  3H4K A;  1YKC A;  4I5Q A;  4IHU A;  11GS A;  4LMW A;  2PPT A;  4IJI A;  3HZ4 A;  4F82 A;  1O81 A;  4YQV A;  3ZVJ A;  1K0D A;  2IIY A;  2B1K A;  1EWX A;  1M9B A;  2HZF A;  3IK9 A;  4AI6 A;  1XVW A;  2IJY A;  5ECN B;  1PGT A;  4D73 B;  1ZL9 A;  3GTU A;  5CRH A;  1NM3 A;  4OWY A;  2OE1 A;  2NPB A;  4X43 A;  3U5R E;  2R6K A;  6GSY A;  2ES7 A;  4EIP A;  1MDK A;  3WT2 A;  5D9V A;  5ECI B;  2V41 A;  3KEB A;  4N11 A;  3US3 A;  5DAK B;  1TW9 A;  4MJE A;  2VCQ A;  2DML A;  2R4V A;  1GTU A;  3GX0 A;  2J9H A;  4XRD A;  2QGV A;  2CZ2 A;  4MF6 A;  3TRP A;  3DVW A;  1Z7P A;  3A5W A;  2LJR A;  4MA9 A;  1GLQ A;  2C4J A;  1C72 A;  5HR2 A;  3BJ5 A;  3GRX A;  3GA4 A;  1TTZ A;  1G6W A;  2MMN A;  3GUR A;  3HCZ A;  4O32 A;  4IGJ A;  2YP6 A;  1A0F A;  1O8W A;  2VCT A;  2OBK A;  5CRE A;  2JZT A;  3UL3 A;  1OC3 A;  3G7J A;  5IOX A;  4KF9 A;  1EGR A;  3D4T A;  3IC8 A;  1PRX A;  1WOU A;  2E2M A;  2GSS A;  2GT5 A;  1Y25 A;  3QR6 A;  1XVQ A;  3MYD A;  5HFI A;  1S3C A;  4K7I A;  3APO A;  1KBN A;  4MJB A;  4FYU A;  1ERT A;  2OJL A;  5ECS A;  4WXT A;  3QCP A;  3GIX A;  1QGV A;  4GRF A;  4JED A;  2O5V A;  5HFG A;  5FWG A;  1XBS A;  2M80 A;  2C0G A;  2I1U A;  4MPF A;  5BMU A;  1ZYE A;  1VF2 A;  3EYT A;  5D96 A;  1X5E A;  4ZL7 A;  3F6D A;  3KH9 A;  4AKG A;  4NHZ A;  5B6M A;  5B8A A;  5J41 A;  4YH2 A;  3HYP A;  4X1U A;  3HA9 A;  5IOW A;  2FWF A;  3HVV A;  4O92 A;  4POK A;  1R4W A;  3LFL A;  3CMI A;  2ZNM A;  3RAZ A;  2DIY A;  2CVK A;  2NTO A;  3GL5 A;  3WGE A;  1MD3 A;  3K8N A;  3IR4 A;  4KW6 A;  1K0A A;  4TR4 A;  5F05 A;  4XS6 A;  2C3N A;  1Y1U A;  2HSN A;  3PPU A;  2AYT A;  2V1M A;  1J0F A;  3NOF A;  1FVK A;  2P31 A;  1GTI A;  2ZCT A;  4ZB7 A;  3SWL A;  3H1N A;  1EEJ A;  1MDJ A;  3I43 A;  5G5E A;  2V6O A;  1I9D A;  4ECI A;  2HSH A;  2AJQ B;  1BJX A;  4MJC A;  3H79 A;  4HU9 A;  3ZL5 A;  3CSH A;  3V1W A;  4MLY A;  3KH7 A;  3EMP A;  4POM A;  4IJ3 A;  1BG5 A;  1VF1 A;  1F3A A;  3GKX A;  3GKN A;  3U6V A;  1WP0 A;  2LRN A;  4G0I A;  1QFN A;  1EOH A;  2J23 A;  2DJJ A;  1B4Q A;  4MMM A;  1AQV A;  3DRN A;  1ACV A;  4AGS A;  3NZN A;  4YKF A;  4HZ2 A;  4GCI A;  1CQG A;  2A2P A;  3M1G A;  1IYI A;  3LW9 A;  1JZO A;  4ZBD A;  2EFC A;  1PKW A;  4HZ4 A;  5A34 A;  1SKS B;  3FEU A;  1ZZY A;  2LUS A;  3E9J B;  3GL3 A;  2R37 A;  2DJK A;  1ERW A;  3P90 A;  1XOB A;  2WCI A;  1U6T A;  3R2Q A;  5J40 A;  4K8M A;  1B9Y C;  4MF5 A;  1GSE A;  5FHI A;  4PX1 A;  4IKH A;  1U3I A;  1S3A A;  1ZYN A;  5A1N A;  2X8H A;  2CZ3 A;  3BCK A;  4HJM A;  1A24 A;  1QMV A;  1YEX A;  2N5A A;  5D9W A;  4XCS A;  3P8W A;  4KB3 A;  1AUC A;  4K7O A;  5F07 A;  5EY6 A;  3TRQ A;  5E4W A;  2GZP A;  4KDU A;  5GAN D;  3M3M A;  2WFC A;  4OFT A;  1SD9 A;  2FGX A;  3EU4 A;  3GKM A;  1H4O A;  2H01 A;  4GWR A;  1V40 A;  1RK4 A;  4WBJ A;  3F3Q A;  4JE1 A;  4OO5 A;  2FWE A;  6GSU A;  2HT9 A;  1EZK A;  6GSV A;  1YZX A;  3VUR A;  2LEG A;  1FB0 A;  4G10 A;  3EU3 A;  2AUV A;  2LRC A;  1FOV A;  1OC8 A;  3LEF A;  2EFH A;  2YV9 A;  3D0Z A;  2L4Q A;  4TR0 A;  3GKK A;  1V57 A;  2M46 A;  4TVE A;  5A5H A;  5HFK A;  2PGT A;  3FK8 A;  1WJK A;  2HSM A;  4NAX A;  3C71 A;  4EC0 A;  3TCO A;  2NBS A;  4AKI A;  3CWG A;  2DSA A;  1XCC A;  1MD4 A;  1UA5 A;  3FYG A;  4PUA A;  3CXG A;  3ZIT A;  3ME8 A;  2YJH A;  1TU8 A;  1RQM A;  2FLS A;  2KP1 A;  4O5Q A;  2LJK A;  4ZIJ A;  1TOF A;  4PNF A;  1ERV A;  1E2Y A;  4TXO A;  1SKW B;  1USB A;  3PIN A;  1M99 A;  2VCV A;  4TW5 A;  1JFU A;  1FHE A;  3ZLP A;  3QAV A;  3KD0 A;  2YWI A;  2HRK B;  4WBR D;  3LSZ A;  1HNC A;  2AB6 A;  3QD9 A;  1K3L A;  3IOS A;  4OO4 A;  2R0G A;  2C3T A;  2RLI A;  2DKI A;  3DXB A;  2H75 A;  3HVS A;  4IQ1 A;  5J47 A;  2OBI A;  2ZUP A;  3I69 A;  4ZBB A;  4ZB8 A;  2K9F A;  4POB A;  1FO5 A;  3IRA A;  1HD2 A;  4BA7 A;  2JU5 A;  5FT3 A;  2HE3 A;  3RPP A;  4HU7 A;  4YQM A;  4G19 A;  3UVH A;  4HDE A;  3F0I A;  2DBC A;  4LLR A;  4XHM A;  1V98 A;  2DLX A;  1GSY A;  3DGQ A;  4NWY A;  1TRS A;  3IAM 2;  3FKF A;  5J9C A;  5A5K A;  4QQ7 A;  3IE3 A;  5J4Y A;  2DJ1 A;  2B1L A;  1GLP A;  1W89 A;  2C3Q A;  1OC9 A;  4PNG A;  3RHB A;  2X64 A;  2JAD A;  4NHW A;  1SKR B;  2CA8 A;  4I6X A;  1VF4 A;  5ID2 A;  3F8U A;  1LBK A;  4OMV A;  2DJ3 A;  3F4S A;  3UOM A;  3F63 A;  4IP6 A;  5A4W A;  1A8Y A;  3LJR A;  2PER A;  20GS A;  5B6N A;  1SVL A;  2HZE B;  2H6Y A;  2GQK A;  4KND A;  3W8J A;  4A5P A;  1EEM A;  6GSW A;  1X9S B;  5D73 A;  2VL2 A;  2IN3 A;  2JSZ A;  1SL2 B;  4OFM A;  4L5O A;  4O5R A;  2H0H A;  3L9U A;  5L71 A;  4BL7 B;  4XS1 A;  3L78 A;  1F6M C;  1EP8 A;  4KUN A;  4EUY A;  4AKH A;  3QDN A;  4CHS A;  2FWG A;  2OAC A;  4ACS A;  5D9T A;  2B5E A;  1OKT A;  4K2X A;  4WF4 A;  3GHA A;  1UN2 A;  3IXR A;  4EVM A;  2V2G A;  2RM5 A;  1JHB A;  2DC5 A;  4YAP A;  3Q19 A;  3UEM A;  4QL9 A;  3RHC A;  3TJG A;  5CRW A;  5CRD A;  1Q98 A;  1PD2 1;  2QA2 A;  5DAL A;  2H70 A;  1AW9 A;  2JSY A;  3LG6 A;  4KE3 A;  2EIQ A;  2GT6 A;  4L0U A;  4JU5 A;  2PUK C;  1GUH A;  5GAP D;  4HUA A;  4K5R A;  1GRX A;  3C73 A;  3KXO A;  3AY8 A;  5ENU A;  2GDR A;  1RW1 A;  4MH3 A;  3C8E A;  1TRV A;  4NMU A;  1QUW A;  3W6G A;  4ULX A;  5LD0 A;  2H71 A;  2DMM A;  4TRX A;  4MAB A;  1SJ6 A;  4DSS A;  2CX4 A;  2WB9 A;  1PMT A;  4WR5 A;  4WF5 A;  5F06 A;  4KCE A;  1A0R P;  3A2X A;  3KMN A;  1Z5Y E;  1TI3 A;  2FCH A;  1YJ6 A;  2BTO T;  1G7E A;  5G1K A;  5DJL A;  4F9Z A;  1V2A A;  2LJA A;  4ZL8 A;  4RQX A;  4FYC A;  3FW2 A;  5AIX A;  4NPB A;  4DVC A;  3G7Y A;  4JZQ A;  3BOA A;  1OAZ A;  3TRX A;  4KAE A;  5EVO A;  4AJ8 A;  4TR1 B;  3UVT A;  5DCH A;  4BVY B;  2YWN A;  2A4V A;  3HKR A;  2F8A A;  2VCW A;  3EUR A;  2YPM A;  3TKP A;  5CO3 A;  4J57 E;  1A2J A;  1M2B A;  2QC7 A;  3UAR A;  1N2A A;  1M7T A;  2KOK A;  1F9M A;  1V9W A;  5DCG A;  1BG1 A;  1GTB A;  3WYW A;  1YDK A;  3HHV A;  5ECP B;  4XTS A;  2MZC A;  4N10 A;  3VWU A;  4HOJ A;  2HNL A;  3IDV A;  1SYX A;  2FUG 2;  2RUE A;  4XS4 A;  5ELG A;  4ID0 A;  4ZL9 A;  3G9B A;  6GSS A;  1XWG A;  2VM1 A;  2IMK A;  2E7P A;  3I9V 2;  3DD3 A;  5COH A;  1A2L A;  1MTC A;  3TDG A;  4K0N A;  4KX4 A;  1YY7 A;  3GSS A;  2VD0 A;  3DYR A;  1T3B A;  2P0G A;  2Z9S A;  4TOP A;  1JZR A;  2H8L A;  1GSS A;  2LNT A;  3VWW A;  1O6J A;  1VRS D;  4EE0 A;  1WIK A;  4ECJ A;  1KTE A;  4FO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...