3KXRA

Structure of the cystathionine beta-synthase pair domain of the putative mg2+ transporter so5017 from shewanella oneidensis mr-1.
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
171
structure length
171
Chain Sequence
DLLFAQLSPEDLIEWSDYLPESFTDRALAQMGERQRQRFELYDQYSENEIGRYTDHQMLVLSDKATVAQAQRFFRRIELDCNDNLFIVDEADKYLGTVRRYDIFKHEPHEPLISLLSEDSRALTANTTLLDAAEAIEHSREIELPVIDDAGELIGRVTLRAATALVREHYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transporter, putative
publication title Structure of the cystathionine beta-synthase pair domain of the putative Mg2+ transporter SO5017 from Shewanella oneidensis MR-1.
rcsb
source organism Shewanella oneidensis mr-1
molecule tags Transport protein
total genus 55
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.50.50 Mainly Alpha Up-down Bundle Pheromone ER-1 Pheromone ER-1 3kxrA01
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3kxrA02
2UV4A 1O50A 3T4NC 4L3VA 2ZY9A 2OOXE 4L0DA 2QREE 2YVYA 3SL7A 4O9KA 3ORGA 2UV6A 2EMQA 2EF7A 2YVXA 3KH5A 3DDJA 5KS7A 4GQWA 3KPBA 5K24C 4GQVA 2RIHA 5MMZA 2YVZA 4P1OA 4FXSA 2RC3A 4NOCA 5IIPA 3FV6A 3FWSA 3KPDA 3HF7A 3PC4A 1YAVA 4IY2A 2D4ZA 2QLVC 3FWRA 3TE5C 5K25C 3OCMA 4GQYA 4IYSA 2QRCE 2QRDE 3OCOA 4P1GA 4UUUA 2UV5A 3PC2A 5K23C 1PBJA 4L27A 4ESYA 3L31A 2RIFA 3LV9A 3FHMA 3LHHA 4COOA 3OI8A 3KXRA 3L2BA 5K22B 2OOYE 2O16A 4HG0A 2UV7A 3TDHC 4IY0A 2PFIA 4L28A 5LXQA 2QH1A 2YZIA 4IY4A 3K2VA 3LQNA 1XKFA 3FNAA 2OUXA 4DQWA 1PVMA 2QR1E 1Y5HA 3PC3A 2P9MA 4FRYA 4PCUA 3KPCA 2NYCA 3K6EA 3LFZA 2NYEA 4ESYB 3GBYA 3I8NA 2YZQA 4IY3A
chains in the Genus database with same CATH superfamily
2UV4A 1O50A 3T4NC 4EDRA 4L3VA 2ZY9A 2OOXE 4L0DA 2QREE 2YVYA 3SL7A 2J9LA 4O9KA 3ORGA 2UV6A 2EMQA 2EF7A 2YVXA 3KH5A 1DDEA 3DDJA 2AU3A 5KS7A 4GQWA 3KPBA 1EQNA 2NSWA 5K24C 2RIHA 4GQVA 5MMZA 2YVZA 4P1OA 4FXSA 2RC3A 2JA3A 4NOCA 5IIPA 3FV6A 3FWSA 3KPDA 3B39A 3HF7A 2ERLA 1YAVA 3PC4A 4IY2A 2D4ZA 2QLVC 3FWRA 3TE5C 5K25C 3OCMA 4GQYA 4IYSA 2JMSA 2QRCE 2QRDE 3OCOA 4P1GA 4UUUA 2UV5A 3PC2A 5K23C 1PBJA 4L27A 4ESYA 2KC6A 2KK2A 2RIFA 3L31A 2NSVA 3LV9A 2LMKA 3FHMA 1DD9A 3LHHA 4COOA 3OI8A 3KXRA 4EDTA 3L2BA 5K22B 2OOYE 2O16A 4HG0A 2UV7A 3CU7A 3TDHC 4E2KA 4IY0A 2PFIA 4L28A 5LXQA 2QH1A 4EDVA 3KLSA 2YZIA 4IY4A 4EDKA 3K2VA 3LQNA 4EDGA 4EE1A 1XKFA 3FNAA 2OUXA 4DQWA 1PVMA 2QR1E 1Y5HA 3PC3A 2P9MA 4FRYA 4PCUA 3KPCA 2NYCA 3K6EA 3LFZA 2NYEA 4ESYB 3GBYA 3I8NA 2YZQA 4IY3A 2B39A 1ERCA
chains in the Genus database with same CATH topology
2UV4A 1O50A 3T4NC 4EDRA 4L3VA 2ZY9A 2OOXE 4L0DA 2QREE 2YVYA 3SL7A 2J9LA 4O9KA 3ORGA 2UV6A 2EMQA 2EF7A 2YVXA 3KH5A 1DDEA 3DDJA 2AU3A 5KS7A 4GQWA 3KPBA 1EQNA 2NSWA 5K24C 2RIHA 4GQVA 5MMZA 2YVZA 4P1OA 4FXSA 2RC3A 2JA3A 4NOCA 5IIPA 3FV6A 3FWSA 3KPDA 3B39A 3HF7A 2ERLA 1YAVA 3PC4A 4IY2A 2D4ZA 2QLVC 3FWRA 3TE5C 5K25C 3OCMA 4GQYA 4IYSA 2JMSA 2QRCE 2QRDE 3OCOA 4P1GA 4UUUA 2UV5A 3PC2A 5K23C 1PBJA 4L27A 4ESYA 2KC6A 2KK2A 2RIFA 3L31A 2NSVA 3LV9A 2LMKA 3FHMA 1DD9A 3LHHA 4COOA 3OI8A 3KXRA 4EDTA 3L2BA 5K22B 2OOYE 2O16A 4HG0A 2UV7A 3CU7A 3TDHC 4E2KA 4IY0A 2PFIA 4L28A 5LXQA 2QH1A 4EDVA 3KLSA 2YZIA 4IY4A 4EDKA 3K2VA 3LQNA 4EDGA 4EE1A 1XKFA 3FNAA 2OUXA 4DQWA 1PVMA 2QR1E 1Y5HA 3PC3A 2P9MA 4FRYA 4PCUA 3KPCA 2NYCA 3K6EA 3LFZA 2NYEA 4ESYB 3GBYA 3I8NA 2YZQA 4IY3A 2B39A 1ERCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UV4 A;  1O50 A;  3T4N C;  4L3V A;  2ZY9 A;  2OOX E;  4L0D A;  2QRE E;  2YVY A;  3SL7 A;  4O9K A;  3ORG A;  2UV6 A;  2EMQ A;  2EF7 A;  2YVX A;  3KH5 A;  3DDJ A;  5KS7 A;  4GQW A;  3KPB A;  5K24 C;  4GQV A;  2RIH A;  5MMZ A;  2YVZ A;  4P1O A;  4FXS A;  2RC3 A;  4NOC A;  5IIP A;  3FV6 A;  3FWS A;  3KPD A;  3HF7 A;  3PC4 A;  1YAV A;  4IY2 A;  2D4Z A;  2QLV C;  3FWR A;  3TE5 C;  5K25 C;  3OCM A;  4GQY A;  4IYS A;  2QRC E;  2QRD E;  3OCO A;  4P1G A;  4UUU A;  2UV5 A;  3PC2 A;  5K23 C;  1PBJ A;  4L27 A;  4ESY A;  3L31 A;  2RIF A;  3LV9 A;  3FHM A;  3LHH A;  4COO A;  3OI8 A;  3KXR A;  3L2B A;  5K22 B;  2OOY E;  2O16 A;  4HG0 A;  2UV7 A;  3TDH C;  4IY0 A;  2PFI A;  4L28 A;  5LXQ A;  2QH1 A;  2YZI A;  4IY4 A;  3K2V A;  3LQN A;  1XKF A;  3FNA A;  2OUX A;  4DQW A;  1PVM A;  2QR1 E;  1Y5H A;  3PC3 A;  2P9M A;  4FRY A;  4PCU A;  3KPC A;  2NYC A;  3K6E A;  3LFZ A;  2NYE A;  4ESY B;  3GBY A;  3I8N A;  2YZQ A;  4IY3 A; 
#chains in the Genus database with same CATH topology
 2UV4 A;  1O50 A;  3T4N C;  4EDR A;  4L3V A;  2ZY9 A;  2OOX E;  4L0D A;  2QRE E;  2YVY A;  3SL7 A;  2J9L A;  4O9K A;  3ORG A;  2UV6 A;  2EMQ A;  2EF7 A;  2YVX A;  3KH5 A;  1DDE A;  3DDJ A;  2AU3 A;  5KS7 A;  4GQW A;  3KPB A;  1EQN A;  2NSW A;  5K24 C;  2RIH A;  4GQV A;  5MMZ A;  2YVZ A;  4P1O A;  4FXS A;  2RC3 A;  2JA3 A;  4NOC A;  5IIP A;  3FV6 A;  3FWS A;  3KPD A;  3B39 A;  3HF7 A;  2ERL A;  1YAV A;  3PC4 A;  4IY2 A;  2D4Z A;  2QLV C;  3FWR A;  3TE5 C;  5K25 C;  3OCM A;  4GQY A;  4IYS A;  2JMS A;  2QRC E;  2QRD E;  3OCO A;  4P1G A;  4UUU A;  2UV5 A;  3PC2 A;  5K23 C;  1PBJ A;  4L27 A;  4ESY A;  2KC6 A;  2KK2 A;  2RIF A;  3L31 A;  2NSV A;  3LV9 A;  2LMK A;  3FHM A;  1DD9 A;  3LHH A;  4COO A;  3OI8 A;  3KXR A;  4EDT A;  3L2B A;  5K22 B;  2OOY E;  2O16 A;  4HG0 A;  2UV7 A;  3CU7 A;  3TDH C;  4E2K A;  4IY0 A;  2PFI A;  4L28 A;  5LXQ A;  2QH1 A;  4EDV A;  3KLS A;  2YZI A;  4IY4 A;  4EDK A;  3K2V A;  3LQN A;  4EDG A;  4EE1 A;  1XKF A;  3FNA A;  2OUX A;  4DQW A;  1PVM A;  2QR1 E;  1Y5H A;  3PC3 A;  2P9M A;  4FRY A;  4PCU A;  3KPC A;  2NYC A;  3K6E A;  3LFZ A;  2NYE A;  4ESY B;  3GBY A;  3I8N A;  2YZQ A;  4IY3 A;  2B39 A;  1ERC A; 
#chains in the Genus database with same CATH homology
 2UV4 A;  1O50 A;  3T4N C;  4EDR A;  4L3V A;  2ZY9 A;  2OOX E;  4L0D A;  2QRE E;  2YVY A;  3SL7 A;  2J9L A;  4O9K A;  3ORG A;  2UV6 A;  2EMQ A;  2EF7 A;  2YVX A;  3KH5 A;  1DDE A;  3DDJ A;  2AU3 A;  5KS7 A;  4GQW A;  3KPB A;  1EQN A;  2NSW A;  5K24 C;  2RIH A;  4GQV A;  5MMZ A;  2YVZ A;  4P1O A;  4FXS A;  2RC3 A;  2JA3 A;  4NOC A;  5IIP A;  3FV6 A;  3FWS A;  3KPD A;  3B39 A;  3HF7 A;  2ERL A;  1YAV A;  3PC4 A;  4IY2 A;  2D4Z A;  2QLV C;  3FWR A;  3TE5 C;  5K25 C;  3OCM A;  4GQY A;  4IYS A;  2JMS A;  2QRC E;  2QRD E;  3OCO A;  4P1G A;  4UUU A;  2UV5 A;  3PC2 A;  5K23 C;  1PBJ A;  4L27 A;  4ESY A;  2KC6 A;  2KK2 A;  2RIF A;  3L31 A;  2NSV A;  3LV9 A;  2LMK A;  3FHM A;  1DD9 A;  3LHH A;  4COO A;  3OI8 A;  3KXR A;  4EDT A;  3L2B A;  5K22 B;  2OOY E;  2O16 A;  4HG0 A;  2UV7 A;  3CU7 A;  3TDH C;  4E2K A;  4IY0 A;  2PFI A;  4L28 A;  5LXQ A;  2QH1 A;  4EDV A;  3KLS A;  2YZI A;  4IY4 A;  4EDK A;  3K2V A;  3LQN A;  4EDG A;  4EE1 A;  1XKF A;  3FNA A;  2OUX A;  4DQW A;  1PVM A;  2QR1 E;  1Y5H A;  3PC3 A;  2P9M A;  4FRY A;  4PCU A;  3KPC A;  2NYC A;  3K6E A;  3LFZ A;  2NYE A;  4ESY B;  3GBY A;  3I8N A;  2YZQ A;  4IY3 A;  2B39 A;  1ERC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...