3KXTA

Crystal structure of sulfolobus cren7-dsdna complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kxtA00
3LWIA 2JTMA 3KXTA 3LWHA 4R55A 4R56A
chains in the Genus database with same CATH superfamily
4GBQA 2JS0A 2FZCB 4II1A 5KH6A 3FDRA 2LQKA 4JS4A 4RMOA 4PJOC 1JO8A 4OMOA 3L42A 1WI7A 3VS6A 1RADB 1PC0A 2X4XA 2E64A 5FU6B 1OZ3A 2AK5A 5CIUA 2Y4YA 3TEEA 2F5TX 1RUWA 1M30A 3CCST 3UT1A 3M0SA 4A4EA 1N8RR 2RK1A 2L89A 4LXCA 4FSXA 2F2XA 1Y7XA 2ZPEB 3V7RA 4LE9A 3CBMA 4ZTFA 4A4KA 4C92G 1D0ZA 4PLIA 2MCNA 3A8MB 4NOYA 3CMAT 2BIVA 3VUZA 1TOVA 2HCKA 3FB9A 3OYEA 4JJBA 2NUTA 2GFUA 2DTOA 5GAMd 3UATA 2YT6A 3VUBA 1VQ9Q 2HDAA 5DM7R 2MF2A 1X01A 2VKNA 3FJPA 1ZA1B 2HKQB 3OYBA 4C92B 3NMZC 1Q82C 4C5GA 4BE1A 1YIJA 3BDLA 3H0HA 4LN2A 1YWOA 1MGQA 2X4YA 5A0GA 2GQIA 1T3LA 1P92A 3SD4A 2MPXC 1JQQA 1VQPA 1WXUA 4AMCA 2ROLA 4PFZA 2QQBA 5J3BA 1M5Q1 3VYHB 2K6DA 3PVQA 2VYTA 4Z8AA 1B3QA 3QXEB 5CKDA 5KYWA 1GFCA 2WSCE 1RAFB 2VB6A 2CP6A 3G1JA 2E70A 2COZA 1K9MU 1QKWA 1OPKA 4J6XA 1PD0A 2QQSA 4R55A 3QSUA 1VQPQ 2GF7A 3QKJA 5AT1B 1K8AU 1EFNA 2GCXA 2LQ8A 1G3WA 1KD1R 1BCOA 1NEGA 3MPUB 3M0TA 3OA6A 3G71Q 2DILA 1NJIU 3OSVA 5A2QE 2E4HA 4RTWA 3OY9A 1QQJA 3V8JA 3G7ZA 1KQSP 1B34A 2AIRB 2LDMA 2H3JA 5CKHA 3L2VA 2WSEE 3OBWA 2CDTA 1T3SA 1I5OB 4KGZB 1WJRA 2AT1B 5I21A 4FT4A 1M1KR 1W2BA 2QDLA 2CH4W 3WVDB 1M3CA 2FEIA 4M75E 2DJQA 4L5GA 2E41A 4PJOA 1BK2A 5LJ3h 3JCMg 5GANh 1M1KC 4AFSC 1W2BS 2RJFA 2XU8A 3OMCA 4BI8B 2NYSA 4F7UA 4EMHA 1MV0B 4F14A 3PIPA 3O5ZA 3JB9I 2O4XB 1M2OA 5IHKA 1MMNA 3I56A 2DRKA 1WJSA 1ZSZB 2VV5A 3A1PA 1KQ2A 2R57A 2DL3A 1V29B 2CSIA 2KQWA 4C0DB 1KHCA 3QZ9B 4HCKA 3QPHA 1HK9A 2HKNA 5FROA 4VUBA 3EGUA 2EKOA 1IGQA 4B9WA 3RMQA 2RMOA 4MZMA 2DLPA 5IT9E 3QDFA 3M4YA 3C4SA 3JCMh 5I2SA 5LJ3g 3WVEB 4OB3B 4KH1B 1QVPA 3OMGA 2K3BA 3I56T 2QA4T 4XQ3A 3CD6Q 5GJVB 1ZA2B 1ZUUA 2RN8A 4M7DG 4J83A 4LDVA 2VUBA 4J9CA 5GAN8 4C8QC 1WHHA 1KC8R 1AHJB 2XK0A 2YUQA 2DL8A 1ZSZC 2ROTA 3VRZA 3NPFA 3I9QA 1YFNA 1G3SA 4J9DA 1UGQB 4ELYC 1WQWA 3QYHB 3MEUA 1WDXA 4MZPA 4RCBA 1SSHA 1OU9A 2DMOA 2KAFA 3REAB 4DEXA 2HMAA 2EQJA 3DLMA 2D0NA 2P0PA 2V1QA 3CMAQ 4M75F 3PTAA 2YRCA 2DAQA 2RF0A 3T9NA 1U1TA 2DBKA 2RI3A 1SSFA 3X28B 2KMTA 2QEXQ 3CCLT 1UDLA 1YJ9A 1AWXA 3H41A 1YI2Q 3IQLA 4BE2A 2CT4A 1X43A 3AT1B 4C92F 3CCET 4TVRA 2X35A 4C8QE 4D6WA 1Q95G 2P4TA 2A36A 1S72A 1AD5A 2YHTA 2JXBA 3A8LB 1TWBA 2HSPA 2AZVA 5IH2A 3NTIA 4FW1A 2LCLA 4DBHA 4LDXA 5GMKj 2BKDN 1MNEA 3UA7A 2X3WD 3G71T 1X75C 4E2FB 4EMKC 1PNJA 4JLGA 2A7YA 2EBPA 3A8OB 3HRTA 3UA6A 2CZ0B 1WYXA 5GMKm 2QDYB 3DB3A 3M5AA 1Y57A 5LJ5j 1Q7YR 2L5QA 4E7ZA 1OQKA 3CQTA 1QLYA 3FEOA 4N4IA 4RTXA 4QQDA 3URGA 1S72Q 2KI7A 2QEXT 1UG1A 3CBOA 4Y92A 2XICA 2NUZA 3CC4A 2DIQA 1D0YA 1N5ZA 1VIEA 1WX6A 2LCSA 4PNOA 3NFCA 3OYGA 3SWNB 1LOJA 5KCOA 2G6FX 5I2MA 2DJZA 4A63B 2DXBA 2PVGB 3HPWA 2A28A 2MK5A 2JMAA 1IGUA 5GAMf 3MJXA 3LYIA 1AZGB 1YHQQ 1UE9A 3JCMV 1VQNA 3V7SA 3TREA 2Y90A 1VOMA 1VQLA 4A53A 2M51A 3LLRA 1FMVA 5CK9A 3QWYA 2ENMA 1BB9A 5KYXB 2GBQA 4QVCA 3EFOB 2QQRA 1M8VA 2BZ8A 1NM7A 4C92D 2O9VA 1JBMA 4FYYB 1M1KU 2B8AA 4YTLA 1WQ7A 2JJ9A 1PKTA 1YJWA 3QIIA 5GAMe 3F70A 5LL6S 3DLLA 3HSBA 2RJDA 1U8RA 5D7UA 4C92E 1VQ6T 1TUGB 5L8RE 4ME7A 2O9SA 1MV3A 1NE8A 4JRKA 3SFMA 4PJMA 1LPLA 4OP0A 1AWOA 3CXCP 2OAWA 1X27A 5CR2A 1AOJA 4M78F 1K9MC 2DM1A 3MP6A 3A8GB 2YXYA 1MMGA 1OZ2A 4C5IA 2FG0A 3M0PA 1K0XA 3EG9B 2DEUA 5A0DA 3N5BB 2ZCFB 5IXBA 2Y4XA 1TXQA 4X9CA 2ED1A 1FXXA 2DERA 4NL3A 4HT8A 2X3XD 4BD3A 2KEAA 1OYXA 2CP0A 2AHJB 3C95A 1KIKA 4IUPA 3QZ5B 4XU1A 2XI9A 2QGFB 3CXCA 5J26A 3CCMT 5LJ3d 1UGSB 4N0AA 4XAXB 4LDYA 3M0QA 4JPBW 3JCMc 1Q86C 1D3BA 4Y28E 1PKSA 4J5YA 1WHMA 3QBYA 1BIBA 4C8QA 3GBQA 4PJJA 3FLGA 1NLPC 1VYVA 4ATOA 1ARKA 4HXJA 3TCJA 4AG2C 2DBMA 4MDWA 4FW2A 5ECAA 1AVZC 1UTIA 2K5IA 3L2QA 5GAN3 3M59A 5LJ3e 2DPPB 3HFOA 5A0LA 2IIMA 1VQ6A 3Q1JA 2K9GA 4LDUA 4LD9K 1U3OA 2HSEB 3CCLA 2V1RA 3CPWA 4C5HA 3CCVA 1S72T 5IAYA 2CSQA 2CZ1B 4GLMA 2P0QA 1KQSS 2DETA 1UFFA 3GPLA 2DK3A 4PFOA 3TSZA 1O75A 2QI2A 2LCCA 4OVAA 1OPLA 2QTVA 4J6YA 4C0DC 2OTJA 5KE3A 4HCCA 3HRSA 3BFMA 1ZX6A 1VQMQ 2KRSA 3JCMb 1IO6A 5LJ3j 1I81A 1M9SA 1PSEA 4MMLA 1M4ZA 3QJ6A 5GAMj 4F7UF 4E47A 2DL4A 3V8LA 1JXMA 3JCMe 3M4GA 1SEMA 1KJWA 4M7DF 4KBMB 4J8OA 1TTHB 1E6GA 4RKUE 1KD1C 2EW3A 3CCJA 2E6ZA 5CCAA 2M16A 1WA7A 4OMMA 2HNIA 5GAOr 3EG1A 4PJLA 4PJOF 1JRIA 1VQKT 5CQYA 3VU3C 4J9FA 1E6HA 3CCQA 1JB0E 1WFWA 4WCIA 4M7AF 1YNZA 1M1GA 2EKHA 3C12A 2BZYA 5I11A 4AT1B 2QASA 1JJ2S 3LW5E 1X69A 2DRMA 2RJEA 3CMET 1OI1A 1M2VA 2F5KA 3EGDB 1KK7A 1M3BA 2RQWA 2EFIA 1WZOA 2ZPFB 2YLCA 3M53A 3J80E 4Z02A 4RTUA 3R6NA 4FIBA 4D8KA 1TUDA 5GMKh 4J9EA 2X4WA 3NGPA 2NUPA 1D09B 2OTLA 1UGVA 1UJ0A 1M90R 1W1FA 1VUBA 1XTDA 4HVWA 1HXDA 4LUEA 2QA4Q 1GL5A 4LDWA 5LJ5f 2RQVA 1D1CA 4JJNK 3I55Q 5FLXE 1WHKA 5J39A 5GMKl 4JLIA 1YITQ 3TU4K 3RERA 3GNFB 4K11A 4M75B 1Q7YU 2K57A 1K73R 4HCZA 4KUIA 3EFRA 4MDXA 2X51A 5KYWB 1HSQA 5FRNA 4M7AC 2K7AA 3H8ZA 3PMTA 1IHWA 2LTOA 4WF2A 2JM9A 1RI0A 3E1SA 1F1BB 1AZEA 4ANJA 3MCAB 3CCEQ 4KRTA 1JJ2P 1D3BB 3A5ZB 2SRCA 1VQOA 4IIMA 2V8IA 1RAIB 4FL6A 2WACA 5EG2A 2PVOB 4PL6A 2L3QA 3LH5A 1KD1U 1XQHA 2YRVA 1VQOT 1MMDA 4M75A 1E7OA 4IUUA 3LWIA 2E10A 4KGXB 1ACMB 1QVGP 4J7IA 3JB9F 1UHFA 2NUTB 1WHGA 4OB1B 2D6FA 5LJ5d 3VYGA 2K79A 3V7CA 1R8OB 3KBGA 1VQPT 5FU7C 3RKYA 1H92A 3X25B 1T0HA 2DL7A 1YIJT 1W70A 3QDRB 4JJCA 1K4US 1N9SA 4DOWA 3M0RA 1AEYA 3EAEA 1NYGA 3CEYA 5KYUB 1JJ2A 3JAME 4XTYA 4CC2A 4M77C 3CMEQ 2NLUA 3OW2A 2F2VA 2O4XA 2RJCA 3PMIA 3E9FA 3NHNA 8ATCB 3EH1A 1D0XA 4MZTA 1GXIE 4ESRA 4C5EA 5D6WA 3RNJA 2BZXA 5C6SA 5GANj 1SPKA 2LNVA 2NWMA 3M0UA 3VV0A 3BY7A 1VQ8T 2O31A 1K9MR 1Y0MA 3CCJT 3G4SA 4IUQA 1YCSB 2QGGA 1VQ7T 1UGPB 1IHVA 2DNUA 3QO3A 5KYUA 1PG5B 1ZBXA 1Q7YC 1PHTA 5GAOn 4CI0C 3BE3A 2RQUA 4A4HA 4F7UE 4E7JA 2O2OA 3OSSC 2LJ1A 4L6V5 1Z9ZA 2OI3A 2HEQA 3G4SQ 2P4RA 3CCQT 3VKIA 2RI5A 3H0FA 4F7UG 3DB4A 1BYMA 3A8HB 1KQSA 1K73U 4EMGA 1QP3A 1YN8A 4HVVA 1VQMA 3RESA 1H641 1YCYA 3CPWS 4C0FA 2ZGWA 5KYYB 1A0NB 4XTWA 2VWFA 3OYNA 1SG5A 1Q81C 1VQLT 2KRMA 1CKBA 1YWPA 2LNHB 1RI9A 1Q81R 3EG9A 3S3MA 1VQ9A 1LNXA 3SWNA 3D7SB 2JT4A 2VASA 3LGLA 3S3NA 4OB0B 4XU2A 3JCMX 4RTTA 4JJDA 2YRDA 3OS0A 2OJ2A 2RHZA 4X9DA 5GAOm 2FO0A 2ZPHB 1C0MA 5IN1A 1Y71A 2DX1A 2RHXA 1VQLQ 3WXMB 1YJNA 1IREB 2EYWA 1C1AA 4UC4A 2M1HA 2KK4A 1M8MA 2YUOA 3CXCS 2CS7A 4XTXA 1J3TA 2GTJA 5FWCA 3OQ5A 2QA4A 3VS1A 1VQ4T 2QQ9A 3FC3A 2L8DA 1YJ9Q 2CH4A 2CZ7B 5CKEA 2X9HA 2V8KA 3CC2Q 4RTYA 1SHFA 4DBQA 2BTTA 4M7DD 3JCMQ 4KGVB 2E3HA 5CQXA 1G83A 2LJ0A 2MWOA 2PQWA 4FCYA 3H0IA 4JDSA 2CZ6B 2FZKB 3PT9A 2E3IA 1VQ9T 4QQGA 3RKXA 4XTVA 1BI2A 2LX7A 1NJIC 2XDPA 5FU6C 3ZFJA 2KYMA 4DBRA 1TU0B 2LP5A 1B7TA 4M78G 3OYLA 4L59A 2PNIA 1QVGS 3UF4A 1ZBJA 3CC7A 1QW1A 2EGAA 2PU9B 1R0CB 1TS9A 2F69A 3EFSA 2YLBA 5CVIA 4M77B 2DTIA 3TSWA 2JVVA 2BUDA 1D1AA 1YJWT 2CGHA 4ZTJA 2K4YA 1N9RA 2J06A 3I5SA 4JRIA 1RAGB 3GIBA 4ZN1A 4XU3A 3CC2T 1ZSGA 3CCUA 5GANf 7AT1B 1ZQ1A 2KBTA 1EIFA 2JTMA 3QHSA 4OB2B 1FMWA 1TH7A 5GMKe 2RQRA 3M58A 2COYA 2DVEA 3ZBDA 4PJOG 3MHXA 5DLOA 5D6YA 3CCUT 3MEWA 1OX9A 1VQNQ 2GNCA 5HY6A 1G8XA 3VS0A 1OULA 4FYWB 1LJOA 3OS5A 2GGRA 4J9BA 1JEGA 2O88A 5HK0A 1QWFA 5CO7A 1NG2A 2FB7A 3O8VA 2ECZA 4RG2A 3QUIA 3OS2A 1UEBA 4O6JA 2W10A 2GFAA 3ASKA 4PJOB 2JMCA 2EQUA 3VS2A 3CMEA 1K73C 2JUFA 2F2WA 1SF9A 3SB2A 1UECA 3S6WA 3CBPA 5GJWB 2EYQA 2DKGA 1MMAA 2C0OA 3G6EA 3CCRA 4M7AA 1TSFA 2EWNA 5DY9A 1GCPA 2L3PA 3TVTA 4M7AE 4N4HA 4HVUA 3CC7Q 2J6FA 2RH2A 4C8QD 4Z89A 2KSSA 1KC8C 9ATCB 3J7AF 3HP9A 2RA2A 3LGFA 1XOVA 3MP1A 2VVKA 2VXFA 4KUDK 3G6ET 1PRLC 4A54A 2CT3A 1WLPB 2DL5A 3X24B 2EYZA 4M77F 4C8QG 3CC4T 3JB9G 4M7AD 1LCKA 1H3HA 2V8JA 5EC7A 3EG3A 3H6ZA 1JU5C 2DO3A 4E7LA 3UWNA 3MKDA 3HHTB 3E2UA 5IXFA 2RD1A 1QCOA 1I5LA 1YP5A 4OGCA 3RBBB 1Q82R 1VQ5A 4QVZA 5C0MA 3A98A 2CP7A 3CCLQ 1B07A 3UPUA 2ED0A 1FX7A 5LJ5h 4AFZC 1B34B 2XKOC 2CREA 1QWEA 1VQKA 3OYDA 1N6AA 2XIDA 4FM4B 1SRLA 4JUVA 2E6NA 1VQ7Q 4HT9A 4E7KA 1N27A 1VQ5Q 8AT1B 3P8BB 1VQ8Q 1LVKA 4Q5WA 2A08A 2OTJQ 3C94A 4NL2A 1QCFA 1PSFA 2ZPBB 2SEMA 2G3RA 1YI2T 1I0CA 2IPOB 2LRQA 3EGDA 2JTEA 3JCMP 3QYGB 1Z9QA 3GP8A 2Z0WA 4C92C 1Y96B 2JNGA 1R0BG 3REBB 3ULRB 3CCEA 3M56A 3OYJA 4EIKA 2HBPA 1KHIA 1YJ9T 3JCMf 2E65A 1ZSZA 5GAOl 3CCJQ 3JB9H 1VA7A 2LT1A 1PD1A 1YIJQ 4CC3A 2XD0A 5GAMg 3S3OA 2F1LA 5AYFA 2QEXA 4IIOA 1WGSA 2A0FB 5KCHA 1VIFA 3E9GA 1W2BP 5LJ3f 4OMNA 1YITA 3HKSA 2EQMA 1WHJA 4J7FA 4FYXB 4JS5A 1QKXA 3EHQA 4QKUA 1SKUB 1Y96A 2FPEA 2YUPA 1ABOA 2B86A 2JOYA 5KE2A 2D1XA 2LC4A 1QCNA 2DE0X 2R5MA 2PZ1A 4CC4B 4EMKA 3VS3A 2EYXA 5CAIA 2HBWA 1KFZA 2XDBA 4OMFB 1PWTA 1WHLA 3VJPA 4XU0A 3KXTA 5CKFA 4F16A 1IXDA 2DTHA 1CKAA 4ZGJB 2FPDA 4FSSA 3GF5A 2JTFA 3ME9A 2K3XA 1NEBA 5KYNA 2KNBB 2PVDB 4J9GA 2DIGA 1C6VX 2DD5A 2EPDA 4M75D 2KROA 2DZ9A 3CCQQ 2H3EB 1W4SA 2XHCA 2KRNA 4EMKB 5GMKi 2C06A 2DVJA 4PK4A 1Q82U 3OW2P 1X6OA 3CMAA 5GAN5 3PGGA 2RK2A 2RNAA 3OYIA 1QVFS 2HAXA 1H3ZA 4RG8A 4MMKA 3EH2A 1HJDA 3META 2HQXA 2RO0A 5L23A 2L3RA 1WJQA 1MNDA 4E6RA 2LX9A 2KT8A 3H9NA 1AWJA 1TG0A 3CCUQ 1G3TA 3I56Q 4X1VA 4R56A 4M78C 1QVFA 4E7HA 4OGEA 5HCKA 1KC8U 2CUDA 4Y91A 1AWWA 1BIAA 1G3YA 2ZPGB 2P0KA 2VGMA 2VC8A 4DA4A 1NZ9A 1FWZA 2ATCB 6AT1B 2EJ9A 2E1HA 4M78A 5I22A 3OW2S 1UGRB 5IHIA 5HKCA 2KR3A 3OYFA 2DF6A 4JRPA 2OTLT 4JRQA 1OU8A 5GAN4 2RM4A 3E19A 3SWNC 3AHUA 2EVRA 1GBRA 3P8DA 1M1FA 1X6BA 2JW4A 2HZYA 2DXCA 3OB9A 3QG1A 1SHGA 3CCRT 2J6KA 3JRZA 2K2MA 4D8DA 2NUPB 2MOXA 5GAOp 2LMJA 4EDUA 1VQ8A 1RACB 1O9SA 4BE0A 2YWWA 2HL3A 2M9UA 2CP3A 4PKCC 2EJGA 1AT1B 2VGNA 3UDCA 3RMSA 2MWPA 2EGCA 2AZSA 4ZN3A 3BDUA 2QXFA 4QW2A 1RLPC 2EQIA 4M78B 1VYUA 3GOXA 3R6OA 4P5NA 1N8RU 4DBFA 2CP5A 2HD0A 3M55A 2A3LA 3RUXA 4OMLA 1M3AA 3OS1A 1X6GA 2WSFE 5CKBA 1Q86U 2DD4A 3HFNA 5KYXA 3SDZA 1YHQT 1JXOA 2MI6A 4F04B 2J05A 3JSCA 2M02A 2ZAEA 4NS5A 4DEYA 1YJNT 3DKMA 2LT4A 1G2BA 2CYZB 3ER0A 4ZNXA 1MHNA 3PVLA 3TQ7P 2OTLQ 2KXDA 1VQMT 3G71A 4GLKA 2O01E 1YITT 1N8RC 1PRMC 1YI2A 5GAOq 1VQ4Q 2P84A 1U06A 4M7DB 2EYYA 1UB4A 4PJNA 1VYTA 4DQ2A 1WXBA 3GLXA 1RL2A 4M7DE 2DA9A 2MMPA 2DXTA 1ZLMA 4BI4A 1UUEA 2OX7A 3I55A 1IRXA 3JCMW 1X2QA 1NJIR 1OOTA 1W6XA 5GAN7 1WPYA 2OAUA 3KFVA 4Z88A 1GBQA 1EX4A 4N4GA 3RR6A 4F17A 2KE9A 2L0AA 4J6WA 4LNPA 1RABB 4FU6A 1SRMA 3MO8A 4CC7A 4DOVA 2QG9B 3M54A 4X34A 2LJ3A 3G4ST 4M75C 2LQWA 4IKFA 2EAYA 2ABLA 5LJ5e 2DXUA 4C8QB 3HTRA 1WXTA 3PFSA 4M77D 1YJNQ 1VQNT 2LVMA 3SEMA 5DLQE 5HK3A 2JM8A 3V8KA 1R77A 3OYAA 1D1BA 1YHQA 1M90C 2FYKA 2XMFA 4OMPA 2J7IA 2FL7A 1U5SA 2FZGB 1HD3A 1K76A 4B6MA 4M77E 2KXCA 2E12A 3EHRA 3X26B 1ZUYA 2ZZDA 3CCRQ 2XG8D 1EZZB 3MEAA 3L1AA 4XK8E 2D8HA 3GNGA 1M2VB 3ZEHA 4BDZA 4BY6B 1YJWQ 4AFQC 1ZUKA 1KQ1A 1Q86R 4FT2A 2HQHA 4LD6A 5FRMA 3CCSQ 4F7UB 4BB7A 3CD6A 1NPPA 2R58A 1OX8A 4J9IA 4ELZC 3JB9D 3FIFA 2LQNA 1I4K1 2R5AA 2L3SA 4ORZA 1QMCA 1OEBA 1S1NA 1WNLA 2EJFA 3EG0A 3U23A 3L2UA 1BCMA 2YDLA 2PUKB 1NYFA 1NPRA 2CUBA 2QYZA 4A4FA 5M9OA 3CCSA 1RAHB 2M0YA 2QAZA 4R0KA 2K3YA 2E5KA 2GTOA 4PJOD 4J9HA 4FYVB 2DZCA 2IVWA 4PLLA 1BI3A 2KDSA 3VRYA 5GAMh 2DFUA 1FYNA 3OBYA 3JV3A 1Q81U 2K2VA 1GRIA 4HKEA 4HCBA 4PJOE 2DYBA 4N0AC 1HYOA 2CKKA 4XTZA 5D6XA 3THKA 4E7SA 1FMKA 5IHNA 2JZ2A 1VQ5T 4CRIA 2D8JA 3PNWC 3OYCA 1K0SA 3OYHA 3EGXA 4IURA 4BY6C 1GCQA 1VQOQ 5GANd 3CCMQ 2MAMA 2EGEA 1IZ6A 2MYSA 2C0TA 2HL5C 4RTVA 4GY5A 1V76A 1H8KA 1RLQC 1NBEB 1QP2A 4JZ4A 2FPFA 1BI1A 2RI2A 2QK0A 1VQ7A 2C0IA 4BACA 2COWA 1Y07A 3JCMd 1PCXA 1RAEB 3HL8A 4M78E 2ZPIB 3G6EQ 1XNIA 2FRYA 3EG2A 2VXEA 1KSWA 3LWHA 1CSKA 1YBYA 2XDDA 3PIOA 3VS4A 2FHDA 3CCMA 3CPFA 3M9QA 4ZGDB 2AKKA 2KY9A 3OYYA 3NTKA 4M78D 2RHIA 2IG0A 3CCVQ 5GANe 2FVUA 4C0GA 3VS5A 4V2SA 4B9XA 3VS7A 2RHUA 3FJ5A 4AFUC 4M77G 4C8QF 1VQ4A 4E7IA 5GAN6 3QWXX 1BI0A 1BU1A 3PE0A 4XTUA 2KGTA 4QVDA 3NTHA 4KH0B 2JN0A 3JCMJ 4BDYA 1BBZA 2RHYA 4OMQA 3X20B 1GFDA 1VQKQ 3RDVA 3CPWP 4LUDA 4OF1A 2RPNA 3I35A 3QJYA 4C92A 2A37A 2ESWA 1DJ7B 2M0OA 2D9TA 3KUFA 5GANg 3JB9J 4M4ZA 2CP2A 4A4GA 2LZ6B 4RTZA 1I07A 4BUGA 1NLOC 3OYMA 1RAAB 2QTXA 4O5VA 3RKWA 2MIOA 4JZ3A 4HA8A 2YUNA 3CD6T 2OTJT 4KT0E 1WIEA 2D0QB 3J81E 1I1JA 1BKBA 2L2PA 1T0JA 2DEQA 3FRNA 4PFPA 3CCVT 3M57A 4M7DA 4RUGA 2RQTA 2YSQA 2PUOB 2QQAA 1ZHIA 4ZGEB 3EFOA 4EPCA 3MEVA 1UHCA 2GQVA 5FWBA 2FRWA 1VQ6Q 3P8HA 3CC7T 1PM3A 4QQ6A 1I8FA 1U1SA 1QVFP 4M7AB 4BI3A 4M7DC 4M77A 4AG1C 3SHWA 2RB6A 2AKLA 1K8AC 3CC4Q 1OV3A 1UJYA 2BE7D 4QT7A 1TUCA 2DYIA 1GCQC 4M75G 1K9AA 3HRUA 2JS2A 1MUZA 2EIFA 4RCCA 3L2RA 4WTOB 1K8AR 5FW9A 2K5FA 3OYKA 2PTKA 2V26A 3LX7A 2EQKA 3ZL7C 1K1ZA 1V1CA 4C0ZA 2W0ZA 4IUTA 4M7AG 1ABQA 3C0CA 3INZA 1G5VA 3BW1A 2H8HA 2KT1A 1KG1A 3LH0A 1M90U 2BE9B 2E5QA 2KYBA 1QVGA 5LJ5g 1XJWB 3L2ZA 2K5LA 3RIRA 3CC2A 5KYYA 1X2KA 2I0NA 3I5RA 2I2LA 2J6OA 4KULA 5FU7B 3MP8A 1M27C 2X4JA 2HQEA 3I55T 3L2WA 4IUVA 2KVQG 5GAN2 1IB8A 3EGXB
chains in the Genus database with same CATH topology
1OZ2A 4C5IA 3CXCS 2CS7A 4XTXA 4II1A 5A0DA 2MI6A 3N5BB 5KH6A 3JSCA 3FDRA 2ZCFB 3OQ5A 2LQKA 2Y4XA 2QA4A 4JS4A 4X9CA 4RMOA 4NS5A 1VQ4T 4PJOC 2QQ9A 3FC3A 1FXXA 2L8DA 4NL3A 3DKMA 1YJNT 4HT8A 2CZ7B 2LT4A 3L42A 5CKEA 2CYZB 4BD3A 3ER0A 1MHNA 2V8KA 1OYXA 2X4XA 2E64A 2AHJB 3C95A 5FU6B 4IUPA 1VQMT 3G71A 4M7DD 1OZ3A 3QZ5B 4GLKA 4XU1A 2O01E 1YITT 3JCMQ 2XI9A 5CIUA 2Y4YA 3CXCA 5J26A 1N8RC 3CCMT 1YI2A 5GAOq 5CQXA 2PQWA 3TEEA 2MWOA 5LJ3d 4JDSA 2F5TX 1UGSB 2CZ6B 3PT9A 4M7DB 4N0AA 3CCST 4XAXB 4LDYA 1UB4A 1VQ9T 4QQGA 3RKXA 4DQ2A 3UT1A 4A4EA 4XTVA 3GLXA 1BI2A 1RL2A 3JCMc 2RK1A 2L89A 1Q86C 4M7DE 4FSXA 1D3BA 4Y28E 2XDPA 5FU6C 1NJIC 3ZFJA 1Y7XA 4J5YA 2MMPA 3QBYA 1BIBA 2DXTA 2ZPEB 3V7RA 4C8QA 3CBMA 4ZTFA 4A4KA 4BI4A 4C92G 3FLGA 4PLIA 4M78G 3OYLA 4L59A 4ATOA 1QVGS 3A8MB 3I55A 4NOYA 3JCMW 3CMAT 2BIVA 3TCJA 3VUZA 3CC7A 1QW1A 2PU9B 4MDWA 2F69A 3EFSA 2YLBA 2K5IA 3FB9A 5GAN7 1WPYA 5CVIA 3OYEA 2OAUA 4M77B 2DTIA 2GFUA 2JVVA 4N4GA 3L2QA 5GAN3 2BUDA 2DTOA 5GAMd 3M59A 3VUBA 5LJ3e 2DPPB 1YJWT 3HFOA 4J6WA 5DM7R 2MF2A 1X01A 2CGHA 3MO8A 4FU6A 2K4YA 4ZTJA 3FJPA 1N9RA 4DOVA 5A0LA 4JRIA 3GIBA 3M54A 4X34A 4ZN1A 4XU3A 3OYBA 3CC2T 4C92B 1VQ6A 3CCUA 3Q1JA 5GANf 1ZQ1A 1Q82C 3G4ST 1EIFA 4C5GA 4BE1A 1YIJA 2JTMA 3BDLA 4M75C 3QHSA 4LDUA 4OB2B 1TH7A 4IKFA 4LD9K 5GMKe 2EAYA 5LJ5e 2DXUA 4C8QB 3CCLA 3CPWA 3M58A 1MGQA 2X4YA 4C5HA 5A0GA 3CCVA 1S72T 5IAYA 1YHQT 2DVEA 3PFSA 3ZBDA 2CZ1B 1P92A 4M77D 3SD4A 4PJOG 2P0QA 1KQSS 1VQPA 3MHXA 3GPLA 2DK3A 2LVMA 1VQNT 1O75A 2QI2A 2LCCA 5DLQE 5DLOA 4OVAA 5HK3A 5D6YA 4J6YA 3V8KA 4C0DC 3CCUT 2OTJA 5KE3A 2QQBA 3MEWA 1M5Q1 5J3BA 3OYAA 2FYKA 3HRSA 3VYHB 1YHQA 1M90C 2VYTA 5HY6A 5CKDA 3QXEB 2FL7A 3BFMA 1LJOA 3OS5A 2WSCE 4M77E 2E70A 5LJ3j 3JCMb 2E12A 1K9MU 1I81A 1M9SA 3X26B 2ZZDA 2QQSA 4J6XA 5HK0A 5CO7A 1PSEA 2FB7A 3O8VA 4MMLA 1M4ZA 2XG8D 3MEAA 4R55A 3QJ6A 3QSUA 3L1AA 5GAMj 4XK8E 2GF7A 4RG2A 3GNGA 3QKJA 3QUIA 4F7UF 2GCXA 4E47A 1K8AU 2LQ8A 1G3WA 3V8LA 3OS2A 1UEBA 4O6JA 2GFAA 3ASKA 4PJOB 3ZEHA 4BDZA 3JCMe 4BY6B 3OA6A 3M4GA 2EQUA 3CMEA 1NJIU 3OSVA 1K73C 2JUFA 3SB2A 5A2QE 4M7DF 3S6WA 1KQ1A 3CBPA 4KBMB 2EYQA 4J8OA 2DKGA 4FT2A 4LD6A 3V8JA 3OY9A 5FRMA 4F7UB 3G7ZA 4RKUE 3G6EA 1KD1C 4BB7A 3CCRA 3CCJA 3CD6A 4M7AA 1B34A 1NPPA 2E6ZA 5CCAA 2EWNA 2LDMA 2M16A 2H3JA 2R58A 5DY9A 5CKHA 3L2VA 2HNIA 5GAOr 4M7AE 4N4HA 4ELZC 2WSEE 3OBWA 3JB9D 3FIFA 2RH2A 4C8QD 1I4K1 4PJOF 1JRIA 2R5AA 5CQYA 1WNLA 1VQKT 2KSSA 2EJFA 3VU3C 1KC8C 4M7AF 3J7AF 1WJRA 3HP9A 2RA2A 5I21A 3CCQA 1XOVA 1JB0E 3LGFA 3MP1A 2VXFA 3C12A 1M1GA 4FT4A 3L2UA 3G6ET 4A54A 1W2BA 4KUDK 2PUKB 3X24B 3WVDB 1NPRA 4M75E 4M77F 4C8QG 3CC4T 4A4FA 4L5GA 5M9OA 3CCSA 3JB9G 1JJ2S 2E41A 4M7AD 4PJOA 3LW5E 2V8JA 2K3YA 2RJEA 5LJ3h 3JCMg 3CMET 1OI1A 2F5KA 5GANh 3H6ZA 1M1KC 2EFIA 4PJOD 2DO3A 2ZPFB 2YLCA 2DZCA 2IVWA 3M53A 4PLLA 3UWNA 4Z02A 2RJFA 3J80E 3HHTB 4E7LA 1W2BS 2RD1A 2XU8A 3OMCA 4BI8B 1BI3A 2KDSA 4F7UA 1I5LA 4FIBA 4OGCA 4EMHA 1VQ5A 5GAMh 3OBYA 4QVZA 5C0MA 3PIPA 3JB9I 3UPUA 2O4XB 1FX7A 5GMKh 1Q81U 5LJ5h 2K2VA 1B34B 2X4WA 2XKOC 1VQKA 4HKEA 4HCBA 3OYDA 4PJOE 3I56A 1N6AA 1WJSA 2XIDA 4FM4B 4N0AC 4JUVA 2VV5A 1KQ2A 2CKKA 2R57A 4XTZA 2OTLA 5D6XA 2E6NA 1V29B 1VUBA 2KQWA 4C0DB 1KHCA 3QZ9B 4E7KA 2JZ2A 1VQ5T 4HT9A 4CRIA 1N27A 1XTDA 3PNWC 1HXDA 3P8BB 3QPHA 4LDWA 4Q5WA 3OYCA 1HK9A 5LJ5f 5FROA 3OYHA 4VUBA 4IURA 2EKOA 3C94A 4NL2A 1PSFA 4BY6C 2ZPBB 4B9WA 4JJNK 2G3RA 1YI2T 3RMQA 2LRQA 5GANd 5FLXE 5J39A 5GMKl 3JCMP 2MAMA 4JLIA 3QYGB 1IZ6A 3TU4K 4MZMA 3GP8A 4C92C 3RERA 1Y96B 5IT9E 3GNFB 2JNGA 3M4YA 4GY5A 4M75B 3CCEA 3M56A 3C4SA 3OYJA 1Q7YU 3JCMh 5I2SA 5LJ3g 3WVEB 2K57A 2HBPA 4OB3B 1KHIA 1QP2A 4HCZA 1BI1A 1YJ9T 4KUIA 1QVPA 3EFRA 3OMGA 3JCMf 4MDXA 2E65A 3I56T 2QA4T 4XQ3A 5FRNA 2RI2A 5GAOl 4M7AC 3H8ZA 3JB9H 1VQ7A 3PMTA 4BACA 1Y07A 1BYMA 2LT1A 2LTOA 3JCMd 4WF2A 4M7DG 2XD0A 1RI0A 3E1SA 5GAMg 3HL8A 4J83A 2VUBA 4LDVA 4M78E 3S3OA 5AYFA 2ZPIB 3MCAB 1XNIA 2QEXA 2VXEA 5GAN8 4C8QC 1WGSA 3LWHA 1D3BB 1AHJB 1YBYA 2XK0A 5KCHA 2XDDA 3PIOA 1VIFA 2FHDA 3E9GA 3CCMA 3A5ZB 3CPFA 3M9QA 5LJ3f 1VQOA 4ZGDB 1YITA 3HKSA 2EQMA 2V8IA 4J7FA 2KY9A 3OYYA 4FL6A 2WACA 1G3SA 5EG2A 4JS5A 3NTKA 4M78D 1UGQB 2PVOB 1Y96A 2RHIA 4PL6A 4ELYC 1WQWA 1KD1U 1XQHA 2IG0A 2YRVA 3QYHB 2FVUA 3MEUA 5GANe 4M75A 1VQOT 4IUUA 3LWIA 2E10A 4C0GA 4V2SA 2JOYA 4MZPA 4RCBA 4B9XA 2RHUA 5KE2A 2LC4A 4M77G 4C8QF 4J7IA 1VQ4A 3JB9F 4E7IA 2KAFA 5GAN6 4OB1B 2R5MA 1BI0A 2EQJA 3DLMA 2D6FA 2P0PA 4XTUA 4QVDA 5LJ5d 4EMKA 3VYGA 4M75F 3PTAA 3NTHA 3V7CA 2DAQA 1R8OB 3KBGA 1VQPT 3T9NA 1U1TA 5FU7C 5CAIA 3RKYA 2RI3A 2JN0A 3JCMJ 1SSFA 3X28B 2XDBA 2KMTA 4BDYA 2RHYA 3X25B 3X20B 3CCLT 1YJ9A 4OMFB 4BE2A 3VJPA 1YIJT 4C92F 3QDRB 4XU0A 3KXTA 3CCET 5CKFA 2DTHA 4TVRA 4ZGJB 1N9SA 4DOWA 3EAEA 3CEYA 3GF5A 2X35A 2JTFA 3ME9A 4OF1A 4C8QE 4D6WA 2K3XA 3JAME 1JJ2A 4XTYA 2P4TA 4M77C 2PVDB 1S72A 2YHTA 2DIGA 2NLUA 3A8LB 3OW2A 3QJYA 2O4XA 2RJCA 3NTIA 2LCLA 4C92A 3PMIA 3E9FA 4LDXA 5GMKj 1DJ7B 2BKDN 2DD5A 4M75D 2M0OA 2DZ9A 2D9TA 3KUFA 5GANg 1X75C 1W4SA 3G71T 4MZTA 2XHCA 4EMKC 3JB9J 4EMKB 1GXIE 4A4GA 5GMKi 2C06A 1Q82U 4C5EA 1X6OA 5D6WA 3CMAA 4BUGA 4JLGA 5GAN5 3PGGA 3OYMA 2RK2A 2A7YA 3OYIA 2QTXA 3A8OB 5C6SA 1QVFS 3HRTA 4O5VA 2CZ0B 5GANj 2LNVA 5GMKm 2HAXA 3VV0A 3RKWA 2QDYB 3BY7A 3DB3A 3M5AA 1H3ZA 4RG8A 5LJ5j 4MMKA 2L5QA 3META 1VQ8T 2HQXA 4HA8A 3CCJT 3CD6T 2RO0A 2OTJT 2L3RA 3FEOA 3G4SA 4IUQA 4N4IA 1WJQA 4KT0E 2D0QB 2LX9A 4QQDA 3J81E 1VQ7T 1UGPB 3URGA 1BKBA 3QO3A 3FRNA 2DEQA 3CCVT 1ZBXA 3M57A 1Q7YC 1G3TA 5GAOn 4M7DA 4CI0C 2QEXT 2PUOB 4A4HA 2QQAA 1ZHIA 4F7UE 4ZGEB 4R56A 4E7JA 3CBOA 4EPCA 2XICA 3MEVA 3OSSC 4M78C 1QVFA 2GQVA 4E7HA 3CC4A 2DIQA 4OGEA 1VIEA 4L6V5 1KC8U 4Y91A 3P8HA 4PNOA 3NFCA 3OYGA 3CC7T 1BIAA 3CCQT 3SWNB 1LOJA 1G3YA 3VKIA 5KCOA 5I2MA 2ZPGB 2DJZA 2RI5A 2P0KA 4QQ6A 2VGMA 2DXBA 2VC8A 1I8FA 3DB4A 3A8HB 4F7UG 1KQSA 1U1SA 2PVGB 3HPWA 4DA4A 4EMGA 1K73U 1QP3A 4M7AB 1NZ9A 1FWZA 4BI3A 1VQMA 3RESA 4M7DC 4M77A 1H641 1YCYA 5GAMf 2EJ9A 2E1HA 4M78A 4C0FA 3CPWS 2ZGWA 3LYIA 3OW2S 1UGRB 5HKCA 2RB6A 3OYFA 3JCMV 1K8AC 1VQNA 4XTWA 4JRPA 2OTLT 4JRQA 3V7SA 3TREA 2Y90A 5GAN4 3OYNA 2RM4A 1VQLA 4A53A 1Q81C 3E19A 3LLRA 3SWNC 3AHUA 3P8DA 5CK9A 4M75G 1M1FA 4QVCA 1VQLT 3HRUA 3QG1A 2DXCA 3OB9A 2QQRA 1M8VA 2EIFA 4RCCA 3L2RA 3CCRT 2K5FA 3JRZA 3OYKA 4C92D 3LX7A 1JBMA 2EQKA 5GAOp 4UC4A 4EDUA 3S3MA 1M1KU 1O9SA 2B8AA 4YTLA 1VQ8A 1LNXA 4C0ZA 1VQ9A 3SWNA 4BE0A 3LGLA 4IUTA 3S3NA 4OB0B 4M7AG 1WQ7A 3INZA 4XU2A 2M9UA 3JCMX 1G5VA 4PKCC 3BW1A 2EJGA 2VGNA 3UDCA 1YJWA 3QIIA 5GAMe 1KG1A 3RMSA 3F70A 3LH0A 2MWPA 3OS0A 1M90U 5LL6S 2E5QA 4ZN3A 2RHZA 3BDUA 4X9DA 3DLLA 5LJ5g 1QVGA 2QXFA 3L2ZA 4QW2A 3HSBA 2RJDA 2K5LA 4M78B 3RIRA 4C92E 1U8RA 5GAOm 3GOXA 3CC2A 5L8RE 1VQ6T 3R6OA 4ME7A 4P5NA 1NE8A 4JRKA 3SFMA 1N8RU 4HCCA 2HD0A 3M55A 2I2LA 2A3LA 2ZPHB 4OP0A 3RUXA 4KULA 5FU7B 5IN1A 3MP8A 2X4JA 2RHXA 1Y71A 2HQEA 3I55T 3WXMB 3OS1A 1YJNA 1IREB 5CR2A 2WSFE 5CKBA 1Q86U 2DD4A 3HFNA 3L2WA 1K9MC 4M78F 4IUVA 2KVQG 3MP6A 3A8GB 5GAN2 2M1HA 2KK4A 3SDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWI A;  2JTM A;  3KXT A;  3LWH A;  4R55 A;  4R56 A; 
#chains in the Genus database with same CATH topology
 4GBQ A;  2JS0 A;  2FZC B;  4II1 A;  5KH6 A;  3FDR A;  2LQK A;  4JS4 A;  4RMO A;  4PJO C;  1JO8 A;  4OMO A;  3L42 A;  1WI7 A;  3VS6 A;  1RAD B;  1PC0 A;  2X4X A;  2E64 A;  5FU6 B;  1OZ3 A;  2AK5 A;  5CIU A;  2Y4Y A;  3TEE A;  2F5T X;  1RUW A;  1M30 A;  3CCS T;  3UT1 A;  3M0S A;  4A4E A;  1N8R R;  2RK1 A;  2L89 A;  4LXC A;  4FSX A;  2F2X A;  1Y7X A;  2ZPE B;  3V7R A;  4LE9 A;  3CBM A;  4ZTF A;  4A4K A;  4C92 G;  1D0Z A;  4PLI A;  2MCN A;  3A8M B;  4NOY A;  3CMA T;  2BIV A;  3VUZ A;  1TOV A;  2HCK A;  3FB9 A;  3OYE A;  4JJB A;  2NUT A;  2GFU A;  2DTO A;  5GAM d;  3UAT A;  2YT6 A;  3VUB A;  1VQ9 Q;  2HDA A;  5DM7 R;  2MF2 A;  1X01 A;  2VKN A;  3FJP A;  1ZA1 B;  2HKQ B;  3OYB A;  4C92 B;  3NMZ C;  1Q82 C;  4C5G A;  4BE1 A;  1YIJ A;  3BDL A;  3H0H A;  4LN2 A;  1YWO A;  1MGQ A;  2X4Y A;  5A0G A;  2GQI A;  1T3L A;  1P92 A;  3SD4 A;  2MPX C;  1JQQ A;  1VQP A;  1WXU A;  4AMC A;  2ROL A;  4PFZ A;  2QQB A;  5J3B A;  1M5Q 1;  3VYH B;  2K6D A;  3PVQ A;  2VYT A;  4Z8A A;  1B3Q A;  3QXE B;  5CKD A;  5KYW A;  1GFC A;  2WSC E;  1RAF B;  2VB6 A;  2CP6 A;  3G1J A;  2E70 A;  2COZ A;  1K9M U;  1QKW A;  1OPK A;  4J6X A;  1PD0 A;  2QQS A;  4R55 A;  3QSU A;  1VQP Q;  2GF7 A;  3QKJ A;  5AT1 B;  1K8A U;  1EFN A;  2GCX A;  2LQ8 A;  1G3W A;  1KD1 R;  1BCO A;  1NEG A;  3MPU B;  3M0T A;  3OA6 A;  3G71 Q;  2DIL A;  1NJI U;  3OSV A;  5A2Q E;  2E4H A;  4RTW A;  3OY9 A;  1QQJ A;  3V8J A;  3G7Z A;  1KQS P;  1B34 A;  2AIR B;  2LDM A;  2H3J A;  5CKH A;  3L2V A;  2WSE E;  3OBW A;  2CDT A;  1T3S A;  1I5O B;  4KGZ B;  1WJR A;  2AT1 B;  5I21 A;  4FT4 A;  1M1K R;  1W2B A;  2QDL A;  2CH4 W;  3WVD B;  1M3C A;  2FEI A;  4M75 E;  2DJQ A;  4L5G A;  2E41 A;  4PJO A;  1BK2 A;  5LJ3 h;  3JCM g;  5GAN h;  1M1K C;  4AFS C;  1W2B S;  2RJF A;  2XU8 A;  3OMC A;  4BI8 B;  2NYS A;  4F7U A;  4EMH A;  1MV0 B;  4F14 A;  3PIP A;  3O5Z A;  3JB9 I;  2O4X B;  1M2O A;  5IHK A;  1MMN A;  3I56 A;  2DRK A;  1WJS A;  1ZSZ B;  2VV5 A;  3A1P A;  1KQ2 A;  2R57 A;  2DL3 A;  1V29 B;  2CSI A;  2KQW A;  4C0D B;  1KHC A;  3QZ9 B;  4HCK A;  3QPH A;  1HK9 A;  2HKN A;  5FRO A;  4VUB A;  3EGU A;  2EKO A;  1IGQ A;  4B9W A;  3RMQ A;  2RMO A;  4MZM A;  2DLP A;  5IT9 E;  3QDF A;  3M4Y A;  3C4S A;  3JCM h;  5I2S A;  5LJ3 g;  3WVE B;  4OB3 B;  4KH1 B;  1QVP A;  3OMG A;  2K3B A;  3I56 T;  2QA4 T;  4XQ3 A;  3CD6 Q;  5GJV B;  1ZA2 B;  1ZUU A;  2RN8 A;  4M7D G;  4J83 A;  4LDV A;  2VUB A;  4J9C A;  5GAN 8;  4C8Q C;  1WHH A;  1KC8 R;  1AHJ B;  2XK0 A;  2YUQ A;  2DL8 A;  1ZSZ C;  2ROT A;  3VRZ A;  3NPF A;  3I9Q A;  1YFN A;  1G3S A;  4J9D A;  1UGQ B;  4ELY C;  1WQW A;  3QYH B;  3MEU A;  1WDX A;  4MZP A;  4RCB A;  1SSH A;  1OU9 A;  2DMO A;  2KAF A;  3REA B;  4DEX A;  2HMA A;  2EQJ A;  3DLM A;  2D0N A;  2P0P A;  2V1Q A;  3CMA Q;  4M75 F;  3PTA A;  2YRC A;  2DAQ A;  2RF0 A;  3T9N A;  1U1T A;  2DBK A;  2RI3 A;  1SSF A;  3X28 B;  2KMT A;  2QEX Q;  3CCL T;  1UDL A;  1YJ9 A;  1AWX A;  3H41 A;  1YI2 Q;  3IQL A;  4BE2 A;  2CT4 A;  1X43 A;  3AT1 B;  4C92 F;  3CCE T;  4TVR A;  2X35 A;  4C8Q E;  4D6W A;  1Q95 G;  2P4T A;  2A36 A;  1S72 A;  1AD5 A;  2YHT A;  2JXB A;  3A8L B;  1TWB A;  2HSP A;  2AZV A;  5IH2 A;  3NTI A;  4FW1 A;  2LCL A;  4DBH A;  4LDX A;  5GMK j;  2BKD N;  1MNE A;  3UA7 A;  2X3W D;  3G71 T;  1X75 C;  4E2F B;  4EMK C;  1PNJ A;  4JLG A;  2A7Y A;  2EBP A;  3A8O B;  3HRT A;  3UA6 A;  2CZ0 B;  1WYX A;  5GMK m;  2QDY B;  3DB3 A;  3M5A A;  1Y57 A;  5LJ5 j;  1Q7Y R;  2L5Q A;  4E7Z A;  1OQK A;  3CQT A;  1QLY A;  3FEO A;  4N4I A;  4RTX A;  4QQD A;  3URG A;  1S72 Q;  2KI7 A;  2QEX T;  1UG1 A;  3CBO A;  4Y92 A;  2XIC A;  2NUZ A;  3CC4 A;  2DIQ A;  1D0Y A;  1N5Z A;  1VIE A;  1WX6 A;  2LCS A;  4PNO A;  3NFC A;  3OYG A;  3SWN B;  1LOJ A;  5KCO A;  2G6F X;  5I2M A;  2DJZ A;  4A63 B;  2DXB A;  2PVG B;  3HPW A;  2A28 A;  2MK5 A;  2JMA A;  1IGU A;  5GAM f;  3MJX A;  3LYI A;  1AZG B;  1YHQ Q;  1UE9 A;  3JCM V;  1VQN A;  3V7S A;  3TRE A;  2Y90 A;  1VOM A;  1VQL A;  4A53 A;  2M51 A;  3LLR A;  1FMV A;  5CK9 A;  3QWY A;  2ENM A;  1BB9 A;  5KYX B;  2GBQ A;  4QVC A;  3EFO B;  2QQR A;  1M8V A;  2BZ8 A;  1NM7 A;  4C92 D;  2O9V A;  1JBM A;  4FYY B;  1M1K U;  2B8A A;  4YTL A;  1WQ7 A;  2JJ9 A;  1PKT A;  1YJW A;  3QII A;  5GAM e;  3F70 A;  5LL6 S;  3DLL A;  3HSB A;  2RJD A;  1U8R A;  5D7U A;  4C92 E;  1VQ6 T;  1TUG B;  5L8R E;  4ME7 A;  2O9S A;  1MV3 A;  1NE8 A;  4JRK A;  3SFM A;  4PJM A;  1LPL A;  4OP0 A;  1AWO A;  3CXC P;  2OAW A;  1X27 A;  5CR2 A;  1AOJ A;  4M78 F;  1K9M C;  2DM1 A;  3MP6 A;  3A8G B;  2YXY A;  1MMG A;  1OZ2 A;  4C5I A;  2FG0 A;  3M0P A;  1K0X A;  3EG9 B;  2DEU A;  5A0D A;  3N5B B;  2ZCF B;  5IXB A;  2Y4X A;  1TXQ A;  4X9C A;  2ED1 A;  1FXX A;  2DER A;  4NL3 A;  4HT8 A;  2X3X D;  4BD3 A;  2KEA A;  1OYX A;  2CP0 A;  2AHJ B;  3C95 A;  1KIK A;  4IUP A;  3QZ5 B;  4XU1 A;  2XI9 A;  2QGF B;  3CXC A;  5J26 A;  3CCM T;  5LJ3 d;  1UGS B;  4N0A A;  4XAX B;  4LDY A;  3M0Q A;  4JPB W;  3JCM c;  1Q86 C;  1D3B A;  4Y28 E;  1PKS A;  4J5Y A;  1WHM A;  3QBY A;  1BIB A;  4C8Q A;  3GBQ A;  4PJJ A;  3FLG A;  1NLP C;  1VYV A;  4ATO A;  1ARK A;  4HXJ A;  3TCJ A;  4AG2 C;  2DBM A;  4MDW A;  4FW2 A;  5ECA A;  1AVZ C;  1UTI A;  2K5I A;  3L2Q A;  5GAN 3;  3M59 A;  5LJ3 e;  2DPP B;  3HFO A;  5A0L A;  2IIM A;  1VQ6 A;  3Q1J A;  2K9G A;  4LDU A;  4LD9 K;  1U3O A;  2HSE B;  3CCL A;  2V1R A;  3CPW A;  4C5H A;  3CCV A;  1S72 T;  5IAY A;  2CSQ A;  2CZ1 B;  4GLM A;  2P0Q A;  1KQS S;  2DET A;  1UFF A;  3GPL A;  2DK3 A;  4PFO A;  3TSZ A;  1O75 A;  2QI2 A;  2LCC A;  4OVA A;  1OPL A;  2QTV A;  4J6Y A;  4C0D C;  2OTJ A;  5KE3 A;  4HCC A;  3HRS A;  3BFM A;  1ZX6 A;  1VQM Q;  2KRS A;  3JCM b;  1IO6 A;  5LJ3 j;  1I81 A;  1M9S A;  1PSE A;  4MML A;  1M4Z A;  3QJ6 A;  5GAM j;  4F7U F;  4E47 A;  2DL4 A;  3V8L A;  1JXM A;  3JCM e;  3M4G A;  1SEM A;  1KJW A;  4M7D F;  4KBM B;  4J8O A;  1TTH B;  1E6G A;  4RKU E;  1KD1 C;  2EW3 A;  3CCJ A;  2E6Z A;  5CCA A;  2M16 A;  1WA7 A;  4OMM A;  2HNI A;  5GAO r;  3EG1 A;  4PJL A;  4PJO F;  1JRI A;  1VQK T;  5CQY A;  3VU3 C;  4J9F A;  1E6H A;  3CCQ A;  1JB0 E;  1WFW A;  4WCI A;  4M7A F;  1YNZ A;  1M1G A;  2EKH A;  3C12 A;  2BZY A;  5I11 A;  4AT1 B;  2QAS A;  1JJ2 S;  3LW5 E;  1X69 A;  2DRM A;  2RJE A;  3CME T;  1OI1 A;  1M2V A;  2F5K A;  3EGD B;  1KK7 A;  1M3B A;  2RQW A;  2EFI A;  1WZO A;  2ZPF B;  2YLC A;  3M53 A;  3J80 E;  4Z02 A;  4RTU A;  3R6N A;  4FIB A;  4D8K A;  1TUD A;  5GMK h;  4J9E A;  2X4W A;  3NGP A;  2NUP A;  1D09 B;  2OTL A;  1UGV A;  1UJ0 A;  1M90 R;  1W1F A;  1VUB A;  1XTD A;  4HVW A;  1HXD A;  4LUE A;  2QA4 Q;  1GL5 A;  4LDW A;  5LJ5 f;  2RQV A;  1D1C A;  4JJN K;  3I55 Q;  5FLX E;  1WHK A;  5J39 A;  5GMK l;  4JLI A;  1YIT Q;  3TU4 K;  3RER A;  3GNF B;  4K11 A;  4M75 B;  1Q7Y U;  2K57 A;  1K73 R;  4HCZ A;  4KUI A;  3EFR A;  4MDX A;  2X51 A;  5KYW B;  1HSQ A;  5FRN A;  4M7A C;  2K7A A;  3H8Z A;  3PMT A;  1IHW A;  2LTO A;  4WF2 A;  2JM9 A;  1RI0 A;  3E1S A;  1F1B B;  1AZE A;  4ANJ A;  3MCA B;  3CCE Q;  4KRT A;  1JJ2 P;  1D3B B;  3A5Z B;  2SRC A;  1VQO A;  4IIM A;  2V8I A;  1RAI B;  4FL6 A;  2WAC A;  5EG2 A;  2PVO B;  4PL6 A;  2L3Q A;  3LH5 A;  1KD1 U;  1XQH A;  2YRV A;  1VQO T;  1MMD A;  4M75 A;  1E7O A;  4IUU A;  3LWI A;  2E10 A;  4KGX B;  1ACM B;  1QVG P;  4J7I A;  3JB9 F;  1UHF A;  2NUT B;  1WHG A;  4OB1 B;  2D6F A;  5LJ5 d;  3VYG A;  2K79 A;  3V7C A;  1R8O B;  3KBG A;  1VQP T;  5FU7 C;  3RKY A;  1H92 A;  3X25 B;  1T0H A;  2DL7 A;  1YIJ T;  1W70 A;  3QDR B;  4JJC A;  1K4U S;  1N9S A;  4DOW A;  3M0R A;  1AEY A;  3EAE A;  1NYG A;  3CEY A;  5KYU B;  1JJ2 A;  3JAM E;  4XTY A;  4CC2 A;  4M77 C;  3CME Q;  2NLU A;  3OW2 A;  2F2V A;  2O4X A;  2RJC A;  3PMI A;  3E9F A;  3NHN A;  8ATC B;  3EH1 A;  1D0X A;  4MZT A;  1GXI E;  4ESR A;  4C5E A;  5D6W A;  3RNJ A;  2BZX A;  5C6S A;  5GAN j;  1SPK A;  2LNV A;  2NWM A;  3M0U A;  3VV0 A;  3BY7 A;  1VQ8 T;  2O31 A;  1K9M R;  1Y0M A;  3CCJ T;  3G4S A;  4IUQ A;  1YCS B;  2QGG A;  1VQ7 T;  1UGP B;  1IHV A;  2DNU A;  3QO3 A;  5KYU A;  1PG5 B;  1ZBX A;  1Q7Y C;  1PHT A;  5GAO n;  4CI0 C;  3BE3 A;  2RQU A;  4A4H A;  4F7U E;  4E7J A;  2O2O A;  3OSS C;  2LJ1 A;  4L6V 5;  1Z9Z A;  2OI3 A;  2HEQ A;  3G4S Q;  2P4R A;  3CCQ T;  3VKI A;  2RI5 A;  3H0F A;  4F7U G;  3DB4 A;  1BYM A;  3A8H B;  1KQS A;  1K73 U;  4EMG A;  1QP3 A;  1YN8 A;  4HVV A;  1VQM A;  3RES A;  1H64 1;  1YCY A;  3CPW S;  4C0F A;  2ZGW A;  5KYY B;  1A0N B;  4XTW A;  2VWF A;  3OYN A;  1SG5 A;  1Q81 C;  1VQL T;  2KRM A;  1CKB A;  1YWP A;  2LNH B;  1RI9 A;  1Q81 R;  3EG9 A;  3S3M A;  1VQ9 A;  1LNX A;  3SWN A;  3D7S B;  2JT4 A;  2VAS A;  3LGL A;  3S3N A;  4OB0 B;  4XU2 A;  3JCM X;  4RTT A;  4JJD A;  2YRD A;  3OS0 A;  2OJ2 A;  2RHZ A;  4X9D A;  5GAO m;  2FO0 A;  2ZPH B;  1C0M A;  5IN1 A;  1Y71 A;  2DX1 A;  2RHX A;  1VQL Q;  3WXM B;  1YJN A;  1IRE B;  2EYW A;  1C1A A;  4UC4 A;  2M1H A;  2KK4 A;  1M8M A;  2YUO A;  3CXC S;  2CS7 A;  4XTX A;  1J3T A;  2GTJ A;  5FWC A;  3OQ5 A;  2QA4 A;  3VS1 A;  1VQ4 T;  2QQ9 A;  3FC3 A;  2L8D A;  1YJ9 Q;  2CH4 A;  2CZ7 B;  5CKE A;  2X9H A;  2V8K A;  3CC2 Q;  4RTY A;  1SHF A;  4DBQ A;  2BTT A;  4M7D D;  3JCM Q;  4KGV B;  2E3H A;  5CQX A;  1G83 A;  2LJ0 A;  2MWO A;  2PQW A;  4FCY A;  3H0I A;  4JDS A;  2CZ6 B;  2FZK B;  3PT9 A;  2E3I A;  1VQ9 T;  4QQG A;  3RKX A;  4XTV A;  1BI2 A;  2LX7 A;  1NJI C;  2XDP A;  5FU6 C;  3ZFJ A;  2KYM A;  4DBR A;  1TU0 B;  2LP5 A;  1B7T A;  4M78 G;  3OYL A;  4L59 A;  2PNI A;  1QVG S;  3UF4 A;  1ZBJ A;  3CC7 A;  1QW1 A;  2EGA A;  2PU9 B;  1R0C B;  1TS9 A;  2F69 A;  3EFS A;  2YLB A;  5CVI A;  4M77 B;  2DTI A;  3TSW A;  2JVV A;  2BUD A;  1D1A A;  1YJW T;  2CGH A;  4ZTJ A;  2K4Y A;  1N9R A;  2J06 A;  3I5S A;  4JRI A;  1RAG B;  3GIB A;  4ZN1 A;  4XU3 A;  3CC2 T;  1ZSG A;  3CCU A;  5GAN f;  7AT1 B;  1ZQ1 A;  2KBT A;  1EIF A;  2JTM A;  3QHS A;  4OB2 B;  1FMW A;  1TH7 A;  5GMK e;  2RQR A;  3M58 A;  2COY A;  2DVE A;  3ZBD A;  4PJO G;  3MHX A;  5DLO A;  5D6Y A;  3CCU T;  3MEW A;  1OX9 A;  1VQN Q;  2GNC A;  5HY6 A;  1G8X A;  3VS0 A;  1OUL A;  4FYW B;  1LJO A;  3OS5 A;  2GGR A;  4J9B A;  1JEG A;  2O88 A;  5HK0 A;  1QWF A;  5CO7 A;  1NG2 A;  2FB7 A;  3O8V A;  2ECZ A;  4RG2 A;  3QUI A;  3OS2 A;  1UEB A;  4O6J A;  2W10 A;  2GFA A;  3ASK A;  4PJO B;  2JMC A;  2EQU A;  3VS2 A;  3CME A;  1K73 C;  2JUF A;  2F2W A;  1SF9 A;  3SB2 A;  1UEC A;  3S6W A;  3CBP A;  5GJW B;  2EYQ A;  2DKG A;  1MMA A;  2C0O A;  3G6E A;  3CCR A;  4M7A A;  1TSF A;  2EWN A;  5DY9 A;  1GCP A;  2L3P A;  3TVT A;  4M7A E;  4N4H A;  4HVU A;  3CC7 Q;  2J6F A;  2RH2 A;  4C8Q D;  4Z89 A;  2KSS A;  1KC8 C;  9ATC B;  3J7A F;  3HP9 A;  2RA2 A;  3LGF A;  1XOV A;  3MP1 A;  2VVK A;  2VXF A;  4KUD K;  3G6E T;  1PRL C;  4A54 A;  2CT3 A;  1WLP B;  2DL5 A;  3X24 B;  2EYZ A;  4M77 F;  4C8Q G;  3CC4 T;  3JB9 G;  4M7A D;  1LCK A;  1H3H A;  2V8J A;  5EC7 A;  3EG3 A;  3H6Z A;  1JU5 C;  2DO3 A;  4E7L A;  3UWN A;  3MKD A;  3HHT B;  3E2U A;  5IXF A;  2RD1 A;  1QCO A;  1I5L A;  1YP5 A;  4OGC A;  3RBB B;  1Q82 R;  1VQ5 A;  4QVZ A;  5C0M A;  3A98 A;  2CP7 A;  3CCL Q;  1B07 A;  3UPU A;  2ED0 A;  1FX7 A;  5LJ5 h;  4AFZ C;  1B34 B;  2XKO C;  2CRE A;  1QWE A;  1VQK A;  3OYD A;  1N6A A;  2XID A;  4FM4 B;  1SRL A;  4JUV A;  2E6N A;  1VQ7 Q;  4HT9 A;  4E7K A;  1N27 A;  1VQ5 Q;  8AT1 B;  3P8B B;  1VQ8 Q;  1LVK A;  4Q5W A;  2A08 A;  2OTJ Q;  3C94 A;  4NL2 A;  1QCF A;  1PSF A;  2ZPB B;  2SEM A;  2G3R A;  1YI2 T;  1I0C A;  2IPO B;  2LRQ A;  3EGD A;  2JTE A;  3JCM P;  3QYG B;  1Z9Q A;  3GP8 A;  2Z0W A;  4C92 C;  1Y96 B;  2JNG A;  1R0B G;  3REB B;  3ULR B;  3CCE A;  3M56 A;  3OYJ A;  4EIK A;  2HBP A;  1KHI A;  1YJ9 T;  3JCM f;  2E65 A;  1ZSZ A;  5GAO l;  3CCJ Q;  3JB9 H;  1VA7 A;  2LT1 A;  1PD1 A;  1YIJ Q;  4CC3 A;  2XD0 A;  5GAM g;  3S3O A;  2F1L A;  5AYF A;  2QEX A;  4IIO A;  1WGS A;  2A0F B;  5KCH A;  1VIF A;  3E9G A;  1W2B P;  5LJ3 f;  4OMN A;  1YIT A;  3HKS A;  2EQM A;  1WHJ A;  4J7F A;  4FYX B;  4JS5 A;  1QKX A;  3EHQ A;  4QKU A;  1SKU B;  1Y96 A;  2FPE A;  2YUP A;  1ABO A;  2B86 A;  2JOY A;  5KE2 A;  2D1X A;  2LC4 A;  1QCN A;  2DE0 X;  2R5M A;  2PZ1 A;  4CC4 B;  4EMK A;  3VS3 A;  2EYX A;  5CAI A;  2HBW A;  1KFZ A;  2XDB A;  4OMF B;  1PWT A;  1WHL A;  3VJP A;  4XU0 A;  3KXT A;  5CKF A;  4F16 A;  1IXD A;  2DTH A;  1CKA A;  4ZGJ B;  2FPD A;  4FSS A;  3GF5 A;  2JTF A;  3ME9 A;  2K3X A;  1NEB A;  5KYN A;  2KNB B;  2PVD B;  4J9G A;  2DIG A;  1C6V X;  2DD5 A;  2EPD A;  4M75 D;  2KRO A;  2DZ9 A;  3CCQ Q;  2H3E B;  1W4S A;  2XHC A;  2KRN A;  4EMK B;  5GMK i;  2C06 A;  2DVJ A;  4PK4 A;  1Q82 U;  3OW2 P;  1X6O A;  3CMA A;  5GAN 5;  3PGG A;  2RK2 A;  2RNA A;  3OYI A;  1QVF S;  2HAX A;  1H3Z A;  4RG8 A;  4MMK A;  3EH2 A;  1HJD A;  3MET A;  2HQX A;  2RO0 A;  5L23 A;  2L3R A;  1WJQ A;  1MND A;  4E6R A;  2LX9 A;  2KT8 A;  3H9N A;  1AWJ A;  1TG0 A;  3CCU Q;  1G3T A;  3I56 Q;  4X1V A;  4R56 A;  4M78 C;  1QVF A;  4E7H A;  4OGE A;  5HCK A;  1KC8 U;  2CUD A;  4Y91 A;  1AWW A;  1BIA A;  1G3Y A;  2ZPG B;  2P0K A;  2VGM A;  2VC8 A;  4DA4 A;  1NZ9 A;  1FWZ A;  2ATC B;  6AT1 B;  2EJ9 A;  2E1H A;  4M78 A;  5I22 A;  3OW2 S;  1UGR B;  5IHI A;  5HKC A;  2KR3 A;  3OYF A;  2DF6 A;  4JRP A;  2OTL T;  4JRQ A;  1OU8 A;  5GAN 4;  2RM4 A;  3E19 A;  3SWN C;  3AHU A;  2EVR A;  1GBR A;  3P8D A;  1M1F A;  1X6B A;  2JW4 A;  2HZY A;  2DXC A;  3OB9 A;  3QG1 A;  1SHG A;  3CCR T;  2J6K A;  3JRZ A;  2K2M A;  4D8D A;  2NUP B;  2MOX A;  5GAO p;  2LMJ A;  4EDU A;  1VQ8 A;  1RAC B;  1O9S A;  4BE0 A;  2YWW A;  2HL3 A;  2M9U A;  2CP3 A;  4PKC C;  2EJG A;  1AT1 B;  2VGN A;  3UDC A;  3RMS A;  2MWP A;  2EGC A;  2AZS A;  4ZN3 A;  3BDU A;  2QXF A;  4QW2 A;  1RLP C;  2EQI A;  4M78 B;  1VYU A;  3GOX A;  3R6O A;  4P5N A;  1N8R U;  4DBF A;  2CP5 A;  2HD0 A;  3M55 A;  2A3L A;  3RUX A;  4OML A;  1M3A A;  3OS1 A;  1X6G A;  2WSF E;  5CKB A;  1Q86 U;  2DD4 A;  3HFN A;  5KYX A;  3SDZ A;  1YHQ T;  1JXO A;  2MI6 A;  4F04 B;  2J05 A;  3JSC A;  2M02 A;  2ZAE A;  4NS5 A;  4DEY A;  1YJN T;  3DKM A;  2LT4 A;  1G2B A;  2CYZ B;  3ER0 A;  4ZNX A;  1MHN A;  3PVL A;  3TQ7 P;  2OTL Q;  2KXD A;  1VQM T;  3G71 A;  4GLK A;  2O01 E;  1YIT T;  1N8R C;  1PRM C;  1YI2 A;  5GAO q;  1VQ4 Q;  2P84 A;  1U06 A;  4M7D B;  2EYY A;  1UB4 A;  4PJN A;  1VYT A;  4DQ2 A;  1WXB A;  3GLX A;  1RL2 A;  4M7D E;  2DA9 A;  2MMP A;  2DXT A;  1ZLM A;  4BI4 A;  1UUE A;  2OX7 A;  3I55 A;  1IRX A;  3JCM W;  1X2Q A;  1NJI R;  1OOT A;  1W6X A;  5GAN 7;  1WPY A;  2OAU A;  3KFV A;  4Z88 A;  1GBQ A;  1EX4 A;  4N4G A;  3RR6 A;  4F17 A;  2KE9 A;  2L0A A;  4J6W A;  4LNP A;  1RAB B;  4FU6 A;  1SRM A;  3MO8 A;  4CC7 A;  4DOV A;  2QG9 B;  3M54 A;  4X34 A;  2LJ3 A;  3G4S T;  4M75 C;  2LQW A;  4IKF A;  2EAY A;  2ABL A;  5LJ5 e;  2DXU A;  4C8Q B;  3HTR A;  1WXT A;  3PFS A;  4M77 D;  1YJN Q;  1VQN T;  2LVM A;  3SEM A;  5DLQ E;  5HK3 A;  2JM8 A;  3V8K A;  1R77 A;  3OYA A;  1D1B A;  1YHQ A;  1M90 C;  2FYK A;  2XMF A;  4OMP A;  2J7I A;  2FL7 A;  1U5S A;  2FZG B;  1HD3 A;  1K76 A;  4B6M A;  4M77 E;  2KXC A;  2E12 A;  3EHR A;  3X26 B;  1ZUY A;  2ZZD A;  3CCR Q;  2XG8 D;  1EZZ B;  3MEA A;  3L1A A;  4XK8 E;  2D8H A;  3GNG A;  1M2V B;  3ZEH A;  4BDZ A;  4BY6 B;  1YJW Q;  4AFQ C;  1ZUK A;  1KQ1 A;  1Q86 R;  4FT2 A;  2HQH A;  4LD6 A;  5FRM A;  3CCS Q;  4F7U B;  4BB7 A;  3CD6 A;  1NPP A;  2R58 A;  1OX8 A;  4J9I A;  4ELZ C;  3JB9 D;  3FIF A;  2LQN A;  1I4K 1;  2R5A A;  2L3S A;  4ORZ A;  1QMC A;  1OEB A;  1S1N A;  1WNL A;  2EJF A;  3EG0 A;  3U23 A;  3L2U A;  1BCM A;  2YDL A;  2PUK B;  1NYF A;  1NPR A;  2CUB A;  2QYZ A;  4A4F A;  5M9O A;  3CCS A;  1RAH B;  2M0Y A;  2QAZ A;  4R0K A;  2K3Y A;  2E5K A;  2GTO A;  4PJO D;  4J9H A;  4FYV B;  2DZC A;  2IVW A;  4PLL A;  1BI3 A;  2KDS A;  3VRY A;  5GAM h;  2DFU A;  1FYN A;  3OBY A;  3JV3 A;  1Q81 U;  2K2V A;  1GRI A;  4HKE A;  4HCB A;  4PJO E;  2DYB A;  4N0A C;  1HYO A;  2CKK A;  4XTZ A;  5D6X A;  3THK A;  4E7S A;  1FMK A;  5IHN A;  2JZ2 A;  1VQ5 T;  4CRI A;  2D8J A;  3PNW C;  3OYC A;  1K0S A;  3OYH A;  3EGX A;  4IUR A;  4BY6 C;  1GCQ A;  1VQO Q;  5GAN d;  3CCM Q;  2MAM A;  2EGE A;  1IZ6 A;  2MYS A;  2C0T A;  2HL5 C;  4RTV A;  4GY5 A;  1V76 A;  1H8K A;  1RLQ C;  1NBE B;  1QP2 A;  4JZ4 A;  2FPF A;  1BI1 A;  2RI2 A;  2QK0 A;  1VQ7 A;  2C0I A;  4BAC A;  2COW A;  1Y07 A;  3JCM d;  1PCX A;  1RAE B;  3HL8 A;  4M78 E;  2ZPI B;  3G6E Q;  1XNI A;  2FRY A;  3EG2 A;  2VXE A;  1KSW A;  3LWH A;  1CSK A;  1YBY A;  2XDD A;  3PIO A;  3VS4 A;  2FHD A;  3CCM A;  3CPF A;  3M9Q A;  4ZGD B;  2AKK A;  2KY9 A;  3OYY A;  3NTK A;  4M78 D;  2RHI A;  2IG0 A;  3CCV Q;  5GAN e;  2FVU A;  4C0G A;  3VS5 A;  4V2S A;  4B9X A;  3VS7 A;  2RHU A;  3FJ5 A;  4AFU C;  4M77 G;  4C8Q F;  1VQ4 A;  4E7I A;  5GAN 6;  3QWX X;  1BI0 A;  1BU1 A;  3PE0 A;  4XTU A;  2KGT A;  4QVD A;  3NTH A;  4KH0 B;  2JN0 A;  3JCM J;  4BDY A;  1BBZ A;  2RHY A;  4OMQ A;  3X20 B;  1GFD A;  1VQK Q;  3RDV A;  3CPW P;  4LUD A;  4OF1 A;  2RPN A;  3I35 A;  3QJY A;  4C92 A;  2A37 A;  2ESW A;  1DJ7 B;  2M0O A;  2D9T A;  3KUF A;  5GAN g;  3JB9 J;  4M4Z A;  2CP2 A;  4A4G A;  2LZ6 B;  4RTZ A;  1I07 A;  4BUG A;  1NLO C;  3OYM A;  1RAA B;  2QTX A;  4O5V A;  3RKW A;  2MIO A;  4JZ3 A;  4HA8 A;  2YUN A;  3CD6 T;  2OTJ T;  4KT0 E;  1WIE A;  2D0Q B;  3J81 E;  1I1J A;  1BKB A;  2L2P A;  1T0J A;  2DEQ A;  3FRN A;  4PFP A;  3CCV T;  3M57 A;  4M7D A;  4RUG A;  2RQT A;  2YSQ A;  2PUO B;  2QQA A;  1ZHI A;  4ZGE B;  3EFO A;  4EPC A;  3MEV A;  1UHC A;  2GQV A;  5FWB A;  2FRW A;  1VQ6 Q;  3P8H A;  3CC7 T;  1PM3 A;  4QQ6 A;  1I8F A;  1U1S A;  1QVF P;  4M7A B;  4BI3 A;  4M7D C;  4M77 A;  4AG1 C;  3SHW A;  2RB6 A;  2AKL A;  1K8A C;  3CC4 Q;  1OV3 A;  1UJY A;  2BE7 D;  4QT7 A;  1TUC A;  2DYI A;  1GCQ C;  4M75 G;  1K9A A;  3HRU A;  2JS2 A;  1MUZ A;  2EIF A;  4RCC A;  3L2R A;  4WTO B;  1K8A R;  5FW9 A;  2K5F A;  3OYK A;  2PTK A;  2V26 A;  3LX7 A;  2EQK A;  3ZL7 C;  1K1Z A;  1V1C A;  4C0Z A;  2W0Z A;  4IUT A;  4M7A G;  1ABQ A;  3C0C A;  3INZ A;  1G5V A;  3BW1 A;  2H8H A;  2KT1 A;  1KG1 A;  3LH0 A;  1M90 U;  2BE9 B;  2E5Q A;  2KYB A;  1QVG A;  5LJ5 g;  1XJW B;  3L2Z A;  2K5L A;  3RIR A;  3CC2 A;  5KYY A;  1X2K A;  2I0N A;  3I5R A;  2I2L A;  2J6O A;  4KUL A;  5FU7 B;  3MP8 A;  1M27 C;  2X4J A;  2HQE A;  3I55 T;  3L2W A;  4IUV A;  2KVQ G;  5GAN 2;  1IB8 A;  3EGX B; 
#chains in the Genus database with same CATH homology
 1OZ2 A;  4C5I A;  3CXC S;  2CS7 A;  4XTX A;  4II1 A;  5A0D A;  2MI6 A;  3N5B B;  5KH6 A;  3JSC A;  3FDR A;  2ZCF B;  3OQ5 A;  2LQK A;  2Y4X A;  2QA4 A;  4JS4 A;  4X9C A;  4RMO A;  4NS5 A;  1VQ4 T;  4PJO C;  2QQ9 A;  3FC3 A;  1FXX A;  2L8D A;  4NL3 A;  3DKM A;  1YJN T;  4HT8 A;  2CZ7 B;  2LT4 A;  3L42 A;  5CKE A;  2CYZ B;  4BD3 A;  3ER0 A;  1MHN A;  2V8K A;  1OYX A;  2X4X A;  2E64 A;  2AHJ B;  3C95 A;  5FU6 B;  4IUP A;  1VQM T;  3G71 A;  4M7D D;  1OZ3 A;  3QZ5 B;  4GLK A;  4XU1 A;  2O01 E;  1YIT T;  3JCM Q;  2XI9 A;  5CIU A;  2Y4Y A;  3CXC A;  5J26 A;  1N8R C;  3CCM T;  1YI2 A;  5GAO q;  5CQX A;  2PQW A;  3TEE A;  2MWO A;  5LJ3 d;  4JDS A;  2F5T X;  1UGS B;  2CZ6 B;  3PT9 A;  4M7D B;  4N0A A;  3CCS T;  4XAX B;  4LDY A;  1UB4 A;  1VQ9 T;  4QQG A;  3RKX A;  4DQ2 A;  3UT1 A;  4A4E A;  4XTV A;  3GLX A;  1BI2 A;  1RL2 A;  3JCM c;  2RK1 A;  2L89 A;  1Q86 C;  4M7D E;  4FSX A;  1D3B A;  4Y28 E;  2XDP A;  5FU6 C;  1NJI C;  3ZFJ A;  1Y7X A;  4J5Y A;  2MMP A;  3QBY A;  1BIB A;  2DXT A;  2ZPE B;  3V7R A;  4C8Q A;  3CBM A;  4ZTF A;  4A4K A;  4BI4 A;  4C92 G;  3FLG A;  4PLI A;  4M78 G;  3OYL A;  4L59 A;  4ATO A;  1QVG S;  3A8M B;  3I55 A;  4NOY A;  3JCM W;  3CMA T;  2BIV A;  3TCJ A;  3VUZ A;  3CC7 A;  1QW1 A;  2PU9 B;  4MDW A;  2F69 A;  3EFS A;  2YLB A;  2K5I A;  3FB9 A;  5GAN 7;  1WPY A;  5CVI A;  3OYE A;  2OAU A;  4M77 B;  2DTI A;  2GFU A;  2JVV A;  4N4G A;  3L2Q A;  5GAN 3;  2BUD A;  2DTO A;  5GAM d;  3M59 A;  3VUB A;  5LJ3 e;  2DPP B;  1YJW T;  3HFO A;  4J6W A;  5DM7 R;  2MF2 A;  1X01 A;  2CGH A;  3MO8 A;  4FU6 A;  2K4Y A;  4ZTJ A;  3FJP A;  1N9R A;  4DOV A;  5A0L A;  4JRI A;  3GIB A;  3M54 A;  4X34 A;  4ZN1 A;  4XU3 A;  3OYB A;  3CC2 T;  4C92 B;  1VQ6 A;  3CCU A;  3Q1J A;  5GAN f;  1ZQ1 A;  1Q82 C;  3G4S T;  1EIF A;  4C5G A;  4BE1 A;  1YIJ A;  2JTM A;  3BDL A;  4M75 C;  3QHS A;  4LDU A;  4OB2 B;  1TH7 A;  4IKF A;  4LD9 K;  5GMK e;  2EAY A;  5LJ5 e;  2DXU A;  4C8Q B;  3CCL A;  3CPW A;  3M58 A;  1MGQ A;  2X4Y A;  4C5H A;  5A0G A;  3CCV A;  1S72 T;  5IAY A;  1YHQ T;  2DVE A;  3PFS A;  3ZBD A;  2CZ1 B;  1P92 A;  4M77 D;  3SD4 A;  4PJO G;  2P0Q A;  1KQS S;  1VQP A;  3MHX A;  3GPL A;  2DK3 A;  2LVM A;  1VQN T;  1O75 A;  2QI2 A;  2LCC A;  5DLQ E;  5DLO A;  4OVA A;  5HK3 A;  5D6Y A;  4J6Y A;  3V8K A;  4C0D C;  3CCU T;  2OTJ A;  5KE3 A;  2QQB A;  3MEW A;  1M5Q 1;  5J3B A;  3OYA A;  2FYK A;  3HRS A;  3VYH B;  1YHQ A;  1M90 C;  2VYT A;  5HY6 A;  5CKD A;  3QXE B;  2FL7 A;  3BFM A;  1LJO A;  3OS5 A;  2WSC E;  4M77 E;  2E70 A;  5LJ3 j;  3JCM b;  2E12 A;  1K9M U;  1I81 A;  1M9S A;  3X26 B;  2ZZD A;  2QQS A;  4J6X A;  5HK0 A;  5CO7 A;  1PSE A;  2FB7 A;  3O8V A;  4MML A;  1M4Z A;  2XG8 D;  3MEA A;  4R55 A;  3QJ6 A;  3QSU A;  3L1A A;  5GAM j;  4XK8 E;  2GF7 A;  4RG2 A;  3GNG A;  3QKJ A;  3QUI A;  4F7U F;  2GCX A;  4E47 A;  1K8A U;  2LQ8 A;  1G3W A;  3V8L A;  3OS2 A;  1UEB A;  4O6J A;  2GFA A;  3ASK A;  4PJO B;  3ZEH A;  4BDZ A;  3JCM e;  4BY6 B;  3OA6 A;  3M4G A;  2EQU A;  3CME A;  1NJI U;  3OSV A;  1K73 C;  2JUF A;  3SB2 A;  5A2Q E;  4M7D F;  3S6W A;  1KQ1 A;  3CBP A;  4KBM B;  2EYQ A;  4J8O A;  2DKG A;  4FT2 A;  4LD6 A;  3V8J A;  3OY9 A;  5FRM A;  4F7U B;  3G7Z A;  4RKU E;  3G6E A;  1KD1 C;  4BB7 A;  3CCR A;  3CCJ A;  3CD6 A;  4M7A A;  1B34 A;  1NPP A;  2E6Z A;  5CCA A;  2EWN A;  2LDM A;  2M16 A;  2H3J A;  2R58 A;  5DY9 A;  5CKH A;  3L2V A;  2HNI A;  5GAO r;  4M7A E;  4N4H A;  4ELZ C;  2WSE E;  3OBW A;  3JB9 D;  3FIF A;  2RH2 A;  4C8Q D;  1I4K 1;  4PJO F;  1JRI A;  2R5A A;  5CQY A;  1WNL A;  1VQK T;  2KSS A;  2EJF A;  3VU3 C;  1KC8 C;  4M7A F;  3J7A F;  1WJR A;  3HP9 A;  2RA2 A;  5I21 A;  3CCQ A;  1XOV A;  1JB0 E;  3LGF A;  3MP1 A;  2VXF A;  3C12 A;  1M1G A;  4FT4 A;  3L2U A;  3G6E T;  4A54 A;  1W2B A;  4KUD K;  2PUK B;  3X24 B;  3WVD B;  1NPR A;  4M75 E;  4M77 F;  4C8Q G;  3CC4 T;  4A4F A;  4L5G A;  5M9O A;  3CCS A;  3JB9 G;  1JJ2 S;  2E41 A;  4M7A D;  4PJO A;  3LW5 E;  2V8J A;  2K3Y A;  2RJE A;  5LJ3 h;  3JCM g;  3CME T;  1OI1 A;  2F5K A;  5GAN h;  3H6Z A;  1M1K C;  2EFI A;  4PJO D;  2DO3 A;  2ZPF B;  2YLC A;  2DZC A;  2IVW A;  3M53 A;  4PLL A;  3UWN A;  4Z02 A;  2RJF A;  3J80 E;  3HHT B;  4E7L A;  1W2B S;  2RD1 A;  2XU8 A;  3OMC A;  4BI8 B;  1BI3 A;  2KDS A;  4F7U A;  1I5L A;  4FIB A;  4OGC A;  4EMH A;  1VQ5 A;  5GAM h;  3OBY A;  4QVZ A;  5C0M A;  3PIP A;  3JB9 I;  3UPU A;  2O4X B;  1FX7 A;  5GMK h;  1Q81 U;  5LJ5 h;  2K2V A;  1B34 B;  2X4W A;  2XKO C;  1VQK A;  4HKE A;  4HCB A;  3OYD A;  4PJO E;  3I56 A;  1N6A A;  1WJS A;  2XID A;  4FM4 B;  4N0A C;  4JUV A;  2VV5 A;  1KQ2 A;  2CKK A;  2R57 A;  4XTZ A;  2OTL A;  5D6X A;  2E6N A;  1V29 B;  1VUB A;  2KQW A;  4C0D B;  1KHC A;  3QZ9 B;  4E7K A;  2JZ2 A;  1VQ5 T;  4HT9 A;  4CRI A;  1N27 A;  1XTD A;  3PNW C;  1HXD A;  3P8B B;  3QPH A;  4LDW A;  4Q5W A;  3OYC A;  1HK9 A;  5LJ5 f;  5FRO A;  3OYH A;  4VUB A;  4IUR A;  2EKO A;  3C94 A;  4NL2 A;  1PSF A;  4BY6 C;  2ZPB B;  4B9W A;  4JJN K;  2G3R A;  1YI2 T;  3RMQ A;  2LRQ A;  5GAN d;  5FLX E;  5J39 A;  5GMK l;  3JCM P;  2MAM A;  4JLI A;  3QYG B;  1IZ6 A;  3TU4 K;  4MZM A;  3GP8 A;  4C92 C;  3RER A;  1Y96 B;  5IT9 E;  3GNF B;  2JNG A;  3M4Y A;  4GY5 A;  4M75 B;  3CCE A;  3M56 A;  3C4S A;  3OYJ A;  1Q7Y U;  3JCM h;  5I2S A;  5LJ3 g;  3WVE B;  2K57 A;  2HBP A;  4OB3 B;  1KHI A;  1QP2 A;  4HCZ A;  1BI1 A;  1YJ9 T;  4KUI A;  1QVP A;  3EFR A;  3OMG A;  3JCM f;  4MDX A;  2E65 A;  3I56 T;  2QA4 T;  4XQ3 A;  5FRN A;  2RI2 A;  5GAO l;  4M7A C;  3H8Z A;  3JB9 H;  1VQ7 A;  3PMT A;  4BAC A;  1Y07 A;  1BYM A;  2LT1 A;  2LTO A;  3JCM d;  4WF2 A;  4M7D G;  2XD0 A;  1RI0 A;  3E1S A;  5GAM g;  3HL8 A;  4J83 A;  2VUB A;  4LDV A;  4M78 E;  3S3O A;  5AYF A;  2ZPI B;  3MCA B;  1XNI A;  2QEX A;  2VXE A;  5GAN 8;  4C8Q C;  1WGS A;  3LWH A;  1D3B B;  1AHJ B;  1YBY A;  2XK0 A;  5KCH A;  2XDD A;  3PIO A;  1VIF A;  2FHD A;  3E9G A;  3CCM A;  3A5Z B;  3CPF A;  3M9Q A;  5LJ3 f;  1VQO A;  4ZGD B;  1YIT A;  3HKS A;  2EQM A;  2V8I A;  4J7F A;  2KY9 A;  3OYY A;  4FL6 A;  2WAC A;  1G3S A;  5EG2 A;  4JS5 A;  3NTK A;  4M78 D;  1UGQ B;  2PVO B;  1Y96 A;  2RHI A;  4PL6 A;  4ELY C;  1WQW A;  1KD1 U;  1XQH A;  2IG0 A;  2YRV A;  3QYH B;  2FVU A;  3MEU A;  5GAN e;  4M75 A;  1VQO T;  4IUU A;  3LWI A;  2E10 A;  4C0G A;  4V2S A;  2JOY A;  4MZP A;  4RCB A;  4B9X A;  2RHU A;  5KE2 A;  2LC4 A;  4M77 G;  4C8Q F;  4J7I A;  1VQ4 A;  3JB9 F;  4E7I A;  2KAF A;  5GAN 6;  4OB1 B;  2R5M A;  1BI0 A;  2EQJ A;  3DLM A;  2D6F A;  2P0P A;  4XTU A;  4QVD A;  5LJ5 d;  4EMK A;  3VYG A;  4M75 F;  3PTA A;  3NTH A;  3V7C A;  2DAQ A;  1R8O B;  3KBG A;  1VQP T;  3T9N A;  1U1T A;  5FU7 C;  5CAI A;  3RKY A;  2RI3 A;  2JN0 A;  3JCM J;  1SSF A;  3X28 B;  2XDB A;  2KMT A;  4BDY A;  2RHY A;  3X25 B;  3X20 B;  3CCL T;  1YJ9 A;  4OMF B;  4BE2 A;  3VJP A;  1YIJ T;  4C92 F;  3QDR B;  4XU0 A;  3KXT A;  3CCE T;  5CKF A;  2DTH A;  4TVR A;  4ZGJ B;  1N9S A;  4DOW A;  3EAE A;  3CEY A;  3GF5 A;  2X35 A;  2JTF A;  3ME9 A;  4OF1 A;  4C8Q E;  4D6W A;  2K3X A;  3JAM E;  1JJ2 A;  4XTY A;  2P4T A;  4M77 C;  2PVD B;  1S72 A;  2YHT A;  2DIG A;  2NLU A;  3A8L B;  3OW2 A;  3QJY A;  2O4X A;  2RJC A;  3NTI A;  2LCL A;  4C92 A;  3PMI A;  3E9F A;  4LDX A;  5GMK j;  1DJ7 B;  2BKD N;  2DD5 A;  4M75 D;  2M0O A;  2DZ9 A;  2D9T A;  3KUF A;  5GAN g;  1X75 C;  1W4S A;  3G71 T;  4MZT A;  2XHC A;  4EMK C;  3JB9 J;  4EMK B;  1GXI E;  4A4G A;  5GMK i;  2C06 A;  1Q82 U;  4C5E A;  1X6O A;  5D6W A;  3CMA A;  4BUG A;  4JLG A;  5GAN 5;  3PGG A;  3OYM A;  2RK2 A;  2A7Y A;  3OYI A;  2QTX A;  3A8O B;  5C6S A;  1QVF S;  3HRT A;  4O5V A;  2CZ0 B;  5GAN j;  2LNV A;  5GMK m;  2HAX A;  3VV0 A;  3RKW A;  2QDY B;  3BY7 A;  3DB3 A;  3M5A A;  1H3Z A;  4RG8 A;  5LJ5 j;  4MMK A;  2L5Q A;  3MET A;  1VQ8 T;  2HQX A;  4HA8 A;  3CCJ T;  3CD6 T;  2RO0 A;  2OTJ T;  2L3R A;  3FEO A;  3G4S A;  4IUQ A;  4N4I A;  1WJQ A;  4KT0 E;  2D0Q B;  2LX9 A;  4QQD A;  3J81 E;  1VQ7 T;  1UGP B;  3URG A;  1BKB A;  3QO3 A;  3FRN A;  2DEQ A;  3CCV T;  1ZBX A;  3M57 A;  1Q7Y C;  1G3T A;  5GAO n;  4M7D A;  4CI0 C;  2QEX T;  2PUO B;  4A4H A;  2QQA A;  1ZHI A;  4F7U E;  4ZGE B;  4R56 A;  4E7J A;  3CBO A;  4EPC A;  2XIC A;  3MEV A;  3OSS C;  4M78 C;  1QVF A;  2GQV A;  4E7H A;  3CC4 A;  2DIQ A;  4OGE A;  1VIE A;  4L6V 5;  1KC8 U;  4Y91 A;  3P8H A;  4PNO A;  3NFC A;  3OYG A;  3CC7 T;  1BIA A;  3CCQ T;  3SWN B;  1LOJ A;  1G3Y A;  3VKI A;  5KCO A;  5I2M A;  2ZPG B;  2DJZ A;  2RI5 A;  2P0K A;  4QQ6 A;  2VGM A;  2DXB A;  2VC8 A;  1I8F A;  3DB4 A;  3A8H B;  4F7U G;  1KQS A;  1U1S A;  2PVG B;  3HPW A;  4DA4 A;  4EMG A;  1K73 U;  1QP3 A;  4M7A B;  1NZ9 A;  1FWZ A;  4BI3 A;  1VQM A;  3RES A;  4M7D C;  4M77 A;  1H64 1;  1YCY A;  5GAM f;  2EJ9 A;  2E1H A;  4M78 A;  4C0F A;  3CPW S;  2ZGW A;  3LYI A;  3OW2 S;  1UGR B;  5HKC A;  2RB6 A;  3OYF A;  3JCM V;  1K8A C;  1VQN A;  4XTW A;  4JRP A;  2OTL T;  4JRQ A;  3V7S A;  3TRE A;  2Y90 A;  5GAN 4;  3OYN A;  2RM4 A;  1VQL A;  4A53 A;  1Q81 C;  3E19 A;  3LLR A;  3SWN C;  3AHU A;  3P8D A;  5CK9 A;  4M75 G;  1M1F A;  4QVC A;  1VQL T;  3HRU A;  3QG1 A;  2DXC A;  3OB9 A;  2QQR A;  1M8V A;  2EIF A;  4RCC A;  3L2R A;  3CCR T;  2K5F A;  3JRZ A;  3OYK A;  4C92 D;  3LX7 A;  1JBM A;  2EQK A;  5GAO p;  4UC4 A;  4EDU A;  3S3M A;  1M1K U;  1O9S A;  2B8A A;  4YTL A;  1VQ8 A;  1LNX A;  4C0Z A;  1VQ9 A;  3SWN A;  4BE0 A;  3LGL A;  4IUT A;  3S3N A;  4OB0 B;  4M7A G;  1WQ7 A;  3INZ A;  4XU2 A;  2M9U A;  3JCM X;  1G5V A;  4PKC C;  3BW1 A;  2EJG A;  2VGN A;  3UDC A;  1YJW A;  3QII A;  5GAM e;  1KG1 A;  3RMS A;  3F70 A;  3LH0 A;  2MWP A;  3OS0 A;  1M90 U;  5LL6 S;  2E5Q A;  4ZN3 A;  2RHZ A;  3BDU A;  4X9D A;  3DLL A;  5LJ5 g;  1QVG A;  2QXF A;  3L2Z A;  4QW2 A;  3HSB A;  2RJD A;  2K5L A;  4M78 B;  3RIR A;  4C92 E;  1U8R A;  5GAO m;  3GOX A;  3CC2 A;  5L8R E;  1VQ6 T;  3R6O A;  4ME7 A;  4P5N A;  1NE8 A;  4JRK A;  3SFM A;  1N8R U;  4HCC A;  2HD0 A;  3M55 A;  2I2L A;  2A3L A;  2ZPH B;  4OP0 A;  3RUX A;  4KUL A;  5FU7 B;  5IN1 A;  3MP8 A;  2X4J A;  2RHX A;  1Y71 A;  2HQE A;  3I55 T;  3WXM B;  3OS1 A;  1YJN A;  1IRE B;  5CR2 A;  2WSF E;  5CKB A;  1Q86 U;  2DD4 A;  3HFN A;  3L2W A;  1K9M C;  4M78 F;  4IUV A;  2KVQ G;  3MP6 A;  3A8G B;  5GAN 2;  2M1H A;  2KK4 A;  3SDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...