3KXTA

Crystal structure of sulfolobus cren7-dsdna complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kxtA00
4R55A 3KXTA 3LWIA 3LWHA 2JTMA 4R56A
chains in the Genus database with same CATH superfamily
4BI3A 1Q7YR 5KYXA 1GXIE 1ZSZC 1QVFP 1VQMQ 3V8KA 2L5QA 1YJ9T 1XTDA 1IHVA 2D0NA 3SFMA 3MP8A 2WACA 3M56A 2KDSA 1RAEB 4PJOF 3OYNA 3OYHA 2KQWA 2EAYA 2DILA 4RTYA 2EQUA 2NUTA 5GJVB 3OW2P 1NLPC 2OAWA 1NJIR 5A0LA 1S1NA 2HD0A 5CIUA 2YRVA 3A8HB 3CCLT 2DTHA 1WNLA 1WX6A 4J9BA 3NHNA 3OYYA 3OS2A 1Q81U 3L2WA 3M0TA 3A8LB 2KK4A 1OOTA 5I2MA 2BZYA 1SHGA 3NTHA 1H3HA 2LCCA 1X6OA 2EYZA 2Y90A 3GLXA 3TVTA 3A8MB 1PHTA 4HCZA 3V7RA 3OMCA 3EFRA 1KFZA 2QAZA 1N27A 1YITQ 4E47A 1UFFA 2HAXA 2YUOA 3ZFJA 1KJWA 2X4JA 2LT1A 1KD1C 1C0MA 4C92A 3CCJQ 3QYGB 4A4GA 4XU0A 3TU4K 3JRZA 2KT1A 5GAMd 3DB3A 3TSWA 1WJRA 2HZYA 1QW1A 2BZ8A 1VQKQ 4A63B 3I35A 3I9QA 3E9FA 2XG8D 4RTWA 1SRLA 3CD6A 4M7DC 2YXYA 1UGQB 5CKBA 3IQLA 1QWFA 4PJMA 4GLKA 1U3OA 1U06A 3OYKA 3M0RA 1OZ2A 3JB9I 1F1BB 2K79A 1YI2Q 3PNWC 5FU6B 1W70A 2PTKA 3EHQA 4M78G 1YIJQ 2JMCA 3OYAA 4C8QA 4XTXA 2M0YA 2MPXC 3I5SA 1AEYA 1O9SA 2D1XA 2PZ1A 2QTVA 2AHJB 3FRNA 2O4XB 4C0DB 2R5MA 4WCIA 4PK4A 5GMKl 5DLOA 3VYGA 4XTVA 4GLMA 3QPHA 4LDWA 4RUGA 4EMKA 2PVOB 2JUFA 1HD3A 3EFOA 2CUBA 5A2QE 1Y0MA 3HRTA 4FW2A 4DBFA 4RKUE 2WSEE 2LJ0A 1D1CA 2YLCA 1VUBA 2YUNA 1YHQA 4NL2A 1WXTA 3X26B 4A53A 1JJ2A 4XTZA 2ED0A 1RLPC 4PJNA 1SF9A 2CP0A 3X28B 1V76A 1XQHA 1KHCA 3G71A 1H8KA 2PVGB 1W6XA 2GFUA 2M0OA 3OW2A 4KH0B 3PFSA 4L59A 3PVLA 3CXCA 4XAXB 3H6ZA 4X1VA 4F04B 2DL3A 1G3SA 1Y07A 3VS6A 1SSHA 3MKDA 1VA7A 2E64A 3NPFA 1JEGA 2LMJA 3CCQA 1X43A 4JRIA 1RAHB 5CVIA 2L3SA 1MMDA 3GBQA 4M77B 1PWTA 4FCYA 3OYEA 1OYXA 4J9EA 3RMSA 3CD6T 2E5QA 2HBPA 1PCXA 3REAB 1AVZC 3I55Q 3CMAQ 5D6XA 3META 3VS3A 2RQRA 1KC8C 2QGFB 2EVRA 2K5FA 3A5ZB 1D0XA 3H41A 4JUVA 4XU2A 7AT1B 4EPCA 3QZ5B 1BIAA 1TH7A 1ZSZA 2BE7D 4DEXA 3CC2Q 4Z8AA 2LQWA 5GAN5 2LC4A 1VQLA 1JRIA 1N9RA 2KNBB 1WI7A 3O5ZA 1LCKA 3ER0A 3EAEA 3GOXA 1TXQA 2XK0A 3VUBA 5CKDA 5KYWA 3JSCA 3VKIA 4FYYB 2DXCA 3SWNC 2ZPBB 3CCST 3C12A 1TUGB 5GAOm 1Q81R 4RMOA 2EQMA 1QVGP 4OMNA 4E7ZA 2IG0A 5GANd 4MMKA 4DOVA 4KRTA 2J7IA 3OMGA 1GCPA 1V29B 4M77F 2F5KA 1K9MC 3QWYA 4IUTA 3G6EA 1UHFA 3G71T 1YFNA 2COWA 3CQTA 2CP5A 3ASKA 5KYYA 3R6OA 1KQSS 1VQPQ 1T0HA 1U5SA 3EGDB 2DBMA 1B3QA 3T9NA 1IB8A 2O01E 2KY9A 2X9HA 3CCQT 2MF2A 1U1SA 2FVUA 4HVUA 1Y96B 3CBPA 4C0ZA 5D6YA 2QQRA 4M75D 2FEIA 3RR6A 3G4SA 4BY6B 2P0KA 4OB3B 2EGEA 2VWFA 4F7UG 3GF5A 1Y7XA 2Y4XA 4A4HA 3RNJA 2IIMA 1LPLA 3MHXA 1UGPB 2HL3A 1WHLA 1I07A 2RM4A 3UA7A 3QHSA 3RMQA 5KYNA 1V1CA 4J9CA 1Q82U 2CP7A 3JCMd 3Q1JA 1WYXA 4N4GA 3CCET 3OYLA 4M78C 3L2RA 1AOJA 1M5Q1 1YJWA 3C0CA 3LH5A 2KYBA 4M7DA 2H8HA 2E1HA 2GFAA 2CZ7B 1IRXA 4DQ2A 2KXDA 4RG2A 3JCMP 2X4WA 4BUGA 3HSBA 4AT1B 4QKUA 1Q7YC 2RK2A 2E70A 1Q95G 4HVVA 2JW4A 4FW1A 2BZXA 2KRSA 2K3YA 4B9WA 2DX1A 1WPYA 1ABOA 4J9GA 1J3TA 3WXMB 3JB9D 2ZPFB 2JXBA 4ZGEB 2MCNA 3OYJA 4M7AE 3CBMA 1GL5A 2D8HA 3I5RA 5LJ3d 1JB0E 1M2VA 2ZPHB 4XU3A 3OYMA 2QQSA 3QDRB 3EGXA 2DTIA 1N6AA 1NJIC 1H641 4AFUC 4LDYA 2JNGA 3MP6A 1MMAA 1NPRA 2FPDA 2JTFA 2D6FA 2QEXQ 1X6BA 2L89A 1H92A 1OV3A 1K8AU 2ZPIB 3J80E 2JJ9A 5GJWB 2EQJA 1K0SA 1VQNQ 3CC4Q 2RK1A 3EH1A 2OTLQ 1WHHA 1M8MA 1TU0B 2EGAA 4PJOE 2E12A 3GIBA 2CP3A 3MEUA 1X75C 4E7IA 4B6MA 5IHNA 2E3IA 1UE9A 2P4RA 3C95A 4O5VA 4EMGA 2D8JA 3FIFA 4M4ZA 5CKFA 3HL8A 4ELZC 1Z9QA 1R8OB 5CO7A 1YJWT 3HPWA 1VQ8T 1PSFA 5I22A 4M75A 3M57A 2HSEB 5DM7R 3UWNA 3M55A 3M53A 2RD1A 4DEYA 2V1RA 2ABLA 3DB4A 2KXCA 3E9GA 2VGNA 2L3RA 4B9XA 5CCAA 2V26A 2DZ9A 4AG2C 4BI4A 2KAFA 3C94A 5GAMg 4ZNXA 1TS9A 1G2BA 1TUDA 2EQKA 1JQQA 5GAOr 5KE2A 2B86A 5FU7C 3QUIA 2AIRB 4CC7A 3P8HA 2AKLA 1YITA 1R0CB 4FYVB 4II1A 5L23A 4LN2A 4M7AB 2OI3A 1B34B 1YJ9A 3AHUA 4MZPA 2KRNA 1QCFA 4EMKC 1KSWA 2HEQA 1Y57A 3SWNA 3LGFA 1BI1A 1OPLA 1TUCA 4MZMA 2EJFA 3REBB 5A0DA 2RQUA 2HKNA 1VQKA 1ZA2B 1VQMT 1H3ZA 2EPDA 2DO3A 3CCLA 2E65A 4QQGA 1BYMA 3OYDA 3OW2S 2GBQA 3GNFB 4R0KA 3EG1A 2DD4A 1WIEA 1VQ9Q 2L8DA 3VS2A 2QG9B 4PJOB 2AZVA 2M16A 1YI2A 1YN8A 2DAQA 6AT1B 1QCOA 1MMNA 2CYZB 1WLPB 5HY6A 2QA4Q 2K3XA 2V8IA 2EWNA 2QDYB 5GMKm 1XOVA 5M9OA 1FWZA 4J9DA 3OYBA 3HRUA 4DA4A 1Q82R 2HNIA 1PD0A 2JS2A 3CCMQ 4M7AF 3X24B 1I81A 4Z02A 2HBWA 2G3RA 4RCBA 3UPUA 1K73U 2ESWA 1LNXA 4OMOA 2DZCA 2VVKA 3X25B 2PNIA 3THKA 2A28A 2RO0A 4F17A 2JMAA 1AWWA 2MAMA 4M75G 4M78A 4WF2A 3FLGA 5GAMf 1YITT 2ROTA 3CC7Q 2XIDA 2DM1A 2X4YA 1BU1A 3S3OA 4OB1B 4IIOA 2G6FX 3S6WA 2PUOB 5FWCA 4ORZA 2LCSA 2DEUA 3CCJT 1QQJA 2C0IA 4C92E 1P92A 4QW2A 4JS5A 1JJ2P 2Z0WA 2CSIA 1NG2A 5KYXB 3QWXX 4J6XA 2WSFE 2JVVA 3BW1A 3PMIA 1VQKT 4MDWA 3HP9A 4Z89A 4OMPA 5GAMh 4FYXB 4NS5A 1I4K1 1OQKA 1R0BG 3OA6A 3CXCP 5IHKA 2F5TX 3L2UA 1SHFA 1AD5A 2PUKB 2VB6A 3RIRA 5FRNA 1ZX6A 3FDRA 3WVDB 3I55A 2DK3A 3CPWP 1QMCA 5GAOp 1K8AR 4GY5A 4ZN3A 1Q81C 1YI2T 3JB9G 2RJCA 2NUTB 1VIEA 1YIJT 3E19A 1MUZA 2LP5A 4R55A 4DOWA 1K1ZA 3KUFA 3M4GA 4C8QE 2V1QA 2DIQA 4EDUA 1VYVA 3RKXA 2DETA 3M4YA 3INZA 1RAAB 2RHUA 2ZPGB 4JRQA 5GAMj 2ATCB 2HL5C 4KGZB 1MV0B 2KGTA 2K57A 4ZGDB 4CRIA 2DL8A 1HJDA 4X9DA 1VQ6Q 4F16A 2C0OA 4QT7A 5GAOn 3LLRA 1GFDA 1N5ZA 3DLMA 3OS1A 2HMAA 1M1KU 4N4IA 1GRIA 2DJQA 2NUPB 3HTRA 3JCMV 3BFMA 3QSUA 4PLIA 4LE9A 4O6JA 4JS4A 2HDAA 4C5GA 1X2KA 4KULA 2EBPA 2OTJQ 4C92B 4M77E 1QLYA 1VQPA 2XMFA 1MMGA 2YT6A 1W1FA 4LUEA 1LJOA 2W0ZA 2XD0A 1U1TA 3MCAB 2XDBA 4FT2A 2FRYA 1PM3A 2KEAA 1M1GA 2J05A 4FM4B 2I0NA 5FWBA 5GAMe 4PL6A 3I55T 1VQOQ 5KCHA 4RCCA 1OU8A 1PRLC 2DJZA 4OB2B 4IURA 3SEMA 2ECZA 1UG1A 4LDVA 3CCRQ 1NE8A 1M4ZA 2RHXA 4K11A 1RAGB 2FPEA 4C8QB 3O8VA 3CCSA 1U8RA 2E6ZA 4DBRA 1BKBA 1C1AA 2X4XA 3VS1A 3CC2T 1K76A 3EG9A 2C06A 3UDCA 3M0SA 2P4TA 1UHCA 3M0UA 4A54A 3TCJA 1Z9ZA 1QVGS 3M9QA 2O31A 4YTLA 9ATCB 2DERA 2VXFA 2EJ9A 4C92F 3LWIA 3EFOB 2DRMA 2PQWA 3L1AA 3G7ZA 2AKKA 3KBGA 4ZTFA 2L3PA 4A4FA 5CKHA 1X6GA 3CMEA 4F7UA 1K73R 3EFSA 5IXFA 1NM7A 3QIIA 2RQWA 2M9UA 3OSVA 3PTAA 3CPWA 3KFVA 4RTVA 2O2OA 2YUQA 4RTZA 4N0AA 1YBYA 3MO8A 3A8OB 4ZGJB 1HXDA 3FB9A 4M75C 3QJYA 1VQPT 3H9NA 1PG5B 2LX9A 1M3BA 1MHNA 2KR3A 4CC2A 4C5EA 1W2BA 4KT0E 4Y91A 5LL6S 2A08A 4PNOA 4C8QF 4JJDA 2MK5A 1YNZA 3RDVA 3BY7A 1S72Q 2QEXA 4MDXA 5HK3A 1TG0A 3CCEA 2RJEA 4F14A 3PIPA 5FW9A 5FLXE 3AT1B 1WHJA 1VQNA 5GANj 3CC4A 4J6YA 5HCKA 1B07A 4A4KA 3GPLA 1ZUUA 2OJ2A 2JZ2A 2BKDN 1ZSZB 3UA6A 2F2WA 1AT1B 1G3YA 5GAN4 1UDLA 2VASA 1VQ5Q 1E7OA 3OQ5A 3S3MA 5KYWB 5I21A 1K9AA 3VU3C 4M7DE 2KVQG 1VQ7Q 2KI7A 2DYIA 2QGGA 2VXEA 4XQ3A 5CK9A 2XDDA 1I8FA 1KQ2A 2DXUA 2RA2A 1AZEA 4NOYA 4RG8A 4DBHA 3CMET 4IUVA 4HT8A 4KGXB 4BB7A 5IHIA 1OU9A 5FRMA 2QQAA 2VKNA 3PE0A 3V8LA 2RHYA 1M2OA 1Y96A 4QVDA 4IKFA 1MGQA 3SD4A 1M1KR 1R77A 5GANe 5KYYB 2K4YA 2L2PA 4LD9K 1KG1A 3PT9A 3CCUQ 1KHIA 4EMHA 2VUBA 1C6VX 4PFOA 2CREA 1WHKA 3VS7A 1OX9A 2GTOA 2FZKB 5KH6A 2LQ8A 2QEXT 1FMWA 2CP6A 3M0PA 5EC7A 1Q82C 3H0HA 3QKJA 3M0QA 4JRPA 4J9FA 1VYUA 1VQNT 3ME9A 1ZHIA 3OBYA 3CC4T 1VQ9A 2F69A 1VQ8A 1M30A 2RQTA 2BIVA 4E7SA 2IPOB 4AG1C 4M7AD 3LH0A 4KH1B 1NEGA 3X20B 3CBOA 5KYUB 2O9SA 3OYGA 4Q5WA 3HKSA 3UF4A 1TOVA 1WGSA 2J6FA 2CH4A 3L42A 1VOMA 2QA4A 2SRCA 2EYXA 4HCBA 1YHQQ 5LJ3j 4CC3A 2LCLA 1G83A 5CKEA 1D09B 4QQDA 4M7DB 4OMFB 1TWBA 3EHRA 4HCCA 1EZZB 1D0ZA 3JCMe 3G71Q 2KBTA 4RTUA 4CI0C 3QG1A 1M1FA 3PMTA 4AFZC 5L8RE 3GNGA 1OX8A 4PJOD 3FC3A 2DVJA 2RB6A 3VRZA 2EGCA 2RJFA 5GMKi 5GAN3 3CCQQ 2NWMA 2QYZA 2F1LA 1ZLMA 2CZ6B 2E3HA 2MOXA 2LZ6B 4BE2A 1OZ3A 1VQMA 2AT1B 4RTXA 5DLQE 1VYTA 1FYNA 2EYYA 1K8AC 2FRWA 2H3JA 2FHDA 2BTTA 2B8AA 4JRKA 5KCOA 1ZA1B 1M2VB 2J06A 3BDUA 4ZTJA 4QVCA 1M90U 2GQIA 1GBQA 4JLGA 4KGVB 4BI8B 2IVWA 3TQ7P 2GNCA 1SPKA 4ELYC 1E6GA 1TTHB 3JCMc 1EIFA 5LJ3e 1WXUA 2YRCA 2NYSA 1VQLQ 3H0FA 2GGRA 1GFCA 1WHMA 4C0FA 1BI0A 2PVDB 2L0AA 4M7DF 1VQ9T 3NGPA 2FZCB 1IZ6A 4EIKA 1AZGB 2FO0A 3R6NA 4Y28E 5IT9E 4J7FA 3OY9A 1CSKA 1WQWA 1ZBXA 2RI5A 5J39A 2DRKA 2RQVA 1WXBA 2K2MA 5FU6C 1D3BA 2KMTA 2QA4T 1OEBA 2I2LA 2DIGA 1QP2A 2ZGWA 3LW5E 2EKOA 2CP2A 2A37A 2JM8A 3QBYA 1X01A 2COZA 1LVKA 3I56Q 3G6EQ 3CCMT 4OMMA 2XI9A 1B34A 3FJPA 8AT1B 4C0DC 5HKCA 1E6HA 2M51A 1VQ6A 1JXMA 1RAIB 3QXEB 1RI9A 2W10A 2C0TA 3CCJA 2CZ0B 1I1JA 3V8JA 1BI2A 2YUPA 2LRQA 5DY9A 5GAN6 2ENMA 2CZ1B 1NPPA 4PLLA 5I2SA 1I5LA 1JJ2S 4Z88A 2EYWA 3NTIA 1WDXA 2Y4YA 3HRSA 4M78E 4J6WA 3CC7T 1JO8A 2XU8A 1M9SA 1YCYA 2QDLA 2GCXA 4OF1A 3G4SQ 2OTJA 2X3WD 3SWNB 3CXCS 4PJOA 1QCNA 1O75A 5D7UA 1YIJA 3CPWS 4E7JA 5I11A 3JCMW 4DBQA 1I0CA 2KYMA 3LX7A 4M75F 5LJ5d 4E7LA 4FU6A 2RN8A 1QP3A 1VQOA 4JDSA 4N0AC 4FYWB 2PU9B 3RUXA 4C92D 3EG2A 3CCRA 1ABQA 3BDLA 4J9HA 1IXDA 1KQSA 1FMKA 3JB9H 2RJDA 1K73C 2RPNA 2ROLA 1ZQ1A 1BI3A 1UGSB 3J7AF 2QXFA 5IN1A 3JAME 4BE0A 3SB2A 3MJXA 3OS5A 4P5NA 2DFUA 1NYGA 1ZUKA 2JTEA 4BE1A 1YJNQ 1RUWA 2QQ9A 4E2FB 2P0QA 1VQ6T 1PD1A 3VRYA 2K6DA 4JPBW 4IUUA 2DBKA 4LNPA 1A0NB 2K5IA 3HFOA 2EQIA 2VGMA 3JB9F 2DF6A 4OGEA 1QKXA 4C8QD 1FMVA 4M78B 2K9GA 3E2UA 3ZL7C 3TSZA 3OYFA 2MWPA 4TVRA 4M7AG 2LVMA 1UECA 1WJQA 5CAIA 2BUDA 1GBRA 4OVAA 2OTJT 1B7TA 4JJCA 4KUIA 5AYFA 1M27C 1PKTA 2J6KA 1T0JA 3RESA 1M8VA 2YSQA 3CMAA 5IAYA 2DL4A 2F2XA 3NFCA 1M90R 4JZ4A 1SKUB 4UC4A 1NZ9A 1S72A 5ECAA 5J3BA 5GANg 1W2BP 1PKSA 3LWHA 8ATCB 3CC2A 2RF0A 1VQ4Q 2LT4A 2FL7A 1VQOT 3JV3A 5GMKh 3CCVQ 4PJOG 4D8KA 2DMOA 3FJ5A 3NTKA 5IH2A 4M77D 2ZCFB 3CCRT 4BY6C 2LX7A 2LJ1A 3P8DA 5GAN8 2O9VA 1G3TA 2MI6A 5GAOq 2NUPA 1VQ5A 4M78F 4D6WA 1M1KC 2CT4A 2GF7A 2R58A 1SG5A 4LXCA 3ZBDA 4A4EA 4D8DA 1YJ9Q 4BDYA 1PC0A 1KD1U 1VQ7A 2DNUA 2QQBA 3JCMX 2XHCA 5GMKj 3URGA 2JTMA 2DXTA 1WJSA 4XTWA 2JN0A 2QTXA 2DKGA 4F7UE 1OPKA 1QWEA 5FROA 1CKBA 2ED1A 4ANJA 3JCMg 5KE3A 2COYA 3UT1A 3KXTA 1IGQA 3SDZA 3CCLQ 1XJWB 4QVZA 1RI0A 1WA7A 2A0FB 3JCMQ 5AT1B 3VS0A 2XDPA 1QVPA 3MPUB 1KIKA 3ZEHA 2O4XA 3CCUA 4IUPA 3RKWA 1RADB 1T3LA 4LD6A 2LNHB 2LQNA 3C4SA 3CMAT 2DL5A 1T3SA 2DEQA 3OS0A 1Q86U 2JS0A 1UJ0A 1Q86C 4J5YA 1X69A 2LTOA 3MEWA 1UEBA 1S72T 1HSQA 2X3XD 1UUEA 5FU7B 2ZZDA 4L6V5 4J83A 3PGGA 2HCKA 2XKOC 3DLLA 3H0IA 2CKKA 4CC4B 2O88A 5GANf 4J9IA 1AWOA 1UJYA 4EMKB 1W4SA 2OX7A 5GMKe 3HFNA 1QVFA 1YP5A 5LJ3g 1CKAA 2BE9B 1D1BA 1NYFA 3EG9B 1RABB 1N9SA 1YWPA 1VQ5T 5GANh 1IO6A 1KQ1A 2MIOA 1NLOC 3F70A 2EYQA 3UATA 1VQ7T 4M77A 3A98A 2HQEA 2V8JA 4BACA 2DE0X 1EFNA 4J7IA 1UB4A 4AFSC 4F7UB 1IHWA 1MNEA 4XTUA 3TREA 1AWJA 3QDFA 4PJLA 3VS4A 1BIBA 3MEAA 1N8RU 4C92G 1N8RC 2QK0A 2RHZA 5EG2A 4M7DD 3CCUT 3TEEA 1ZSGA 3JCMf 4M7AC 2MYSA 3D7SB 1KC8U 2RMOA 3L2QA 3LYIA 2OTLA 1RLQC 2KSSA 4L5GA 2CS7A 2KE9A 2HQHA 4MMLA 2K3BA 2NLUA 2YLBA 4N4HA 2A36A 2A7YA 4KBMB 2V8KA 3OSSC 1ZBJA 4JJNK 3ULRB 1GCQC 4XTYA 3QZ9B 2EIFA 2VC8A 5C6SA 1YWOA 3JCMh 2WSCE 1UGRB 3FEOA 1FX7A 4IIMA 2F2VA 4VUBA 4OMLA 3U23A 2QASA 2R5AA 2H3EB 4C8QG 4PJOC 4FSSA 2DXBA 2E5KA 2R57A 2FPFA 4F7UF 1M3CA 4LDUA 1FXXA 1WFWA 3EGDA 1YHQT 2DVEA 4IUQA 2DLPA 5LJ3f 2M1HA 1K9MU 3SHWA 4FL6A 4ME7A 3I56A 1G8XA 3V7SA 2LQKA 2CGHA 2RH2A 4FSXA 3CD6Q 2CSQA 4C5IA 2AZSA 5IXBA 3GP8A 5CQXA 1JBMA 2CUDA 1AHJB 3DKMA 2CT3A 1KD1R 4FIBA 5HK0A 1ARKA 4PKCC 2P84A 2K2VA 5LJ3h 2X51A 1NEBA 5C0MA 1IGUA 1OULA 1PRMC 1RACB 4JLIA 2HSPA 3P8BB 3PIOA 1SEMA 4BD3A 3M58A 4M77G 4E7KA 3S3NA 3N5BB 5LJ5g 3EH2A 4LDXA 3VS5A 1JU5C 3JB9J 4V2SA 1SSFA 1G3WA 3QYHB 1DJ7B 1ZUYA 1ACMB 2OTLT 4OGCA 5KYUA 3CCSQ 2DPPB 3JCMJ 1WZOA 2LJ3A 1VQLT 4ZN1A 2HQXA 1KK7A 5J26A 1Q86R 4Y92A 3OYIA 4JZ3A 3L2VA 3RBBB 4OB0B 4HKEA 1HYOA 2EFIA 4M75E 2D9TA 3CCMA 4AMCA 4HT9A 1Q7YU 4E7HA 2D0QB 1BBZA 2CH4W 4PFPA 3OBWA 3QJ6A 1BB9A 3CMEQ 1LOJA 4BDZA 2GTJA 3J81E 3MEVA 2JM9A 3M54A 5CR2A 1BCOA 3M59A 4KUDK 1G5VA 1KQSP 1X2QA 3I56T 3G6ET 2YDLA 2FYKA 3CC7A 1YJNA 2ZAEA 1SRMA 1NBEB 4FT4A 2AK5A 1WQ7A 1NJIU 3RERA 1M90C 4ATOA 4HVWA 2E4HA 2FZGB 2QI2A 3EGXB 2DD5A 2J6OA 2K5LA 1XNIA 3QO3A 2KROA 4X34A 2OAUA 1BK2A 2CDTA 1WHGA 2KRMA 2JT4A 2VYTA 2E41A 1PNJA 3VV0A 2NUZA 3CCEQ 4HA8A 2A3LA 3VYHB 3G4ST 3OB9A 2KT8A 4HCKA 3V7CA 1VIFA 2RHIA 5CQYA 1QVGA 5GAN7 3A1PA 2LNVA 1N8RR 4C0GA 4C92C 5LJ5f 3NMZC 4OMQA 2DYBA 1BCMA 4C5HA 4X9CA 1KC8R 1RL2A 3EGUA 4LUDA 3M5AA 3G1JA 2YWWA 5GAOl 2EJGA 4M78D 1VQ4A 4M75B 3CCVA 1K4US 5LJ5h 1JXOA 1YCSB 4M7AA 4XU1A 1D0YA 4ESRA 2VV5A 1Y71A 1D3BB 2YRDA 3EG3A 1AWXA 3VUZA 3MP1A 3EG0A 4C8QC 2E10A 1I5OB 1X27A 3CEYA 4M7DG 1GCQA 1TSFA 1YJNT 2X35A 5D6WA 2DL7A 2MWOA 2SEMA 1QVFS 4QQ6A 1K9MR 1K0XA 2EW3A 4XK8E 4NL3A 2E6NA 1IREB 1OI1A 1D1AA 4JJBA 4HXJA 5LJ5j 2M02A 2GQVA 2MMPA 2JOYA 4MZTA 4RTTA 3H8ZA 3CPFA 3BE3A 1QKWA 3JCMb 3L2ZA 1UTIA 4PJJA 2XICA 1MNDA 2LDMA 3A8GB 3WVEB 1HK9A 4J8OA 5A0GA 1PSEA 1YJWQ 3RKYA 4OP0A 3OYCA 1VQ8Q 2RI3A 4M77C 1W2BS 4AFQC 1UGVA 1MV3A 4WTOB 2FB7A 2EKHA 2RNAA 3HHTB 3LGLA 1RAFB 2HKQB 5GAN2 4PFZA 2L3QA 1M3AA 2YHTA 3E1SA 1VQ4T 2FG0A 2P0PA 3CCVT 2RI2A 4E6RA 3VJPA 1EX4A 2DTOA 2K7AA 2ZPEB 2DA9A 5LJ5e 3PVQA 4GBQA 4R56A
chains in the Genus database with same CATH topology
4E7IA 4HT8A 1Q86C 4BI3A 4J5YA 2LTOA 3MEWA 1UEBA 1S72T 1GXIE 3C95A 4BB7A 5FRMA 4O5VA 4EMGA 2QQAA 3FIFA 5FU7B 3V8LA 5CKFA 2ZZDA 4L6V5 3HL8A 2RHYA 4ELZC 1Y96A 4J83A 1R8OB 2L5QA 3V8KA 3PGGA 4QVDA 5CO7A 2XKOC 3DLLA 1YJWT 4IKFA 2CKKA 1YJ9T 3HPWA 1XTDA 1MGQA 1PSFA 3SD4A 1VQ8T 4M75A 3M57A 5GANe 3SFMA 3MP8A 5DM7R 2WACA 3UWNA 3M55A 3M56A 3M53A 2K4YA 2RD1A 5GANf 4LD9K 1KG1A 2KDSA 3PT9A 4PJOF 3DB4A 4EMKB 3OYNA 1KHIA 3OYHA 3E9GA 1W4SA 2KQWA 2VGNA 4EMHA 2L3RA 2EAYA 4B9XA 5GMKe 3HFNA 5CCAA 2VUBA 2DZ9A 1QVFA 4BI4A 5LJ3g 2KAFA 3C94A 2EQUA 5GAMg 1N9SA 2EQKA 5KH6A 5A0LA 5GAOr 1VQ5T 2HD0A 2LQ8A 5CIUA 2QEXT 2YRVA 3A8HB 3CCLT 2DTHA 1Q82C 1WNLA 5KE2A 5GANh 5FU7C 3QUIA 1KQ1A 3QKJA 3P8HA 1YITA 4II1A 4JRPA 1VQNT 3F70A 2EYQA 1VQ7T 3ME9A 1ZHIA 3OBYA 4M77A 4M7AB 3CC4T 1VQ9A 1B34B 2F69A 1YJ9A 1VQ8A 3AHUA 3OYYA 2HQEA 2BIVA 3OS2A 2V8JA 1Q81U 4BACA 4M7AD 3L2WA 4J7IA 3A8LB 4MZPA 3LH0A 2KK4A 1UB4A 5I2MA 4EMKC 3X20B 3CBOA 3OYGA 3SWNA 4V2SA 3NTHA 3LGFA 4Q5WA 1BI1A 4F7UB 3HKSA 2LCCA 1X6OA 2Y90A 3GLXA 1WGSA 4MZMA 4XTUA 2EJFA 3A8MB 3TREA 5A0DA 3L42A 1VQKA 2QA4A 4HCZA 1VQMT 3V7RA 3OMCA 1H3ZA 4HCBA 5LJ3j 2DO3A 3EFRA 2LCLA 1BIBA 3MEAA 1N8RU 2E65A 4QQGA 5CKEA 4C92G 4QQDA 1N8RC 3OYDA 4OMFB 3OW2S 4M7DB 2RHZA 5EG2A 1N27A 3GNFB 4HCCA 4E47A 2HAXA 3JCMe 4M7DD 3CCUT 3TEEA 4CI0C 2DD4A 3QG1A 1M1FA 2L8DA 3JCMf 3ZFJA 4M7AC 3PMTA 5L8RE 3GNGA 2X4JA 2LT1A 1KC8U 1KD1C 4PJOB 4C92A 3L2QA 1BYMA 3LYIA 3QYGB 2OTLA 4PJOD 2M16A 1YI2A 4A4GA 4XU0A 2KSSA 3TU4K 4L5GA 3FC3A 3JRZA 2CS7A 2DAQA 5GAMd 4MMLA 2NLUA 2YLBA 3DB3A 4N4HA 2RB6A 2CYZB 1WJRA 2A7YA 2RJFA 4KBMB 1QW1A 5HY6A 5GMKi 5GAN3 2V8KA 3OSSC 4JJNK 2CZ6B 2K3XA 2EWNA 2V8IA 4XTYA 2QDYB 3QZ9B 2EIFA 1OZ3A 2VC8A 5GMKm 1XOVA 4BE2A 5C6SA 5M9OA 1FWZA 1VQMA 3JCMh 3E9FA 5DLQE 2XG8D 2WSCE 3OYBA 3HRUA 4DA4A 1UGRB 1K8AC 3FEOA 2HNIA 3CD6A 2H3JA 1FX7A 4M7DC 1UGQB 2FHDA 5CKBA 4M7AF 2B8AA 4GLKA 4JRKA 3X24B 5KCOA 1I81A 4Z02A 3BDUA 4VUBA 3OYKA 2G3RA 4RCBA 4QVCA 4ZTJA 1M90U 3UPUA 1K73U 1OZ2A 2R5AA 4C8QG 3JB9I 4PJOC 1LNXA 2DXBA 2R57A 4JLGA 4BI8B 2DZCA 3PNWC 2IVWA 5FU6B 3X25B 4M78G 4F7UF 4ELYC 2RO0A 4LDUA 1FXXA 3OYAA 3JCMc 4C8QA 1EIFA 1YHQT 4XTXA 5LJ3e 2DVEA 4IUQA 2MAMA 4M75G 5LJ3f 2M1HA 1O9SA 4M78A 4WF2A 1K9MU 3FLGA 3CCLA 4C0FA 1BI0A 4FL6A 5GAMf 1YITT 2AHJB 3FRNA 2PVDB 4ME7A 2XIDA 3V7SA 3I56A 2O4XB 2LQKA 2X4YA 2CGHA 1VQ9T 4M7DF 4C0DB 2R5MA 2RH2A 4FSXA 4OB1B 3S3OA 3S6WA 5GMKl 5DLOA 1IZ6A 2PUOB 3VYGA 4C5IA 4XTVA 3QPHA 3CCJT 4LDWA 5CQXA 4EMKA 1JBMA 1P92A 4C92E 3GP8A 2PVOB 2JUFA 4QW2A 4Y28E 4JS5A 5IT9E 4J7FA 3OY9A 1AHJB 1WQWA 1ZBXA 3DKMA 2RI5A 5J39A 5A2QE 4FIBA 5HK0A 4J6XA 2WSFE 2JVVA 4PKCC 3HRTA 2K2VA 5LJ3h 5FU6C 3BW1A 1D3BA 3PMIA 5C0MA 2KMTA 1VQKT 4MDWA 2QA4T 3HP9A 2I2LA 5GAMh 4NS5A 4JLIA 1I4K1 2DIGA 3OA6A 1QP2A 3P8BB 4RKUE 2ZGWA 3PIOA 2WSEE 3LW5E 4BD3A 2EKOA 2YLCA 3M58A 4M77G 1VUBA 4E7KA 2F5TX 4NL2A 3L2UA 3S3NA 1YHQA 3N5BB 3X26B 3QBYA 1X01A 4A53A 5LJ5g 2PUKB 4XTZA 1JJ2A 4LDXA 3CCMT 3X28B 3RIRA 5FRNA 2XI9A 1XQHA 1B34A 1KHCA 3FDRA 3WVDB 1SSFA 1G3WA 2DK3A 1DJ7B 3FJPA 3QYHB 4C0DC 2PVGB 5GAOp 5HKCA 4GY5A 2GFUA 2M0OA 4ZN3A 3OW2A 1Q81C 2OTLT 1VQ6A 1YI2T 3PFSA 4L59A 3JB9G 2RJCA 3QXEB 4OGCA 3CCJA 1VIEA 2CZ0B 1YIJT 3E19A 3CXCA 4XAXB 3V8JA 4R55A 1BI2A 4DOWA 3H6ZA 2DPPB 3KUFA 3JCMJ 2LRQA 1G3SA 1Y07A 5DY9A 3M4GA 5GAN6 2CZ1B 1NPPA 2E64A 4C8QE 4PLLA 5I2SA 1VQLT 2DIQA 4EDUA 4ZN1A 3CCQA 4JRIA 2HQXA 5CVIA 1I5LA 3RKXA 5J26A 1JJ2S 3NTIA 4M78E 2Y4YA 3HRSA 3M4YA 4J6WA 3CC7T 3INZA 3OYIA 2XU8A 2RHUA 4M77B 3L2VA 2ZPGB 1M9SA 1YCYA 4JRQA 3OYEA 1OYXA 3RMSA 4OB0B 3CD6T 4HKEA 2GCXA 2E5QA 2EFIA 5GAMj 4OF1A 2OTJA 2HBPA 4M75E 2D9TA 2K57A 4ZGDB 3CCMA 3JB9J 4CRIA 4HT9A 1Q7YU 5D6XA 3SWNB 3CXCS 4PJOA 3META 4E7HA 2D0QB 1O75A 4X9DA 3OBWA 3QJ6A 1KC8C 2K5FA 3A5ZB 4JUVA 5GAOn 3LLRA 4XU2A 1LOJA 4BDZA 3DLMA 4EPCA 3OS1A 3J81E 3MEVA 1YIJA 3CPWS 3QZ5B 1BIAA 3M54A 5CR2A 1M1KU 3M59A 4N4IA 1TH7A 4KUDK 4E7JA 3JCMW 1G5VA 5GAN5 3JCMV 2LC4A 3BFMA 1VQLA 3QSUA 3LX7A 1JRIA 4PLIA 1N9RA 4M75F 3I56T 3G6ET 5LJ5d 3ER0A 4E7LA 3EAEA 2FYKA 4O6JA 3CC7A 4FU6A 1YJNA 3GOXA 4JS4A 2XK0A 3VUBA 1QP3A 4C5GA 1VQOA 4JDSA 4N0AC 5CKDA 4KULA 3JSCA 4C92B 3VKIA 2PU9B 4M77E 1VQPA 4FT4A 3RUXA 4C92D 3CCRA 1WQ7A 1LJOA 2XD0A 2DXCA 1U1TA 1NJIU 3BDLA 3MCAB 3SWNC 2ZPBB 3CCST 1M90C 1KQSA 3C12A 2XDBA 2QI2A 3RERA 4ATOA 2DD5A 3JB9H 2RJDA 2K5LA 5GAOm 1K73C 1XNIA 3QO3A 4FT2A 4X34A 4RMOA 2EQMA 2OAUA 1M1GA 1ZQ1A 2IG0A 5GANd 4MMKA 1BI3A 1UGSB 4FM4B 3J7AF 2VYTA 2E41A 3VV0A 4DOVA 2QXFA 5IN1A 4HA8A 3JAME 3OMGA 2A3LA 4BE0A 3SB2A 1V29B 3OS5A 4P5NA 3VYHB 4PL6A 5GAMe 3G4ST 3OB9A 4M77F 2F5KA 1K9MC 3V7CA 4IUTA 4BE1A 3G6EA 3I55T 3G71T 1VIFA 5KCHA 4RCCA 2RHIA 2QQ9A 3ASKA 5CQYA 1QVGA 3R6OA 5GAN7 1KQSS 2DJZA 2LNVA 4OB2B 4IURA 4C0GA 2P0QA 4C92C 1VQ6T 4LDVA 5LJ5f 1NE8A 1M4ZA 2RHXA 4IUUA 4C5HA 4X9CA 2K5IA 3HFOA 3O8VA 2VGMA 4C8QB 3CCSA 3JB9F 4OGEA 1U8RA 1RL2A 2E6ZA 1BKBA 3T9NA 4C8QD 2X4XA 2O01E 3CC2T 2KY9A 4M78B 3M5AA 3CCQT 2C06A 2MF2A 3UDCA 1U1SA 5GAOl 2FVUA 2P4TA 3OYFA 2EJGA 2MWPA 1Y96B 4M78D 3CBPA 4A54A 4TVRA 4C0ZA 4M7AG 3TCJA 1VQ4A 2LVMA 5CAIA 1WJQA 4M75B 1QVGS 2BUDA 3M9QA 5D6YA 3CCVA 4OVAA 2OTJT 2QQRA 4YTLA 5LJ5h 4M75D 4KUIA 5AYFA 3G4SA 4BY6B 2VXFA 2P0KA 2EJ9A 4OB3B 4C92F 3LWIA 4M7AA 4XU1A 2PQWA 3L1AA 3RESA 3G7ZA 1M8VA 3KBGA 3GF5A 1Y7XA 4F7UG 2Y4XA 3CMAA 4A4HA 4ZTFA 5IAYA 2VV5A 1Y71A 3MHXA 4A4FA 1UGPB 5CKHA 1D3BB 2RM4A 3CMEA 3NFCA 3VUZA 3MP1A 3QHSA 3RMQA 4UC4A 4F7UA 4C8QC 1NZ9A 2E10A 3EFSA 3CEYA 1Q82U 3JCMd 3Q1JA 1S72A 4N4GA 3CCET 5J3BA 5GANg 3OYLA 4M7DG 3QIIA 4M78C 2M9UA 3LWHA 3CC2A 3OSVA 3L2RA 3PTAA 3CPWA 1M5Q1 1YJNT 1YJWA 2X35A 5D6WA 2LT4A 2FL7A 4N0AA 1YBYA 1VQOT 5GMKh 3MO8A 3A8OB 4ZGJB 1HXDA 3FB9A 4M75C 4PJOG 4M7DA 2MWOA 3NTKA 3QJYA 1QVFS 4QQ6A 1VQPT 4M77D 2E1HA 2GFAA 2ZCFB 2CZ7B 2LX9A 4DQ2A 3CCRT 4RG2A 4XK8E 4BY6C 1MHNA 2E6NA 4NL3A 1IREB 4C5EA 2X4WA 4BUGA 3JCMP 3P8DA 1W2BA 4KT0E 4Y91A 1OI1A 3HSBA 5LL6S 1Q7YC 2RK2A 2E70A 5LJ5j 2GQVA 2MMPA 2JOYA 4MZTA 3H8ZA 2K3YA 3CPFA 5GAN8 4PNOA 4B9WA 1WPYA 4C8QF 3JCMb 3L2ZA 1G3TA 3WXMB 3JB9D 2MI6A 5GAOq 2XICA 2LDMA 3BY7A 2ZPFB 1VQ5A 4M78F 4D6WA 2QEXA 4MDXA 1M1KC 3A8GB 2GF7A 5HK3A 2R58A 3WVEB 1HK9A 3CCEA 2RJEA 4J8OA 5A0GA 1PSEA 3ZBDA 3PIPA 4A4EA 5FLXE 3RKYA 4OP0A 3OYCA 4BDYA 4ZGEB 1KD1U 1VQ7A 2RI3A 1VQNA 5GANj 3CC4A 4M77C 1W2BS 4J6YA 3OYJA 2QQBA 3JCMX 3CBMA 4M7AE 5LJ3d 2FB7A 2XHCA 1JB0E 3HHTB 4A4KA 2ZPHB 4XU3A 5GMKj 3OYMA 3URGA 2QQSA 3GPLA 3LGLA 3QDRB 2JTMA 2JZ2A 2DTIA 1N6AA 1WJSA 2DXTA 1NJIC 2BKDN 5GAN2 3G71A 1H641 4XTWA 2JN0A 4LDYA 2QTXA 2DKGA 2JNGA 4F7UE 5FROA 1G3YA 3MP6A 1NPRA 5GAN4 2YHTA 2JTFA 3JCMg 5KE3A 3E1SA 3UT1A 2L89A 3KXTA 3SDZA 1VQ4T 2D6FA 3OQ5A 3S3MA 1K8AU 4QVZA 1RI0A 2ZPIB 3J80E 2P0PA 3I55A 3CCVT 2RI2A 3JCMQ 2EQJA 5I21A 3VJPA 2XDPA 1QVPA 3VU3C 4M7DE 2KVQG 3ZEHA 2DTOA 2O4XA 2VXEA 4IUPA 4XQ3A 5CK9A 3RKWA 2ZPEB 2XDDA 3CCUA 4LD6A 3C4SA 1I8FA 3CMAT 1KQ2A 2DXUA 2RK1A 5LJ5e 2DEQA 2RA2A 3OS0A 2E12A 4NOYA 4RG8A 3GIBA 4PJOE 3MEUA 3CMET 4R56A 1X75C 4IUVA 1Q86U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R55 A;  3KXT A;  3LWI A;  3LWH A;  2JTM A;  4R56 A; 
#chains in the Genus database with same CATH topology
 4BI3 A;  1Q7Y R;  5KYX A;  1GXI E;  1ZSZ C;  1QVF P;  1VQM Q;  3V8K A;  2L5Q A;  1YJ9 T;  1XTD A;  1IHV A;  2D0N A;  3SFM A;  3MP8 A;  2WAC A;  3M56 A;  2KDS A;  1RAE B;  4PJO F;  3OYN A;  3OYH A;  2KQW A;  2EAY A;  2DIL A;  4RTY A;  2EQU A;  2NUT A;  5GJV B;  3OW2 P;  1NLP C;  2OAW A;  1NJI R;  5A0L A;  1S1N A;  2HD0 A;  5CIU A;  2YRV A;  3A8H B;  3CCL T;  2DTH A;  1WNL A;  1WX6 A;  4J9B A;  3NHN A;  3OYY A;  3OS2 A;  1Q81 U;  3L2W A;  3M0T A;  3A8L B;  2KK4 A;  1OOT A;  5I2M A;  2BZY A;  1SHG A;  3NTH A;  1H3H A;  2LCC A;  1X6O A;  2EYZ A;  2Y90 A;  3GLX A;  3TVT A;  3A8M B;  1PHT A;  4HCZ A;  3V7R A;  3OMC A;  3EFR A;  1KFZ A;  2QAZ A;  1N27 A;  1YIT Q;  4E47 A;  1UFF A;  2HAX A;  2YUO A;  3ZFJ A;  1KJW A;  2X4J A;  2LT1 A;  1KD1 C;  1C0M A;  4C92 A;  3CCJ Q;  3QYG B;  4A4G A;  4XU0 A;  3TU4 K;  3JRZ A;  2KT1 A;  5GAM d;  3DB3 A;  3TSW A;  1WJR A;  2HZY A;  1QW1 A;  2BZ8 A;  1VQK Q;  4A63 B;  3I35 A;  3I9Q A;  3E9F A;  2XG8 D;  4RTW A;  1SRL A;  3CD6 A;  4M7D C;  2YXY A;  1UGQ B;  5CKB A;  3IQL A;  1QWF A;  4PJM A;  4GLK A;  1U3O A;  1U06 A;  3OYK A;  3M0R A;  1OZ2 A;  3JB9 I;  1F1B B;  2K79 A;  1YI2 Q;  3PNW C;  5FU6 B;  1W70 A;  2PTK A;  3EHQ A;  4M78 G;  1YIJ Q;  2JMC A;  3OYA A;  4C8Q A;  4XTX A;  2M0Y A;  2MPX C;  3I5S A;  1AEY A;  1O9S A;  2D1X A;  2PZ1 A;  2QTV A;  2AHJ B;  3FRN A;  2O4X B;  4C0D B;  2R5M A;  4WCI A;  4PK4 A;  5GMK l;  5DLO A;  3VYG A;  4XTV A;  4GLM A;  3QPH A;  4LDW A;  4RUG A;  4EMK A;  2PVO B;  2JUF A;  1HD3 A;  3EFO A;  2CUB A;  5A2Q E;  1Y0M A;  3HRT A;  4FW2 A;  4DBF A;  4RKU E;  2WSE E;  2LJ0 A;  1D1C A;  2YLC A;  1VUB A;  2YUN A;  1YHQ A;  4NL2 A;  1WXT A;  3X26 B;  4A53 A;  1JJ2 A;  4XTZ A;  2ED0 A;  1RLP C;  4PJN A;  1SF9 A;  2CP0 A;  3X28 B;  1V76 A;  1XQH A;  1KHC A;  3G71 A;  1H8K A;  2PVG B;  1W6X A;  2GFU A;  2M0O A;  3OW2 A;  4KH0 B;  3PFS A;  4L59 A;  3PVL A;  3CXC A;  4XAX B;  3H6Z A;  4X1V A;  4F04 B;  2DL3 A;  1G3S A;  1Y07 A;  3VS6 A;  1SSH A;  3MKD A;  1VA7 A;  2E64 A;  3NPF A;  1JEG A;  2LMJ A;  3CCQ A;  1X43 A;  4JRI A;  1RAH B;  5CVI A;  2L3S A;  1MMD A;  3GBQ A;  4M77 B;  1PWT A;  4FCY A;  3OYE A;  1OYX A;  4J9E A;  3RMS A;  3CD6 T;  2E5Q A;  2HBP A;  1PCX A;  3REA B;  1AVZ C;  3I55 Q;  3CMA Q;  5D6X A;  3MET A;  3VS3 A;  2RQR A;  1KC8 C;  2QGF B;  2EVR A;  2K5F A;  3A5Z B;  1D0X A;  3H41 A;  4JUV A;  4XU2 A;  7AT1 B;  4EPC A;  3QZ5 B;  1BIA A;  1TH7 A;  1ZSZ A;  2BE7 D;  4DEX A;  3CC2 Q;  4Z8A A;  2LQW A;  5GAN 5;  2LC4 A;  1VQL A;  1JRI A;  1N9R A;  2KNB B;  1WI7 A;  3O5Z A;  1LCK A;  3ER0 A;  3EAE A;  3GOX A;  1TXQ A;  2XK0 A;  3VUB A;  5CKD A;  5KYW A;  3JSC A;  3VKI A;  4FYY B;  2DXC A;  3SWN C;  2ZPB B;  3CCS T;  3C12 A;  1TUG B;  5GAO m;  1Q81 R;  4RMO A;  2EQM A;  1QVG P;  4OMN A;  4E7Z A;  2IG0 A;  5GAN d;  4MMK A;  4DOV A;  4KRT A;  2J7I A;  3OMG A;  1GCP A;  1V29 B;  4M77 F;  2F5K A;  1K9M C;  3QWY A;  4IUT A;  3G6E A;  1UHF A;  3G71 T;  1YFN A;  2COW A;  3CQT A;  2CP5 A;  3ASK A;  5KYY A;  3R6O A;  1KQS S;  1VQP Q;  1T0H A;  1U5S A;  3EGD B;  2DBM A;  1B3Q A;  3T9N A;  1IB8 A;  2O01 E;  2KY9 A;  2X9H A;  3CCQ T;  2MF2 A;  1U1S A;  2FVU A;  4HVU A;  1Y96 B;  3CBP A;  4C0Z A;  5D6Y A;  2QQR A;  4M75 D;  2FEI A;  3RR6 A;  3G4S A;  4BY6 B;  2P0K A;  4OB3 B;  2EGE A;  2VWF A;  4F7U G;  3GF5 A;  1Y7X A;  2Y4X A;  4A4H A;  3RNJ A;  2IIM A;  1LPL A;  3MHX A;  1UGP B;  2HL3 A;  1WHL A;  1I07 A;  2RM4 A;  3UA7 A;  3QHS A;  3RMQ A;  5KYN A;  1V1C A;  4J9C A;  1Q82 U;  2CP7 A;  3JCM d;  3Q1J A;  1WYX A;  4N4G A;  3CCE T;  3OYL A;  4M78 C;  3L2R A;  1AOJ A;  1M5Q 1;  1YJW A;  3C0C A;  3LH5 A;  2KYB A;  4M7D A;  2H8H A;  2E1H A;  2GFA A;  2CZ7 B;  1IRX A;  4DQ2 A;  2KXD A;  4RG2 A;  3JCM P;  2X4W A;  4BUG A;  3HSB A;  4AT1 B;  4QKU A;  1Q7Y C;  2RK2 A;  2E70 A;  1Q95 G;  4HVV A;  2JW4 A;  4FW1 A;  2BZX A;  2KRS A;  2K3Y A;  4B9W A;  2DX1 A;  1WPY A;  1ABO A;  4J9G A;  1J3T A;  3WXM B;  3JB9 D;  2ZPF B;  2JXB A;  4ZGE B;  2MCN A;  3OYJ A;  4M7A E;  3CBM A;  1GL5 A;  2D8H A;  3I5R A;  5LJ3 d;  1JB0 E;  1M2V A;  2ZPH B;  4XU3 A;  3OYM A;  2QQS A;  3QDR B;  3EGX A;  2DTI A;  1N6A A;  1NJI C;  1H64 1;  4AFU C;  4LDY A;  2JNG A;  3MP6 A;  1MMA A;  1NPR A;  2FPD A;  2JTF A;  2D6F A;  2QEX Q;  1X6B A;  2L89 A;  1H92 A;  1OV3 A;  1K8A U;  2ZPI B;  3J80 E;  2JJ9 A;  5GJW B;  2EQJ A;  1K0S A;  1VQN Q;  3CC4 Q;  2RK1 A;  3EH1 A;  2OTL Q;  1WHH A;  1M8M A;  1TU0 B;  2EGA A;  4PJO E;  2E12 A;  3GIB A;  2CP3 A;  3MEU A;  1X75 C;  4E7I A;  4B6M A;  5IHN A;  2E3I A;  1UE9 A;  2P4R A;  3C95 A;  4O5V A;  4EMG A;  2D8J A;  3FIF A;  4M4Z A;  5CKF A;  3HL8 A;  4ELZ C;  1Z9Q A;  1R8O B;  5CO7 A;  1YJW T;  3HPW A;  1VQ8 T;  1PSF A;  5I22 A;  4M75 A;  3M57 A;  2HSE B;  5DM7 R;  3UWN A;  3M55 A;  3M53 A;  2RD1 A;  4DEY A;  2V1R A;  2ABL A;  3DB4 A;  2KXC A;  3E9G A;  2VGN A;  2L3R A;  4B9X A;  5CCA A;  2V26 A;  2DZ9 A;  4AG2 C;  4BI4 A;  2KAF A;  3C94 A;  5GAM g;  4ZNX A;  1TS9 A;  1G2B A;  1TUD A;  2EQK A;  1JQQ A;  5GAO r;  5KE2 A;  2B86 A;  5FU7 C;  3QUI A;  2AIR B;  4CC7 A;  3P8H A;  2AKL A;  1YIT A;  1R0C B;  4FYV B;  4II1 A;  5L23 A;  4LN2 A;  4M7A B;  2OI3 A;  1B34 B;  1YJ9 A;  3AHU A;  4MZP A;  2KRN A;  1QCF A;  4EMK C;  1KSW A;  2HEQ A;  1Y57 A;  3SWN A;  3LGF A;  1BI1 A;  1OPL A;  1TUC A;  4MZM A;  2EJF A;  3REB B;  5A0D A;  2RQU A;  2HKN A;  1VQK A;  1ZA2 B;  1VQM T;  1H3Z A;  2EPD A;  2DO3 A;  3CCL A;  2E65 A;  4QQG A;  1BYM A;  3OYD A;  3OW2 S;  2GBQ A;  3GNF B;  4R0K A;  3EG1 A;  2DD4 A;  1WIE A;  1VQ9 Q;  2L8D A;  3VS2 A;  2QG9 B;  4PJO B;  2AZV A;  2M16 A;  1YI2 A;  1YN8 A;  2DAQ A;  6AT1 B;  1QCO A;  1MMN A;  2CYZ B;  1WLP B;  5HY6 A;  2QA4 Q;  2K3X A;  2V8I A;  2EWN A;  2QDY B;  5GMK m;  1XOV A;  5M9O A;  1FWZ A;  4J9D A;  3OYB A;  3HRU A;  4DA4 A;  1Q82 R;  2HNI A;  1PD0 A;  2JS2 A;  3CCM Q;  4M7A F;  3X24 B;  1I81 A;  4Z02 A;  2HBW A;  2G3R A;  4RCB A;  3UPU A;  1K73 U;  2ESW A;  1LNX A;  4OMO A;  2DZC A;  2VVK A;  3X25 B;  2PNI A;  3THK A;  2A28 A;  2RO0 A;  4F17 A;  2JMA A;  1AWW A;  2MAM A;  4M75 G;  4M78 A;  4WF2 A;  3FLG A;  5GAM f;  1YIT T;  2ROT A;  3CC7 Q;  2XID A;  2DM1 A;  2X4Y A;  1BU1 A;  3S3O A;  4OB1 B;  4IIO A;  2G6F X;  3S6W A;  2PUO B;  5FWC A;  4ORZ A;  2LCS A;  2DEU A;  3CCJ T;  1QQJ A;  2C0I A;  4C92 E;  1P92 A;  4QW2 A;  4JS5 A;  1JJ2 P;  2Z0W A;  2CSI A;  1NG2 A;  5KYX B;  3QWX X;  4J6X A;  2WSF E;  2JVV A;  3BW1 A;  3PMI A;  1VQK T;  4MDW A;  3HP9 A;  4Z89 A;  4OMP A;  5GAM h;  4FYX B;  4NS5 A;  1I4K 1;  1OQK A;  1R0B G;  3OA6 A;  3CXC P;  5IHK A;  2F5T X;  3L2U A;  1SHF A;  1AD5 A;  2PUK B;  2VB6 A;  3RIR A;  5FRN A;  1ZX6 A;  3FDR A;  3WVD B;  3I55 A;  2DK3 A;  3CPW P;  1QMC A;  5GAO p;  1K8A R;  4GY5 A;  4ZN3 A;  1Q81 C;  1YI2 T;  3JB9 G;  2RJC A;  2NUT B;  1VIE A;  1YIJ T;  3E19 A;  1MUZ A;  2LP5 A;  4R55 A;  4DOW A;  1K1Z A;  3KUF A;  3M4G A;  4C8Q E;  2V1Q A;  2DIQ A;  4EDU A;  1VYV A;  3RKX A;  2DET A;  3M4Y A;  3INZ A;  1RAA B;  2RHU A;  2ZPG B;  4JRQ A;  5GAM j;  2ATC B;  2HL5 C;  4KGZ B;  1MV0 B;  2KGT A;  2K57 A;  4ZGD B;  4CRI A;  2DL8 A;  1HJD A;  4X9D A;  1VQ6 Q;  4F16 A;  2C0O A;  4QT7 A;  5GAO n;  3LLR A;  1GFD A;  1N5Z A;  3DLM A;  3OS1 A;  2HMA A;  1M1K U;  4N4I A;  1GRI A;  2DJQ A;  2NUP B;  3HTR A;  3JCM V;  3BFM A;  3QSU A;  4PLI A;  4LE9 A;  4O6J A;  4JS4 A;  2HDA A;  4C5G A;  1X2K A;  4KUL A;  2EBP A;  2OTJ Q;  4C92 B;  4M77 E;  1QLY A;  1VQP A;  2XMF A;  1MMG A;  2YT6 A;  1W1F A;  4LUE A;  1LJO A;  2W0Z A;  2XD0 A;  1U1T A;  3MCA B;  2XDB A;  4FT2 A;  2FRY A;  1PM3 A;  2KEA A;  1M1G A;  2J05 A;  4FM4 B;  2I0N A;  5FWB A;  5GAM e;  4PL6 A;  3I55 T;  1VQO Q;  5KCH A;  4RCC A;  1OU8 A;  1PRL C;  2DJZ A;  4OB2 B;  4IUR A;  3SEM A;  2ECZ A;  1UG1 A;  4LDV A;  3CCR Q;  1NE8 A;  1M4Z A;  2RHX A;  4K11 A;  1RAG B;  2FPE A;  4C8Q B;  3O8V A;  3CCS A;  1U8R A;  2E6Z A;  4DBR A;  1BKB A;  1C1A A;  2X4X A;  3VS1 A;  3CC2 T;  1K76 A;  3EG9 A;  2C06 A;  3UDC A;  3M0S A;  2P4T A;  1UHC A;  3M0U A;  4A54 A;  3TCJ A;  1Z9Z A;  1QVG S;  3M9Q A;  2O31 A;  4YTL A;  9ATC B;  2DER A;  2VXF A;  2EJ9 A;  4C92 F;  3LWI A;  3EFO B;  2DRM A;  2PQW A;  3L1A A;  3G7Z A;  2AKK A;  3KBG A;  4ZTF A;  2L3P A;  4A4F A;  5CKH A;  1X6G A;  3CME A;  4F7U A;  1K73 R;  3EFS A;  5IXF A;  1NM7 A;  3QII A;  2RQW A;  2M9U A;  3OSV A;  3PTA A;  3CPW A;  3KFV A;  4RTV A;  2O2O A;  2YUQ A;  4RTZ A;  4N0A A;  1YBY A;  3MO8 A;  3A8O B;  4ZGJ B;  1HXD A;  3FB9 A;  4M75 C;  3QJY A;  1VQP T;  3H9N A;  1PG5 B;  2LX9 A;  1M3B A;  1MHN A;  2KR3 A;  4CC2 A;  4C5E A;  1W2B A;  4KT0 E;  4Y91 A;  5LL6 S;  2A08 A;  4PNO A;  4C8Q F;  4JJD A;  2MK5 A;  1YNZ A;  3RDV A;  3BY7 A;  1S72 Q;  2QEX A;  4MDX A;  5HK3 A;  1TG0 A;  3CCE A;  2RJE A;  4F14 A;  3PIP A;  5FW9 A;  5FLX E;  3AT1 B;  1WHJ A;  1VQN A;  5GAN j;  3CC4 A;  4J6Y A;  5HCK A;  1B07 A;  4A4K A;  3GPL A;  1ZUU A;  2OJ2 A;  2JZ2 A;  2BKD N;  1ZSZ B;  3UA6 A;  2F2W A;  1AT1 B;  1G3Y A;  5GAN 4;  1UDL A;  2VAS A;  1VQ5 Q;  1E7O A;  3OQ5 A;  3S3M A;  5KYW B;  5I21 A;  1K9A A;  3VU3 C;  4M7D E;  2KVQ G;  1VQ7 Q;  2KI7 A;  2DYI A;  2QGG A;  2VXE A;  4XQ3 A;  5CK9 A;  2XDD A;  1I8F A;  1KQ2 A;  2DXU A;  2RA2 A;  1AZE A;  4NOY A;  4RG8 A;  4DBH A;  3CME T;  4IUV A;  4HT8 A;  4KGX B;  4BB7 A;  5IHI A;  1OU9 A;  5FRM A;  2QQA A;  2VKN A;  3PE0 A;  3V8L A;  2RHY A;  1M2O A;  1Y96 A;  4QVD A;  4IKF A;  1MGQ A;  3SD4 A;  1M1K R;  1R77 A;  5GAN e;  5KYY B;  2K4Y A;  2L2P A;  4LD9 K;  1KG1 A;  3PT9 A;  3CCU Q;  1KHI A;  4EMH A;  2VUB A;  1C6V X;  4PFO A;  2CRE A;  1WHK A;  3VS7 A;  1OX9 A;  2GTO A;  2FZK B;  5KH6 A;  2LQ8 A;  2QEX T;  1FMW A;  2CP6 A;  3M0P A;  5EC7 A;  1Q82 C;  3H0H A;  3QKJ A;  3M0Q A;  4JRP A;  4J9F A;  1VYU A;  1VQN T;  3ME9 A;  1ZHI A;  3OBY A;  3CC4 T;  1VQ9 A;  2F69 A;  1VQ8 A;  1M30 A;  2RQT A;  2BIV A;  4E7S A;  2IPO B;  4AG1 C;  4M7A D;  3LH0 A;  4KH1 B;  1NEG A;  3X20 B;  3CBO A;  5KYU B;  2O9S A;  3OYG A;  4Q5W A;  3HKS A;  3UF4 A;  1TOV A;  1WGS A;  2J6F A;  2CH4 A;  3L42 A;  1VOM A;  2QA4 A;  2SRC A;  2EYX A;  4HCB A;  1YHQ Q;  5LJ3 j;  4CC3 A;  2LCL A;  1G83 A;  5CKE A;  1D09 B;  4QQD A;  4M7D B;  4OMF B;  1TWB A;  3EHR A;  4HCC A;  1EZZ B;  1D0Z A;  3JCM e;  3G71 Q;  2KBT A;  4RTU A;  4CI0 C;  3QG1 A;  1M1F A;  3PMT A;  4AFZ C;  5L8R E;  3GNG A;  1OX8 A;  4PJO D;  3FC3 A;  2DVJ A;  2RB6 A;  3VRZ A;  2EGC A;  2RJF A;  5GMK i;  5GAN 3;  3CCQ Q;  2NWM A;  2QYZ A;  2F1L A;  1ZLM A;  2CZ6 B;  2E3H A;  2MOX A;  2LZ6 B;  4BE2 A;  1OZ3 A;  1VQM A;  2AT1 B;  4RTX A;  5DLQ E;  1VYT A;  1FYN A;  2EYY A;  1K8A C;  2FRW A;  2H3J A;  2FHD A;  2BTT A;  2B8A A;  4JRK A;  5KCO A;  1ZA1 B;  1M2V B;  2J06 A;  3BDU A;  4ZTJ A;  4QVC A;  1M90 U;  2GQI A;  1GBQ A;  4JLG A;  4KGV B;  4BI8 B;  2IVW A;  3TQ7 P;  2GNC A;  1SPK A;  4ELY C;  1E6G A;  1TTH B;  3JCM c;  1EIF A;  5LJ3 e;  1WXU A;  2YRC A;  2NYS A;  1VQL Q;  3H0F A;  2GGR A;  1GFC A;  1WHM A;  4C0F A;  1BI0 A;  2PVD B;  2L0A A;  4M7D F;  1VQ9 T;  3NGP A;  2FZC B;  1IZ6 A;  4EIK A;  1AZG B;  2FO0 A;  3R6N A;  4Y28 E;  5IT9 E;  4J7F A;  3OY9 A;  1CSK A;  1WQW A;  1ZBX A;  2RI5 A;  5J39 A;  2DRK A;  2RQV A;  1WXB A;  2K2M A;  5FU6 C;  1D3B A;  2KMT A;  2QA4 T;  1OEB A;  2I2L A;  2DIG A;  1QP2 A;  2ZGW A;  3LW5 E;  2EKO A;  2CP2 A;  2A37 A;  2JM8 A;  3QBY A;  1X01 A;  2COZ A;  1LVK A;  3I56 Q;  3G6E Q;  3CCM T;  4OMM A;  2XI9 A;  1B34 A;  3FJP A;  8AT1 B;  4C0D C;  5HKC A;  1E6H A;  2M51 A;  1VQ6 A;  1JXM A;  1RAI B;  3QXE B;  1RI9 A;  2W10 A;  2C0T A;  3CCJ A;  2CZ0 B;  1I1J A;  3V8J A;  1BI2 A;  2YUP A;  2LRQ A;  5DY9 A;  5GAN 6;  2ENM A;  2CZ1 B;  1NPP A;  4PLL A;  5I2S A;  1I5L A;  1JJ2 S;  4Z88 A;  2EYW A;  3NTI A;  1WDX A;  2Y4Y A;  3HRS A;  4M78 E;  4J6W A;  3CC7 T;  1JO8 A;  2XU8 A;  1M9S A;  1YCY A;  2QDL A;  2GCX A;  4OF1 A;  3G4S Q;  2OTJ A;  2X3W D;  3SWN B;  3CXC S;  4PJO A;  1QCN A;  1O75 A;  5D7U A;  1YIJ A;  3CPW S;  4E7J A;  5I11 A;  3JCM W;  4DBQ A;  1I0C A;  2KYM A;  3LX7 A;  4M75 F;  5LJ5 d;  4E7L A;  4FU6 A;  2RN8 A;  1QP3 A;  1VQO A;  4JDS A;  4N0A C;  4FYW B;  2PU9 B;  3RUX A;  4C92 D;  3EG2 A;  3CCR A;  1ABQ A;  3BDL A;  4J9H A;  1IXD A;  1KQS A;  1FMK A;  3JB9 H;  2RJD A;  1K73 C;  2RPN A;  2ROL A;  1ZQ1 A;  1BI3 A;  1UGS B;  3J7A F;  2QXF A;  5IN1 A;  3JAM E;  4BE0 A;  3SB2 A;  3MJX A;  3OS5 A;  4P5N A;  2DFU A;  1NYG A;  1ZUK A;  2JTE A;  4BE1 A;  1YJN Q;  1RUW A;  2QQ9 A;  4E2F B;  2P0Q A;  1VQ6 T;  1PD1 A;  3VRY A;  2K6D A;  4JPB W;  4IUU A;  2DBK A;  4LNP A;  1A0N B;  2K5I A;  3HFO A;  2EQI A;  2VGM A;  3JB9 F;  2DF6 A;  4OGE A;  1QKX A;  4C8Q D;  1FMV A;  4M78 B;  2K9G A;  3E2U A;  3ZL7 C;  3TSZ A;  3OYF A;  2MWP A;  4TVR A;  4M7A G;  2LVM A;  1UEC A;  1WJQ A;  5CAI A;  2BUD A;  1GBR A;  4OVA A;  2OTJ T;  1B7T A;  4JJC A;  4KUI A;  5AYF A;  1M27 C;  1PKT A;  2J6K A;  1T0J A;  3RES A;  1M8V A;  2YSQ A;  3CMA A;  5IAY A;  2DL4 A;  2F2X A;  3NFC A;  1M90 R;  4JZ4 A;  1SKU B;  4UC4 A;  1NZ9 A;  1S72 A;  5ECA A;  5J3B A;  5GAN g;  1W2B P;  1PKS A;  3LWH A;  8ATC B;  3CC2 A;  2RF0 A;  1VQ4 Q;  2LT4 A;  2FL7 A;  1VQO T;  3JV3 A;  5GMK h;  3CCV Q;  4PJO G;  4D8K A;  2DMO A;  3FJ5 A;  3NTK A;  5IH2 A;  4M77 D;  2ZCF B;  3CCR T;  4BY6 C;  2LX7 A;  2LJ1 A;  3P8D A;  5GAN 8;  2O9V A;  1G3T A;  2MI6 A;  5GAO q;  2NUP A;  1VQ5 A;  4M78 F;  4D6W A;  1M1K C;  2CT4 A;  2GF7 A;  2R58 A;  1SG5 A;  4LXC A;  3ZBD A;  4A4E A;  4D8D A;  1YJ9 Q;  4BDY A;  1PC0 A;  1KD1 U;  1VQ7 A;  2DNU A;  2QQB A;  3JCM X;  2XHC A;  5GMK j;  3URG A;  2JTM A;  2DXT A;  1WJS A;  4XTW A;  2JN0 A;  2QTX A;  2DKG A;  4F7U E;  1OPK A;  1QWE A;  5FRO A;  1CKB A;  2ED1 A;  4ANJ A;  3JCM g;  5KE3 A;  2COY A;  3UT1 A;  3KXT A;  1IGQ A;  3SDZ A;  3CCL Q;  1XJW B;  4QVZ A;  1RI0 A;  1WA7 A;  2A0F B;  3JCM Q;  5AT1 B;  3VS0 A;  2XDP A;  1QVP A;  3MPU B;  1KIK A;  3ZEH A;  2O4X A;  3CCU A;  4IUP A;  3RKW A;  1RAD B;  1T3L A;  4LD6 A;  2LNH B;  2LQN A;  3C4S A;  3CMA T;  2DL5 A;  1T3S A;  2DEQ A;  3OS0 A;  1Q86 U;  2JS0 A;  1UJ0 A;  1Q86 C;  4J5Y A;  1X69 A;  2LTO A;  3MEW A;  1UEB A;  1S72 T;  1HSQ A;  2X3X D;  1UUE A;  5FU7 B;  2ZZD A;  4L6V 5;  4J83 A;  3PGG A;  2HCK A;  2XKO C;  3DLL A;  3H0I A;  2CKK A;  4CC4 B;  2O88 A;  5GAN f;  4J9I A;  1AWO A;  1UJY A;  4EMK B;  1W4S A;  2OX7 A;  5GMK e;  3HFN A;  1QVF A;  1YP5 A;  5LJ3 g;  1CKA A;  2BE9 B;  1D1B A;  1NYF A;  3EG9 B;  1RAB B;  1N9S A;  1YWP A;  1VQ5 T;  5GAN h;  1IO6 A;  1KQ1 A;  2MIO A;  1NLO C;  3F70 A;  2EYQ A;  3UAT A;  1VQ7 T;  4M77 A;  3A98 A;  2HQE A;  2V8J A;  4BAC A;  2DE0 X;  1EFN A;  4J7I A;  1UB4 A;  4AFS C;  4F7U B;  1IHW A;  1MNE A;  4XTU A;  3TRE A;  1AWJ A;  3QDF A;  4PJL A;  3VS4 A;  1BIB A;  3MEA A;  1N8R U;  4C92 G;  1N8R C;  2QK0 A;  2RHZ A;  5EG2 A;  4M7D D;  3CCU T;  3TEE A;  1ZSG A;  3JCM f;  4M7A C;  2MYS A;  3D7S B;  1KC8 U;  2RMO A;  3L2Q A;  3LYI A;  2OTL A;  1RLQ C;  2KSS A;  4L5G A;  2CS7 A;  2KE9 A;  2HQH A;  4MML A;  2K3B A;  2NLU A;  2YLB A;  4N4H A;  2A36 A;  2A7Y A;  4KBM B;  2V8K A;  3OSS C;  1ZBJ A;  4JJN K;  3ULR B;  1GCQ C;  4XTY A;  3QZ9 B;  2EIF A;  2VC8 A;  5C6S A;  1YWO A;  3JCM h;  2WSC E;  1UGR B;  3FEO A;  1FX7 A;  4IIM A;  2F2V A;  4VUB A;  4OML A;  3U23 A;  2QAS A;  2R5A A;  2H3E B;  4C8Q G;  4PJO C;  4FSS A;  2DXB A;  2E5K A;  2R57 A;  2FPF A;  4F7U F;  1M3C A;  4LDU A;  1FXX A;  1WFW A;  3EGD A;  1YHQ T;  2DVE A;  4IUQ A;  2DLP A;  5LJ3 f;  2M1H A;  1K9M U;  3SHW A;  4FL6 A;  4ME7 A;  3I56 A;  1G8X A;  3V7S A;  2LQK A;  2CGH A;  2RH2 A;  4FSX A;  3CD6 Q;  2CSQ A;  4C5I A;  2AZS A;  5IXB A;  3GP8 A;  5CQX A;  1JBM A;  2CUD A;  1AHJ B;  3DKM A;  2CT3 A;  1KD1 R;  4FIB A;  5HK0 A;  1ARK A;  4PKC C;  2P84 A;  2K2V A;  5LJ3 h;  2X51 A;  1NEB A;  5C0M A;  1IGU A;  1OUL A;  1PRM C;  1RAC B;  4JLI A;  2HSP A;  3P8B B;  3PIO A;  1SEM A;  4BD3 A;  3M58 A;  4M77 G;  4E7K A;  3S3N A;  3N5B B;  5LJ5 g;  3EH2 A;  4LDX A;  3VS5 A;  1JU5 C;  3JB9 J;  4V2S A;  1SSF A;  1G3W A;  3QYH B;  1DJ7 B;  1ZUY A;  1ACM B;  2OTL T;  4OGC A;  5KYU A;  3CCS Q;  2DPP B;  3JCM J;  1WZO A;  2LJ3 A;  1VQL T;  4ZN1 A;  2HQX A;  1KK7 A;  5J26 A;  1Q86 R;  4Y92 A;  3OYI A;  4JZ3 A;  3L2V A;  3RBB B;  4OB0 B;  4HKE A;  1HYO A;  2EFI A;  4M75 E;  2D9T A;  3CCM A;  4AMC A;  4HT9 A;  1Q7Y U;  4E7H A;  2D0Q B;  1BBZ A;  2CH4 W;  4PFP A;  3OBW A;  3QJ6 A;  1BB9 A;  3CME Q;  1LOJ A;  4BDZ A;  2GTJ A;  3J81 E;  3MEV A;  2JM9 A;  3M54 A;  5CR2 A;  1BCO A;  3M59 A;  4KUD K;  1G5V A;  1KQS P;  1X2Q A;  3I56 T;  3G6E T;  2YDL A;  2FYK A;  3CC7 A;  1YJN A;  2ZAE A;  1SRM A;  1NBE B;  4FT4 A;  2AK5 A;  1WQ7 A;  1NJI U;  3RER A;  1M90 C;  4ATO A;  4HVW A;  2E4H A;  2FZG B;  2QI2 A;  3EGX B;  2DD5 A;  2J6O A;  2K5L A;  1XNI A;  3QO3 A;  2KRO A;  4X34 A;  2OAU A;  1BK2 A;  2CDT A;  1WHG A;  2KRM A;  2JT4 A;  2VYT A;  2E41 A;  1PNJ A;  3VV0 A;  2NUZ A;  3CCE Q;  4HA8 A;  2A3L A;  3VYH B;  3G4S T;  3OB9 A;  2KT8 A;  4HCK A;  3V7C A;  1VIF A;  2RHI A;  5CQY A;  1QVG A;  5GAN 7;  3A1P A;  2LNV A;  1N8R R;  4C0G A;  4C92 C;  5LJ5 f;  3NMZ C;  4OMQ A;  2DYB A;  1BCM A;  4C5H A;  4X9C A;  1KC8 R;  1RL2 A;  3EGU A;  4LUD A;  3M5A A;  3G1J A;  2YWW A;  5GAO l;  2EJG A;  4M78 D;  1VQ4 A;  4M75 B;  3CCV A;  1K4U S;  5LJ5 h;  1JXO A;  1YCS B;  4M7A A;  4XU1 A;  1D0Y A;  4ESR A;  2VV5 A;  1Y71 A;  1D3B B;  2YRD A;  3EG3 A;  1AWX A;  3VUZ A;  3MP1 A;  3EG0 A;  4C8Q C;  2E10 A;  1I5O B;  1X27 A;  3CEY A;  4M7D G;  1GCQ A;  1TSF A;  1YJN T;  2X35 A;  5D6W A;  2DL7 A;  2MWO A;  2SEM A;  1QVF S;  4QQ6 A;  1K9M R;  1K0X A;  2EW3 A;  4XK8 E;  4NL3 A;  2E6N A;  1IRE B;  1OI1 A;  1D1A A;  4JJB A;  4HXJ A;  5LJ5 j;  2M02 A;  2GQV A;  2MMP A;  2JOY A;  4MZT A;  4RTT A;  3H8Z A;  3CPF A;  3BE3 A;  1QKW A;  3JCM b;  3L2Z A;  1UTI A;  4PJJ A;  2XIC A;  1MND A;  2LDM A;  3A8G B;  3WVE B;  1HK9 A;  4J8O A;  5A0G A;  1PSE A;  1YJW Q;  3RKY A;  4OP0 A;  3OYC A;  1VQ8 Q;  2RI3 A;  4M77 C;  1W2B S;  4AFQ C;  1UGV A;  1MV3 A;  4WTO B;  2FB7 A;  2EKH A;  2RNA A;  3HHT B;  3LGL A;  1RAF B;  2HKQ B;  5GAN 2;  4PFZ A;  2L3Q A;  1M3A A;  2YHT A;  3E1S A;  1VQ4 T;  2FG0 A;  2P0P A;  3CCV T;  2RI2 A;  4E6R A;  3VJP A;  1EX4 A;  2DTO A;  2K7A A;  2ZPE B;  2DA9 A;  5LJ5 e;  3PVQ A;  4GBQ A;  4R56 A; 
#chains in the Genus database with same CATH homology
 4E7I A;  4HT8 A;  1Q86 C;  4BI3 A;  4J5Y A;  2LTO A;  3MEW A;  1UEB A;  1S72 T;  1GXI E;  3C95 A;  4BB7 A;  5FRM A;  4O5V A;  4EMG A;  2QQA A;  3FIF A;  5FU7 B;  3V8L A;  5CKF A;  2ZZD A;  4L6V 5;  3HL8 A;  2RHY A;  4ELZ C;  1Y96 A;  4J83 A;  1R8O B;  2L5Q A;  3V8K A;  3PGG A;  4QVD A;  5CO7 A;  2XKO C;  3DLL A;  1YJW T;  4IKF A;  2CKK A;  1YJ9 T;  3HPW A;  1XTD A;  1MGQ A;  1PSF A;  3SD4 A;  1VQ8 T;  4M75 A;  3M57 A;  5GAN e;  3SFM A;  3MP8 A;  5DM7 R;  2WAC A;  3UWN A;  3M55 A;  3M56 A;  3M53 A;  2K4Y A;  2RD1 A;  5GAN f;  4LD9 K;  1KG1 A;  2KDS A;  3PT9 A;  4PJO F;  3DB4 A;  4EMK B;  3OYN A;  1KHI A;  3OYH A;  3E9G A;  1W4S A;  2KQW A;  2VGN A;  4EMH A;  2L3R A;  2EAY A;  4B9X A;  5GMK e;  3HFN A;  5CCA A;  2VUB A;  2DZ9 A;  1QVF A;  4BI4 A;  5LJ3 g;  2KAF A;  3C94 A;  2EQU A;  5GAM g;  1N9S A;  2EQK A;  5KH6 A;  5A0L A;  5GAO r;  1VQ5 T;  2HD0 A;  2LQ8 A;  5CIU A;  2QEX T;  2YRV A;  3A8H B;  3CCL T;  2DTH A;  1Q82 C;  1WNL A;  5KE2 A;  5GAN h;  5FU7 C;  3QUI A;  1KQ1 A;  3QKJ A;  3P8H A;  1YIT A;  4II1 A;  4JRP A;  1VQN T;  3F70 A;  2EYQ A;  1VQ7 T;  3ME9 A;  1ZHI A;  3OBY A;  4M77 A;  4M7A B;  3CC4 T;  1VQ9 A;  1B34 B;  2F69 A;  1YJ9 A;  1VQ8 A;  3AHU A;  3OYY A;  2HQE A;  2BIV A;  3OS2 A;  2V8J A;  1Q81 U;  4BAC A;  4M7A D;  3L2W A;  4J7I A;  3A8L B;  4MZP A;  3LH0 A;  2KK4 A;  1UB4 A;  5I2M A;  4EMK C;  3X20 B;  3CBO A;  3OYG A;  3SWN A;  4V2S A;  3NTH A;  3LGF A;  4Q5W A;  1BI1 A;  4F7U B;  3HKS A;  2LCC A;  1X6O A;  2Y90 A;  3GLX A;  1WGS A;  4MZM A;  4XTU A;  2EJF A;  3A8M B;  3TRE A;  5A0D A;  3L42 A;  1VQK A;  2QA4 A;  4HCZ A;  1VQM T;  3V7R A;  3OMC A;  1H3Z A;  4HCB A;  5LJ3 j;  2DO3 A;  3EFR A;  2LCL A;  1BIB A;  3MEA A;  1N8R U;  2E65 A;  4QQG A;  5CKE A;  4C92 G;  4QQD A;  1N8R C;  3OYD A;  4OMF B;  3OW2 S;  4M7D B;  2RHZ A;  5EG2 A;  1N27 A;  3GNF B;  4HCC A;  4E47 A;  2HAX A;  3JCM e;  4M7D D;  3CCU T;  3TEE A;  4CI0 C;  2DD4 A;  3QG1 A;  1M1F A;  2L8D A;  3JCM f;  3ZFJ A;  4M7A C;  3PMT A;  5L8R E;  3GNG A;  2X4J A;  2LT1 A;  1KC8 U;  1KD1 C;  4PJO B;  4C92 A;  3L2Q A;  1BYM A;  3LYI A;  3QYG B;  2OTL A;  4PJO D;  2M16 A;  1YI2 A;  4A4G A;  4XU0 A;  2KSS A;  3TU4 K;  4L5G A;  3FC3 A;  3JRZ A;  2CS7 A;  2DAQ A;  5GAM d;  4MML A;  2NLU A;  2YLB A;  3DB3 A;  4N4H A;  2RB6 A;  2CYZ B;  1WJR A;  2A7Y A;  2RJF A;  4KBM B;  1QW1 A;  5HY6 A;  5GMK i;  5GAN 3;  2V8K A;  3OSS C;  4JJN K;  2CZ6 B;  2K3X A;  2EWN A;  2V8I A;  4XTY A;  2QDY B;  3QZ9 B;  2EIF A;  1OZ3 A;  2VC8 A;  5GMK m;  1XOV A;  4BE2 A;  5C6S A;  5M9O A;  1FWZ A;  1VQM A;  3JCM h;  3E9F A;  5DLQ E;  2XG8 D;  2WSC E;  3OYB A;  3HRU A;  4DA4 A;  1UGR B;  1K8A C;  3FEO A;  2HNI A;  3CD6 A;  2H3J A;  1FX7 A;  4M7D C;  1UGQ B;  2FHD A;  5CKB A;  4M7A F;  2B8A A;  4GLK A;  4JRK A;  3X24 B;  5KCO A;  1I81 A;  4Z02 A;  3BDU A;  4VUB A;  3OYK A;  2G3R A;  4RCB A;  4QVC A;  4ZTJ A;  1M90 U;  3UPU A;  1K73 U;  1OZ2 A;  2R5A A;  4C8Q G;  3JB9 I;  4PJO C;  1LNX A;  2DXB A;  2R57 A;  4JLG A;  4BI8 B;  2DZC A;  3PNW C;  2IVW A;  5FU6 B;  3X25 B;  4M78 G;  4F7U F;  4ELY C;  2RO0 A;  4LDU A;  1FXX A;  3OYA A;  3JCM c;  4C8Q A;  1EIF A;  1YHQ T;  4XTX A;  5LJ3 e;  2DVE A;  4IUQ A;  2MAM A;  4M75 G;  5LJ3 f;  2M1H A;  1O9S A;  4M78 A;  4WF2 A;  1K9M U;  3FLG A;  3CCL A;  4C0F A;  1BI0 A;  4FL6 A;  5GAM f;  1YIT T;  2AHJ B;  3FRN A;  2PVD B;  4ME7 A;  2XID A;  3V7S A;  3I56 A;  2O4X B;  2LQK A;  2X4Y A;  2CGH A;  1VQ9 T;  4M7D F;  4C0D B;  2R5M A;  2RH2 A;  4FSX A;  4OB1 B;  3S3O A;  3S6W A;  5GMK l;  5DLO A;  1IZ6 A;  2PUO B;  3VYG A;  4C5I A;  4XTV A;  3QPH A;  3CCJ T;  4LDW A;  5CQX A;  4EMK A;  1JBM A;  1P92 A;  4C92 E;  3GP8 A;  2PVO B;  2JUF A;  4QW2 A;  4Y28 E;  4JS5 A;  5IT9 E;  4J7F A;  3OY9 A;  1AHJ B;  1WQW A;  1ZBX A;  3DKM A;  2RI5 A;  5J39 A;  5A2Q E;  4FIB A;  5HK0 A;  4J6X A;  2WSF E;  2JVV A;  4PKC C;  3HRT A;  2K2V A;  5LJ3 h;  5FU6 C;  3BW1 A;  1D3B A;  3PMI A;  5C0M A;  2KMT A;  1VQK T;  4MDW A;  2QA4 T;  3HP9 A;  2I2L A;  5GAM h;  4NS5 A;  4JLI A;  1I4K 1;  2DIG A;  3OA6 A;  1QP2 A;  3P8B B;  4RKU E;  2ZGW A;  3PIO A;  2WSE E;  3LW5 E;  4BD3 A;  2EKO A;  2YLC A;  3M58 A;  4M77 G;  1VUB A;  4E7K A;  2F5T X;  4NL2 A;  3L2U A;  3S3N A;  1YHQ A;  3N5B B;  3X26 B;  3QBY A;  1X01 A;  4A53 A;  5LJ5 g;  2PUK B;  4XTZ A;  1JJ2 A;  4LDX A;  3CCM T;  3X28 B;  3RIR A;  5FRN A;  2XI9 A;  1XQH A;  1B34 A;  1KHC A;  3FDR A;  3WVD B;  1SSF A;  1G3W A;  2DK3 A;  1DJ7 B;  3FJP A;  3QYH B;  4C0D C;  2PVG B;  5GAO p;  5HKC A;  4GY5 A;  2GFU A;  2M0O A;  4ZN3 A;  3OW2 A;  1Q81 C;  2OTL T;  1VQ6 A;  1YI2 T;  3PFS A;  4L59 A;  3JB9 G;  2RJC A;  3QXE B;  4OGC A;  3CCJ A;  1VIE A;  2CZ0 B;  1YIJ T;  3E19 A;  3CXC A;  4XAX B;  3V8J A;  4R55 A;  1BI2 A;  4DOW A;  3H6Z A;  2DPP B;  3KUF A;  3JCM J;  2LRQ A;  1G3S A;  1Y07 A;  5DY9 A;  3M4G A;  5GAN 6;  2CZ1 B;  1NPP A;  2E64 A;  4C8Q E;  4PLL A;  5I2S A;  1VQL T;  2DIQ A;  4EDU A;  4ZN1 A;  3CCQ A;  4JRI A;  2HQX A;  5CVI A;  1I5L A;  3RKX A;  5J26 A;  1JJ2 S;  3NTI A;  4M78 E;  2Y4Y A;  3HRS A;  3M4Y A;  4J6W A;  3CC7 T;  3INZ A;  3OYI A;  2XU8 A;  2RHU A;  4M77 B;  3L2V A;  2ZPG B;  1M9S A;  1YCY A;  4JRQ A;  3OYE A;  1OYX A;  3RMS A;  4OB0 B;  3CD6 T;  4HKE A;  2GCX A;  2E5Q A;  2EFI A;  5GAM j;  4OF1 A;  2OTJ A;  2HBP A;  4M75 E;  2D9T A;  2K57 A;  4ZGD B;  3CCM A;  3JB9 J;  4CRI A;  4HT9 A;  1Q7Y U;  5D6X A;  3SWN B;  3CXC S;  4PJO A;  3MET A;  4E7H A;  2D0Q B;  1O75 A;  4X9D A;  3OBW A;  3QJ6 A;  1KC8 C;  2K5F A;  3A5Z B;  4JUV A;  5GAO n;  3LLR A;  4XU2 A;  1LOJ A;  4BDZ A;  3DLM A;  4EPC A;  3OS1 A;  3J81 E;  3MEV A;  1YIJ A;  3CPW S;  3QZ5 B;  1BIA A;  3M54 A;  5CR2 A;  1M1K U;  3M59 A;  4N4I A;  1TH7 A;  4KUD K;  4E7J A;  3JCM W;  1G5V A;  5GAN 5;  3JCM V;  2LC4 A;  3BFM A;  1VQL A;  3QSU A;  3LX7 A;  1JRI A;  4PLI A;  1N9R A;  4M75 F;  3I56 T;  3G6E T;  5LJ5 d;  3ER0 A;  4E7L A;  3EAE A;  2FYK A;  4O6J A;  3CC7 A;  4FU6 A;  1YJN A;  3GOX A;  4JS4 A;  2XK0 A;  3VUB A;  1QP3 A;  4C5G A;  1VQO A;  4JDS A;  4N0A C;  5CKD A;  4KUL A;  3JSC A;  4C92 B;  3VKI A;  2PU9 B;  4M77 E;  1VQP A;  4FT4 A;  3RUX A;  4C92 D;  3CCR A;  1WQ7 A;  1LJO A;  2XD0 A;  2DXC A;  1U1T A;  1NJI U;  3BDL A;  3MCA B;  3SWN C;  2ZPB B;  3CCS T;  1M90 C;  1KQS A;  3C12 A;  2XDB A;  2QI2 A;  3RER A;  4ATO A;  2DD5 A;  3JB9 H;  2RJD A;  2K5L A;  5GAO m;  1K73 C;  1XNI A;  3QO3 A;  4FT2 A;  4X34 A;  4RMO A;  2EQM A;  2OAU A;  1M1G A;  1ZQ1 A;  2IG0 A;  5GAN d;  4MMK A;  1BI3 A;  1UGS B;  4FM4 B;  3J7A F;  2VYT A;  2E41 A;  3VV0 A;  4DOV A;  2QXF A;  5IN1 A;  4HA8 A;  3JAM E;  3OMG A;  2A3L A;  4BE0 A;  3SB2 A;  1V29 B;  3OS5 A;  4P5N A;  3VYH B;  4PL6 A;  5GAM e;  3G4S T;  3OB9 A;  4M77 F;  2F5K A;  1K9M C;  3V7C A;  4IUT A;  4BE1 A;  3G6E A;  3I55 T;  3G71 T;  1VIF A;  5KCH A;  4RCC A;  2RHI A;  2QQ9 A;  3ASK A;  5CQY A;  1QVG A;  3R6O A;  5GAN 7;  1KQS S;  2DJZ A;  2LNV A;  4OB2 B;  4IUR A;  4C0G A;  2P0Q A;  4C92 C;  1VQ6 T;  4LDV A;  5LJ5 f;  1NE8 A;  1M4Z A;  2RHX A;  4IUU A;  4C5H A;  4X9C A;  2K5I A;  3HFO A;  3O8V A;  2VGM A;  4C8Q B;  3CCS A;  3JB9 F;  4OGE A;  1U8R A;  1RL2 A;  2E6Z A;  1BKB A;  3T9N A;  4C8Q D;  2X4X A;  2O01 E;  3CC2 T;  2KY9 A;  4M78 B;  3M5A A;  3CCQ T;  2C06 A;  2MF2 A;  3UDC A;  1U1S A;  5GAO l;  2FVU A;  2P4T A;  3OYF A;  2EJG A;  2MWP A;  1Y96 B;  4M78 D;  3CBP A;  4A54 A;  4TVR A;  4C0Z A;  4M7A G;  3TCJ A;  1VQ4 A;  2LVM A;  5CAI A;  1WJQ A;  4M75 B;  1QVG S;  2BUD A;  3M9Q A;  5D6Y A;  3CCV A;  4OVA A;  2OTJ T;  2QQR A;  4YTL A;  5LJ5 h;  4M75 D;  4KUI A;  5AYF A;  3G4S A;  4BY6 B;  2VXF A;  2P0K A;  2EJ9 A;  4OB3 B;  4C92 F;  3LWI A;  4M7A A;  4XU1 A;  2PQW A;  3L1A A;  3RES A;  3G7Z A;  1M8V A;  3KBG A;  3GF5 A;  1Y7X A;  4F7U G;  2Y4X A;  3CMA A;  4A4H A;  4ZTF A;  5IAY A;  2VV5 A;  1Y71 A;  3MHX A;  4A4F A;  1UGP B;  5CKH A;  1D3B B;  2RM4 A;  3CME A;  3NFC A;  3VUZ A;  3MP1 A;  3QHS A;  3RMQ A;  4UC4 A;  4F7U A;  4C8Q C;  1NZ9 A;  2E10 A;  3EFS A;  3CEY A;  1Q82 U;  3JCM d;  3Q1J A;  1S72 A;  4N4G A;  3CCE T;  5J3B A;  5GAN g;  3OYL A;  4M7D G;  3QII A;  4M78 C;  2M9U A;  3LWH A;  3CC2 A;  3OSV A;  3L2R A;  3PTA A;  3CPW A;  1M5Q 1;  1YJN T;  1YJW A;  2X35 A;  5D6W A;  2LT4 A;  2FL7 A;  4N0A A;  1YBY A;  1VQO T;  5GMK h;  3MO8 A;  3A8O B;  4ZGJ B;  1HXD A;  3FB9 A;  4M75 C;  4PJO G;  4M7D A;  2MWO A;  3NTK A;  3QJY A;  1QVF S;  4QQ6 A;  1VQP T;  4M77 D;  2E1H A;  2GFA A;  2ZCF B;  2CZ7 B;  2LX9 A;  4DQ2 A;  3CCR T;  4RG2 A;  4XK8 E;  4BY6 C;  1MHN A;  2E6N A;  4NL3 A;  1IRE B;  4C5E A;  2X4W A;  4BUG A;  3JCM P;  3P8D A;  1W2B A;  4KT0 E;  4Y91 A;  1OI1 A;  3HSB A;  5LL6 S;  1Q7Y C;  2RK2 A;  2E70 A;  5LJ5 j;  2GQV A;  2MMP A;  2JOY A;  4MZT A;  3H8Z A;  2K3Y A;  3CPF A;  5GAN 8;  4PNO A;  4B9W A;  1WPY A;  4C8Q F;  3JCM b;  3L2Z A;  1G3T A;  3WXM B;  3JB9 D;  2MI6 A;  5GAO q;  2XIC A;  2LDM A;  3BY7 A;  2ZPF B;  1VQ5 A;  4M78 F;  4D6W A;  2QEX A;  4MDX A;  1M1K C;  3A8G B;  2GF7 A;  5HK3 A;  2R58 A;  3WVE B;  1HK9 A;  3CCE A;  2RJE A;  4J8O A;  5A0G A;  1PSE A;  3ZBD A;  3PIP A;  4A4E A;  5FLX E;  3RKY A;  4OP0 A;  3OYC A;  4BDY A;  4ZGE B;  1KD1 U;  1VQ7 A;  2RI3 A;  1VQN A;  5GAN j;  3CC4 A;  4M77 C;  1W2B S;  4J6Y A;  3OYJ A;  2QQB A;  3JCM X;  3CBM A;  4M7A E;  5LJ3 d;  2FB7 A;  2XHC A;  1JB0 E;  3HHT B;  4A4K A;  2ZPH B;  4XU3 A;  5GMK j;  3OYM A;  3URG A;  2QQS A;  3GPL A;  3LGL A;  3QDR B;  2JTM A;  2JZ2 A;  2DTI A;  1N6A A;  1WJS A;  2DXT A;  1NJI C;  2BKD N;  5GAN 2;  3G71 A;  1H64 1;  4XTW A;  2JN0 A;  4LDY A;  2QTX A;  2DKG A;  2JNG A;  4F7U E;  5FRO A;  1G3Y A;  3MP6 A;  1NPR A;  5GAN 4;  2YHT A;  2JTF A;  3JCM g;  5KE3 A;  3E1S A;  3UT1 A;  2L89 A;  3KXT A;  3SDZ A;  1VQ4 T;  2D6F A;  3OQ5 A;  3S3M A;  1K8A U;  4QVZ A;  1RI0 A;  2ZPI B;  3J80 E;  2P0P A;  3I55 A;  3CCV T;  2RI2 A;  3JCM Q;  2EQJ A;  5I21 A;  3VJP A;  2XDP A;  1QVP A;  3VU3 C;  4M7D E;  2KVQ G;  3ZEH A;  2DTO A;  2O4X A;  2VXE A;  4IUP A;  4XQ3 A;  5CK9 A;  3RKW A;  2ZPE B;  2XDD A;  3CCU A;  4LD6 A;  3C4S A;  1I8F A;  3CMA T;  1KQ2 A;  2DXU A;  2RK1 A;  5LJ5 e;  2DEQ A;  2RA2 A;  3OS0 A;  2E12 A;  4NOY A;  4RG8 A;  3GIB A;  4PJO E;  3MEU A;  3CME T;  4R56 A;  1X75 C;  4IUV A;  1Q86 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...