3KXTA

Crystal structure of sulfolobus cren7-dsdna complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin protein Cren7
publication title Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kxtA00
3LWHA 2JTMA 4R55A 3KXTA 4R56A 3LWIA
chains in the Genus database with same CATH superfamily
1KG1A 4EMKC 3LGFA 5GANh 2LX9A 1VQ8A 4QVZA 1YITA 2M1HA 1JBMA 3EH1A 1OX8A 2GBQA 2DL7A 2R58A 2RQTA 3I5SA 4JLGA 4C92E 5CO7A 3QYHB 2CP5A 1ACMB 3BE3A 4MZPA 2H8HA 2E1HA 3QPHA 3PIPA 3P8DA 1JEGA 1N8RC 4OB2B 2DZCA 1UHFA 3QIIA 4V2SA 3HP9A 3EFSA 5DM7R 1VQPQ 2RD1A 4J6WA 1YJNQ 2LX7A 1VQ7T 1KC8U 1G3YA 1LVKA 4PJMA 2G3RA 1VQLQ 2JOYA 2E41A 2A0FB 2RJDA 4N4GA 5GMKi 3CC2Q 1XNIA 3G71T 1B7TA 2QQ9A 2JT4A 3EG0A 2WSFE 1YP5A 3M0RA 4OMPA 3PMTA 4M7AE 1X43A 3JCMP 4QW2A 3ZEHA 4DBQA 2ZGWA 4OMMA 4PKCC 2D0QB 4J9FA 3CCLA 1U1TA 4BY6B 1BYMA 2DBKA 2KXCA 1N8RU 4AFUC 5J39A 2CYZB 2K5IA 3META 2YUOA 1YNZA 4Y28E 4YTLA 4B6MA 3CCRQ 1PM3A 5LJ5h 1FWZA 4C92C 1PG5B 3PNWC 5L23A 2Y90A 4CI0C 1X6GA 3I9QA 1LCKA 3L42A 4MZTA 2HKQB 4F04B 3GOXA 1M2OA 1Q7YC 5KYUB 2B86A 2KI7A 3EHQA 2QGFB 4HVUA 2DILA 4JRPA 2CS7A 2K3XA 1PRMC 2P0PA 1KFZA 2DKGA 1VQ5T 4XU2A 5IXFA 2LCSA 4RKUE 2RQRA 2QTVA 4IUQA 1T0JA 5CCAA 3OYGA 1M30A 1TG0A 3SDZA 2HCKA 3A8LB 2K79A 1GFDA 2VUBA 1JB0E 1Q7YU 2NUTA 3CMET 3ASKA 5EC7A 2OTJQ 3OYIA 3PE0A 1SPKA 3OBYA 4ZTJA 1U5SA 4CRIA 1K1ZA 1RACB 1GCQA 2YWWA 4X1VA 4D8DA 4M7DA 3L2UA 5GAOr 2RO0A 2YXYA 2KT1A 4LDUA 5C6SA 2LZ6B 2P4RA 5IHIA 3EGXB 3INZA 4C92F 3T9NA 2DJZA 1K9MR 1GL5A 1I1JA 1SF9A 2Y4YA 2XDDA 2A7YA 4LDVA 1S72Q 4PJLA 2A28A 4J5YA 5KYYA 4MDWA 2YUNA 1SHGA 4A4KA 1CKAA 1KQ2A 1Y07A 1GBRA 3CBMA 3RDVA 2CP3A 3M0QA 2QGGA 3M9QA 2YT6A 4ORZA 2QDYB 2KYBA 5IH2A 4M7DE 3TSZA 2O01E 2IPOB 3OSSC 5GANf 1YITQ 5D6WA 5GAN2 1HSQA 9ATCB 1TUCA 4R55A 1RAIB 1IRXA 1TTHB 4M7AF 5AT1B 2M02A 2K57A 3E1SA 4A4GA 2EFIA 2XD0A 3CD6T 1Q81R 2EKHA 5GANe 1AWXA 2M0YA 2EQIA 5GAOq 1B07A 1PWTA 1K73C 2YRDA 2LRQA 2PU9B 5CKFA 1QVFP 2LC4A 3LH5A 2QDLA 1PC0A 1VQ6A 2ROLA 3TREA 1Y96B 3OYYA 3CCJA 1E7OA 2VXFA 3CCMT 1ZUUA 2VWFA 2DL3A 2EW3A 4JJCA 3RKXA 2E5KA 2IIMA 3OQ5A 2X3XD 4M7AB 2E10A 2ESWA 1BCOA 1ZLMA 4MMKA 5LJ3g 3CCUA 3RUXA 2FPDA 2GNCA 2GCXA 3A8HB 1GCQC 4O6JA 2L0AA 3CC7A 3CCLQ 2O31A 1AZEA 1E6GA 3JCMV 4M7DC 1U8RA 1UE9A 2JMCA 1YWOA 1K73U 2CSIA 3MHXA 3QWYA 3SEMA 1FMVA 2PQWA 5FU7C 2CH4A 3H41A 2QA4A 5KE2A 4A54A 3X24B 4J9EA 2FPEA 2MK5A 3E9GA 4M78A 2DEUA 1ZHIA 3REBB 2DL4A 2PVDB 2Y4XA 2CP7A 2LT4A 5GAMh 5HY6A 2HQEA 2MWPA 1VQ9T 4J9DA 4Z89A 3L2ZA 3C12A 2EKOA 1WLPB 1N6AA 3M0PA 2QQAA 1UHCA 1UB4A 1YJ9T 5DY9A 2RJEA 1YCSB 2DYBA 4ATOA 4PFZA 5GAOm 3JB9D 4OMFB 2QXFA 5KCOA 1PHTA 1KSWA 4LD6A 3BFMA 4E7HA 4M78E 3RR6A 4RG2A 3GBQA 4JPBW 1NZ9A 1UGVA 2EYZA 4DQ2A 1XQHA 1AHJB 1QCFA 3CMAT 4M7DF 1WPYA 1W70A 2LP5A 1VIFA 4AG1C 1IB8A 1VQNT 1B34B 4A63B 3THKA 2CUDA 4JS5A 5D7UA 4PK4A 1YI2T 2JS0A 3VU3C 1YCYA 1Q95G 1X6OA 4J9CA 4M77D 4LXCA 1M2VB 3NMZC 2VYTA 2DIGA 4XTYA 1QVFA 3MP6A 3S3MA 5HK0A 2EYXA 1ZUKA 4FSXA 4C0ZA 2CZ7B 4A4FA 4ZGJB 2FG0A 2IVWA 3I55T 1D3BA 2DE0X 4OB3B 4FIBA 3CPWA 4Q5WA 2OTLA 1OPLA 2ZZDA 4WF2A 4M78C 4EMHA 4TVRA 2FVUA 2EIFA 2GFAA 4E47A 3RMSA 4C8QA 2C06A 3HSBA 2QAZA 3CCVA 2DD5A 4WTOB 4ZTFA 2C0TA 2HBWA 4EIKA 4CC3A 3QXEB 2LT1A 4KGVB 1RAGB 4QVDA 2P84A 2NUPB 3CCQA 4Z88A 5A0LA 3VS5A 1IHWA 3O5ZA 7AT1B 1W2BP 3PIOA 2D8JA 4B9WA 1ZSZA 5DLOA 4GY5A 1H92A 3CCUQ 4FT2A 3JCMg 4RTXA 4C8QE 2EQUA 3N5BB 2RQUA 3CC7Q 2EAYA 1IREB 2HDAA 2GTJA 2FZGB 1PSFA 2ZPHB 5M9OA 4OMQA 1HXDA 3HPWA 1EIFA 2K3YA 2XMFA 2HKNA 3TQ7P 3NGPA 5KH6A 1RABB 2ABLA 4N0AA 1BB9A 2MPXC 4LN2A 4KH0B 4M78F 2DM1A 2M51A 3FEOA 1K0SA 3LWHA 3JB9G 5GAMf 2K5LA 4KH1B 4Z02A 3PVQA 4M77A 4IKFA 1QWEA 3UF4A 1K4US 2JXBA 3S3NA 2LTOA 3GNGA 4LDYA 1M1FA 3CBPA 2HEQA 1M1KR 1VQ7A 1K9AA 4C8QC 2JN0A 2SEMA 8ATCB 3CCET 2LDMA 1I81A 2CZ1B 2AZSA 2DA9A 4ZNXA 1DJ7B 3OBWA 3OMCA 3REAB 5KYWA 4R56A 2MI6A 4OMOA 3A5ZB 3JSCA 3VS3A 1VQMA 2CKKA 4M77G 3V8KA 1I0CA 1NJIR 2X51A 1X2KA 2RHIA 5IT9E 4JJBA 2I2LA 3RERA 4KGXB 1ZSZC 2AHJB 3RKWA 3SFMA 1H3HA 4C5IA 2VVKA 4LNPA 3OSVA 5LJ5j 5IN1A 1Y0MA 1QP2A 3CC4A 1PNJA 1D1AA 3NTHA 1MMAA 4D6WA 4N0AC 2JVVA 3OYCA 1M3BA 2DRMA 4VUBA 1UUEA 2HZYA 1VQ5A 4J9GA 4F7UB 1W2BA 1WHKA 2L3RA 2LNHB 2QEXQ 2L89A 1M9SA 3HRUA 6AT1B 1PKSA 2RH2A 4FU6A 4HCZA 4X9DA 1VQOQ 1VQPT 1YJNT 4FYXB 4C8QF 4RG8A 4M77C 1VQLT 3JCMX 2RN8A 2BZ8A 3QKJA 4J7IA 5GAN8 3SWNB 3CCSQ 3G6EQ 3CC2T 5IHNA 2IG0A 4C0DB 2KROA 4OF1A 4BDZA 5GAN6 2NLUA 2G6FX 3CCQQ 4KUIA 2RB6A 1D09B 2PUOB 3TEEA 1RLPC 4XQ3A 1E6HA 3OB9A 2ZPGB 4PJJA 2LQWA 1Y71A 2HQXA 3OYLA 2H3EB 3PMIA 2ZPBB 3CCRT 2XIDA 2F2WA 3L1AA 5J3BA 1QWFA 5GJWB 3Q1JA 2MWOA 4OMLA 3EGDB 1SRLA 1K76A 3QG1A 3A8OB 1V29B 4PJOD 3EG3A 3OYNA 4HCBA 2KVQG 2V8JA 2RHYA 4E7ZA 1VQKA 1SKUB 1KD1R 2RI5A 1AEYA 1OOTA 2SRCA 3NHNA 4Z8AA 3VRZA 4BB7A 3BY7A 1PCXA 1LPLA 3GNFB 3EFOA 2DPPB 1TS9A 3WVDB 3MJXA 3G4SA 2KSSA 4JLIA 4NL3A 3MPUB 2DVEA 1MUZA 1LJOA 4DOVA 2HMAA 2HSEB 2AKKA 2OTJT 3LH0A 4J9BA 1YFNA 1TOVA 4HVWA 2HL3A 2O4XA 2MMPA 3HL8A 3M53A 1WIEA 4JRIA 1LNXA 4J9IA 2X4WA 2P0QA 4HT9A 2FEIA 3ZL7C 2FPFA 2JJ9A 4PLIA 2L5QA 2GGRA 1Q81C 1Q86C 3EG9A 4KULA 1MHNA 5KYXA 3JRZA 4RTTA 1VQMQ 1FX7A 1YIJA 5HKCA 4AT1B 3S6WA 3C4SA 1S72T 2DIQA 2FYKA 1WX6A 1KC8C 2MCNA 3QZ9B 3M0SA 2PZ1A 3OMGA 1Y7XA 1RLQC 1H3ZA 4HXJA 3NTIA 4DBRA 3C95A 2EGEA 3CBOA 3SHWA 1Q81U 1Q86U 3EG1A 4J83A 2DZ9A 1YITT 3J7AF 2C0IA 4R0KA 1Q82C 3CC4Q 4M75D 2F5TX 4QQDA 3H0HA 5CIUA 1G3SA 2JTEA 3VS1A 2ROTA 2JNGA 4UC4A 4PJOA 2BZYA 2RHXA 5GAMj 2YHTA 2CP2A 5FLXE 3E2UA 3IQLA 2EBPA 1VYTA 1YJ9A 2FB7A 2HD0A 3WXMB 2K7AA 2DD4A 2ENMA 2R57A 1AT1B 4XU3A 4F14A 2XHCA 3E9FA 5GANg 1D0ZA 1R8OB 3NFCA 4II1A 1VQ8Q 1Q82U 5D6YA 1M5Q1 1K8AC 1QVFS 3A1PA 2FRYA 2JTMA 3FRNA 5GAN5 1SHFA 4C92B 1GCPA 2KT8A 1M4ZA 2WSCE 4C5GA 5FU6C 2QQBA 2VXEA 4PJOE 4PJOG 2EGAA 3CPWS 1JQQA 1Q7YR 4P5NA 2MOXA 3CCLT 3CMAA 2A36A 4J9HA 3DLMA 3FLGA 3R6NA 2KK4A 3G7ZA 3J80E 4DEXA 5CQXA 4ESRA 3GPLA 3OYAA 2D0NA 3O8VA 2YUQA 3P8HA 2V8KA 1TSFA 4OMNA 1UEBA 3CPWP 4NL2A 1K8AU 2QK0A 2A08A 4AFZC 4LUDA 3H6ZA 1U1SA 3BDLA 3U23A 1PRLC 2EWNA 4ME7A 1VQKQ 5IXBA 2MIOA 5D6XA 1AVZC 2EJGA 2QTXA 4DOWA 5CKHA 2BZXA 3PTAA 1HK9A 3LLRA 3EFRA 3G4SQ 5LJ5g 1WGSA 3LWIA 1XJWB 1JO8A 5LJ5f 2VGNA 3P8BB 5EG2A 1T3LA 4PJOC 5CVIA 2ZPFB 2KY9A 1U3OA 4C0GA 4C0FA 2E3IA 4M75A 1ZSGA 3UPUA 1F1BB 4RTUA 2DRKA 1Z9QA 5LJ5e 5LJ3d 1WJRA 1KIKA 5ECAA 2KBTA 1KHCA 4L6V5 1NYGA 3EHRA 1WHGA 2ZCFB 5AYFA 3PVLA 4A53A 2ATCB 3M4GA 3MP8A 1X01A 3QZ5B 3I56A 3A98A 2KRSA 2ED0A 2JTFA 1QKWA 2I0NA 4MMLA 2D6FA 1PKTA 2OX7A 2BE7D 1YIJQ 3HFOA 1VQ4A 5I2MA 3UDCA 3VRYA 1GXIE 1YHQA 3V7RA 1M8VA 4M75E 3SB2A 4M75G 1WHHA 2XDPA 3HFNA 4L59A 1WXBA 1BI1A 4DBHA 1NG2A 1FMKA 2A3LA 2DTOA 1JXOA 1W4SA 2LNVA 2LJ1A 3CXCS 1K73R 3H0FA 1QP3A 1IGUA 2FZCB 2GQVA 3I5RA 1WJQA 1R0CB 2P4TA 2RM4A 1W6XA 4BACA 2NUTB 4XTUA 1UECA 1C0MA 1CSKA 3JCMW 2YLBA 3MEAA 3CXCP 1IGQA 3PT9A 3RIRA 3VS7A 5KCHA 2J05A 5GAOp 4BI4A 2AK5A 1ARKA 3HTRA 2FRWA 2NYSA 4M7DB 1Z9ZA 4RTZA 2FHDA 5GMKm 3QO3A 3RKYA 1WXUA 4M75C 3OYBA 1WJSA 3CCEA 2EYWA 2O88A 1QMCA 3KFVA 5FU7B 3SWNA 1X2QA 2AT1B 4J6YA 3CCUT 2YRCA 1KQSS 3JCMQ 5HK3A 3HKSA 3CC7T 1WQWA 1W2BS 5KYYB 1G5VA 4HT8A 1M1KC 3M56A 1OQKA 3MEWA 2D8HA 4F7UG 2J6FA 4FT4A 3URGA 1VQ6Q 1PSEA 1TH7A 1YJWA 3CCJQ 1WNLA 1KQSP 1BIBA 1BI3A 4BI8B 3OYDA 3FIFA 3TU4K 2V1QA 2CH4W 3VKIA 1NE8A 1M1GA 2OI3A 4J6XA 1ABOA 1NJIC 2K6DA 3M0TA 3HRSA 2EGCA 1WZOA 1I07A 3J81E 2EQKA 3E19A 2XDBA 1M1KU 2QG9B 4JJNK 3ZFJA 3QDFA 1WI7A 2RJFA 2LCLA 4C5HA 3X26B 1AOJA 2K9GA 2AZVA 4PFPA 1VQPA 2QA4Q 2EYQA 1VQLA 4FSSA 2W10A 5GAMg 1NJIU 4C92D 2X3WD 2KXDA 2J6KA 4XTWA 4EMGA 4XTVA 1C1AA 5KYUA 3JCMd 2JM8A 2EQMA 4A4EA 3EH2A 2BIVA 2OAWA 2DTHA 1MMNA 3A8MB 3L2RA 3V8JA 5GAMe 3I56Q 1W1FA 2RA2A 3SWNC 2V8IA 3CCRA 1MGQA 3FC3A 1FYNA 4IUPA 4C0DC 2DXTA 2DNUA 4M78B 5GJVB 1RAEB 3CXCA 1RI0A 1VQ4Q 4M7AD 1YHQQ 1V1CA 2CP0A 2XI9A 2JW4A 4RUGA 3AHUA 5A0DA 2ZPIB 3G71A 2J06A 1KJWA 1D0XA 2CP6A 4JJDA 2CT3A 4FYWB 2X4YA 2CZ6B 4M77E 1AWJA 2GFUA 2MAMA 4D8KA 5IAYA 3FB9A 3PGGA 3ZBDA 2QEXT 1BK2A 3CPFA 3H8ZA 1PD1A 2BKDN 2E64A 4NS5A 3OY9A 1VQOT 3EGXA 1AWOA 2KAFA 1SSHA 5CKDA 2EJ9A 3RNJA 4QVCA 1OZ2A 1KD1C 1BIAA 5GAN3 3CCST 4HCCA 1XOVA 3G6ET 3MKDA 4BY6C 4BUGA 4IIMA 2EJFA 5LJ3j 1HD3A 2L2PA 4J7FA 3DLLA 2F5KA 1GBQA 1KQSA 2XU8A 3V8LA 4JS4A 3NTKA 3CCQT 1RI9A 2OTLQ 3NPFA 1U06A 1RL2A 4FW1A 4JUVA 1WHMA 2YRVA 5A2QE 2E70A 5CQYA 4LDXA 1UJYA 1A0NB 1VOMA 2EYYA 2LMJA 3X25B 2J6OA 3JCMb 4C92A 1KD1U 2EVRA 2K2VA 3CCVQ 4FW2A 3JCMc 1M90R 1UDLA 1V76A 2VASA 4E7IA 4AMCA 3MEUA 3JCMJ 4OGEA 3CMEA 2M9UA 2PVOB 4X9CA 1RAFB 3HRTA 3OS1A 2HBPA 4JRKA 1D3BB 2RI3A 5GMKl 3TCJA 1YJWQ 4RMOA 1X75C 2LJ3A 3BW1A 1Y96A 4N4IA 3JB9F 5CKBA 2K2MA 4PJNA 3D7SB 1G3TA 4LE9A 4C8QB 3M5AA 4M7AA 4RTYA 2E6NA 5FRNA 2X35A 4C92G 4K11A 4WCIA 4KUDK 2BUDA 2R5MA 4BD3A 1MNDA 1N9RA 4M7DD 1VA7A 5FRMA 1D1CA 1YBYA 1X6BA 2LQNA 4CC2A 2KMTA 1VUBA 3VS6A 2DETA 3A8GB 3MCAB 3QJ6A 2F69A 1BCMA 1ZSZB 4KRTA 1K9MC 2QI2A 2F2VA 4M77F 4M7AG 2HNIA 1BBZA 2MF2A 2CSQA 1VQMT 2XICA 5LJ3h 1P92A 4HKEA 2O9SA 3H0IA 3CD6A 1VIEA 1I5OB 4F17A 1OU9A 4XTZA 2KGTA 2DBMA 4OB0B 2L8DA 2FZKB 1G8XA 1VQ7Q 1ZX6A 2XKOC 3OYMA 3CCMA 3L2WA 3M55A 1TU0B 1AWWA 2CGHA 1MMGA 1K9MU 2WACA 1JU5C 3QDRB 3G71Q 1QVPA 4LUEA 3CC4T 2K5FA 4M77B 1JRIA 1KC8R 4ELZC 3VYHB 4EMKB 4RCCA 2F2XA 4EDUA 1WQ7A 3OA6A 1NLOC 4LDWA 4ZN3A 1NBEB 3VYGA 4ANJA 1SG5A 2X4JA 2GTOA 5GMKj 4M4ZA 2W0ZA 4M7AC 2O9VA 3JV3A 1B34A 1N8RR 1RUWA 4MZMA 3M59A 2CZ0B 2DL5A 1NEGA 4CC7A 1ZUYA 1UJ0A 1VQ8T 2ECZA 2CREA 2DEQA 4NOYA 5KYWB 4OVAA 2LJ0A 1VQ9A 1YWPA 1G3WA 1M2VA 2D9TA 4ZGEB 2DAQA 5IHKA 2HAXA 2RQVA 1HYOA 1TUGB 4IURA 3QYGB 1OX9A 1VQ5Q 5GAOn 2VGMA 4KT0E 4ELYC 2DF6A 3FDRA 4GBQA 3OW2S 4F16A 2V26A 1QCOA 2YSQA 1OI1A 4J8OA 2LVMA 4M78D 3VV0A 1QQJA 1C6VX 1NPPA 3OS5A 3GLXA 2CUBA 4QKUA 1KQ1A 2K4YA 1IXDA 2COZA 2DJQA 3G1JA 4E6RA 1T3SA 1NEBA 3VS2A 3CMEQ 1UG1A 3I35A 1I5LA 4GLKA 1N5ZA 2B8AA 2E5QA 2PTKA 2DL8A 3M0UA 1G2BA 2PUKB 3OW2P 1VQKT 2RNAA 2KRNA 2ZPEB 4O5VA 3LX7A 3ULRB 4LD9K 2DX1A 4RCBA 2NUPA 4M7DG 3VUBA 3UT1A 1M3AA 2VKNA 1TXQA 4Y91A 3G4ST 2DMOA 2RF0A 1UFFA 3V7CA 1VQNA 4JRQA 4E7KA 1MMDA 1AD5A 2DFUA 2RI2A 3L2VA 3JB9J 1MV3A 4IIOA 2X9HA 5GANd 1YI2A 3C0CA 3VS0A 5C0MA 1Q86R 3V7SA 4E7SA 2E4HA 4E7LA 2KE9A 1JJ2S 3GF5A 2JUFA 1XTDA 3DB3A 5GAN7 3JB9I 3I55A 5GMKh 4EPCA 2CDTA 4XK8E 1BU1A 1OULA 5CR2A 1VYVA 1PD0A 1SEMA 1O9SA 2RK1A 3AT1B 3OS0A 1JJ2P 4PFOA 2DVJA 2DO3A 5LJ3f 4FYYB 1YIJT 4BE2A 3CD6Q 3JCMh 1OV3A 2Z0WA 3OYFA 1Q82R 1QVGS 1QW1A 1M8MA 3M57A 2R5AA 2QQSA 2KDSA 3QHSA 3JAME 3LW5E 2DXCA 4PLLA 1I4K1 3BDUA 5LJ3e 3EFOB 3CCMQ 3EAEA 1NLPC 4RTVA 1M3CA 1SRMA 4AFSC 1QVGP 4C8QD 2L3PA 5LJ5d 2KR3A 2HQHA 2J7IA 4L5GA 4HCKA 4BE1A 2X4XA 5CKEA 2COWA 2BE9B 1N9SA 2L3QA 1K8AR 2WSEE 5CK9A 5J26A 5GAN4 2K3BA 2XK0A 3KUFA 3VJPA 2XG8D 3LYIA 4XAXB 2JZ2A 4IUVA 2JS2A 5FU6B 1Y57A 2O4XB 2FL7A 3TSWA 3VS4A 2RHUA 2O2OA 2C0OA 2F1LA 1QCNA 4QQ6A 1M27C 4XTXA 2P0KA 1RADB 3EG9B 3MP1A 4M78G 2VB6A 5KYXB 1VQ9Q 3OW2A 1J3TA 1EFNA 2DYIA 4PJOF 5I22A 3RBBB 2RMOA 3RMQA 5I2SA 5L8RE 1KK7A 1B3QA 2KQWA 1IO6A 1WYXA 4QQGA 3ER0A 1O75A 1YJ9Q 1QKXA 4CC4B 4F7UA 4IUUA 2NWMA 1ZBXA 1VQ6T 1WXTA 4OB1B 3CCJT 5DLQE 1AZGB 1ZA2B 1X69A 1QLYA 3M4YA 2QYZA 1UGSB 2M0OA 8AT1B 3FJPA 3EGUA 4AFQC 4PJOB 4JZ3A 3RESA 3QBYA 2VV5A 1H8KA 2PVGB 2LCCA 1NPRA 5FWCA 1X27A 3CMAQ 2HL5C 3KBGA 1VYUA 5LL6S 4FCYA 3CEYA 3HHTB 5KE3A 2ZAEA 3X20B 3FJ5A 2QEXA 1VQNQ 4F7UE 1JJ2A 2YUPA 4AG2C 1TUDA 1VQOA 1WHJA 2QA4T 2DERA 4FL6A 2AKLA 1HJDA 2EPDA 4FYVB 1YI2Q 2KYMA 1ZQ1A 3ME9A 3PFSA 2E3HA 2NUZA 2E65A 2KNBB 1GFCA 3EGDA 3S3OA 1BI2A 1RAHB 3CCSA 2QQRA 3G6EA 2A37A 5FWBA 4FM4B 4DBFA 5HCKA 4E2FB 2CT4A 2HSPA 3I55Q 2ED1A 1JXMA 1N27A 2V1RA 4HVVA 3C94A 2OJ2A 1UGPB 1ZA1B 3VUZA 1QVGA 2DK3A 3I56T 3M58A 3KXTA 1BKBA 1UGRB 3M54A 4HA8A 1KHIA 4DA4A 3OYKA 1MNEA 4GLMA 2DTIA 2OAUA 1YJNA 5I11A 2JM9A 2L3SA 4N4HA 4A4HA 5GMKe 3MO8A 4C8QG 4B9XA 4JZ4A 4M75F 3R6OA 3JCMf 1VQ4T 3QSUA 1S1NA 1YN8A 5A0GA 2GF7A 1YHQT 3CC2A 5FROA 1WA7A 1IHVA 3CQTA 3OYHA 1TWBA 1LOJA 1EZZB 3WVEB 3JCMe 2E6ZA 1K0XA 4BE0A 2RJCA 1WFWA 4JDSA 1SSFA 1GRIA 1M90C 1FXXA 3TVTA 2FO0A 3QJYA 3DKMA 5GANj 4XU0A 2EQJA 1OYXA 4M75B 4KGZB 1I8FA 4X34A 5GAMd 1UTIA 4EMKA 4ZGDB 3OYEA 1D1BA 4BI3A 1WHLA 1NM7A 3X28B 3DB4A 3L2QA 5I21A 2QASA 3SD4A 3UWNA 3QUIA 4XU1A 1CKBA 2OTLT 1FMWA 1BI0A 4PL6A 4OGCA 2RK2A 4RTWA 1M90U 3UA7A 2YLCA 1R0BG 2MYSA 2KRMA 4MDXA 4PNOA 1OZ3A 1NYFA 3CCVT 2H3JA 3EG2A 4KBMB 1ABQA 1MV0B 2COYA 1OU8A 1ZBJA 1T0HA 2DXUA 3QWXX 5GAOl 2AIRB 4F7UF 2OTJA 2RHZA 1EX4A 4DEYA 2GQIA 1RAAB 1YJWT 5FW9A 3LGLA 4Y92A 2RQWA 4BDYA 3F70A 4QT7A 3JB9H 2JMAA 2E12A 2D1XA 2LQ8A 4E7JA 3GIBA 2RPNA 3CCEQ 1R77A 1UGQB 2LQKA 1D0YA 5KYNA 3OYJA 3GP8A 4C5EA 3UA6A 4ZN1A 1OPKA 4OP0A 2BTTA 1H641 3H9NA 1OEBA 2M16A 1S72A 2DXBA 1WDXA 2YDLA 3MEVA 2KEAA 5CAIA 1IZ6A 3OS2A 3UATA 2VC8A 1G83A 2PNIA 2DLPA 4IUTA
chains in the Genus database with same CATH topology
4MMLA 1KG1A 4IURA 2ZPHB 3LGFA 4EMKC 2D6FA 5M9OA 5GANh 3QYGB 2LX9A 1HXDA 3HPWA 1VQ8A 1EIFA 5GAOn 4QVZA 2VGMA 2K3YA 1YITA 4KT0E 2M1HA 1JBMA 4ELYC 5KH6A 3HFOA 3FDRA 5I2MA 4N0AA 1VQ4A 3UDCA 1GXIE 3OW2S 3V7RA 1YHQA 4M75E 3SB2A 4M75G 1M8VA 2XDPA 2R58A 3HFNA 1OI1A 4J8OA 4JLGA 2LVMA 4C92E 4L59A 4M78D 4M78F 5CO7A 3VV0A 3QYHB 1NPPA 3FEOA 3GLXA 1BI1A 3OS5A 3LWHA 1KQ1A 3JB9G 2A3LA 2DTOA 2K4YA 4MZPA 5GAMf 1W4SA 2E1HA 2LNVA 3QPHA 3P8DA 3PIPA 1N8RC 2K5LA 4OB2B 2DZCA 3QIIA 3CXCS 1I5LA 4V2SA 4GLKA 2B8AA 2E5QA 3HP9A 1QP3A 4Z02A 3EFSA 4M77A 5DM7R 4IKFA 2RD1A 2GQVA 4J6WA 1VQ7T 2PUKB 1VQKT 1KC8U 1G3YA 1WJQA 2G3RA 2ZPEB 4O5VA 2JOYA 2E41A 2P4TA 3LX7A 2RM4A 4LD9K 2RJDA 3S3NA 4N4GA 2LTOA 3GNGA 5GMKi 4LDYA 4BACA 1M1FA 1XNIA 4RCBA 3G71T 4M7DG 3VUBA 4XTUA 2QQ9A 3CBPA 3UT1A 3JCMW 2YLBA 3MEAA 2WSFE 4Y91A 3PT9A 3G4ST 4C8QC 1VQ7A 3PMTA 4M7AE 2JN0A 3RIRA 3V7CA 1VQNA 4JRQA 4E7KA 3JCMP 4QW2A 3ZEHA 5KCHA 2RI2A 2ZGWA 5GAOp 4BI4A 4PKCC 2D0QB 3L2VA 3JB9J 3CCLA 1U1TA 4BY6B 3CCET 1BYMA 2LDMA 1N8RU 5J39A 5GANd 1YI2A 2CYZB 2K5IA 1I81A 2CZ1B 5C0MA 3META 4M7DB 3V7SA 4R56A 1DJ7B 3OBWA 3OMCA 4Y28E 2MI6A 4YTLA 2FHDA 3A5ZB 3JSCA 5GMKm 4E7LA 3QO3A 3RKYA 1VQMA 1JJ2S 2CKKA 4M77G 1FWZA 5LJ5h 4M75C 3V8KA 3OYBA 1WJSA 3GF5A 2JUFA 1XTDA 4C92C 3PNWC 3CCEA 2RHIA 5IT9E 3DB3A 5FU7B 5GAN7 2I2LA 2Y90A 3SWNA 4CI0C 3JB9I 3I55A 3RERA 4J6YA 3CCUT 3L42A 4MZTA 1KQSS 3JCMQ 5GMKh 2AHJB 3GOXA 4EPCA 4XK8E 1Q7YC 5HK3A 3HKSA 3CC7T 1WQWA 5CR2A 3RKWA 3SFMA 4C5IA 1W2BS 2XDBA 1O9SA 2RK1A 3OS0A 1G5VA 4HT8A 1M1KC 4JRPA 3M56A 3OSVA 3MEWA 2CS7A 2K3XA 5IN1A 5LJ5j 2DO3A 2P0PA 4F7UG 2DKGA 1VQ5T 4FT4A 3URGA 1QP2A 1PSEA 5LJ3f 1YIJT 1TH7A 4BE2A 1YJWA 3JCMh 4XU2A 3CC4A 1WNLA 3OYFA 1QVGS 1QW1A 1BIBA 4RKUE 1BI3A 4BI8B 3OYDA 3FIFA 4IUQA 3NTHA 5CCAA 3TU4K 4KUDK 3OYGA 4D6WA 3VKIA 1NE8A 4N0AC 3M57A 1M1GA 2JVVA 2R5AA 3OYCA 2QQSA 4J6XA 2KDSA 3QHSA 4VUBA 1VQ5A 3JAME 3LW5E 1NJIC 3SDZA 2DXCA 3A8LB 4F7UB 4PLLA 1I4K1 2VUBA 3BDUA 5LJ3e 1W2BA 2L3RA 3HRSA 1JB0E 1Q7YU 2L89A 3CMET 1M9SA 3EAEA 3ASKA 3HRUA 2RH2A 4FU6A 4HCZA 4X9DA 1VQPT 3J81E 3OYIA 1YJNT 4C8QD 2EQKA 3E19A 4C8QF 1M1KU 4RG8A 3OBYA 5LJ5d 3ZFJA 4JJNK 4M77C 4ZTJA 4L5GA 4BE1A 3JCMX 1VQLT 2X4XA 5CKEA 4CRIA 2RJFA 3QKJA 4J7IA 5GAN8 2LCLA 4C5HA 3X26B 3SWNB 1N9SA 3CC2T 4M7DA 3L2UA 5GAOr 2RO0A 2WSEE 5CK9A 2IG0A 5J26A 4C0DB 5GAN4 1VQPA 4LDUA 2XK0A 5C6SA 3KUFA 2EYQA 3VJPA 4OF1A 4BDZA 2XG8D 3LYIA 3INZA 2NLUA 5GAN6 1VQLA 4XAXB 2JZ2A 4IUVA 5GAMg 4KUIA 2RB6A 1NJIU 4C92F 4C92D 5FU6B 2PUOB 2O4XB 2FL7A 3T9NA 3TEEA 2DJZA 4XTWA 4XQ3A 4EMGA 3OB9A 2ZPGB 4XTVA 2RHUA 1Y71A 2HQXA 2Y4YA 2XDDA 3OYLA 2A7YA 3JCMd 4LDVA 4QQ6A 2EQMA 3PMIA 4XTXA 2P0KA 2ZPBB 4A4EA 3CCRT 2BIVA 2XIDA 4J5YA 3L1AA 5J3BA 4MDWA 3MP1A 3Q1JA 4M78G 2MWOA 4A4KA 2DTHA 1Y07A 1KQ2A 3CBMA 3QG1A 3A8MB 3L2RA 3V8JA 5GAMe 3A8OB 3OW2A 3M9QA 2RA2A 1V29B 4PJOF 4PJOD 3RMQA 3SWNC 2QDYB 2V8IA 5I2SA 5L8RE 3CCRA 3OYNA 4M7DE 1MGQA 3FC3A 2O01E 4HCBA 4HCCA 2KQWA 2KVQG 2V8JA 4IUPA 5GANf 3OSSC 4C0DC 2RHYA 2DXTA 1VQKA 4QQGA 5D6WA 2RI5A 4M78B 5GAN2 3ER0A 4R55A 1O75A 1Q86U 3CXCA 1RI0A 4M7AF 4M7AD 4F7UA 4IUUA 4BB7A 2XI9A 1ZBXA 3BY7A 3AHUA 5A0DA 4A4GA 2K57A 2ZPIB 3E1SA 3GNFB 2DPPB 2EFIA 4OB1B 3G71A 1VQ6T 2XD0A 3CD6T 3CCJT 3WVDB 5DLQE 5GANe 3G4SA 2X4YA 2CZ6B 2KSSA 5GAOq 4JLIA 4NL3A 4M77E 1K73C 2DVEA 2GFUA 3M4YA 2LRQA 2PU9B 5CKFA 2LC4A 1UGSB 1LJOA 2M0OA 2MAMA 5IAYA 3FJPA 1VQ6A 3FB9A 3TREA 1Y96B 3OYYA 3PGGA 3ZBDA 4DOVA 3CCJA 3RESA 4PJOB 3QBYA 2VXFA 2QEXT 3CCMT 3CPFA 2VV5A 3H8ZA 2PVGB 2BKDN 2LCCA 1NPRA 3RKXA 2E64A 4NS5A 3OY9A 1VQOT 2OTJT 3KBGA 3LH0A 5LL6S 3OQ5A 2KAFA 3CEYA 3HHTB 5CKDA 2EJ9A 4M7AB 2E10A 5KE3A 4QVCA 1OZ2A 3X20B 4MMKA 2O4XA 1KD1C 2MMPA 3HL8A 5LJ3g 3CCUA 1BIAA 3M53A 5GAN3 2QEXA 3CCST 3RUXA 4JRIA 4F7UE 1JJ2A 1XOVA 3G6ET 1LNXA 4BY6C 2X4WA 4BUGA 2GCXA 2P0QA 2EJFA 3A8HB 5LJ3j 4HT9A 4O6JA 3CC7A 1VQOA 2QA4T 4FL6A 4PLIA 3JCMV 2L5QA 4M7DC 4J7FA 1U8RA 3DLLA 2F5KA 1ZQ1A 3ME9A 1Q81C 1Q86C 1K73U 3PFSA 3MHXA 4KULA 2E65A 1MHNA 2XU8A 3V8LA 4JS4A 3JRZA 3NTKA 1KQSA 3CCQT 3S3OA 1BI2A 3CCSA 2QQRA 3G6EA 1RL2A 4JUVA 4FM4B 1FX7A 2PQWA 1YIJA 5FU7C 2YRVA 5A2QE 2E70A 5HKCA 2QA4A 5CQYA 5KE2A 4LDXA 3S6WA 3C4SA 4A54A 2DIQA 3X24B 1S72T 2FYKA 3X25B 3E9GA 3JCMb 4M78A 1ZHIA 1N27A 2PVDB 4C92A 2Y4XA 3C94A 2LT4A 5GAMh 5HY6A 2HQEA 2K2VA 2MWPA 1UGPB 3QZ9B 3OMGA 3VUZA 2DK3A 1Y7XA 3I56T 1VQ9T 1QVGA 3M58A 1H3ZA 3JCMc 3L2ZA 3KXTA 4E7IA 3C12A 3MEUA 3NTIA 4OGEA 3JCMJ 3CMEA 2M9UA 1BKBA 2PVOB 1UGRB 3M54A 4X9CA 4HA8A 1KHIA 3C95A 4DA4A 3CBOA 3OYKA 2EKOA 3HRTA 3OS1A 1N6AA 1Q81U 2DTIA 2OAUA 2HBPA 4J83A 2QQAA 4JRKA 1YJNA 1D3BB 2DZ9A 2RI3A 4N4HA 1YITT 3J7AF 4A4HA 5GMKe 3MO8A 5GMKl 3TCJA 4B9XA 4C8QG 1UB4A 1YJ9T 5DY9A 1Q82C 2RJEA 4M75D 2F5TX 3R6OA 4M75F 4QQDA 3JCMf 1VQ4T 3QSUA 1YHQT 5A0GA 2GF7A 1X75C 4RMOA 4ATOA 5CIUA 1G3SA 3BW1A 1Y96A 2JNGA 4UC4A 3CC2A 4PJOA 2RHXA 4N4IA 5FROA 5GAMj 5GAOm 2YHTA 3JB9D 3JB9F 4OMFB 2QXFA 5CKBA 5FLXE 5KCOA 3OYHA 1LOJA 1YJ9A 3WVEB 1G3TA 4LD6A 4C8QB 3BFMA 3JCMe 3M5AA 4E7HA 2E6ZA 2FB7A 2HD0A 4M78E 4RG2A 4M7AA 2E6NA 5FRNA 2X35A 3WXMB 4BE0A 4C92G 2DD4A 2RJCA 2R57A 1NZ9A 4XU3A 4DQ2A 4JDSA 1SSFA 1XQHA 2BUDA 2R5MA 2XHCA 1AHJB 3E9FA 4BD3A 5GANg 1M90C 1FXXA 1R8OB 3NFCA 3QJYA 1N9RA 3CMAT 3DKMA 4II1A 4M7DD 5GANj 4M7DF 1Q82U 5D6YA 1WPYA 1M5Q1 1K8AC 1QVFS 4XU0A 5FRMA 2JTMA 3FRNA 1YBYA 2EQJA 1OYXA 4M75B 1I8FA 5GAN5 1VIFA 4X34A 4C92B 5GAMd 2WSCE 2KMTA 1VUBA 1M4ZA 4C5GA 4EMKA 4ZGDB 3OYEA 1VQNT 4BI3A 5FU6C 2QQBA 3A8GB 2VXEA 1B34B 3MCAB 3QJ6A 2F69A 4PJOG 3X28B 3CPWS 4PJOE 4P5NA 4JS5A 3CCLT 3CMAA 3DB4A 1YI2T 1K9MC 3DLMA 3FLGA 3L2QA 2QI2A 5I21A 3VU3C 1YCYA 1X6OA 2KK4A 3G7ZA 3SD4A 3J80E 3UWNA 5CQXA 3QUIA 4XU1A 3GPLA 2OTLT 4M77D 1BI0A 4M77F 4PL6A 2HNIA 4OGCA 2MF2A 3OYAA 4M7AG 2RK2A 3O8VA 2XICA 5LJ3h 1VQMT 1P92A 4HKEA 2VYTA 2DIGA 3P8HA 4XTYA 1QVFA 3CD6A 1VIEA 3MP6A 3S3MA 2V8KA 5HK0A 4C0ZA 4FSXA 2YLCA 1M90U 1UEBA 2CZ7B 4A4FA 4ZGJB 2IVWA 4NL2A 3I55T 1D3BA 1K8AU 4OB3B 4MDXA 4XTZA 4FIBA 3CPWA 4Q5WA 4PNOA 2OTLA 4OB0B 2L8DA 2ZZDA 1OZ3A 3H6ZA 4WF2A 3CCVT 4M78C 2H3JA 4EMHA 4KBMB 1U1SA 3BDLA 4TVRA 4ME7A 2EWNA 2XKOC 3OYMA 3CCMA 2DXUA 2FVUA 5D6XA 3L2WA 3M55A 5GAOl 2EIFA 2EJGA 2QTXA 4F7UF 2CGHA 4DOWA 5CKHA 1K9MU 2OTJA 2RHZA 2WACA 3QDRB 3PTAA 1HK9A 2GFAA 4E47A 3RMSA 4C8QA 1QVPA 2C06A 3HSBA 3LLRA 1YJWT 3EFRA 3CC4T 2K5FA 3LGLA 3CCVA 4M77B 1JRIA 4BDYA 2DD5A 5LJ5g 3F70A 4ELZC 4ZTFA 1WGSA 3VYHB 3LWIA 3JB9H 4EMKB 2E12A 2LQ8A 5LJ5f 4E7JA 2VGNA 4RCCA 3P8BB 4EDUA 3GIBA 1WQ7A 3QXEB 1UGQB 5EG2A 3OA6A 4PJOC 2LQKA 5CVIA 2LT1A 4LDWA 4ZN3A 3VYGA 2ZPFB 4QVDA 3OYJA 3GP8A 2KY9A 4C0GA 4C0FA 4M75A 4C5EA 3CCQA 2X4JA 5A0LA 5GMKj 3UPUA 4ZN1A 4OP0A 4M7AC 1H641 5LJ5e 5LJ3d 3PIOA 1B34A 1WJRA 4B9WA 2M16A 4MZMA 3M59A 1KD1U 1S72A 2CZ0B 4GY5A 5DLOA 2DXBA 1KHCA 3MEVA 4L6V5 1VQ8T 2ZCFB 4FT2A 5AYFA 3JCMg 4A53A 1IZ6A 5CAIA 2DEQA 4NOYA 3OS2A 3M4GA 2EQUA 3N5BB 3MP8A 4OVAA 1X01A 4C8QE 1VQ9A 3QZ5B 3I56A 1G3WA 2D9TA 2JTFA 4ZGEB 2DAQA 2VC8A 2EAYA 1IREB 2HAXA 1PSFA 1KC8C 4IUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWH A;  2JTM A;  4R55 A;  3KXT A;  4R56 A;  3LWI A; 
#chains in the Genus database with same CATH topology
 1KG1 A;  4EMK C;  3LGF A;  5GAN h;  2LX9 A;  1VQ8 A;  4QVZ A;  1YIT A;  2M1H A;  1JBM A;  3EH1 A;  1OX8 A;  2GBQ A;  2DL7 A;  2R58 A;  2RQT A;  3I5S A;  4JLG A;  4C92 E;  5CO7 A;  3QYH B;  2CP5 A;  1ACM B;  3BE3 A;  4MZP A;  2H8H A;  2E1H A;  3QPH A;  3PIP A;  3P8D A;  1JEG A;  1N8R C;  4OB2 B;  2DZC A;  1UHF A;  3QII A;  4V2S A;  3HP9 A;  3EFS A;  5DM7 R;  1VQP Q;  2RD1 A;  4J6W A;  1YJN Q;  2LX7 A;  1VQ7 T;  1KC8 U;  1G3Y A;  1LVK A;  4PJM A;  2G3R A;  1VQL Q;  2JOY A;  2E41 A;  2A0F B;  2RJD A;  4N4G A;  5GMK i;  3CC2 Q;  1XNI A;  3G71 T;  1B7T A;  2QQ9 A;  2JT4 A;  3EG0 A;  2WSF E;  1YP5 A;  3M0R A;  4OMP A;  3PMT A;  4M7A E;  1X43 A;  3JCM P;  4QW2 A;  3ZEH A;  4DBQ A;  2ZGW A;  4OMM A;  4PKC C;  2D0Q B;  4J9F A;  3CCL A;  1U1T A;  4BY6 B;  1BYM A;  2DBK A;  2KXC A;  1N8R U;  4AFU C;  5J39 A;  2CYZ B;  2K5I A;  3MET A;  2YUO A;  1YNZ A;  4Y28 E;  4YTL A;  4B6M A;  3CCR Q;  1PM3 A;  5LJ5 h;  1FWZ A;  4C92 C;  1PG5 B;  3PNW C;  5L23 A;  2Y90 A;  4CI0 C;  1X6G A;  3I9Q A;  1LCK A;  3L42 A;  4MZT A;  2HKQ B;  4F04 B;  3GOX A;  1M2O A;  1Q7Y C;  5KYU B;  2B86 A;  2KI7 A;  3EHQ A;  2QGF B;  4HVU A;  2DIL A;  4JRP A;  2CS7 A;  2K3X A;  1PRM C;  2P0P A;  1KFZ A;  2DKG A;  1VQ5 T;  4XU2 A;  5IXF A;  2LCS A;  4RKU E;  2RQR A;  2QTV A;  4IUQ A;  1T0J A;  5CCA A;  3OYG A;  1M30 A;  1TG0 A;  3SDZ A;  2HCK A;  3A8L B;  2K79 A;  1GFD A;  2VUB A;  1JB0 E;  1Q7Y U;  2NUT A;  3CME T;  3ASK A;  5EC7 A;  2OTJ Q;  3OYI A;  3PE0 A;  1SPK A;  3OBY A;  4ZTJ A;  1U5S A;  4CRI A;  1K1Z A;  1RAC B;  1GCQ A;  2YWW A;  4X1V A;  4D8D A;  4M7D A;  3L2U A;  5GAO r;  2RO0 A;  2YXY A;  2KT1 A;  4LDU A;  5C6S A;  2LZ6 B;  2P4R A;  5IHI A;  3EGX B;  3INZ A;  4C92 F;  3T9N A;  2DJZ A;  1K9M R;  1GL5 A;  1I1J A;  1SF9 A;  2Y4Y A;  2XDD A;  2A7Y A;  4LDV A;  1S72 Q;  4PJL A;  2A28 A;  4J5Y A;  5KYY A;  4MDW A;  2YUN A;  1SHG A;  4A4K A;  1CKA A;  1KQ2 A;  1Y07 A;  1GBR A;  3CBM A;  3RDV A;  2CP3 A;  3M0Q A;  2QGG A;  3M9Q A;  2YT6 A;  4ORZ A;  2QDY B;  2KYB A;  5IH2 A;  4M7D E;  3TSZ A;  2O01 E;  2IPO B;  3OSS C;  5GAN f;  1YIT Q;  5D6W A;  5GAN 2;  1HSQ A;  9ATC B;  1TUC A;  4R55 A;  1RAI B;  1IRX A;  1TTH B;  4M7A F;  5AT1 B;  2M02 A;  2K57 A;  3E1S A;  4A4G A;  2EFI A;  2XD0 A;  3CD6 T;  1Q81 R;  2EKH A;  5GAN e;  1AWX A;  2M0Y A;  2EQI A;  5GAO q;  1B07 A;  1PWT A;  1K73 C;  2YRD A;  2LRQ A;  2PU9 B;  5CKF A;  1QVF P;  2LC4 A;  3LH5 A;  2QDL A;  1PC0 A;  1VQ6 A;  2ROL A;  3TRE A;  1Y96 B;  3OYY A;  3CCJ A;  1E7O A;  2VXF A;  3CCM T;  1ZUU A;  2VWF A;  2DL3 A;  2EW3 A;  4JJC A;  3RKX A;  2E5K A;  2IIM A;  3OQ5 A;  2X3X D;  4M7A B;  2E10 A;  2ESW A;  1BCO A;  1ZLM A;  4MMK A;  5LJ3 g;  3CCU A;  3RUX A;  2FPD A;  2GNC A;  2GCX A;  3A8H B;  1GCQ C;  4O6J A;  2L0A A;  3CC7 A;  3CCL Q;  2O31 A;  1AZE A;  1E6G A;  3JCM V;  4M7D C;  1U8R A;  1UE9 A;  2JMC A;  1YWO A;  1K73 U;  2CSI A;  3MHX A;  3QWY A;  3SEM A;  1FMV A;  2PQW A;  5FU7 C;  2CH4 A;  3H41 A;  2QA4 A;  5KE2 A;  4A54 A;  3X24 B;  4J9E A;  2FPE A;  2MK5 A;  3E9G A;  4M78 A;  2DEU A;  1ZHI A;  3REB B;  2DL4 A;  2PVD B;  2Y4X A;  2CP7 A;  2LT4 A;  5GAM h;  5HY6 A;  2HQE A;  2MWP A;  1VQ9 T;  4J9D A;  4Z89 A;  3L2Z A;  3C12 A;  2EKO A;  1WLP B;  1N6A A;  3M0P A;  2QQA A;  1UHC A;  1UB4 A;  1YJ9 T;  5DY9 A;  2RJE A;  1YCS B;  2DYB A;  4ATO A;  4PFZ A;  5GAO m;  3JB9 D;  4OMF B;  2QXF A;  5KCO A;  1PHT A;  1KSW A;  4LD6 A;  3BFM A;  4E7H A;  4M78 E;  3RR6 A;  4RG2 A;  3GBQ A;  4JPB W;  1NZ9 A;  1UGV A;  2EYZ A;  4DQ2 A;  1XQH A;  1AHJ B;  1QCF A;  3CMA T;  4M7D F;  1WPY A;  1W70 A;  2LP5 A;  1VIF A;  4AG1 C;  1IB8 A;  1VQN T;  1B34 B;  4A63 B;  3THK A;  2CUD A;  4JS5 A;  5D7U A;  4PK4 A;  1YI2 T;  2JS0 A;  3VU3 C;  1YCY A;  1Q95 G;  1X6O A;  4J9C A;  4M77 D;  4LXC A;  1M2V B;  3NMZ C;  2VYT A;  2DIG A;  4XTY A;  1QVF A;  3MP6 A;  3S3M A;  5HK0 A;  2EYX A;  1ZUK A;  4FSX A;  4C0Z A;  2CZ7 B;  4A4F A;  4ZGJ B;  2FG0 A;  2IVW A;  3I55 T;  1D3B A;  2DE0 X;  4OB3 B;  4FIB A;  3CPW A;  4Q5W A;  2OTL A;  1OPL A;  2ZZD A;  4WF2 A;  4M78 C;  4EMH A;  4TVR A;  2FVU A;  2EIF A;  2GFA A;  4E47 A;  3RMS A;  4C8Q A;  2C06 A;  3HSB A;  2QAZ A;  3CCV A;  2DD5 A;  4WTO B;  4ZTF A;  2C0T A;  2HBW A;  4EIK A;  4CC3 A;  3QXE B;  2LT1 A;  4KGV B;  1RAG B;  4QVD A;  2P84 A;  2NUP B;  3CCQ A;  4Z88 A;  5A0L A;  3VS5 A;  1IHW A;  3O5Z A;  7AT1 B;  1W2B P;  3PIO A;  2D8J A;  4B9W A;  1ZSZ A;  5DLO A;  4GY5 A;  1H92 A;  3CCU Q;  4FT2 A;  3JCM g;  4RTX A;  4C8Q E;  2EQU A;  3N5B B;  2RQU A;  3CC7 Q;  2EAY A;  1IRE B;  2HDA A;  2GTJ A;  2FZG B;  1PSF A;  2ZPH B;  5M9O A;  4OMQ A;  1HXD A;  3HPW A;  1EIF A;  2K3Y A;  2XMF A;  2HKN A;  3TQ7 P;  3NGP A;  5KH6 A;  1RAB B;  2ABL A;  4N0A A;  1BB9 A;  2MPX C;  4LN2 A;  4KH0 B;  4M78 F;  2DM1 A;  2M51 A;  3FEO A;  1K0S A;  3LWH A;  3JB9 G;  5GAM f;  2K5L A;  4KH1 B;  4Z02 A;  3PVQ A;  4M77 A;  4IKF A;  1QWE A;  3UF4 A;  1K4U S;  2JXB A;  3S3N A;  2LTO A;  3GNG A;  4LDY A;  1M1F A;  3CBP A;  2HEQ A;  1M1K R;  1VQ7 A;  1K9A A;  4C8Q C;  2JN0 A;  2SEM A;  8ATC B;  3CCE T;  2LDM A;  1I81 A;  2CZ1 B;  2AZS A;  2DA9 A;  4ZNX A;  1DJ7 B;  3OBW A;  3OMC A;  3REA B;  5KYW A;  4R56 A;  2MI6 A;  4OMO A;  3A5Z B;  3JSC A;  3VS3 A;  1VQM A;  2CKK A;  4M77 G;  3V8K A;  1I0C A;  1NJI R;  2X51 A;  1X2K A;  2RHI A;  5IT9 E;  4JJB A;  2I2L A;  3RER A;  4KGX B;  1ZSZ C;  2AHJ B;  3RKW A;  3SFM A;  1H3H A;  4C5I A;  2VVK A;  4LNP A;  3OSV A;  5LJ5 j;  5IN1 A;  1Y0M A;  1QP2 A;  3CC4 A;  1PNJ A;  1D1A A;  3NTH A;  1MMA A;  4D6W A;  4N0A C;  2JVV A;  3OYC A;  1M3B A;  2DRM A;  4VUB A;  1UUE A;  2HZY A;  1VQ5 A;  4J9G A;  4F7U B;  1W2B A;  1WHK A;  2L3R A;  2LNH B;  2QEX Q;  2L89 A;  1M9S A;  3HRU A;  6AT1 B;  1PKS A;  2RH2 A;  4FU6 A;  4HCZ A;  4X9D A;  1VQO Q;  1VQP T;  1YJN T;  4FYX B;  4C8Q F;  4RG8 A;  4M77 C;  1VQL T;  3JCM X;  2RN8 A;  2BZ8 A;  3QKJ A;  4J7I A;  5GAN 8;  3SWN B;  3CCS Q;  3G6E Q;  3CC2 T;  5IHN A;  2IG0 A;  4C0D B;  2KRO A;  4OF1 A;  4BDZ A;  5GAN 6;  2NLU A;  2G6F X;  3CCQ Q;  4KUI A;  2RB6 A;  1D09 B;  2PUO B;  3TEE A;  1RLP C;  4XQ3 A;  1E6H A;  3OB9 A;  2ZPG B;  4PJJ A;  2LQW A;  1Y71 A;  2HQX A;  3OYL A;  2H3E B;  3PMI A;  2ZPB B;  3CCR T;  2XID A;  2F2W A;  3L1A A;  5J3B A;  1QWF A;  5GJW B;  3Q1J A;  2MWO A;  4OML A;  3EGD B;  1SRL A;  1K76 A;  3QG1 A;  3A8O B;  1V29 B;  4PJO D;  3EG3 A;  3OYN A;  4HCB A;  2KVQ G;  2V8J A;  2RHY A;  4E7Z A;  1VQK A;  1SKU B;  1KD1 R;  2RI5 A;  1AEY A;  1OOT A;  2SRC A;  3NHN A;  4Z8A A;  3VRZ A;  4BB7 A;  3BY7 A;  1PCX A;  1LPL A;  3GNF B;  3EFO A;  2DPP B;  1TS9 A;  3WVD B;  3MJX A;  3G4S A;  2KSS A;  4JLI A;  4NL3 A;  3MPU B;  2DVE A;  1MUZ A;  1LJO A;  4DOV A;  2HMA A;  2HSE B;  2AKK A;  2OTJ T;  3LH0 A;  4J9B A;  1YFN A;  1TOV A;  4HVW A;  2HL3 A;  2O4X A;  2MMP A;  3HL8 A;  3M53 A;  1WIE A;  4JRI A;  1LNX A;  4J9I A;  2X4W A;  2P0Q A;  4HT9 A;  2FEI A;  3ZL7 C;  2FPF A;  2JJ9 A;  4PLI A;  2L5Q A;  2GGR A;  1Q81 C;  1Q86 C;  3EG9 A;  4KUL A;  1MHN A;  5KYX A;  3JRZ A;  4RTT A;  1VQM Q;  1FX7 A;  1YIJ A;  5HKC A;  4AT1 B;  3S6W A;  3C4S A;  1S72 T;  2DIQ A;  2FYK A;  1WX6 A;  1KC8 C;  2MCN A;  3QZ9 B;  3M0S A;  2PZ1 A;  3OMG A;  1Y7X A;  1RLQ C;  1H3Z A;  4HXJ A;  3NTI A;  4DBR A;  3C95 A;  2EGE A;  3CBO A;  3SHW A;  1Q81 U;  1Q86 U;  3EG1 A;  4J83 A;  2DZ9 A;  1YIT T;  3J7A F;  2C0I A;  4R0K A;  1Q82 C;  3CC4 Q;  4M75 D;  2F5T X;  4QQD A;  3H0H A;  5CIU A;  1G3S A;  2JTE A;  3VS1 A;  2ROT A;  2JNG A;  4UC4 A;  4PJO A;  2BZY A;  2RHX A;  5GAM j;  2YHT A;  2CP2 A;  5FLX E;  3E2U A;  3IQL A;  2EBP A;  1VYT A;  1YJ9 A;  2FB7 A;  2HD0 A;  3WXM B;  2K7A A;  2DD4 A;  2ENM A;  2R57 A;  1AT1 B;  4XU3 A;  4F14 A;  2XHC A;  3E9F A;  5GAN g;  1D0Z A;  1R8O B;  3NFC A;  4II1 A;  1VQ8 Q;  1Q82 U;  5D6Y A;  1M5Q 1;  1K8A C;  1QVF S;  3A1P A;  2FRY A;  2JTM A;  3FRN A;  5GAN 5;  1SHF A;  4C92 B;  1GCP A;  2KT8 A;  1M4Z A;  2WSC E;  4C5G A;  5FU6 C;  2QQB A;  2VXE A;  4PJO E;  4PJO G;  2EGA A;  3CPW S;  1JQQ A;  1Q7Y R;  4P5N A;  2MOX A;  3CCL T;  3CMA A;  2A36 A;  4J9H A;  3DLM A;  3FLG A;  3R6N A;  2KK4 A;  3G7Z A;  3J80 E;  4DEX A;  5CQX A;  4ESR A;  3GPL A;  3OYA A;  2D0N A;  3O8V A;  2YUQ A;  3P8H A;  2V8K A;  1TSF A;  4OMN A;  1UEB A;  3CPW P;  4NL2 A;  1K8A U;  2QK0 A;  2A08 A;  4AFZ C;  4LUD A;  3H6Z A;  1U1S A;  3BDL A;  3U23 A;  1PRL C;  2EWN A;  4ME7 A;  1VQK Q;  5IXB A;  2MIO A;  5D6X A;  1AVZ C;  2EJG A;  2QTX A;  4DOW A;  5CKH A;  2BZX A;  3PTA A;  1HK9 A;  3LLR A;  3EFR A;  3G4S Q;  5LJ5 g;  1WGS A;  3LWI A;  1XJW B;  1JO8 A;  5LJ5 f;  2VGN A;  3P8B B;  5EG2 A;  1T3L A;  4PJO C;  5CVI A;  2ZPF B;  2KY9 A;  1U3O A;  4C0G A;  4C0F A;  2E3I A;  4M75 A;  1ZSG A;  3UPU A;  1F1B B;  4RTU A;  2DRK A;  1Z9Q A;  5LJ5 e;  5LJ3 d;  1WJR A;  1KIK A;  5ECA A;  2KBT A;  1KHC A;  4L6V 5;  1NYG A;  3EHR A;  1WHG A;  2ZCF B;  5AYF A;  3PVL A;  4A53 A;  2ATC B;  3M4G A;  3MP8 A;  1X01 A;  3QZ5 B;  3I56 A;  3A98 A;  2KRS A;  2ED0 A;  2JTF A;  1QKW A;  2I0N A;  4MML A;  2D6F A;  1PKT A;  2OX7 A;  2BE7 D;  1YIJ Q;  3HFO A;  1VQ4 A;  5I2M A;  3UDC A;  3VRY A;  1GXI E;  1YHQ A;  3V7R A;  1M8V A;  4M75 E;  3SB2 A;  4M75 G;  1WHH A;  2XDP A;  3HFN A;  4L59 A;  1WXB A;  1BI1 A;  4DBH A;  1NG2 A;  1FMK A;  2A3L A;  2DTO A;  1JXO A;  1W4S A;  2LNV A;  2LJ1 A;  3CXC S;  1K73 R;  3H0F A;  1QP3 A;  1IGU A;  2FZC B;  2GQV A;  3I5R A;  1WJQ A;  1R0C B;  2P4T A;  2RM4 A;  1W6X A;  4BAC A;  2NUT B;  4XTU A;  1UEC A;  1C0M A;  1CSK A;  3JCM W;  2YLB A;  3MEA A;  3CXC P;  1IGQ A;  3PT9 A;  3RIR A;  3VS7 A;  5KCH A;  2J05 A;  5GAO p;  4BI4 A;  2AK5 A;  1ARK A;  3HTR A;  2FRW A;  2NYS A;  4M7D B;  1Z9Z A;  4RTZ A;  2FHD A;  5GMK m;  3QO3 A;  3RKY A;  1WXU A;  4M75 C;  3OYB A;  1WJS A;  3CCE A;  2EYW A;  2O88 A;  1QMC A;  3KFV A;  5FU7 B;  3SWN A;  1X2Q A;  2AT1 B;  4J6Y A;  3CCU T;  2YRC A;  1KQS S;  3JCM Q;  5HK3 A;  3HKS A;  3CC7 T;  1WQW A;  1W2B S;  5KYY B;  1G5V A;  4HT8 A;  1M1K C;  3M56 A;  1OQK A;  3MEW A;  2D8H A;  4F7U G;  2J6F A;  4FT4 A;  3URG A;  1VQ6 Q;  1PSE A;  1TH7 A;  1YJW A;  3CCJ Q;  1WNL A;  1KQS P;  1BIB A;  1BI3 A;  4BI8 B;  3OYD A;  3FIF A;  3TU4 K;  2V1Q A;  2CH4 W;  3VKI A;  1NE8 A;  1M1G A;  2OI3 A;  4J6X A;  1ABO A;  1NJI C;  2K6D A;  3M0T A;  3HRS A;  2EGC A;  1WZO A;  1I07 A;  3J81 E;  2EQK A;  3E19 A;  2XDB A;  1M1K U;  2QG9 B;  4JJN K;  3ZFJ A;  3QDF A;  1WI7 A;  2RJF A;  2LCL A;  4C5H A;  3X26 B;  1AOJ A;  2K9G A;  2AZV A;  4PFP A;  1VQP A;  2QA4 Q;  2EYQ A;  1VQL A;  4FSS A;  2W10 A;  5GAM g;  1NJI U;  4C92 D;  2X3W D;  2KXD A;  2J6K A;  4XTW A;  4EMG A;  4XTV A;  1C1A A;  5KYU A;  3JCM d;  2JM8 A;  2EQM A;  4A4E A;  3EH2 A;  2BIV A;  2OAW A;  2DTH A;  1MMN A;  3A8M B;  3L2R A;  3V8J A;  5GAM e;  3I56 Q;  1W1F A;  2RA2 A;  3SWN C;  2V8I A;  3CCR A;  1MGQ A;  3FC3 A;  1FYN A;  4IUP A;  4C0D C;  2DXT A;  2DNU A;  4M78 B;  5GJV B;  1RAE B;  3CXC A;  1RI0 A;  1VQ4 Q;  4M7A D;  1YHQ Q;  1V1C A;  2CP0 A;  2XI9 A;  2JW4 A;  4RUG A;  3AHU A;  5A0D A;  2ZPI B;  3G71 A;  2J06 A;  1KJW A;  1D0X A;  2CP6 A;  4JJD A;  2CT3 A;  4FYW B;  2X4Y A;  2CZ6 B;  4M77 E;  1AWJ A;  2GFU A;  2MAM A;  4D8K A;  5IAY A;  3FB9 A;  3PGG A;  3ZBD A;  2QEX T;  1BK2 A;  3CPF A;  3H8Z A;  1PD1 A;  2BKD N;  2E64 A;  4NS5 A;  3OY9 A;  1VQO T;  3EGX A;  1AWO A;  2KAF A;  1SSH A;  5CKD A;  2EJ9 A;  3RNJ A;  4QVC A;  1OZ2 A;  1KD1 C;  1BIA A;  5GAN 3;  3CCS T;  4HCC A;  1XOV A;  3G6E T;  3MKD A;  4BY6 C;  4BUG A;  4IIM A;  2EJF A;  5LJ3 j;  1HD3 A;  2L2P A;  4J7F A;  3DLL A;  2F5K A;  1GBQ A;  1KQS A;  2XU8 A;  3V8L A;  4JS4 A;  3NTK A;  3CCQ T;  1RI9 A;  2OTL Q;  3NPF A;  1U06 A;  1RL2 A;  4FW1 A;  4JUV A;  1WHM A;  2YRV A;  5A2Q E;  2E70 A;  5CQY A;  4LDX A;  1UJY A;  1A0N B;  1VOM A;  2EYY A;  2LMJ A;  3X25 B;  2J6O A;  3JCM b;  4C92 A;  1KD1 U;  2EVR A;  2K2V A;  3CCV Q;  4FW2 A;  3JCM c;  1M90 R;  1UDL A;  1V76 A;  2VAS A;  4E7I A;  4AMC A;  3MEU A;  3JCM J;  4OGE A;  3CME A;  2M9U A;  2PVO B;  4X9C A;  1RAF B;  3HRT A;  3OS1 A;  2HBP A;  4JRK A;  1D3B B;  2RI3 A;  5GMK l;  3TCJ A;  1YJW Q;  4RMO A;  1X75 C;  2LJ3 A;  3BW1 A;  1Y96 A;  4N4I A;  3JB9 F;  5CKB A;  2K2M A;  4PJN A;  3D7S B;  1G3T A;  4LE9 A;  4C8Q B;  3M5A A;  4M7A A;  4RTY A;  2E6N A;  5FRN A;  2X35 A;  4C92 G;  4K11 A;  4WCI A;  4KUD K;  2BUD A;  2R5M A;  4BD3 A;  1MND A;  1N9R A;  4M7D D;  1VA7 A;  5FRM A;  1D1C A;  1YBY A;  1X6B A;  2LQN A;  4CC2 A;  2KMT A;  1VUB A;  3VS6 A;  2DET A;  3A8G B;  3MCA B;  3QJ6 A;  2F69 A;  1BCM A;  1ZSZ B;  4KRT A;  1K9M C;  2QI2 A;  2F2V A;  4M77 F;  4M7A G;  2HNI A;  1BBZ A;  2MF2 A;  2CSQ A;  1VQM T;  2XIC A;  5LJ3 h;  1P92 A;  4HKE A;  2O9S A;  3H0I A;  3CD6 A;  1VIE A;  1I5O B;  4F17 A;  1OU9 A;  4XTZ A;  2KGT A;  2DBM A;  4OB0 B;  2L8D A;  2FZK B;  1G8X A;  1VQ7 Q;  1ZX6 A;  2XKO C;  3OYM A;  3CCM A;  3L2W A;  3M55 A;  1TU0 B;  1AWW A;  2CGH A;  1MMG A;  1K9M U;  2WAC A;  1JU5 C;  3QDR B;  3G71 Q;  1QVP A;  4LUE A;  3CC4 T;  2K5F A;  4M77 B;  1JRI A;  1KC8 R;  4ELZ C;  3VYH B;  4EMK B;  4RCC A;  2F2X A;  4EDU A;  1WQ7 A;  3OA6 A;  1NLO C;  4LDW A;  4ZN3 A;  1NBE B;  3VYG A;  4ANJ A;  1SG5 A;  2X4J A;  2GTO A;  5GMK j;  4M4Z A;  2W0Z A;  4M7A C;  2O9V A;  3JV3 A;  1B34 A;  1N8R R;  1RUW A;  4MZM A;  3M59 A;  2CZ0 B;  2DL5 A;  1NEG A;  4CC7 A;  1ZUY A;  1UJ0 A;  1VQ8 T;  2ECZ A;  2CRE A;  2DEQ A;  4NOY A;  5KYW B;  4OVA A;  2LJ0 A;  1VQ9 A;  1YWP A;  1G3W A;  1M2V A;  2D9T A;  4ZGE B;  2DAQ A;  5IHK A;  2HAX A;  2RQV A;  1HYO A;  1TUG B;  4IUR A;  3QYG B;  1OX9 A;  1VQ5 Q;  5GAO n;  2VGM A;  4KT0 E;  4ELY C;  2DF6 A;  3FDR A;  4GBQ A;  3OW2 S;  4F16 A;  2V26 A;  1QCO A;  2YSQ A;  1OI1 A;  4J8O A;  2LVM A;  4M78 D;  3VV0 A;  1QQJ A;  1C6V X;  1NPP A;  3OS5 A;  3GLX A;  2CUB A;  4QKU A;  1KQ1 A;  2K4Y A;  1IXD A;  2COZ A;  2DJQ A;  3G1J A;  4E6R A;  1T3S A;  1NEB A;  3VS2 A;  3CME Q;  1UG1 A;  3I35 A;  1I5L A;  4GLK A;  1N5Z A;  2B8A A;  2E5Q A;  2PTK A;  2DL8 A;  3M0U A;  1G2B A;  2PUK B;  3OW2 P;  1VQK T;  2RNA A;  2KRN A;  2ZPE B;  4O5V A;  3LX7 A;  3ULR B;  4LD9 K;  2DX1 A;  4RCB A;  2NUP A;  4M7D G;  3VUB A;  3UT1 A;  1M3A A;  2VKN A;  1TXQ A;  4Y91 A;  3G4S T;  2DMO A;  2RF0 A;  1UFF A;  3V7C A;  1VQN A;  4JRQ A;  4E7K A;  1MMD A;  1AD5 A;  2DFU A;  2RI2 A;  3L2V A;  3JB9 J;  1MV3 A;  4IIO A;  2X9H A;  5GAN d;  1YI2 A;  3C0C A;  3VS0 A;  5C0M A;  1Q86 R;  3V7S A;  4E7S A;  2E4H A;  4E7L A;  2KE9 A;  1JJ2 S;  3GF5 A;  2JUF A;  1XTD A;  3DB3 A;  5GAN 7;  3JB9 I;  3I55 A;  5GMK h;  4EPC A;  2CDT A;  4XK8 E;  1BU1 A;  1OUL A;  5CR2 A;  1VYV A;  1PD0 A;  1SEM A;  1O9S A;  2RK1 A;  3AT1 B;  3OS0 A;  1JJ2 P;  4PFO A;  2DVJ A;  2DO3 A;  5LJ3 f;  4FYY B;  1YIJ T;  4BE2 A;  3CD6 Q;  3JCM h;  1OV3 A;  2Z0W A;  3OYF A;  1Q82 R;  1QVG S;  1QW1 A;  1M8M A;  3M57 A;  2R5A A;  2QQS A;  2KDS A;  3QHS A;  3JAM E;  3LW5 E;  2DXC A;  4PLL A;  1I4K 1;  3BDU A;  5LJ3 e;  3EFO B;  3CCM Q;  3EAE A;  1NLP C;  4RTV A;  1M3C A;  1SRM A;  4AFS C;  1QVG P;  4C8Q D;  2L3P A;  5LJ5 d;  2KR3 A;  2HQH A;  2J7I A;  4L5G A;  4HCK A;  4BE1 A;  2X4X A;  5CKE A;  2COW A;  2BE9 B;  1N9S A;  2L3Q A;  1K8A R;  2WSE E;  5CK9 A;  5J26 A;  5GAN 4;  2K3B A;  2XK0 A;  3KUF A;  3VJP A;  2XG8 D;  3LYI A;  4XAX B;  2JZ2 A;  4IUV A;  2JS2 A;  5FU6 B;  1Y57 A;  2O4X B;  2FL7 A;  3TSW A;  3VS4 A;  2RHU A;  2O2O A;  2C0O A;  2F1L A;  1QCN A;  4QQ6 A;  1M27 C;  4XTX A;  2P0K A;  1RAD B;  3EG9 B;  3MP1 A;  4M78 G;  2VB6 A;  5KYX B;  1VQ9 Q;  3OW2 A;  1J3T A;  1EFN A;  2DYI A;  4PJO F;  5I22 A;  3RBB B;  2RMO A;  3RMQ A;  5I2S A;  5L8R E;  1KK7 A;  1B3Q A;  2KQW A;  1IO6 A;  1WYX A;  4QQG A;  3ER0 A;  1O75 A;  1YJ9 Q;  1QKX A;  4CC4 B;  4F7U A;  4IUU A;  2NWM A;  1ZBX A;  1VQ6 T;  1WXT A;  4OB1 B;  3CCJ T;  5DLQ E;  1AZG B;  1ZA2 B;  1X69 A;  1QLY A;  3M4Y A;  2QYZ A;  1UGS B;  2M0O A;  8AT1 B;  3FJP A;  3EGU A;  4AFQ C;  4PJO B;  4JZ3 A;  3RES A;  3QBY A;  2VV5 A;  1H8K A;  2PVG B;  2LCC A;  1NPR A;  5FWC A;  1X27 A;  3CMA Q;  2HL5 C;  3KBG A;  1VYU A;  5LL6 S;  4FCY A;  3CEY A;  3HHT B;  5KE3 A;  2ZAE A;  3X20 B;  3FJ5 A;  2QEX A;  1VQN Q;  4F7U E;  1JJ2 A;  2YUP A;  4AG2 C;  1TUD A;  1VQO A;  1WHJ A;  2QA4 T;  2DER A;  4FL6 A;  2AKL A;  1HJD A;  2EPD A;  4FYV B;  1YI2 Q;  2KYM A;  1ZQ1 A;  3ME9 A;  3PFS A;  2E3H A;  2NUZ A;  2E65 A;  2KNB B;  1GFC A;  3EGD A;  3S3O A;  1BI2 A;  1RAH B;  3CCS A;  2QQR A;  3G6E A;  2A37 A;  5FWB A;  4FM4 B;  4DBF A;  5HCK A;  4E2F B;  2CT4 A;  2HSP A;  3I55 Q;  2ED1 A;  1JXM A;  1N27 A;  2V1R A;  4HVV A;  3C94 A;  2OJ2 A;  1UGP B;  1ZA1 B;  3VUZ A;  1QVG A;  2DK3 A;  3I56 T;  3M58 A;  3KXT A;  1BKB A;  1UGR B;  3M54 A;  4HA8 A;  1KHI A;  4DA4 A;  3OYK A;  1MNE A;  4GLM A;  2DTI A;  2OAU A;  1YJN A;  5I11 A;  2JM9 A;  2L3S A;  4N4H A;  4A4H A;  5GMK e;  3MO8 A;  4C8Q G;  4B9X A;  4JZ4 A;  4M75 F;  3R6O A;  3JCM f;  1VQ4 T;  3QSU A;  1S1N A;  1YN8 A;  5A0G A;  2GF7 A;  1YHQ T;  3CC2 A;  5FRO A;  1WA7 A;  1IHV A;  3CQT A;  3OYH A;  1TWB A;  1LOJ A;  1EZZ B;  3WVE B;  3JCM e;  2E6Z A;  1K0X A;  4BE0 A;  2RJC A;  1WFW A;  4JDS A;  1SSF A;  1GRI A;  1M90 C;  1FXX A;  3TVT A;  2FO0 A;  3QJY A;  3DKM A;  5GAN j;  4XU0 A;  2EQJ A;  1OYX A;  4M75 B;  4KGZ B;  1I8F A;  4X34 A;  5GAM d;  1UTI A;  4EMK A;  4ZGD B;  3OYE A;  1D1B A;  4BI3 A;  1WHL A;  1NM7 A;  3X28 B;  3DB4 A;  3L2Q A;  5I21 A;  2QAS A;  3SD4 A;  3UWN A;  3QUI A;  4XU1 A;  1CKB A;  2OTL T;  1FMW A;  1BI0 A;  4PL6 A;  4OGC A;  2RK2 A;  4RTW A;  1M90 U;  3UA7 A;  2YLC A;  1R0B G;  2MYS A;  2KRM A;  4MDX A;  4PNO A;  1OZ3 A;  1NYF A;  3CCV T;  2H3J A;  3EG2 A;  4KBM B;  1ABQ A;  1MV0 B;  2COY A;  1OU8 A;  1ZBJ A;  1T0H A;  2DXU A;  3QWX X;  5GAO l;  2AIR B;  4F7U F;  2OTJ A;  2RHZ A;  1EX4 A;  4DEY A;  2GQI A;  1RAA B;  1YJW T;  5FW9 A;  3LGL A;  4Y92 A;  2RQW A;  4BDY A;  3F70 A;  4QT7 A;  3JB9 H;  2JMA A;  2E12 A;  2D1X A;  2LQ8 A;  4E7J A;  3GIB A;  2RPN A;  3CCE Q;  1R77 A;  1UGQ B;  2LQK A;  1D0Y A;  5KYN A;  3OYJ A;  3GP8 A;  4C5E A;  3UA6 A;  4ZN1 A;  1OPK A;  4OP0 A;  2BTT A;  1H64 1;  3H9N A;  1OEB A;  2M16 A;  1S72 A;  2DXB A;  1WDX A;  2YDL A;  3MEV A;  2KEA A;  5CAI A;  1IZ6 A;  3OS2 A;  3UAT A;  2VC8 A;  1G83 A;  2PNI A;  2DLP A;  4IUT A; 
#chains in the Genus database with same CATH homology
 4MML A;  1KG1 A;  4IUR A;  2ZPH B;  3LGF A;  4EMK C;  2D6F A;  5M9O A;  5GAN h;  3QYG B;  2LX9 A;  1HXD A;  3HPW A;  1VQ8 A;  1EIF A;  5GAO n;  4QVZ A;  2VGM A;  2K3Y A;  1YIT A;  4KT0 E;  2M1H A;  1JBM A;  4ELY C;  5KH6 A;  3HFO A;  3FDR A;  5I2M A;  4N0A A;  1VQ4 A;  3UDC A;  1GXI E;  3OW2 S;  3V7R A;  1YHQ A;  4M75 E;  3SB2 A;  4M75 G;  1M8V A;  2XDP A;  2R58 A;  3HFN A;  1OI1 A;  4J8O A;  4JLG A;  2LVM A;  4C92 E;  4L59 A;  4M78 D;  4M78 F;  5CO7 A;  3VV0 A;  3QYH B;  1NPP A;  3FEO A;  3GLX A;  1BI1 A;  3OS5 A;  3LWH A;  1KQ1 A;  3JB9 G;  2A3L A;  2DTO A;  2K4Y A;  4MZP A;  5GAM f;  1W4S A;  2E1H A;  2LNV A;  3QPH A;  3P8D A;  3PIP A;  1N8R C;  2K5L A;  4OB2 B;  2DZC A;  3QII A;  3CXC S;  1I5L A;  4V2S A;  4GLK A;  2B8A A;  2E5Q A;  3HP9 A;  1QP3 A;  4Z02 A;  3EFS A;  4M77 A;  5DM7 R;  4IKF A;  2RD1 A;  2GQV A;  4J6W A;  1VQ7 T;  2PUK B;  1VQK T;  1KC8 U;  1G3Y A;  1WJQ A;  2G3R A;  2ZPE B;  4O5V A;  2JOY A;  2E41 A;  2P4T A;  3LX7 A;  2RM4 A;  4LD9 K;  2RJD A;  3S3N A;  4N4G A;  2LTO A;  3GNG A;  5GMK i;  4LDY A;  4BAC A;  1M1F A;  1XNI A;  4RCB A;  3G71 T;  4M7D G;  3VUB A;  4XTU A;  2QQ9 A;  3CBP A;  3UT1 A;  3JCM W;  2YLB A;  3MEA A;  2WSF E;  4Y91 A;  3PT9 A;  3G4S T;  4C8Q C;  1VQ7 A;  3PMT A;  4M7A E;  2JN0 A;  3RIR A;  3V7C A;  1VQN A;  4JRQ A;  4E7K A;  3JCM P;  4QW2 A;  3ZEH A;  5KCH A;  2RI2 A;  2ZGW A;  5GAO p;  4BI4 A;  4PKC C;  2D0Q B;  3L2V A;  3JB9 J;  3CCL A;  1U1T A;  4BY6 B;  3CCE T;  1BYM A;  2LDM A;  1N8R U;  5J39 A;  5GAN d;  1YI2 A;  2CYZ B;  2K5I A;  1I81 A;  2CZ1 B;  5C0M A;  3MET A;  4M7D B;  3V7S A;  4R56 A;  1DJ7 B;  3OBW A;  3OMC A;  4Y28 E;  2MI6 A;  4YTL A;  2FHD A;  3A5Z B;  3JSC A;  5GMK m;  4E7L A;  3QO3 A;  3RKY A;  1VQM A;  1JJ2 S;  2CKK A;  4M77 G;  1FWZ A;  5LJ5 h;  4M75 C;  3V8K A;  3OYB A;  1WJS A;  3GF5 A;  2JUF A;  1XTD A;  4C92 C;  3PNW C;  3CCE A;  2RHI A;  5IT9 E;  3DB3 A;  5FU7 B;  5GAN 7;  2I2L A;  2Y90 A;  3SWN A;  4CI0 C;  3JB9 I;  3I55 A;  3RER A;  4J6Y A;  3CCU T;  3L42 A;  4MZT A;  1KQS S;  3JCM Q;  5GMK h;  2AHJ B;  3GOX A;  4EPC A;  4XK8 E;  1Q7Y C;  5HK3 A;  3HKS A;  3CC7 T;  1WQW A;  5CR2 A;  3RKW A;  3SFM A;  4C5I A;  1W2B S;  2XDB A;  1O9S A;  2RK1 A;  3OS0 A;  1G5V A;  4HT8 A;  1M1K C;  4JRP A;  3M56 A;  3OSV A;  3MEW A;  2CS7 A;  2K3X A;  5IN1 A;  5LJ5 j;  2DO3 A;  2P0P A;  4F7U G;  2DKG A;  1VQ5 T;  4FT4 A;  3URG A;  1QP2 A;  1PSE A;  5LJ3 f;  1YIJ T;  1TH7 A;  4BE2 A;  1YJW A;  3JCM h;  4XU2 A;  3CC4 A;  1WNL A;  3OYF A;  1QVG S;  1QW1 A;  1BIB A;  4RKU E;  1BI3 A;  4BI8 B;  3OYD A;  3FIF A;  4IUQ A;  3NTH A;  5CCA A;  3TU4 K;  4KUD K;  3OYG A;  4D6W A;  3VKI A;  1NE8 A;  4N0A C;  3M57 A;  1M1G A;  2JVV A;  2R5A A;  3OYC A;  2QQS A;  4J6X A;  2KDS A;  3QHS A;  4VUB A;  1VQ5 A;  3JAM E;  3LW5 E;  1NJI C;  3SDZ A;  2DXC A;  3A8L B;  4F7U B;  4PLL A;  1I4K 1;  2VUB A;  3BDU A;  5LJ3 e;  1W2B A;  2L3R A;  3HRS A;  1JB0 E;  1Q7Y U;  2L89 A;  3CME T;  1M9S A;  3EAE A;  3ASK A;  3HRU A;  2RH2 A;  4FU6 A;  4HCZ A;  4X9D A;  1VQP T;  3J81 E;  3OYI A;  1YJN T;  4C8Q D;  2EQK A;  3E19 A;  4C8Q F;  1M1K U;  4RG8 A;  3OBY A;  5LJ5 d;  3ZFJ A;  4JJN K;  4M77 C;  4ZTJ A;  4L5G A;  4BE1 A;  3JCM X;  1VQL T;  2X4X A;  5CKE A;  4CRI A;  2RJF A;  3QKJ A;  4J7I A;  5GAN 8;  2LCL A;  4C5H A;  3X26 B;  3SWN B;  1N9S A;  3CC2 T;  4M7D A;  3L2U A;  5GAO r;  2RO0 A;  2WSE E;  5CK9 A;  2IG0 A;  5J26 A;  4C0D B;  5GAN 4;  1VQP A;  4LDU A;  2XK0 A;  5C6S A;  3KUF A;  2EYQ A;  3VJP A;  4OF1 A;  4BDZ A;  2XG8 D;  3LYI A;  3INZ A;  2NLU A;  5GAN 6;  1VQL A;  4XAX B;  2JZ2 A;  4IUV A;  5GAM g;  4KUI A;  2RB6 A;  1NJI U;  4C92 F;  4C92 D;  5FU6 B;  2PUO B;  2O4X B;  2FL7 A;  3T9N A;  3TEE A;  2DJZ A;  4XTW A;  4XQ3 A;  4EMG A;  3OB9 A;  2ZPG B;  4XTV A;  2RHU A;  1Y71 A;  2HQX A;  2Y4Y A;  2XDD A;  3OYL A;  2A7Y A;  3JCM d;  4LDV A;  4QQ6 A;  2EQM A;  3PMI A;  4XTX A;  2P0K A;  2ZPB B;  4A4E A;  3CCR T;  2BIV A;  2XID A;  4J5Y A;  3L1A A;  5J3B A;  4MDW A;  3MP1 A;  3Q1J A;  4M78 G;  2MWO A;  4A4K A;  2DTH A;  1Y07 A;  1KQ2 A;  3CBM A;  3QG1 A;  3A8M B;  3L2R A;  3V8J A;  5GAM e;  3A8O B;  3OW2 A;  3M9Q A;  2RA2 A;  1V29 B;  4PJO F;  4PJO D;  3RMQ A;  3SWN C;  2QDY B;  2V8I A;  5I2S A;  5L8R E;  3CCR A;  3OYN A;  4M7D E;  1MGQ A;  3FC3 A;  2O01 E;  4HCB A;  4HCC A;  2KQW A;  2KVQ G;  2V8J A;  4IUP A;  5GAN f;  3OSS C;  4C0D C;  2RHY A;  2DXT A;  1VQK A;  4QQG A;  5D6W A;  2RI5 A;  4M78 B;  5GAN 2;  3ER0 A;  4R55 A;  1O75 A;  1Q86 U;  3CXC A;  1RI0 A;  4M7A F;  4M7A D;  4F7U A;  4IUU A;  4BB7 A;  2XI9 A;  1ZBX A;  3BY7 A;  3AHU A;  5A0D A;  4A4G A;  2K57 A;  2ZPI B;  3E1S A;  3GNF B;  2DPP B;  2EFI A;  4OB1 B;  3G71 A;  1VQ6 T;  2XD0 A;  3CD6 T;  3CCJ T;  3WVD B;  5DLQ E;  5GAN e;  3G4S A;  2X4Y A;  2CZ6 B;  2KSS A;  5GAO q;  4JLI A;  4NL3 A;  4M77 E;  1K73 C;  2DVE A;  2GFU A;  3M4Y A;  2LRQ A;  2PU9 B;  5CKF A;  2LC4 A;  1UGS B;  1LJO A;  2M0O A;  2MAM A;  5IAY A;  3FJP A;  1VQ6 A;  3FB9 A;  3TRE A;  1Y96 B;  3OYY A;  3PGG A;  3ZBD A;  4DOV A;  3CCJ A;  3RES A;  4PJO B;  3QBY A;  2VXF A;  2QEX T;  3CCM T;  3CPF A;  2VV5 A;  3H8Z A;  2PVG B;  2BKD N;  2LCC A;  1NPR A;  3RKX A;  2E64 A;  4NS5 A;  3OY9 A;  1VQO T;  2OTJ T;  3KBG A;  3LH0 A;  5LL6 S;  3OQ5 A;  2KAF A;  3CEY A;  3HHT B;  5CKD A;  2EJ9 A;  4M7A B;  2E10 A;  5KE3 A;  4QVC A;  1OZ2 A;  3X20 B;  4MMK A;  2O4X A;  1KD1 C;  2MMP A;  3HL8 A;  5LJ3 g;  3CCU A;  1BIA A;  3M53 A;  5GAN 3;  2QEX A;  3CCS T;  3RUX A;  4JRI A;  4F7U E;  1JJ2 A;  1XOV A;  3G6E T;  1LNX A;  4BY6 C;  2X4W A;  4BUG A;  2GCX A;  2P0Q A;  2EJF A;  3A8H B;  5LJ3 j;  4HT9 A;  4O6J A;  3CC7 A;  1VQO A;  2QA4 T;  4FL6 A;  4PLI A;  3JCM V;  2L5Q A;  4M7D C;  4J7F A;  1U8R A;  3DLL A;  2F5K A;  1ZQ1 A;  3ME9 A;  1Q81 C;  1Q86 C;  1K73 U;  3PFS A;  3MHX A;  4KUL A;  2E65 A;  1MHN A;  2XU8 A;  3V8L A;  4JS4 A;  3JRZ A;  3NTK A;  1KQS A;  3CCQ T;  3S3O A;  1BI2 A;  3CCS A;  2QQR A;  3G6E A;  1RL2 A;  4JUV A;  4FM4 B;  1FX7 A;  2PQW A;  1YIJ A;  5FU7 C;  2YRV A;  5A2Q E;  2E70 A;  5HKC A;  2QA4 A;  5CQY A;  5KE2 A;  4LDX A;  3S6W A;  3C4S A;  4A54 A;  2DIQ A;  3X24 B;  1S72 T;  2FYK A;  3X25 B;  3E9G A;  3JCM b;  4M78 A;  1ZHI A;  1N27 A;  2PVD B;  4C92 A;  2Y4X A;  3C94 A;  2LT4 A;  5GAM h;  5HY6 A;  2HQE A;  2K2V A;  2MWP A;  1UGP B;  3QZ9 B;  3OMG A;  3VUZ A;  2DK3 A;  1Y7X A;  3I56 T;  1VQ9 T;  1QVG A;  3M58 A;  1H3Z A;  3JCM c;  3L2Z A;  3KXT A;  4E7I A;  3C12 A;  3MEU A;  3NTI A;  4OGE A;  3JCM J;  3CME A;  2M9U A;  1BKB A;  2PVO B;  1UGR B;  3M54 A;  4X9C A;  4HA8 A;  1KHI A;  3C95 A;  4DA4 A;  3CBO A;  3OYK A;  2EKO A;  3HRT A;  3OS1 A;  1N6A A;  1Q81 U;  2DTI A;  2OAU A;  2HBP A;  4J83 A;  2QQA A;  4JRK A;  1YJN A;  1D3B B;  2DZ9 A;  2RI3 A;  4N4H A;  1YIT T;  3J7A F;  4A4H A;  5GMK e;  3MO8 A;  5GMK l;  3TCJ A;  4B9X A;  4C8Q G;  1UB4 A;  1YJ9 T;  5DY9 A;  1Q82 C;  2RJE A;  4M75 D;  2F5T X;  3R6O A;  4M75 F;  4QQD A;  3JCM f;  1VQ4 T;  3QSU A;  1YHQ T;  5A0G A;  2GF7 A;  1X75 C;  4RMO A;  4ATO A;  5CIU A;  1G3S A;  3BW1 A;  1Y96 A;  2JNG A;  4UC4 A;  3CC2 A;  4PJO A;  2RHX A;  4N4I A;  5FRO A;  5GAM j;  5GAO m;  2YHT A;  3JB9 D;  3JB9 F;  4OMF B;  2QXF A;  5CKB A;  5FLX E;  5KCO A;  3OYH A;  1LOJ A;  1YJ9 A;  3WVE B;  1G3T A;  4LD6 A;  4C8Q B;  3BFM A;  3JCM e;  3M5A A;  4E7H A;  2E6Z A;  2FB7 A;  2HD0 A;  4M78 E;  4RG2 A;  4M7A A;  2E6N A;  5FRN A;  2X35 A;  3WXM B;  4BE0 A;  4C92 G;  2DD4 A;  2RJC A;  2R57 A;  1NZ9 A;  4XU3 A;  4DQ2 A;  4JDS A;  1SSF A;  1XQH A;  2BUD A;  2R5M A;  2XHC A;  1AHJ B;  3E9F A;  4BD3 A;  5GAN g;  1M90 C;  1FXX A;  1R8O B;  3NFC A;  3QJY A;  1N9R A;  3CMA T;  3DKM A;  4II1 A;  4M7D D;  5GAN j;  4M7D F;  1Q82 U;  5D6Y A;  1WPY A;  1M5Q 1;  1K8A C;  1QVF S;  4XU0 A;  5FRM A;  2JTM A;  3FRN A;  1YBY A;  2EQJ A;  1OYX A;  4M75 B;  1I8F A;  5GAN 5;  1VIF A;  4X34 A;  4C92 B;  5GAM d;  2WSC E;  2KMT A;  1VUB A;  1M4Z A;  4C5G A;  4EMK A;  4ZGD B;  3OYE A;  1VQN T;  4BI3 A;  5FU6 C;  2QQB A;  3A8G B;  2VXE A;  1B34 B;  3MCA B;  3QJ6 A;  2F69 A;  4PJO G;  3X28 B;  3CPW S;  4PJO E;  4P5N A;  4JS5 A;  3CCL T;  3CMA A;  3DB4 A;  1YI2 T;  1K9M C;  3DLM A;  3FLG A;  3L2Q A;  2QI2 A;  5I21 A;  3VU3 C;  1YCY A;  1X6O A;  2KK4 A;  3G7Z A;  3SD4 A;  3J80 E;  3UWN A;  5CQX A;  3QUI A;  4XU1 A;  3GPL A;  2OTL T;  4M77 D;  1BI0 A;  4M77 F;  4PL6 A;  2HNI A;  4OGC A;  2MF2 A;  3OYA A;  4M7A G;  2RK2 A;  3O8V A;  2XIC A;  5LJ3 h;  1VQM T;  1P92 A;  4HKE A;  2VYT A;  2DIG A;  3P8H A;  4XTY A;  1QVF A;  3CD6 A;  1VIE A;  3MP6 A;  3S3M A;  2V8K A;  5HK0 A;  4C0Z A;  4FSX A;  2YLC A;  1M90 U;  1UEB A;  2CZ7 B;  4A4F A;  4ZGJ B;  2IVW A;  4NL2 A;  3I55 T;  1D3B A;  1K8A U;  4OB3 B;  4MDX A;  4XTZ A;  4FIB A;  3CPW A;  4Q5W A;  4PNO A;  2OTL A;  4OB0 B;  2L8D A;  2ZZD A;  1OZ3 A;  3H6Z A;  4WF2 A;  3CCV T;  4M78 C;  2H3J A;  4EMH A;  4KBM B;  1U1S A;  3BDL A;  4TVR A;  4ME7 A;  2EWN A;  2XKO C;  3OYM A;  3CCM A;  2DXU A;  2FVU A;  5D6X A;  3L2W A;  3M55 A;  5GAO l;  2EIF A;  2EJG A;  2QTX A;  4F7U F;  2CGH A;  4DOW A;  5CKH A;  1K9M U;  2OTJ A;  2RHZ A;  2WAC A;  3QDR B;  3PTA A;  1HK9 A;  2GFA A;  4E47 A;  3RMS A;  4C8Q A;  1QVP A;  2C06 A;  3HSB A;  3LLR A;  1YJW T;  3EFR A;  3CC4 T;  2K5F A;  3LGL A;  3CCV A;  4M77 B;  1JRI A;  4BDY A;  2DD5 A;  5LJ5 g;  3F70 A;  4ELZ C;  4ZTF A;  1WGS A;  3VYH B;  3LWI A;  3JB9 H;  4EMK B;  2E12 A;  2LQ8 A;  5LJ5 f;  4E7J A;  2VGN A;  4RCC A;  3P8B B;  4EDU A;  3GIB A;  1WQ7 A;  3QXE B;  1UGQ B;  5EG2 A;  3OA6 A;  4PJO C;  2LQK A;  5CVI A;  2LT1 A;  4LDW A;  4ZN3 A;  3VYG A;  2ZPF B;  4QVD A;  3OYJ A;  3GP8 A;  2KY9 A;  4C0G A;  4C0F A;  4M75 A;  4C5E A;  3CCQ A;  2X4J A;  5A0L A;  5GMK j;  3UPU A;  4ZN1 A;  4OP0 A;  4M7A C;  1H64 1;  5LJ5 e;  5LJ3 d;  3PIO A;  1B34 A;  1WJR A;  4B9W A;  2M16 A;  4MZM A;  3M59 A;  1KD1 U;  1S72 A;  2CZ0 B;  4GY5 A;  5DLO A;  2DXB A;  1KHC A;  3MEV A;  4L6V 5;  1VQ8 T;  2ZCF B;  4FT2 A;  5AYF A;  3JCM g;  4A53 A;  1IZ6 A;  5CAI A;  2DEQ A;  4NOY A;  3OS2 A;  3M4G A;  2EQU A;  3N5B B;  3MP8 A;  4OVA A;  1X01 A;  4C8Q E;  1VQ9 A;  3QZ5 B;  3I56 A;  1G3W A;  2D9T A;  2JTF A;  4ZGE B;  2DAQ A;  2VC8 A;  2EAY A;  1IRE B;  2HAX A;  1PSF A;  1KC8 C;  4IUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...