3KXTA

Crystal structure of sulfolobus cren7-dsdna complex
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
56
structure length
56
Chain Sequence
MKPVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the crenarchaeal conserved chromatin protein Cren7 and double-stranded DNA complex
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna binding protein/dna
molecule keywords Chromatin protein Cren7
total genus 5
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2009-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.610 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kxtA00
4R56A 3KXTA 2JTMA 3LWHA 4R55A 3LWIA
chains in the Genus database with same CATH superfamily
1YITQ 1QP3A 5D6XA 3JB9J 1YP5A 2LVMA 3REAB 1M27C 4JLGA 4BDYA 3QKJA 1B3QA 1Q7YC 1PSEA 4ELYC 1VQLT 3FB9A 2HNIA 2HSPA 1RI0A 2PVDB 3RERA 1OULA 1X01A 1BYMA 3FLGA 2D0QB 2HZYA 4JJDA 3MEWA 3V8KA 4PJOE 4QQ6A 3LW5E 4BB7A 1ZUKA 3JCMP 2DD4A 1BBZA 1TSFA 4R55A 3HP9A 1VYTA 4AFZC 2PUKB 2OAUA 1WHKA 3OYNA 1OQKA 3JCMb 3EGDB 2EIFA 1PKTA 2MI6A 1YHQA 3CC4A 2QK0A 2HQEA 3CCEA 2RI3A 2M02A 3QWXX 4FYYB 3O8VA 3PMIA 1X75C 1M3CA 2JTMA 4J9EA 1UUEA 4JZ3A 3VRYA 2B8AA 2QQBA 5KYYB 2CS7A 1VIFA 4MMKA 5FU6C 2LQKA 1AWWA 1WZOA 1JXMA 3BDUA 2RF0A 1PD1A 3EG9B 1M1KR 5GAN5 4FYXB 2F1LA 4M75A 7AT1B 1UHFA 4XTYA 2KRNA 3RKYA 3HRTA 3EG9A 3AT1B 2DETA 5HY6A 3HL8A 1WHJA 2QQRA 2O9VA 4ANJA 5EG2A 2RD1A 4JRQA 4EMHA 1GFDA 4M77G 1WYXA 2HCKA 2DMOA 1YITT 3MO8A 5I21A 2K5FA 4K11A 2HSEB 3M4GA 3KFVA 2AHJB 4LDVA 1WNLA 1H92A 1W4SA 5IAYA 2KEAA 1HJDA 2ESWA 4X9DA 4GY5A 2CSIA 2ED0A 5HK0A 3JCMh 1XQHA 4AT1B 4KGZB 2DERA 1WQ7A 1UJYA 4KT0E 3QO3A 2EYXA 4E7IA 3J80E 3HHTB 3VS6A 2RQWA 1ZSZC 5GANh 1GXIE 2DL7A 5I22A 2DKGA 1ARKA 5LJ3j 4NL3A 4M7AA 4JDSA 4EDUA 9ATCB 3VV0A 1QCFA 2M0YA 2QGGA 3A8OB 1PKSA 2RH2A 1M3AA 1B07A 3QPHA 3V8JA 1FXXA 1NYGA 3HTRA 3OYCA 4JJCA 2H3JA 2DIGA 2RI5A 2LQWA 4RG2A 2LQ8A 1I5OB 2F5TX 3G71Q 4Z8AA 3QZ5B 3FC3A 2DJQA 4M75D 2L3RA 2A7YA 4BI8B 3CBOA 1WPYA 2DZ9A 1YJ9T 2ZPGB 1M1KU 2X9HA 1QVPA 4J9BA 3P8HA 5FLXE 1K73C 2E5KA 2X3XD 3OSVA 3WVEB 2HD0A 3CCJQ 1AEYA 2FPEA 3C12A 1HD3A 1QVFP 1BIBA 1U1TA 4AG1C 4D6WA 1YJWA 2IVWA 3CMAQ 1O9SA 4M75B 2V8KA 4FSSA 4CRIA 4UC4A 4FL6A 1TU0B 4OP0A 4FT4A 4MZPA 2PNIA 2LCSA 2K4YA 2VGNA 3JCMQ 1RLPC 4MDWA 1YJWQ 4BI3A 3RBBB 2ZPEB 2FYKA 3CCRT 1MNDA 1ZBXA 4QQDA 2GGRA 5CIUA 4NL2A 2CT4A 2HQXA 2KVQG 5KCHA 1EFNA 3C94A 3QSUA 5J3BA 2X4YA 2HMAA 3EGXB 5FRNA 2D9TA 1NM7A 1U06A 1GL5A 2DX1A 1SSFA 4LXCA 2ZPBB 2JUFA 1D3BA 4QKUA 3L2RA 2A08A 1YI2T 1BK2A 1TUDA 3LX7A 4M77F 3PE0A 3LLRA 2XD0A 2RHYA 4J9DA 3CC7Q 1QVGA 1NLOC 1NLPC 1VYUA 2DM1A 1G5VA 2RJCA 5GMKj 1RABB 3JB9G 2CUDA 4MMLA 2GFUA 2JXBA 3META 3IQLA 5KH6A 1D1BA 1S1NA 1CKBA 4JRKA 2FG0A 4E7SA 4FW1A 2YRVA 2CDTA 4RTTA 1WGSA 2J7IA 2E12A 3CC4T 4KUDK 2EGCA 1RAIB 3EGDA 2JMCA 2AT1B 1YJ9Q 2O31A 1VQ4A 4F04B 3CBPA 2QAZA 5I11A 1Z9ZA 1M1KC 1ZQ1A 1VQMA 5LL6S 1IGQA 3TSZA 1NJIU 2CYZB 2QDLA 2BE9B 3E1SA 3PGGA 2RQVA 1BKBA 3CPFA 1JJ2A 1QWFA 1ZA1B 3PNWC 2OTLQ 2DE0X 2DZCA 3I55T 3AHUA 2O01E 1IO6A 3OYYA 1K76A 5GMKl 2OX7A 4BI4A 1GCQC 4JS4A 1VQLA 1WJQA 1OYXA 2HBWA 4C0GA 4A4KA 2E70A 4CC7A 5CQXA 3S3OA 3PT9A 5LJ3f 1PSFA 1WHGA 4ZNXA 3ZEHA 2Z0WA 4M7AG 2MCNA 1M1GA 5GAN3 2E64A 4BD3A 2PTKA 4C8QB 1S72Q 1NEGA 1D3BB 1ZSZA 1U1SA 2XI9A 1XNIA 3OYHA 3H9NA 2DNUA 4ORZA 4Y92A 5GAN2 5GAMg 1WI7A 1GCQA 5GAMe 3PTAA 1Y96A 4N4GA 1MNEA 1VQNQ 1M2VB 2RB6A 1Y0MA 4N4HA 3REBB 4AFQC 4J9HA 3MP1A 3VS3A 2K3XA 3P8DA 3PIOA 1X43A 4M78G 2NUPB 3QXEB 4IIMA 2C0IA 3QG1A 2NUTB 1E6GA 5CVIA 1UGSB 1G3YA 2ZZDA 1KD1C 4M78F 3ULRB 1BI0A 2W10A 3FIFA 2YXYA 1EZZB 2AK5A 2QA4T 2X51A 1Y07A 3NHNA 1V1CA 3M5AA 1BU1A 3SFMA 1ZUYA 2RNAA 5KYUB 1PCXA 1RLQC 2BKDN 5GMKe 3HRSA 5IXFA 1JRIA 3JCMe 2GFAA 3VS2A 2R58A 1YCYA 2D1XA 4PJOD 5CK9A 1PNJA 3OYJA 2EYQA 2CP5A 1BB9A 4BDZA 2LRQA 4KH1B 3RESA 2LNHB 1K8AU 4J9GA 4M75E 1QWEA 2DRKA 2R5MA 4EMKC 4ZGJB 1TXQA 2LJ0A 5GMKi 3LH0A 3O5ZA 4ZTFA 2OTLA 1FX7A 2RI2A 2JVVA 2FZCB 2JS0A 2VWFA 1GFCA 2F69A 3A8HB 4LN2A 1VYVA 1B34A 3OYKA 2YUQA 1ZSGA 3G4SQ 3QDFA 4A4FA 2EJ9A 4EMKB 1D0ZA 4B9XA 1VUBA 2ED1A 1QKXA 3OYIA 4E7HA 1R0BG 3TEEA 1OU9A 1T0JA 2EAYA 2MMPA 2XU8A 2RN8A 3SEMA 2JMAA 2LNVA 1ZHIA 3X25B 3TQ7P 4C0ZA 5GAMh 2FZKB 3GF5A 3L2WA 1UECA 2BZYA 3C4SA 2OTJA 3OS5A 4OMMA 1VQ8T 2V8IA 4OMOA 1BI2A 2JM8A 1MMNA 2VVKA 2LMJA 1UTIA 2KBTA 2D6FA 2MAMA 3GPLA 4PNOA 2DXTA 4AFSC 2EPDA 1B7TA 1W1FA 2P0KA 4C8QG 4BACA 4RMOA 1VQ6A 5IT9E 1KHCA 4MZMA 2COZA 1TOVA 1N8RR 4L6V5 4LE9A 3CMAA 4OB3B 2NWMA 1Q82C 2FRYA 2ZCFB 1W2BP 2RJEA 3M0QA 1WHMA 5GANg 5LJ5h 3L42A 1SRLA 3CMET 3C95A 2ZAEA 2YRDA 4M7DA 2OTJQ 3JB9I 4BE1A 3VYHB 2WSFE 2XHCA 1K8AC 4DEXA 4E2FB 1PHTA 3QUIA 2K5LA 3A1PA 3SHWA 4C92E 1MUZA 5DY9A 4RTYA 1AWJA 5GAN7 5LJ5d 2OI3A 4RCBA 4RUGA 2MOXA 1PC0A 4J7FA 3NPFA 5IHKA 3LH5A 3M0UA 3MEAA 4FSXA 3M0PA 1VQ6Q 2X4JA 1NYFA 1QQJA 1LVKA 1W2BA 4Z89A 1M90U 2QGFB 3DKMA 2QI2A 2BIVA 4M78A 3THKA 3QZ9B 4RTVA 3S3MA 3M56A 3EHRA 1VQ7Q 3V7SA 1EIFA 2E3IA 1ABOA 1T3SA 1VIEA 3GNGA 5CKBA 1EX4A 4LUDA 3JCMg 3H6ZA 1PG5B 4OGCA 2VXFA 4N4IA 4EMKA 4C92G 3M54A 1RAFB 4QVZA 4PJOC 1GBQA 4M7DE 3TVTA 3CCMA 3X28B 3TSWA 2XG8D 3Q1JA 3OYAA 1Q81U 3CCQQ 5FU6B 4OMLA 3MPUB 3I56Q 1P92A 1G3SA 2QYZA 2X4XA 4DBFA 4J9FA 4OMFB 2DO3A 1VQ6T 3HSBA 1VA7A 3I5SA 5CKHA 4E47A 1G3WA 2VXEA 1X2QA 3CQTA 3A8MB 1YI2A 2GTJA 4LDWA 1FMWA 2RA2A 2AIRB 4LUEA 2ZPFB 1M8VA 3CPWP 4DQ2A 1HK9A 4JLIA 1NZ9A 2JN0A 2SRCA 1PRMC 2W0ZA 4CC2A 1K8AR 3KBGA 1QKWA 2KXDA 5KYUA 1ZA2B 1I8FA 2OTJT 3HFNA 3M59A 4LDYA 1M8MA 1YWPA 4KGVB 5FRMA 1FMVA 5DLQE 1VOMA 4YTLA 5CKDA 1VQ8Q 1YFNA 4IUUA 4RTXA 2DTHA 3NTIA 1M4ZA 1ZUUA 4OB2B 2CZ0B 1Q82R 3CXCA 3BE3A 1JJ2P 4HT9A 2I2LA 5DLOA 2JS2A 3OMGA 4HCZA 5L23A 1KC8R 4V2SA 4ZN3A 3CCJA 5D6YA 2HEQA 2QTXA 1AD5A 1ZLMA 2KDSA 2FHDA 2CZ1B 2CP2A 1VQNA 4C5GA 4Z88A 4GLKA 2K3BA 1BCOA 2YLCA 2KNBB 5CKFA 1UE9A 1YIJQ 2HDAA 1NE8A 5AYFA 1UHCA 1BCMA 3UT1A 5A2QE 3OW2A 4A4GA 4HKEA 1NEBA 2QEXQ 5GMKm 1KIKA 3M53A 1Y57A 3EG1A 1K9MC 3M58A 2Y90A 5KYXA 1DJ7B 2DFUA 4M7AE 1VQKQ 1F1BB 4HVUA 1X6GA 2LTOA 2DYBA 1YIJA 4XU0A 2QTVA 3CCVA 2CZ7B 4RCCA 3SWNB 3VKIA 3L2QA 1UDLA 3GP8A 1E6HA 1VQPT 1TWBA 3QDRB 5FU7B 5IH2A 1MGQA 1H8KA 1A0NB 2DXBA 2QA4Q 2KR3A 2YRCA 4J9IA 5LJ5f 1RAHB 3E9FA 4RTZA 2FVUA 3SWNA 1JQQA 2V26A 3T9NA 2LZ6B 3OY9A 2AZSA 5EC7A 2P84A 3H8ZA 4PKCC 3CCRQ 2LX9A 4RKUE 5KYYA 1VQNT 1VQ7T 4M77B 1I07A 4DBQA 1J3TA 4PJOA 3JV3A 1Q7YU 3JB9H 4M7DD 1QVFS 5FW9A 3QJYA 2KE9A 2RQTA 2JJ9A 4M7DB 4E7JA 2WSCE 2GQVA 5GAMd 2O2OA 3R6NA 3M9QA 2P0PA 4KBMB 4XQ3A 4M77D 1Q81R 2PVOB 5IN1A 3EG3A 2QG9B 3G6EA 3OYFA 1VQ9A 2J05A 3CCQA 4PL6A 5CCAA 4KH0B 1RAAB 1D0XA 2YDLA 3NMZC 2ATCB 2KT1A 2RHXA 2JT4A 5LJ5e 2EYYA 1H641 3CCET 2RHZA 2G6FX 1PWTA 2JNGA 3OW2S 2DXUA 2DA9A 5CQYA 4F7UB 3C0CA 1PD0A 3VS0A 4MZTA 3JCMd 3UWNA 4PLIA 1KQSP 2O4XB 3G1JA 2ZGWA 4F7UG 3I5RA 3J81E 2LJ1A 3E9GA 2AKKA 2YUOA 3QJ6A 1XJWB 4D8KA 2XDDA 2KYMA 1N8RU 1MV0B 2DEUA 3M0RA 4XU3A 3VYGA 3ME9A 3CXCP 2V1QA 2X35A 3EFRA 4EIKA 5FWCA 3E19A 4OB0B 3PVQA 3A98A 2EYZA 2K57A 4CI0C 5KYNA 4DOVA 4D8DA 1T0HA 3RMSA 1U5SA 3M57A 4M77C 4JUVA 1RL2A 2DL8A 4C92C 5GJVB 5D6WA 2KRMA 2V8JA 2K79A 4M7AC 2K5IA 2K2VA 1G8XA 3CC7T 2DXCA 2YT6A 3F70A 5J26A 4M7AB 1IHWA 1M1FA 4JS5A 5KYXB 2DVJA 2F2VA 4C92F 1KSWA 2VC8A 1VQMT 2C0TA 4DOWA 2C0OA 2YSQA 3VJPA 2DYIA 2DTIA 2IPOB 1VQ4T 2K3YA 2YLBA 3DB3A 3QHSA 5GANf 4NS5A 1CKAA 4MDXA 2XMFA 2E6ZA 4PJOF 1WHLA 4M78B 3SWNC 1W2BS 2VB6A 2RO0A 5GAN6 5CR2A 1VQ5Q 2FL7A 2DILA 2NYSA 4IURA 2P4RA 3OYEA 4OF1A 2CP7A 3G6EQ 3OBWA 1VQOT 1YJWT 5I2MA 5GANj 1I4K1 1SEMA 4PFOA 3JCMc 2E3HA 2EWNA 1WXUA 2MIOA 1K1ZA 2RQRA 1VQ4Q 1IXDA 2J06A 4ESRA 4OMNA 4M7DF 1BI1A 2JTFA 1K73U 4BE2A 1M90R 4XTWA 1KC8U 4HT8A 4M77A 5GAMf 2CT3A 4E7LA 4XU1A 1OX8A 4LD9K 2P4TA 2XKOC 1GBRA 1OI1A 3S6WA 2LT1A 4PFPA 1TTHB 5GJWB 3WXMB 3HFOA 2X3WD 4XK8E 4AFUC 4R56A 3FEOA 2DIQA 3CCRA 4F17A 3CXCS 1WFWA 3CCJT 1UG1A 2YUNA 4HA8A 3M4YA 1N9SA 3X20B 1QVFA 3I9QA 3OBYA 2MK5A 1X27A 1SSHA 1LOJA 4IUVA 2CH4W 3UDCA 3VS4A 4PJOG 4CC4B 4LDXA 4EPCA 5LJ5g 3N5BB 5C0MA 1WLPB 3ZBDA 2FO0A 2QQ9A 4A4EA 2GTOA 3VS5A 3PIPA 1C6VX 4PJMA 1Q95G 1AZEA 3GNFB 4J6WA 2DD5A 3CC2A 4C5HA 1WJSA 2OJ2A 1K4US 3DB4A 1FYNA 5KE3A 2HAXA 3CCEQ 4FM4B 1N9RA 4FIBA 3H41A 4X34A 1IREB 3V7CA 3G7ZA 2QDYB 4O6JA 5FU7C 3H0HA 4F7UF 1LJOA 1PM3A 1WHHA 3RUXA 3L1AA 2DVEA 1OZ3A 4AMCA 1YNZA 4PK4A 1M9SA 3H0IA 3CC4Q 5LJ3e 3CCMT 3MKDA 2RHUA 2M51A 1VQOA 5GAOq 1M5Q1 1NJIC 3HRUA 1UGPB 2QASA 3P8BB 4RTWA 3LWHA 2FEIA 5J39A 2DK3A 2DL3A 3QIIA 2RK2A 2RK1A 3EG0A 2KGTA 2E4HA 2ABLA 2LC4A 2L3PA 1WDXA 3VS7A 5FROA 3BW1A 2PVGB 3A8LB 4Y28E 2E6NA 1M3BA 1T3LA 1SPKA 2EQJA 2RPNA 1VQOQ 1QVGP 1OEBA 1QLYA 2AKLA 4C8QD 4M78E 1KQ2A 1YI2Q 4F7UA 5LJ3h 3NGPA 4ELZC 2EBPA 1NBEB 4EMGA 1AOJA 2A0FB 3QYGB 3H0FA 4FYVB 2KSSA 3RIRA 2HBPA 4J6YA 3BDLA 1KQSS 2JZ2A 2DPPB 4ZGDB 2J6KA 2VGMA 4P5NA 3L2VA 2V1RA 2XICA 3JRZA 1V76A 1SG5A 2E41A 3CBMA 4IIOA 4C8QF 2ENMA 4QVCA 2M1HA 3CMAT 3VUBA 1FWZA 2CP0A 3OYGA 2A36A 1D1CA 2CGHA 3CPWA 4ZTJA 3CCMQ 1OV3A 2GF7A 4M75F 2RQUA 4ATOA 4C0FA 3M0TA 1Z9QA 1WJRA 1G83A 1WA7A 2KK4A 3S3NA 3VU3C 2FZGB 3FDRA 4WTOB 5IHNA 3JSCA 3G71T 2L5QA 1VQ8A 4BY6B 1KQSA 1SF9A 1YCSB 5KYWB 3E2UA 4VUBA 1YN8A 3JCMV 5GANd 1LPLA 1Q86U 1NPPA 3CCUQ 1X6OA 2IG0A 3CC7A 1G2BA 1KJWA 1HSQA 1RAEB 3LYIA 1TG0A 3V7RA 2CKKA 3OYLA 2D8HA 4PFZA 5GAN8 2KQWA 1NG2A 3A5ZB 1KK7A 1S72A 4OB1B 1FMKA 3EH2A 1KQ1A 2D8JA 4HVVA 4PJJA 3EGXA 1QVGS 2DL5A 3ZL7C 3OS1A 2K2MA 4E7ZA 1XOVA 5GMKh 4JJNK 2FRWA 3DLLA 4FCYA 2DBMA 3CCLT 1IRXA 3ER0A 3M0SA 1OX9A 1CSKA 3LWIA 3L2ZA 2LT4A 4XTXA 2PQWA 4WCIA 3G71A 1IB8A 3CCST 4PJNA 1K9MR 2HKQB 4F16A 4PJLA 3MHXA 4JRPA 2XIDA 5A0LA 4II1A 5DM7R 2BTTA 4IKFA 4C8QA 2CUBA 2XDPA 4C0DB 5M9OA 1M2OA 2PU9B 3ZFJA 2EQIA 4BY6C 3URGA 1OZ2A 3SDZA 3UPUA 1WIEA 2KRSA 2QA4A 1VQPA 4DA4A 3QWYA 1N5ZA 1N27A 4C0DC 3JB9F 3OQ5A 3OYBA 1C0MA 3CCVT 1RAGB 1Y96B 5GAMj 1U3OA 1YJ9A 4ZN1A 3OSSC 3R6OA 1Q7YR 4IUQA 3FJPA 1YJNA 4BE0A 2DJZA 1VQ9Q 1UGRB 3CPWS 4GLMA 2FPDA 3G4SA 2ZPHB 3CD6A 5CAIA 5GAOn 1KFZA 4JPBW 2DBKA 4IUPA 2PZ1A 5GAOr 4O5VA 3BY7A 3G6ET 2NUPA 4XTZA 4C92A 2X4WA 1VQ5T 2KYBA 1Q86C 3QBYA 3GBQA 2QEXA 4LDUA 2HL3A 1MHNA 2R5AA 2J6FA 3TREA 1Y71A 1VQKT 1IHVA 3VRZA 1R0CB 3D7SB 4L59A 4R0KA 1OOTA 1VQ7A 1VQMQ 1BI3A 3J7AF 2QEXT 1QP2A 1VQ5A 3X26B 1TUGB 1VQPQ 4CC3A 2DAQA 2CH4A 2FPFA 2GBQA 4J83A 5IHIA 1D0YA 2DRMA 2M0OA 1M90C 4LNPA 2MF2A 4DBRA 2HKNA 4DBHA 1VQLQ 3TU4K 4OMQA 4J7IA 1I5LA 3JCMX 3OYMA 3CD6T 1V29B 3NTKA 4L5GA 5KYWA 2RHIA 2M16A 1RADB 3WVDB 3I56A 3FRNA 1YITA 3CEYA 5FWBA 3I55A 2SEMA 1MMDA 2LJ3A 5CKEA 4B6MA 1QCOA 2NLUA 2JM9A 4C5IA 2EVRA 1D1AA 2EGAA 2BZXA 2EGEA 3RR6A 1OU8A 2DLPA 2K6DA 4OMPA 1TS9A 4WF2A 5ECAA 1SHGA 4J8OA 1YIJT 1Q86R 5IXBA 2LX7A 1Q81C 1MMAA 1SHFA 1UGVA 1W6XA 3RKXA 2EYWA 3PFSA 3CC2T 3OMCA 4C92D 4KULA 1GRIA 3QYHB 1KD1U 3SD4A 6AT1B 4HXJA 5HK3A 2E5QA 1M30A 2L89A 3CCLA 2CP3A 1QMCA 1SRMA 1AWOA 4RTUA 1X2KA 4KRTA 1RUWA 1AZGB 2ROTA 1K0SA 4J6XA 1GCPA 1YHQT 4Q5WA 2A28A 4M7AF 2COWA 1AVZC 2MYSA 1TUCA 2J6OA 3U23A 2B86A 2RJFA 4FYWB 3OW2P 4C92B 5HKCA 1I1JA 5D7UA 1ABQA 4M75G 5LJ3g 4C8QC 2I0NA 1LCKA 1HXDA 4QW2A 8AT1B 4HCBA 4J9CA 4X9CA 2LP5A 2DF6A 2F2WA 3FJ5A 4FT2A 5GAOm 4M75C 4J5YA 3V8LA 2VV5A 5L8RE 2MWOA 1OPLA 2G3RA 2VYTA 1RI9A 2ROLA 1UGQB 4XAXB 2EFIA 4JZ4A 3UA6A 4HCCA 4N0AC 1NJIR 5A0GA 3CCVQ 3GLXA 2RM4A 2VUBA 2L0AA 2EKOA 2D0NA 2XK0A 2LDMA 1K9MU 2WSEE 2YHTA 5LJ3d 3SB2A 2M9UA 4OGEA 1TH7A 4QVDA 1N6AA 2GNCA 4M77E 4E6RA 5LJ5j 2MWPA 3UF4A 2E65A 4ZGEB 1ZBJA 4C8QE 1UFFA 1OPKA 3MEVA 2E1HA 1YJNQ 1JJ2S 3EFOA 2QXFA 4A53A 3GOXA 1Q82U 2YUPA 2EKHA 1KHIA 1G3TA 1MV3A 1ZX6A 4TVRA 5KCOA 2C06A 4GBQA 3OA6A 2KXCA 4RG8A 2NUTA 1YWOA 4XTVA 3CC2Q 5GAN4 2F5KA 3RNJA 2DL4A 1X6BA 2GCXA 3GIBA 2H3EB 3EG2A 1WX6A 1K0XA 1YHQQ 2EQUA 3EGUA 2HQHA 4FW2A 2O4XA 1WXBA 3JCMW 1JXOA 1SKUB 3NFCA 4XU2A 4A54A 2EJFA 3ASKA 3OYDA 4F7UE 3LGFA 1QW1A 4XTUA 2HL5C 2OTLT 1JO8A 3OB9A 2LCCA 3CMEA 1I0CA 1HYOA 3MCAB 4OVAA 4FU6A 2QQAA 5C6SA 3CD6Q 2K9GA 2KAFA 4KGXB 3KXTA 4A63B 5HCKA 3OS0A 2K7AA 4NOYA 3MEUA 2CP6A 2EQMA 3HPWA 3JCMf 3UA7A 4HVWA 2IIMA 2A37A 3PVLA 3EFSA 4ME7A 3OS2A 2BZ8A 4JJBA 2F2XA 4N0AA 3X24B 2H8HA 4JRIA 3G4ST 4C5EA 1AHJB 2DTOA 2GQIA 2L3QA 1YJNT 4M78C 2COYA 5GANe 1XTDA 1YBYA 2VKNA 1AWXA 4M4ZA 3I56T 2YWWA 2RMOA 5KE2A 2MPXC 3VUZA 3CCQT 1O75A 2EJGA 3VS1A 1N8RC 1W70A 2Y4YA 1VQ9T 2ZPIB 2P0QA 1KD1R 3I35A 1X69A 1BIAA 1RACB 2EW3A 1NPRA 3LGLA 4KUIA 1U8RA 3EH1A 1H3HA 3RDVA 5AT1B 2L8DA 1KG1A 1IZ6A 4M7AD 2L3SA 4E7KA 2DEQA 3BFMA 3EHQA 3A8GB 2LQNA 5CO7A 2ECZA 1ZSZB 2L2PA 1H3ZA 1R8OB 1MMGA 4Z02A 1QCNA 1VQKA 2KI7A 3MJXA 3MP6A 2O88A 2KMTA 4Y91A 3L2UA 3JAME 2XDBA 2KY9A 1IGUA 1I81A 2VASA 8ATCB 3CCSQ 1C1AA 1M2VA 3M55A 3JCMJ 1D09B 2E10A 1Y7XA 2O9SA 1R77A 1S72T 1JU5C 2QQSA 1JB0E 5A0DA 5GAOp 1ACMB 2JOYA 4A4HA 2EQKA 3KUFA 4IUTA 2Y4XA 1JEGA 2JW4A 2KROA 1LNXA 2LCLA 3TCJA 3CMEQ 1UEBA 3HKSA 1JBMA 3UATA 2AZVA 2RJDA 3RMQA 2CSQA 4BUGA 4DEYA 2WACA 4HCKA 5GAOl 4PLLA 4AG2C 4F14A 2CZ6B 2FB7A 1UJ0A 3MP8A 4M7DG 4PJOB 3CCLQ 4QT7A 3CCUT 1K9AA 2KT8A 1AT1B 3JB9D 3CCSA 3INZA 3PMTA 3CCUA 1E7OA 4M78D 4QQGA 3DLMA 2BUDA 3EAEA 2R57A 2PUOB 5I2SA 1WXTA 4B9WA 2NUZA 1KC8C 2OAWA 3NTHA 1K73R 2CREA 1UB4A 3RKWA 2JTEA 1B34B 4M7DC 3EFOB 2BE7D 1PRLC 1WQWA 4LD6A 3I55Q 2A3LA 4X1VA
chains in the Genus database with same CATH topology
1QP3A 3M57A 4L59A 4M77C 5D6XA 3JB9J 4M75E 2LVMA 4JUVA 1RL2A 2R5MA 4JLGA 4EMKC 4ZGJB 4BDYA 1VQ7A 5GMKi 4C92C 3LH0A 1BI3A 4ZTFA 3J7AF 3QKJA 1FX7A 5D6WA 2V8JA 2QEXT 2OTLA 1Q7YC 2RI2A 1QP2A 2JVVA 4M7AC 1PSEA 1VQ5A 2K5IA 3X26B 4ELYC 1VQLT 2K2VA 3FB9A 3CC7T 2DXCA 2HNIA 2F69A 3A8HB 3F70A 2DAQA 4J83A 1B34A 1RI0A 5J26A 4M7AB 3OYKA 2M0OA 2PVDB 1M90C 2MF2A 1M1FA 3RERA 4JS5A 1X01A 3TU4K 1BYMA 3FLGA 4J7IA 1YJ9A 2D0QB 3JCMX 4A4FA 1I5LA 2EJ9A 4EMKB 4ZN1A 4B9XA 3MEWA 3OYMA 3CD6T 1VUBA 1V29B 3NTKA 4L5GA 3V8KA 4C92F 2RHIA 4PJOE 2VC8A 1VQMT 2M16A 4QQ6A 3LW5E 3OYIA 4BB7A 3JCMP 2DD4A 3WVDB 3I56A 4E7HA 3TEEA 3FRNA 4DOWA 1YITA 3VJPA 2DTIA 2EAYA 2MMPA 2XU8A 1VQ4T 2K3YA 2YLBA 3CEYA 3HP9A 4R55A 3DB3A 3QHSA 5GANf 4NS5A 2LNVA 3I55A 1ZHIA 5CKEA 3X25B 2PUKB 4C0ZA 4MDXA 2OAUA 2E6ZA 2NLUA 4PJOF 4M78B 5GAMh 4C5IA 3OYNA 3GF5A 3SWNC 3JCMb 3L2WA 1W2BS 2EIFA 2RO0A 3C4SA 5GAN6 5CR2A 2MI6A 2FL7A 2OTJA 4WF2A 1YHQA 3CC4A 3OS5A 2HQEA 4J8OA 1YIJT 2V8IA 4IURA 3CCEA 3OYEA 1KD1C 1BI2A 4OF1A 1VQ8T 2RI3A 3OBWA 2MAMA 1VQOT 2D6FA 1YJWT 5I2MA 3GPLA 5GANj 4PNOA 2DXTA 3O8VA 1I4K1 3JCMc 1Q81C 3RKXA 3PMIA 3PFSA 2EWNA 2P0KA 4C8QG 3CC2T 4BACA 1X75C 3OMCA 2JTMA 4RMOA 1VQ6A 4C92D 5IT9E 4KULA 2B8AA 2QQBA 1KHCA 3QYHB 2CS7A 1VIFA 4MZMA 1KD1U 4MMKA 3SD4A 5FU6C 2LQKA 5HK3A 4M7DF 2E5QA 4L6V5 2L89A 1BI1A 2JTFA 3CMAA 3BDUA 4OB3B 1K73U 3CCLA 4BE2A 1Q82C 4XTWA 1KC8U 4HT8A 2ZCFB 4M77A 2RJEA 5GAMf 5GAN5 4E7LA 4M75A 4XU1A 4LD9K 2P4TA 2XKOC 4XTYA 3RKYA 3HRTA 5GANg 5LJ5h 1OI1A 3S6WA 2LT1A 4J6XA 3L42A 5HY6A 4Q5WA 1YHQT 3CMET 3HL8A 3WXMB 3HFOA 4M7AF 3C95A 2QQRA 4M7DA 4XK8E 5EG2A 3JB9I 2RD1A 4BE1A 4R56A 3VYHB 4EMHA 4JRQA 3FEOA 2DIQA 2WSFE 4M77G 3CCRA 2RJFA 2XHCA 3CXCS 4C92B 1K8AC 5HKCA 3QUIA 1YITT 3MO8A 4M75G 5I21A 2K5LA 2K5FA 5LJ3g 3CCJT 4C8QC 4C92E 3M4GA 5DY9A 2AHJB 5GAN7 1HXDA 5LJ5d 4RCBA 4LDVA 1WNLA 1W4SA 4J7FA 4HA8A 3M4YA 1N9SA 4QW2A 5IAYA 4X9DA 3MEAA 4FSXA 4GY5A 3X20B 1QVFA 2X4JA 4HCBA 4X9CA 3OBYA 1W2BA 1M90U 5HK0A 3DKMA 1XQHA 3JCMh 4FT2A 2QI2A 5GAOm 2BIVA 1WQ7A 4M75C 4M78A 4J5YA 3V8LA 1LOJA 3QZ9B 2VV5A 4KT0E 3QO3A 4IUVA 4E7IA 3J80E 3S3MA 3HHTB 3UDCA 3M56A 4PJOG 5L8RE 2MWOA 5GANh 4LDXA 2G3RA 2VYTA 3V7SA 4EPCA 3N5BB 5LJ5g 1GXIE 5C0MA 2DKGA 1UGQB 4XAXB 1EIFA 2EFIA 5LJ3j 3ZBDA 3GNGA 1VIEA 5CKBA 4NL3A 4HCCA 4N0AC 4JDSA 4EDUA 4M7AA 3VV0A 3JCMg 3H6ZA 4OGCA 5A0GA 2QQ9A 2VXFA 4A4EA 4N4IA 4EMKA 3GLXA 3PIPA 3A8OB 4C92G 3M54A 2RM4A 2VUBA 3GNFB 2RH2A 4J6WA 2EKOA 2XK0A 3QPHA 3V8JA 2DD5A 3CC2A 4C5HA 2LDMA 4QVZA 1FXXA 1K9MU 1WJSA 2WSEE 4PJOC 2YHTA 3DB4A 5LJ3d 3OYCA 2H3JA 3SB2A 4M7DE 2DIGA 2RI5A 2M9UA 4OGEA 5KE3A 2HAXA 4FM4B 1TH7A 1N9RA 4QVDA 4RG2A 3X28B 3CCMA 1N6AA 2XG8D 3Q1JA 3OYAA 4FIBA 1Q81U 4X34A 1IREB 2LQ8A 2F5TX 3V7CA 3G7ZA 5FU6B 2QDYB 4O6JA 5FU7C 4M77E 3QZ5B 5LJ5j 2MWPA 3FC3A 4F7UF 2E65A 4ZGEB 1LJOA 2L3RA 4M75D 4C8QE 1P92A 2A7YA 3CBOA 4BI8B 1G3SA 2X4XA 3L1AA 2DVEA 1OZ3A 1WPYA 3RUXA 2DZ9A 1YJ9T 3MEVA 2E1HA 2ZPGB 4OMFB 2DO3A 1M1KU 1VQ6T 1JJ2S 3HSBA 1M9SA 5LJ3e 3CCMT 5CKHA 4E47A 1G3WA 1QVPA 2RHUA 2VXEA 1VQOA 3A8MB 3P8HA 5FLXE 1YI2A 5GAOq 1M5Q1 1K73C 2QXFA 4A53A 4LDWA 3GOXA 1NJIC 1Q82U 3HRUA 1UGPB 2RA2A 2HD0A 3OSVA 3P8BB 3WVEB 3LWHA 2ZPFB 1M8VA 1KHIA 3C12A 1G3TA 5J39A 2DK3A 1BIBA 1HK9A 1U1TA 2RK2A 3QIIA 1NZ9A 2IVWA 2JN0A 1O9SA 2RK1A 2V8KA 4JLIA 4M75B 4TVRA 5KCOA 2C06A 2LC4A 4CRIA 3OA6A 4UC4A 3KBGA 4FL6A 4RG8A 4OP0A 4XTVA 4FT4A 1I8FA 4MZPA 2OTJT 5GAN4 2F5KA 2K4YA 2VGNA 3HFNA 5FROA 3M59A 3BW1A 2GCXA 3JCMQ 3GIBA 2PVGB 4MDWA 3A8LB 4LDYA 4Y28E 5FRMA 2EQUA 2E6NA 5DLQE 2EQJA 4BI3A 2ZPEB 2O4XA 2FYKA 3JCMW 4YTLA 5CKDA 4IUUA 4C8QD 3CCRT 2DTHA 3NTIA 3NFCA 1ZBXA 1M4ZA 4M78E 4QQDA 1KQ2A 5CIUA 4NL2A 4OB2B 2CZ0B 2HQXA 2KVQG 4XU2A 4A54A 2EJFA 5LJ3h 4F7UA 3C94A 5KCHA 3QSUA 3CXCA 3ASKA 5J3BA 4ELZC 2X4YA 3OYDA 1YJWA 4F7UE 3LGFA 4EMGA 1QW1A 4HT9A 2I2LA 4XTUA 5FRNA 5DLOA 2D9TA 3OMGA 4HCZA 2OTLT 3OB9A 4V2SA 4ZN3A 3QYGB 2LCCA 3CMEA 1SSFA 3MCAB 4OVAA 3CCJA 4FU6A 5D6YA 2QQAA 2ZPBB 2QTXA 2KSSA 3RIRA 2JUFA 1D3BA 2HBPA 2KDSA 4J6YA 5C6SA 3L2RA 1YI2T 3BDLA 2FHDA 2CZ1B 1KQSS 2JZ2A 1VQNA 3LX7A 4C5GA 2KAFA 4GLKA 2YLCA 4M77F 2DPPB 4ZGDB 5CKFA 3KXTA 2VGMA 3LLRA 2XD0A 4P5NA 3L2VA 2RHYA 2XICA 1NE8A 3JRZA 1QVGA 3OS0A 2E41A 3CBMA 5AYFA 4NOYA 3MEUA 3UT1A 5A2QE 3OW2A 4A4GA 4HKEA 4C8QF 1G5VA 5GMKm 2RJCA 5GMKj 2EQMA 3HPWA 3M53A 3JCMf 3JB9G 4MMLA 1K9MC 3M58A 2GFUA 3META 2Y90A 5KH6A 1DJ7B 3EFSA 4ME7A 4QVCA 2M1HA 3OS2A 3CMAT 4JRKA 4M7AE 3VUBA 1FWZA 4N0AA 3OYGA 3X24B 2LTOA 4JRIA 2YRVA 2CGHA 1WGSA 1YIJA 4XU0A 3CPWA 2E12A 3G4ST 4ZTJA 3CCVA 2CZ7B 4C5EA 3CC4T 4RCCA 1AHJB 2DTOA 4KUDK 3SWNB 3VKIA 1YJNT 2GF7A 4M75F 4M78C 4ATOA 3L2QA 1VQ4A 4C0FA 5GANe 1XTDA 1YBYA 3GP8A 1VQPT 3CBPA 1WJRA 3I56T 3QDRB 5FU7B 2KK4A 5KE2A 3S3NA 1M1KC 3VU3C 3FDRA 1ZQ1A 1VQMA 3JSCA 3VUZA 3G71T 5LL6S 3CCQT 2L5QA 1MGQA 1NJIU 1O75A 2EJGA 1VQ8A 2DXBA 2CYZB 4BY6B 1N8RC 1KQSA 2Y4YA 3E1SA 3PGGA 1VQ9T 1BKBA 2ZPIB 3CPFA 1JJ2A 2P0QA 1BIAA 5LJ5f 3PNWC 3E9FA 2DZCA 2FVUA 4VUBA 1NPRA 3LGLA 4KUIA 3SWNA 3JCMV 5GANd 3I55T 1U8RA 3AHUA 1Q86U 2L8DA 1NPPA 3T9NA 1KG1A 1IZ6A 2O01E 3OY9A 3OYYA 4M7AD 5GMKl 1X6OA 2IG0A 4E7KA 2DEQA 3BFMA 3CC7A 3A8GB 4BI4A 1VQLA 3H8ZA 4JS4A 1WJQA 5CO7A 4PKCC 3LYIA 1OYXA 1H3ZA 1R8OB 4C0GA 4Z02A 2CKKA 3V7RA 2LX9A 4A4KA 3OYLA 1VQKA 4RKUE 5GAN8 2E70A 2KQWA 1VQNT 1VQ7T 3MP6A 3A5ZB 4M77B 2KMTA 4Y91A 3L2UA 4PJOA 3JAME 2XDBA 5CQXA 1S72A 4OB1B 2KY9A 3S3OA 1Q7YU 3PT9A 3JB9H 1I81A 1KQ1A 5LJ3f 4M7DD 1QVFS 1PSFA 3QJYA 1QVGS 3ZEHA 3OS1A 4M7DB 4E7JA 4M7AG 2WSCE 2GQVA 1XOVA 1M1GA 5GAMd 5GMKh 4JJNK 3M9QA 2P0PA 4KBMB 5GAN3 4XQ3A 2E64A 4M77D 3M55A 3JCMJ 3DLLA 2PVOB 4BD3A 2E10A 5IN1A 4C8QB 1Y7XA 3CCLT 1D3BB 1S72T 1U1SA 3G6EA 3ER0A 2QQSA 1JB0E 3OYFA 3LWIA 1VQ9A 2XI9A 1XNIA 3L2ZA 2LT4A 4XTXA 5A0DA 3OYHA 5GAOp 2JOYA 4A4HA 2PQWA 5GAN2 5GAMg 2EQKA 3G71A 3CCQA 4PL6A 5CCAA 3KUFA 3CCST 4IUTA 2Y4XA 5GAMe 3MHXA 4JRPA 2XIDA 3PTAA 1LNXA 5A0LA 2LCLA 3TCJA 4II1A 1Y96A 2RHXA 4N4GA 5DM7R 4IKFA 1UEBA 4C8QA 2XDPA 3HKSA 4C0DB 5M9OA 1JBMA 5LJ5e 2PU9B 2RB6A 1H641 3ZFJA 2RJDA 3RMQA 4BY6C 3URGA 1OZ2A 4N4HA 3SDZA 4BUGA 3UPUA 3CCET 2RHZA 2WACA 2JNGA 3MP1A 5GAOl 2QA4A 2K3XA 2DXUA 4PLLA 3OW2S 2CZ6B 2FB7A 3P8DA 5CQYA 3MP8A 4F7UB 1VQPA 3PIOA 4M7DG 4DA4A 4PJOB 1N27A 4MZTA 4C0DC 3CCUT 3JB9F 3OQ5A 3JCMd 4M78G 3OYBA 3UWNA 4PLIA 3QXEB 4D6WA 3JB9D 3QG1A 3CCSA 3CCVT 3INZA 3PMTA 5CVIA 2O4XB 1Y96B 5GAMj 3CCUA 1UGSB 4M78D 2ZGWA 3DLMA 1G3YA 2ZZDA 2BUDA 3OSSC 3R6OA 4IUQA 4M78F 4QQGA 1BI0A 4F7UG 3J81E 3FIFA 3EAEA 3FJPA 2R57A 2PUOB 5I2SA 4BE0A 2DJZA 1YJNA 4DQ2A 3E9GA 2QA4T 1UGRB 3CPWS 1Y07A 3G4SA 4B9WA 2ZPHB 3CD6A 3M5AA 3SFMA 5CAIA 3QJ6A 5GAOn 2XDDA 1KC8C 1N8RU 4IUPA 5GAOr 4O5VA 3BY7A 2BKDN 4XU3A 5GMKe 3HRSA 3NTHA 3G6ET 1JRIA 3VYGA 3JCMe 2GFAA 3ME9A 4XTZA 4C92A 1UB4A 2R58A 2X35A 3EFRA 3RKWA 1YCYA 2X4WA 1VQ5T 4PJOD 1Q86C 3E19A 3QBYA 5CK9A 2QEXA 1B34B 4OB0B 3OYJA 4M7DC 4LDUA 2EYQA 2K57A 4CI0C 1WQWA 4LD6A 1MHNA 4DOVA 2R5AA 3TREA 4BDZA 2A3LA 2LRQA 3RESA 1Y71A 1VQKT 3RMSA 1K8AU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R56 A;  3KXT A;  2JTM A;  3LWH A;  4R55 A;  3LWI A; 
#chains in the Genus database with same CATH topology
 1YIT Q;  1QP3 A;  5D6X A;  3JB9 J;  1YP5 A;  2LVM A;  3REA B;  1M27 C;  4JLG A;  4BDY A;  3QKJ A;  1B3Q A;  1Q7Y C;  1PSE A;  4ELY C;  1VQL T;  3FB9 A;  2HNI A;  2HSP A;  1RI0 A;  2PVD B;  3RER A;  1OUL A;  1X01 A;  1BYM A;  3FLG A;  2D0Q B;  2HZY A;  4JJD A;  3MEW A;  3V8K A;  4PJO E;  4QQ6 A;  3LW5 E;  4BB7 A;  1ZUK A;  3JCM P;  2DD4 A;  1BBZ A;  1TSF A;  4R55 A;  3HP9 A;  1VYT A;  4AFZ C;  2PUK B;  2OAU A;  1WHK A;  3OYN A;  1OQK A;  3JCM b;  3EGD B;  2EIF A;  1PKT A;  2MI6 A;  1YHQ A;  3CC4 A;  2QK0 A;  2HQE A;  3CCE A;  2RI3 A;  2M02 A;  3QWX X;  4FYY B;  3O8V A;  3PMI A;  1X75 C;  1M3C A;  2JTM A;  4J9E A;  1UUE A;  4JZ3 A;  3VRY A;  2B8A A;  2QQB A;  5KYY B;  2CS7 A;  1VIF A;  4MMK A;  5FU6 C;  2LQK A;  1AWW A;  1WZO A;  1JXM A;  3BDU A;  2RF0 A;  1PD1 A;  3EG9 B;  1M1K R;  5GAN 5;  4FYX B;  2F1L A;  4M75 A;  7AT1 B;  1UHF A;  4XTY A;  2KRN A;  3RKY A;  3HRT A;  3EG9 A;  3AT1 B;  2DET A;  5HY6 A;  3HL8 A;  1WHJ A;  2QQR A;  2O9V A;  4ANJ A;  5EG2 A;  2RD1 A;  4JRQ A;  4EMH A;  1GFD A;  4M77 G;  1WYX A;  2HCK A;  2DMO A;  1YIT T;  3MO8 A;  5I21 A;  2K5F A;  4K11 A;  2HSE B;  3M4G A;  3KFV A;  2AHJ B;  4LDV A;  1WNL A;  1H92 A;  1W4S A;  5IAY A;  2KEA A;  1HJD A;  2ESW A;  4X9D A;  4GY5 A;  2CSI A;  2ED0 A;  5HK0 A;  3JCM h;  1XQH A;  4AT1 B;  4KGZ B;  2DER A;  1WQ7 A;  1UJY A;  4KT0 E;  3QO3 A;  2EYX A;  4E7I A;  3J80 E;  3HHT B;  3VS6 A;  2RQW A;  1ZSZ C;  5GAN h;  1GXI E;  2DL7 A;  5I22 A;  2DKG A;  1ARK A;  5LJ3 j;  4NL3 A;  4M7A A;  4JDS A;  4EDU A;  9ATC B;  3VV0 A;  1QCF A;  2M0Y A;  2QGG A;  3A8O B;  1PKS A;  2RH2 A;  1M3A A;  1B07 A;  3QPH A;  3V8J A;  1FXX A;  1NYG A;  3HTR A;  3OYC A;  4JJC A;  2H3J A;  2DIG A;  2RI5 A;  2LQW A;  4RG2 A;  2LQ8 A;  1I5O B;  2F5T X;  3G71 Q;  4Z8A A;  3QZ5 B;  3FC3 A;  2DJQ A;  4M75 D;  2L3R A;  2A7Y A;  4BI8 B;  3CBO A;  1WPY A;  2DZ9 A;  1YJ9 T;  2ZPG B;  1M1K U;  2X9H A;  1QVP A;  4J9B A;  3P8H A;  5FLX E;  1K73 C;  2E5K A;  2X3X D;  3OSV A;  3WVE B;  2HD0 A;  3CCJ Q;  1AEY A;  2FPE A;  3C12 A;  1HD3 A;  1QVF P;  1BIB A;  1U1T A;  4AG1 C;  4D6W A;  1YJW A;  2IVW A;  3CMA Q;  1O9S A;  4M75 B;  2V8K A;  4FSS A;  4CRI A;  4UC4 A;  4FL6 A;  1TU0 B;  4OP0 A;  4FT4 A;  4MZP A;  2PNI A;  2LCS A;  2K4Y A;  2VGN A;  3JCM Q;  1RLP C;  4MDW A;  1YJW Q;  4BI3 A;  3RBB B;  2ZPE B;  2FYK A;  3CCR T;  1MND A;  1ZBX A;  4QQD A;  2GGR A;  5CIU A;  4NL2 A;  2CT4 A;  2HQX A;  2KVQ G;  5KCH A;  1EFN A;  3C94 A;  3QSU A;  5J3B A;  2X4Y A;  2HMA A;  3EGX B;  5FRN A;  2D9T A;  1NM7 A;  1U06 A;  1GL5 A;  2DX1 A;  1SSF A;  4LXC A;  2ZPB B;  2JUF A;  1D3B A;  4QKU A;  3L2R A;  2A08 A;  1YI2 T;  1BK2 A;  1TUD A;  3LX7 A;  4M77 F;  3PE0 A;  3LLR A;  2XD0 A;  2RHY A;  4J9D A;  3CC7 Q;  1QVG A;  1NLO C;  1NLP C;  1VYU A;  2DM1 A;  1G5V A;  2RJC A;  5GMK j;  1RAB B;  3JB9 G;  2CUD A;  4MML A;  2GFU A;  2JXB A;  3MET A;  3IQL A;  5KH6 A;  1D1B A;  1S1N A;  1CKB A;  4JRK A;  2FG0 A;  4E7S A;  4FW1 A;  2YRV A;  2CDT A;  4RTT A;  1WGS A;  2J7I A;  2E12 A;  3CC4 T;  4KUD K;  2EGC A;  1RAI B;  3EGD A;  2JMC A;  2AT1 B;  1YJ9 Q;  2O31 A;  1VQ4 A;  4F04 B;  3CBP A;  2QAZ A;  5I11 A;  1Z9Z A;  1M1K C;  1ZQ1 A;  1VQM A;  5LL6 S;  1IGQ A;  3TSZ A;  1NJI U;  2CYZ B;  2QDL A;  2BE9 B;  3E1S A;  3PGG A;  2RQV A;  1BKB A;  3CPF A;  1JJ2 A;  1QWF A;  1ZA1 B;  3PNW C;  2OTL Q;  2DE0 X;  2DZC A;  3I55 T;  3AHU A;  2O01 E;  1IO6 A;  3OYY A;  1K76 A;  5GMK l;  2OX7 A;  4BI4 A;  1GCQ C;  4JS4 A;  1VQL A;  1WJQ A;  1OYX A;  2HBW A;  4C0G A;  4A4K A;  2E70 A;  4CC7 A;  5CQX A;  3S3O A;  3PT9 A;  5LJ3 f;  1PSF A;  1WHG A;  4ZNX A;  3ZEH A;  2Z0W A;  4M7A G;  2MCN A;  1M1G A;  5GAN 3;  2E64 A;  4BD3 A;  2PTK A;  4C8Q B;  1S72 Q;  1NEG A;  1D3B B;  1ZSZ A;  1U1S A;  2XI9 A;  1XNI A;  3OYH A;  3H9N A;  2DNU A;  4ORZ A;  4Y92 A;  5GAN 2;  5GAM g;  1WI7 A;  1GCQ A;  5GAM e;  3PTA A;  1Y96 A;  4N4G A;  1MNE A;  1VQN Q;  1M2V B;  2RB6 A;  1Y0M A;  4N4H A;  3REB B;  4AFQ C;  4J9H A;  3MP1 A;  3VS3 A;  2K3X A;  3P8D A;  3PIO A;  1X43 A;  4M78 G;  2NUP B;  3QXE B;  4IIM A;  2C0I A;  3QG1 A;  2NUT B;  1E6G A;  5CVI A;  1UGS B;  1G3Y A;  2ZZD A;  1KD1 C;  4M78 F;  3ULR B;  1BI0 A;  2W10 A;  3FIF A;  2YXY A;  1EZZ B;  2AK5 A;  2QA4 T;  2X51 A;  1Y07 A;  3NHN A;  1V1C A;  3M5A A;  1BU1 A;  3SFM A;  1ZUY A;  2RNA A;  5KYU B;  1PCX A;  1RLQ C;  2BKD N;  5GMK e;  3HRS A;  5IXF A;  1JRI A;  3JCM e;  2GFA A;  3VS2 A;  2R58 A;  1YCY A;  2D1X A;  4PJO D;  5CK9 A;  1PNJ A;  3OYJ A;  2EYQ A;  2CP5 A;  1BB9 A;  4BDZ A;  2LRQ A;  4KH1 B;  3RES A;  2LNH B;  1K8A U;  4J9G A;  4M75 E;  1QWE A;  2DRK A;  2R5M A;  4EMK C;  4ZGJ B;  1TXQ A;  2LJ0 A;  5GMK i;  3LH0 A;  3O5Z A;  4ZTF A;  2OTL A;  1FX7 A;  2RI2 A;  2JVV A;  2FZC B;  2JS0 A;  2VWF A;  1GFC A;  2F69 A;  3A8H B;  4LN2 A;  1VYV A;  1B34 A;  3OYK A;  2YUQ A;  1ZSG A;  3G4S Q;  3QDF A;  4A4F A;  2EJ9 A;  4EMK B;  1D0Z A;  4B9X A;  1VUB A;  2ED1 A;  1QKX A;  3OYI A;  4E7H A;  1R0B G;  3TEE A;  1OU9 A;  1T0J A;  2EAY A;  2MMP A;  2XU8 A;  2RN8 A;  3SEM A;  2JMA A;  2LNV A;  1ZHI A;  3X25 B;  3TQ7 P;  4C0Z A;  5GAM h;  2FZK B;  3GF5 A;  3L2W A;  1UEC A;  2BZY A;  3C4S A;  2OTJ A;  3OS5 A;  4OMM A;  1VQ8 T;  2V8I A;  4OMO A;  1BI2 A;  2JM8 A;  1MMN A;  2VVK A;  2LMJ A;  1UTI A;  2KBT A;  2D6F A;  2MAM A;  3GPL A;  4PNO A;  2DXT A;  4AFS C;  2EPD A;  1B7T A;  1W1F A;  2P0K A;  4C8Q G;  4BAC A;  4RMO A;  1VQ6 A;  5IT9 E;  1KHC A;  4MZM A;  2COZ A;  1TOV A;  1N8R R;  4L6V 5;  4LE9 A;  3CMA A;  4OB3 B;  2NWM A;  1Q82 C;  2FRY A;  2ZCF B;  1W2B P;  2RJE A;  3M0Q A;  1WHM A;  5GAN g;  5LJ5 h;  3L42 A;  1SRL A;  3CME T;  3C95 A;  2ZAE A;  2YRD A;  4M7D A;  2OTJ Q;  3JB9 I;  4BE1 A;  3VYH B;  2WSF E;  2XHC A;  1K8A C;  4DEX A;  4E2F B;  1PHT A;  3QUI A;  2K5L A;  3A1P A;  3SHW A;  4C92 E;  1MUZ A;  5DY9 A;  4RTY A;  1AWJ A;  5GAN 7;  5LJ5 d;  2OI3 A;  4RCB A;  4RUG A;  2MOX A;  1PC0 A;  4J7F A;  3NPF A;  5IHK A;  3LH5 A;  3M0U A;  3MEA A;  4FSX A;  3M0P A;  1VQ6 Q;  2X4J A;  1NYF A;  1QQJ A;  1LVK A;  1W2B A;  4Z89 A;  1M90 U;  2QGF B;  3DKM A;  2QI2 A;  2BIV A;  4M78 A;  3THK A;  3QZ9 B;  4RTV A;  3S3M A;  3M56 A;  3EHR A;  1VQ7 Q;  3V7S A;  1EIF A;  2E3I A;  1ABO A;  1T3S A;  1VIE A;  3GNG A;  5CKB A;  1EX4 A;  4LUD A;  3JCM g;  3H6Z A;  1PG5 B;  4OGC A;  2VXF A;  4N4I A;  4EMK A;  4C92 G;  3M54 A;  1RAF B;  4QVZ A;  4PJO C;  1GBQ A;  4M7D E;  3TVT A;  3CCM A;  3X28 B;  3TSW A;  2XG8 D;  3Q1J A;  3OYA A;  1Q81 U;  3CCQ Q;  5FU6 B;  4OML A;  3MPU B;  3I56 Q;  1P92 A;  1G3S A;  2QYZ A;  2X4X A;  4DBF A;  4J9F A;  4OMF B;  2DO3 A;  1VQ6 T;  3HSB A;  1VA7 A;  3I5S A;  5CKH A;  4E47 A;  1G3W A;  2VXE A;  1X2Q A;  3CQT A;  3A8M B;  1YI2 A;  2GTJ A;  4LDW A;  1FMW A;  2RA2 A;  2AIR B;  4LUE A;  2ZPF B;  1M8V A;  3CPW P;  4DQ2 A;  1HK9 A;  4JLI A;  1NZ9 A;  2JN0 A;  2SRC A;  1PRM C;  2W0Z A;  4CC2 A;  1K8A R;  3KBG A;  1QKW A;  2KXD A;  5KYU A;  1ZA2 B;  1I8F A;  2OTJ T;  3HFN A;  3M59 A;  4LDY A;  1M8M A;  1YWP A;  4KGV B;  5FRM A;  1FMV A;  5DLQ E;  1VOM A;  4YTL A;  5CKD A;  1VQ8 Q;  1YFN A;  4IUU A;  4RTX A;  2DTH A;  3NTI A;  1M4Z A;  1ZUU A;  4OB2 B;  2CZ0 B;  1Q82 R;  3CXC A;  3BE3 A;  1JJ2 P;  4HT9 A;  2I2L A;  5DLO A;  2JS2 A;  3OMG A;  4HCZ A;  5L23 A;  1KC8 R;  4V2S A;  4ZN3 A;  3CCJ A;  5D6Y A;  2HEQ A;  2QTX A;  1AD5 A;  1ZLM A;  2KDS A;  2FHD A;  2CZ1 B;  2CP2 A;  1VQN A;  4C5G A;  4Z88 A;  4GLK A;  2K3B A;  1BCO A;  2YLC A;  2KNB B;  5CKF A;  1UE9 A;  1YIJ Q;  2HDA A;  1NE8 A;  5AYF A;  1UHC A;  1BCM A;  3UT1 A;  5A2Q E;  3OW2 A;  4A4G A;  4HKE A;  1NEB A;  2QEX Q;  5GMK m;  1KIK A;  3M53 A;  1Y57 A;  3EG1 A;  1K9M C;  3M58 A;  2Y90 A;  5KYX A;  1DJ7 B;  2DFU A;  4M7A E;  1VQK Q;  1F1B B;  4HVU A;  1X6G A;  2LTO A;  2DYB A;  1YIJ A;  4XU0 A;  2QTV A;  3CCV A;  2CZ7 B;  4RCC A;  3SWN B;  3VKI A;  3L2Q A;  1UDL A;  3GP8 A;  1E6H A;  1VQP T;  1TWB A;  3QDR B;  5FU7 B;  5IH2 A;  1MGQ A;  1H8K A;  1A0N B;  2DXB A;  2QA4 Q;  2KR3 A;  2YRC A;  4J9I A;  5LJ5 f;  1RAH B;  3E9F A;  4RTZ A;  2FVU A;  3SWN A;  1JQQ A;  2V26 A;  3T9N A;  2LZ6 B;  3OY9 A;  2AZS A;  5EC7 A;  2P84 A;  3H8Z A;  4PKC C;  3CCR Q;  2LX9 A;  4RKU E;  5KYY A;  1VQN T;  1VQ7 T;  4M77 B;  1I07 A;  4DBQ A;  1J3T A;  4PJO A;  3JV3 A;  1Q7Y U;  3JB9 H;  4M7D D;  1QVF S;  5FW9 A;  3QJY A;  2KE9 A;  2RQT A;  2JJ9 A;  4M7D B;  4E7J A;  2WSC E;  2GQV A;  5GAM d;  2O2O A;  3R6N A;  3M9Q A;  2P0P A;  4KBM B;  4XQ3 A;  4M77 D;  1Q81 R;  2PVO B;  5IN1 A;  3EG3 A;  2QG9 B;  3G6E A;  3OYF A;  1VQ9 A;  2J05 A;  3CCQ A;  4PL6 A;  5CCA A;  4KH0 B;  1RAA B;  1D0X A;  2YDL A;  3NMZ C;  2ATC B;  2KT1 A;  2RHX A;  2JT4 A;  5LJ5 e;  2EYY A;  1H64 1;  3CCE T;  2RHZ A;  2G6F X;  1PWT A;  2JNG A;  3OW2 S;  2DXU A;  2DA9 A;  5CQY A;  4F7U B;  3C0C A;  1PD0 A;  3VS0 A;  4MZT A;  3JCM d;  3UWN A;  4PLI A;  1KQS P;  2O4X B;  3G1J A;  2ZGW A;  4F7U G;  3I5R A;  3J81 E;  2LJ1 A;  3E9G A;  2AKK A;  2YUO A;  3QJ6 A;  1XJW B;  4D8K A;  2XDD A;  2KYM A;  1N8R U;  1MV0 B;  2DEU A;  3M0R A;  4XU3 A;  3VYG A;  3ME9 A;  3CXC P;  2V1Q A;  2X35 A;  3EFR A;  4EIK A;  5FWC A;  3E19 A;  4OB0 B;  3PVQ A;  3A98 A;  2EYZ A;  2K57 A;  4CI0 C;  5KYN A;  4DOV A;  4D8D A;  1T0H A;  3RMS A;  1U5S A;  3M57 A;  4M77 C;  4JUV A;  1RL2 A;  2DL8 A;  4C92 C;  5GJV B;  5D6W A;  2KRM A;  2V8J A;  2K79 A;  4M7A C;  2K5I A;  2K2V A;  1G8X A;  3CC7 T;  2DXC A;  2YT6 A;  3F70 A;  5J26 A;  4M7A B;  1IHW A;  1M1F A;  4JS5 A;  5KYX B;  2DVJ A;  2F2V A;  4C92 F;  1KSW A;  2VC8 A;  1VQM T;  2C0T A;  4DOW A;  2C0O A;  2YSQ A;  3VJP A;  2DYI A;  2DTI A;  2IPO B;  1VQ4 T;  2K3Y A;  2YLB A;  3DB3 A;  3QHS A;  5GAN f;  4NS5 A;  1CKA A;  4MDX A;  2XMF A;  2E6Z A;  4PJO F;  1WHL A;  4M78 B;  3SWN C;  1W2B S;  2VB6 A;  2RO0 A;  5GAN 6;  5CR2 A;  1VQ5 Q;  2FL7 A;  2DIL A;  2NYS A;  4IUR A;  2P4R A;  3OYE A;  4OF1 A;  2CP7 A;  3G6E Q;  3OBW A;  1VQO T;  1YJW T;  5I2M A;  5GAN j;  1I4K 1;  1SEM A;  4PFO A;  3JCM c;  2E3H A;  2EWN A;  1WXU A;  2MIO A;  1K1Z A;  2RQR A;  1VQ4 Q;  1IXD A;  2J06 A;  4ESR A;  4OMN A;  4M7D F;  1BI1 A;  2JTF A;  1K73 U;  4BE2 A;  1M90 R;  4XTW A;  1KC8 U;  4HT8 A;  4M77 A;  5GAM f;  2CT3 A;  4E7L A;  4XU1 A;  1OX8 A;  4LD9 K;  2P4T A;  2XKO C;  1GBR A;  1OI1 A;  3S6W A;  2LT1 A;  4PFP A;  1TTH B;  5GJW B;  3WXM B;  3HFO A;  2X3W D;  4XK8 E;  4AFU C;  4R56 A;  3FEO A;  2DIQ A;  3CCR A;  4F17 A;  3CXC S;  1WFW A;  3CCJ T;  1UG1 A;  2YUN A;  4HA8 A;  3M4Y A;  1N9S A;  3X20 B;  1QVF A;  3I9Q A;  3OBY A;  2MK5 A;  1X27 A;  1SSH A;  1LOJ A;  4IUV A;  2CH4 W;  3UDC A;  3VS4 A;  4PJO G;  4CC4 B;  4LDX A;  4EPC A;  5LJ5 g;  3N5B B;  5C0M A;  1WLP B;  3ZBD A;  2FO0 A;  2QQ9 A;  4A4E A;  2GTO A;  3VS5 A;  3PIP A;  1C6V X;  4PJM A;  1Q95 G;  1AZE A;  3GNF B;  4J6W A;  2DD5 A;  3CC2 A;  4C5H A;  1WJS A;  2OJ2 A;  1K4U S;  3DB4 A;  1FYN A;  5KE3 A;  2HAX A;  3CCE Q;  4FM4 B;  1N9R A;  4FIB A;  3H41 A;  4X34 A;  1IRE B;  3V7C A;  3G7Z A;  2QDY B;  4O6J A;  5FU7 C;  3H0H A;  4F7U F;  1LJO A;  1PM3 A;  1WHH A;  3RUX A;  3L1A A;  2DVE A;  1OZ3 A;  4AMC A;  1YNZ A;  4PK4 A;  1M9S A;  3H0I A;  3CC4 Q;  5LJ3 e;  3CCM T;  3MKD A;  2RHU A;  2M51 A;  1VQO A;  5GAO q;  1M5Q 1;  1NJI C;  3HRU A;  1UGP B;  2QAS A;  3P8B B;  4RTW A;  3LWH A;  2FEI A;  5J39 A;  2DK3 A;  2DL3 A;  3QII A;  2RK2 A;  2RK1 A;  3EG0 A;  2KGT A;  2E4H A;  2ABL A;  2LC4 A;  2L3P A;  1WDX A;  3VS7 A;  5FRO A;  3BW1 A;  2PVG B;  3A8L B;  4Y28 E;  2E6N A;  1M3B A;  1T3L A;  1SPK A;  2EQJ A;  2RPN A;  1VQO Q;  1QVG P;  1OEB A;  1QLY A;  2AKL A;  4C8Q D;  4M78 E;  1KQ2 A;  1YI2 Q;  4F7U A;  5LJ3 h;  3NGP A;  4ELZ C;  2EBP A;  1NBE B;  4EMG A;  1AOJ A;  2A0F B;  3QYG B;  3H0F A;  4FYV B;  2KSS A;  3RIR A;  2HBP A;  4J6Y A;  3BDL A;  1KQS S;  2JZ2 A;  2DPP B;  4ZGD B;  2J6K A;  2VGM A;  4P5N A;  3L2V A;  2V1R A;  2XIC A;  3JRZ A;  1V76 A;  1SG5 A;  2E41 A;  3CBM A;  4IIO A;  4C8Q F;  2ENM A;  4QVC A;  2M1H A;  3CMA T;  3VUB A;  1FWZ A;  2CP0 A;  3OYG A;  2A36 A;  1D1C A;  2CGH A;  3CPW A;  4ZTJ A;  3CCM Q;  1OV3 A;  2GF7 A;  4M75 F;  2RQU A;  4ATO A;  4C0F A;  3M0T A;  1Z9Q A;  1WJR A;  1G83 A;  1WA7 A;  2KK4 A;  3S3N A;  3VU3 C;  2FZG B;  3FDR A;  4WTO B;  5IHN A;  3JSC A;  3G71 T;  2L5Q A;  1VQ8 A;  4BY6 B;  1KQS A;  1SF9 A;  1YCS B;  5KYW B;  3E2U A;  4VUB A;  1YN8 A;  3JCM V;  5GAN d;  1LPL A;  1Q86 U;  1NPP A;  3CCU Q;  1X6O A;  2IG0 A;  3CC7 A;  1G2B A;  1KJW A;  1HSQ A;  1RAE B;  3LYI A;  1TG0 A;  3V7R A;  2CKK A;  3OYL A;  2D8H A;  4PFZ A;  5GAN 8;  2KQW A;  1NG2 A;  3A5Z B;  1KK7 A;  1S72 A;  4OB1 B;  1FMK A;  3EH2 A;  1KQ1 A;  2D8J A;  4HVV A;  4PJJ A;  3EGX A;  1QVG S;  2DL5 A;  3ZL7 C;  3OS1 A;  2K2M A;  4E7Z A;  1XOV A;  5GMK h;  4JJN K;  2FRW A;  3DLL A;  4FCY A;  2DBM A;  3CCL T;  1IRX A;  3ER0 A;  3M0S A;  1OX9 A;  1CSK A;  3LWI A;  3L2Z A;  2LT4 A;  4XTX A;  2PQW A;  4WCI A;  3G71 A;  1IB8 A;  3CCS T;  4PJN A;  1K9M R;  2HKQ B;  4F16 A;  4PJL A;  3MHX A;  4JRP A;  2XID A;  5A0L A;  4II1 A;  5DM7 R;  2BTT A;  4IKF A;  4C8Q A;  2CUB A;  2XDP A;  4C0D B;  5M9O A;  1M2O A;  2PU9 B;  3ZFJ A;  2EQI A;  4BY6 C;  3URG A;  1OZ2 A;  3SDZ A;  3UPU A;  1WIE A;  2KRS A;  2QA4 A;  1VQP A;  4DA4 A;  3QWY A;  1N5Z A;  1N27 A;  4C0D C;  3JB9 F;  3OQ5 A;  3OYB A;  1C0M A;  3CCV T;  1RAG B;  1Y96 B;  5GAM j;  1U3O A;  1YJ9 A;  4ZN1 A;  3OSS C;  3R6O A;  1Q7Y R;  4IUQ A;  3FJP A;  1YJN A;  4BE0 A;  2DJZ A;  1VQ9 Q;  1UGR B;  3CPW S;  4GLM A;  2FPD A;  3G4S A;  2ZPH B;  3CD6 A;  5CAI A;  5GAO n;  1KFZ A;  4JPB W;  2DBK A;  4IUP A;  2PZ1 A;  5GAO r;  4O5V A;  3BY7 A;  3G6E T;  2NUP A;  4XTZ A;  4C92 A;  2X4W A;  1VQ5 T;  2KYB A;  1Q86 C;  3QBY A;  3GBQ A;  2QEX A;  4LDU A;  2HL3 A;  1MHN A;  2R5A A;  2J6F A;  3TRE A;  1Y71 A;  1VQK T;  1IHV A;  3VRZ A;  1R0C B;  3D7S B;  4L59 A;  4R0K A;  1OOT A;  1VQ7 A;  1VQM Q;  1BI3 A;  3J7A F;  2QEX T;  1QP2 A;  1VQ5 A;  3X26 B;  1TUG B;  1VQP Q;  4CC3 A;  2DAQ A;  2CH4 A;  2FPF A;  2GBQ A;  4J83 A;  5IHI A;  1D0Y A;  2DRM A;  2M0O A;  1M90 C;  4LNP A;  2MF2 A;  4DBR A;  2HKN A;  4DBH A;  1VQL Q;  3TU4 K;  4OMQ A;  4J7I A;  1I5L A;  3JCM X;  3OYM A;  3CD6 T;  1V29 B;  3NTK A;  4L5G A;  5KYW A;  2RHI A;  2M16 A;  1RAD B;  3WVD B;  3I56 A;  3FRN A;  1YIT A;  3CEY A;  5FWB A;  3I55 A;  2SEM A;  1MMD A;  2LJ3 A;  5CKE A;  4B6M A;  1QCO A;  2NLU A;  2JM9 A;  4C5I A;  2EVR A;  1D1A A;  2EGA A;  2BZX A;  2EGE A;  3RR6 A;  1OU8 A;  2DLP A;  2K6D A;  4OMP A;  1TS9 A;  4WF2 A;  5ECA A;  1SHG A;  4J8O A;  1YIJ T;  1Q86 R;  5IXB A;  2LX7 A;  1Q81 C;  1MMA A;  1SHF A;  1UGV A;  1W6X A;  3RKX A;  2EYW A;  3PFS A;  3CC2 T;  3OMC A;  4C92 D;  4KUL A;  1GRI A;  3QYH B;  1KD1 U;  3SD4 A;  6AT1 B;  4HXJ A;  5HK3 A;  2E5Q A;  1M30 A;  2L89 A;  3CCL A;  2CP3 A;  1QMC A;  1SRM A;  1AWO A;  4RTU A;  1X2K A;  4KRT A;  1RUW A;  1AZG B;  2ROT A;  1K0S A;  4J6X A;  1GCP A;  1YHQ T;  4Q5W A;  2A28 A;  4M7A F;  2COW A;  1AVZ C;  2MYS A;  1TUC A;  2J6O A;  3U23 A;  2B86 A;  2RJF A;  4FYW B;  3OW2 P;  4C92 B;  5HKC A;  1I1J A;  5D7U A;  1ABQ A;  4M75 G;  5LJ3 g;  4C8Q C;  2I0N A;  1LCK A;  1HXD A;  4QW2 A;  8AT1 B;  4HCB A;  4J9C A;  4X9C A;  2LP5 A;  2DF6 A;  2F2W A;  3FJ5 A;  4FT2 A;  5GAO m;  4M75 C;  4J5Y A;  3V8L A;  2VV5 A;  5L8R E;  2MWO A;  1OPL A;  2G3R A;  2VYT A;  1RI9 A;  2ROL A;  1UGQ B;  4XAX B;  2EFI A;  4JZ4 A;  3UA6 A;  4HCC A;  4N0A C;  1NJI R;  5A0G A;  3CCV Q;  3GLX A;  2RM4 A;  2VUB A;  2L0A A;  2EKO A;  2D0N A;  2XK0 A;  2LDM A;  1K9M U;  2WSE E;  2YHT A;  5LJ3 d;  3SB2 A;  2M9U A;  4OGE A;  1TH7 A;  4QVD A;  1N6A A;  2GNC A;  4M77 E;  4E6R A;  5LJ5 j;  2MWP A;  3UF4 A;  2E65 A;  4ZGE B;  1ZBJ A;  4C8Q E;  1UFF A;  1OPK A;  3MEV A;  2E1H A;  1YJN Q;  1JJ2 S;  3EFO A;  2QXF A;  4A53 A;  3GOX A;  1Q82 U;  2YUP A;  2EKH A;  1KHI A;  1G3T A;  1MV3 A;  1ZX6 A;  4TVR A;  5KCO A;  2C06 A;  4GBQ A;  3OA6 A;  2KXC A;  4RG8 A;  2NUT A;  1YWO A;  4XTV A;  3CC2 Q;  5GAN 4;  2F5K A;  3RNJ A;  2DL4 A;  1X6B A;  2GCX A;  3GIB A;  2H3E B;  3EG2 A;  1WX6 A;  1K0X A;  1YHQ Q;  2EQU A;  3EGU A;  2HQH A;  4FW2 A;  2O4X A;  1WXB A;  3JCM W;  1JXO A;  1SKU B;  3NFC A;  4XU2 A;  4A54 A;  2EJF A;  3ASK A;  3OYD A;  4F7U E;  3LGF A;  1QW1 A;  4XTU A;  2HL5 C;  2OTL T;  1JO8 A;  3OB9 A;  2LCC A;  3CME A;  1I0C A;  1HYO A;  3MCA B;  4OVA A;  4FU6 A;  2QQA A;  5C6S A;  3CD6 Q;  2K9G A;  2KAF A;  4KGX B;  3KXT A;  4A63 B;  5HCK A;  3OS0 A;  2K7A A;  4NOY A;  3MEU A;  2CP6 A;  2EQM A;  3HPW A;  3JCM f;  3UA7 A;  4HVW A;  2IIM A;  2A37 A;  3PVL A;  3EFS A;  4ME7 A;  3OS2 A;  2BZ8 A;  4JJB A;  2F2X A;  4N0A A;  3X24 B;  2H8H A;  4JRI A;  3G4S T;  4C5E A;  1AHJ B;  2DTO A;  2GQI A;  2L3Q A;  1YJN T;  4M78 C;  2COY A;  5GAN e;  1XTD A;  1YBY A;  2VKN A;  1AWX A;  4M4Z A;  3I56 T;  2YWW A;  2RMO A;  5KE2 A;  2MPX C;  3VUZ A;  3CCQ T;  1O75 A;  2EJG A;  3VS1 A;  1N8R C;  1W70 A;  2Y4Y A;  1VQ9 T;  2ZPI B;  2P0Q A;  1KD1 R;  3I35 A;  1X69 A;  1BIA A;  1RAC B;  2EW3 A;  1NPR A;  3LGL A;  4KUI A;  1U8R A;  3EH1 A;  1H3H A;  3RDV A;  5AT1 B;  2L8D A;  1KG1 A;  1IZ6 A;  4M7A D;  2L3S A;  4E7K A;  2DEQ A;  3BFM A;  3EHQ A;  3A8G B;  2LQN A;  5CO7 A;  2ECZ A;  1ZSZ B;  2L2P A;  1H3Z A;  1R8O B;  1MMG A;  4Z02 A;  1QCN A;  1VQK A;  2KI7 A;  3MJX A;  3MP6 A;  2O88 A;  2KMT A;  4Y91 A;  3L2U A;  3JAM E;  2XDB A;  2KY9 A;  1IGU A;  1I81 A;  2VAS A;  8ATC B;  3CCS Q;  1C1A A;  1M2V A;  3M55 A;  3JCM J;  1D09 B;  2E10 A;  1Y7X A;  2O9S A;  1R77 A;  1S72 T;  1JU5 C;  2QQS A;  1JB0 E;  5A0D A;  5GAO p;  1ACM B;  2JOY A;  4A4H A;  2EQK A;  3KUF A;  4IUT A;  2Y4X A;  1JEG A;  2JW4 A;  2KRO A;  1LNX A;  2LCL A;  3TCJ A;  3CME Q;  1UEB A;  3HKS A;  1JBM A;  3UAT A;  2AZV A;  2RJD A;  3RMQ A;  2CSQ A;  4BUG A;  4DEY A;  2WAC A;  4HCK A;  5GAO l;  4PLL A;  4AG2 C;  4F14 A;  2CZ6 B;  2FB7 A;  1UJ0 A;  3MP8 A;  4M7D G;  4PJO B;  3CCL Q;  4QT7 A;  3CCU T;  1K9A A;  2KT8 A;  1AT1 B;  3JB9 D;  3CCS A;  3INZ A;  3PMT A;  3CCU A;  1E7O A;  4M78 D;  4QQG A;  3DLM A;  2BUD A;  3EAE A;  2R57 A;  2PUO B;  5I2S A;  1WXT A;  4B9W A;  2NUZ A;  1KC8 C;  2OAW A;  3NTH A;  1K73 R;  2CRE A;  1UB4 A;  3RKW A;  2JTE A;  1B34 B;  4M7D C;  3EFO B;  2BE7 D;  1PRL C;  1WQW A;  4LD6 A;  3I55 Q;  2A3L A;  4X1V A; 
#chains in the Genus database with same CATH homology
 1QP3 A;  3M57 A;  4L59 A;  4M77 C;  5D6X A;  3JB9 J;  4M75 E;  2LVM A;  4JUV A;  1RL2 A;  2R5M A;  4JLG A;  4EMK C;  4ZGJ B;  4BDY A;  1VQ7 A;  5GMK i;  4C92 C;  3LH0 A;  1BI3 A;  4ZTF A;  3J7A F;  3QKJ A;  1FX7 A;  5D6W A;  2V8J A;  2QEX T;  2OTL A;  1Q7Y C;  2RI2 A;  1QP2 A;  2JVV A;  4M7A C;  1PSE A;  1VQ5 A;  2K5I A;  3X26 B;  4ELY C;  1VQL T;  2K2V A;  3FB9 A;  3CC7 T;  2DXC A;  2HNI A;  2F69 A;  3A8H B;  3F70 A;  2DAQ A;  4J83 A;  1B34 A;  1RI0 A;  5J26 A;  4M7A B;  3OYK A;  2M0O A;  2PVD B;  1M90 C;  2MF2 A;  1M1F A;  3RER A;  4JS5 A;  1X01 A;  3TU4 K;  1BYM A;  3FLG A;  4J7I A;  1YJ9 A;  2D0Q B;  3JCM X;  4A4F A;  1I5L A;  2EJ9 A;  4EMK B;  4ZN1 A;  4B9X A;  3MEW A;  3OYM A;  3CD6 T;  1VUB A;  1V29 B;  3NTK A;  4L5G A;  3V8K A;  4C92 F;  2RHI A;  4PJO E;  2VC8 A;  1VQM T;  2M16 A;  4QQ6 A;  3LW5 E;  3OYI A;  4BB7 A;  3JCM P;  2DD4 A;  3WVD B;  3I56 A;  4E7H A;  3TEE A;  3FRN A;  4DOW A;  1YIT A;  3VJP A;  2DTI A;  2EAY A;  2MMP A;  2XU8 A;  1VQ4 T;  2K3Y A;  2YLB A;  3CEY A;  3HP9 A;  4R55 A;  3DB3 A;  3QHS A;  5GAN f;  4NS5 A;  2LNV A;  3I55 A;  1ZHI A;  5CKE A;  3X25 B;  2PUK B;  4C0Z A;  4MDX A;  2OAU A;  2E6Z A;  2NLU A;  4PJO F;  4M78 B;  5GAM h;  4C5I A;  3OYN A;  3GF5 A;  3SWN C;  3JCM b;  3L2W A;  1W2B S;  2EIF A;  2RO0 A;  3C4S A;  5GAN 6;  5CR2 A;  2MI6 A;  2FL7 A;  2OTJ A;  4WF2 A;  1YHQ A;  3CC4 A;  3OS5 A;  2HQE A;  4J8O A;  1YIJ T;  2V8I A;  4IUR A;  3CCE A;  3OYE A;  1KD1 C;  1BI2 A;  4OF1 A;  1VQ8 T;  2RI3 A;  3OBW A;  2MAM A;  1VQO T;  2D6F A;  1YJW T;  5I2M A;  3GPL A;  5GAN j;  4PNO A;  2DXT A;  3O8V A;  1I4K 1;  3JCM c;  1Q81 C;  3RKX A;  3PMI A;  3PFS A;  2EWN A;  2P0K A;  4C8Q G;  3CC2 T;  4BAC A;  1X75 C;  3OMC A;  2JTM A;  4RMO A;  1VQ6 A;  4C92 D;  5IT9 E;  4KUL A;  2B8A A;  2QQB A;  1KHC A;  3QYH B;  2CS7 A;  1VIF A;  4MZM A;  1KD1 U;  4MMK A;  3SD4 A;  5FU6 C;  2LQK A;  5HK3 A;  4M7D F;  2E5Q A;  4L6V 5;  2L89 A;  1BI1 A;  2JTF A;  3CMA A;  3BDU A;  4OB3 B;  1K73 U;  3CCL A;  4BE2 A;  1Q82 C;  4XTW A;  1KC8 U;  4HT8 A;  2ZCF B;  4M77 A;  2RJE A;  5GAM f;  5GAN 5;  4E7L A;  4M75 A;  4XU1 A;  4LD9 K;  2P4T A;  2XKO C;  4XTY A;  3RKY A;  3HRT A;  5GAN g;  5LJ5 h;  1OI1 A;  3S6W A;  2LT1 A;  4J6X A;  3L42 A;  5HY6 A;  4Q5W A;  1YHQ T;  3CME T;  3HL8 A;  3WXM B;  3HFO A;  4M7A F;  3C95 A;  2QQR A;  4M7D A;  4XK8 E;  5EG2 A;  3JB9 I;  2RD1 A;  4BE1 A;  4R56 A;  3VYH B;  4EMH A;  4JRQ A;  3FEO A;  2DIQ A;  2WSF E;  4M77 G;  3CCR A;  2RJF A;  2XHC A;  3CXC S;  4C92 B;  1K8A C;  5HKC A;  3QUI A;  1YIT T;  3MO8 A;  4M75 G;  5I21 A;  2K5L A;  2K5F A;  5LJ3 g;  3CCJ T;  4C8Q C;  4C92 E;  3M4G A;  5DY9 A;  2AHJ B;  5GAN 7;  1HXD A;  5LJ5 d;  4RCB A;  4LDV A;  1WNL A;  1W4S A;  4J7F A;  4HA8 A;  3M4Y A;  1N9S A;  4QW2 A;  5IAY A;  4X9D A;  3MEA A;  4FSX A;  4GY5 A;  3X20 B;  1QVF A;  2X4J A;  4HCB A;  4X9C A;  3OBY A;  1W2B A;  1M90 U;  5HK0 A;  3DKM A;  1XQH A;  3JCM h;  4FT2 A;  2QI2 A;  5GAO m;  2BIV A;  1WQ7 A;  4M75 C;  4M78 A;  4J5Y A;  3V8L A;  1LOJ A;  3QZ9 B;  2VV5 A;  4KT0 E;  3QO3 A;  4IUV A;  4E7I A;  3J80 E;  3S3M A;  3HHT B;  3UDC A;  3M56 A;  4PJO G;  5L8R E;  2MWO A;  5GAN h;  4LDX A;  2G3R A;  2VYT A;  3V7S A;  4EPC A;  3N5B B;  5LJ5 g;  1GXI E;  5C0M A;  2DKG A;  1UGQ B;  4XAX B;  1EIF A;  2EFI A;  5LJ3 j;  3ZBD A;  3GNG A;  1VIE A;  5CKB A;  4NL3 A;  4HCC A;  4N0A C;  4JDS A;  4EDU A;  4M7A A;  3VV0 A;  3JCM g;  3H6Z A;  4OGC A;  5A0G A;  2QQ9 A;  2VXF A;  4A4E A;  4N4I A;  4EMK A;  3GLX A;  3PIP A;  3A8O B;  4C92 G;  3M54 A;  2RM4 A;  2VUB A;  3GNF B;  2RH2 A;  4J6W A;  2EKO A;  2XK0 A;  3QPH A;  3V8J A;  2DD5 A;  3CC2 A;  4C5H A;  2LDM A;  4QVZ A;  1FXX A;  1K9M U;  1WJS A;  2WSE E;  4PJO C;  2YHT A;  3DB4 A;  5LJ3 d;  3OYC A;  2H3J A;  3SB2 A;  4M7D E;  2DIG A;  2RI5 A;  2M9U A;  4OGE A;  5KE3 A;  2HAX A;  4FM4 B;  1TH7 A;  1N9R A;  4QVD A;  4RG2 A;  3X28 B;  3CCM A;  1N6A A;  2XG8 D;  3Q1J A;  3OYA A;  4FIB A;  1Q81 U;  4X34 A;  1IRE B;  2LQ8 A;  2F5T X;  3V7C A;  3G7Z A;  5FU6 B;  2QDY B;  4O6J A;  5FU7 C;  4M77 E;  3QZ5 B;  5LJ5 j;  2MWP A;  3FC3 A;  4F7U F;  2E65 A;  4ZGE B;  1LJO A;  2L3R A;  4M75 D;  4C8Q E;  1P92 A;  2A7Y A;  3CBO A;  4BI8 B;  1G3S A;  2X4X A;  3L1A A;  2DVE A;  1OZ3 A;  1WPY A;  3RUX A;  2DZ9 A;  1YJ9 T;  3MEV A;  2E1H A;  2ZPG B;  4OMF B;  2DO3 A;  1M1K U;  1VQ6 T;  1JJ2 S;  3HSB A;  1M9S A;  5LJ3 e;  3CCM T;  5CKH A;  4E47 A;  1G3W A;  1QVP A;  2RHU A;  2VXE A;  1VQO A;  3A8M B;  3P8H A;  5FLX E;  1YI2 A;  5GAO q;  1M5Q 1;  1K73 C;  2QXF A;  4A53 A;  4LDW A;  3GOX A;  1NJI C;  1Q82 U;  3HRU A;  1UGP B;  2RA2 A;  2HD0 A;  3OSV A;  3P8B B;  3WVE B;  3LWH A;  2ZPF B;  1M8V A;  1KHI A;  3C12 A;  1G3T A;  5J39 A;  2DK3 A;  1BIB A;  1HK9 A;  1U1T A;  2RK2 A;  3QII A;  1NZ9 A;  2IVW A;  2JN0 A;  1O9S A;  2RK1 A;  2V8K A;  4JLI A;  4M75 B;  4TVR A;  5KCO A;  2C06 A;  2LC4 A;  4CRI A;  3OA6 A;  4UC4 A;  3KBG A;  4FL6 A;  4RG8 A;  4OP0 A;  4XTV A;  4FT4 A;  1I8F A;  4MZP A;  2OTJ T;  5GAN 4;  2F5K A;  2K4Y A;  2VGN A;  3HFN A;  5FRO A;  3M59 A;  3BW1 A;  2GCX A;  3JCM Q;  3GIB A;  2PVG B;  4MDW A;  3A8L B;  4LDY A;  4Y28 E;  5FRM A;  2EQU A;  2E6N A;  5DLQ E;  2EQJ A;  4BI3 A;  2ZPE B;  2O4X A;  2FYK A;  3JCM W;  4YTL A;  5CKD A;  4IUU A;  4C8Q D;  3CCR T;  2DTH A;  3NTI A;  3NFC A;  1ZBX A;  1M4Z A;  4M78 E;  4QQD A;  1KQ2 A;  5CIU A;  4NL2 A;  4OB2 B;  2CZ0 B;  2HQX A;  2KVQ G;  4XU2 A;  4A54 A;  2EJF A;  5LJ3 h;  4F7U A;  3C94 A;  5KCH A;  3QSU A;  3CXC A;  3ASK A;  5J3B A;  4ELZ C;  2X4Y A;  3OYD A;  1YJW A;  4F7U E;  3LGF A;  4EMG A;  1QW1 A;  4HT9 A;  2I2L A;  4XTU A;  5FRN A;  5DLO A;  2D9T A;  3OMG A;  4HCZ A;  2OTL T;  3OB9 A;  4V2S A;  4ZN3 A;  3QYG B;  2LCC A;  3CME A;  1SSF A;  3MCA B;  4OVA A;  3CCJ A;  4FU6 A;  5D6Y A;  2QQA A;  2ZPB B;  2QTX A;  2KSS A;  3RIR A;  2JUF A;  1D3B A;  2HBP A;  2KDS A;  4J6Y A;  5C6S A;  3L2R A;  1YI2 T;  3BDL A;  2FHD A;  2CZ1 B;  1KQS S;  2JZ2 A;  1VQN A;  3LX7 A;  4C5G A;  2KAF A;  4GLK A;  2YLC A;  4M77 F;  2DPP B;  4ZGD B;  5CKF A;  3KXT A;  2VGM A;  3LLR A;  2XD0 A;  4P5N A;  3L2V A;  2RHY A;  2XIC A;  1NE8 A;  3JRZ A;  1QVG A;  3OS0 A;  2E41 A;  3CBM A;  5AYF A;  4NOY A;  3MEU A;  3UT1 A;  5A2Q E;  3OW2 A;  4A4G A;  4HKE A;  4C8Q F;  1G5V A;  5GMK m;  2RJC A;  5GMK j;  2EQM A;  3HPW A;  3M53 A;  3JCM f;  3JB9 G;  4MML A;  1K9M C;  3M58 A;  2GFU A;  3MET A;  2Y90 A;  5KH6 A;  1DJ7 B;  3EFS A;  4ME7 A;  4QVC A;  2M1H A;  3OS2 A;  3CMA T;  4JRK A;  4M7A E;  3VUB A;  1FWZ A;  4N0A A;  3OYG A;  3X24 B;  2LTO A;  4JRI A;  2YRV A;  2CGH A;  1WGS A;  1YIJ A;  4XU0 A;  3CPW A;  2E12 A;  3G4S T;  4ZTJ A;  3CCV A;  2CZ7 B;  4C5E A;  3CC4 T;  4RCC A;  1AHJ B;  2DTO A;  4KUD K;  3SWN B;  3VKI A;  1YJN T;  2GF7 A;  4M75 F;  4M78 C;  4ATO A;  3L2Q A;  1VQ4 A;  4C0F A;  5GAN e;  1XTD A;  1YBY A;  3GP8 A;  1VQP T;  3CBP A;  1WJR A;  3I56 T;  3QDR B;  5FU7 B;  2KK4 A;  5KE2 A;  3S3N A;  1M1K C;  3VU3 C;  3FDR A;  1ZQ1 A;  1VQM A;  3JSC A;  3VUZ A;  3G71 T;  5LL6 S;  3CCQ T;  2L5Q A;  1MGQ A;  1NJI U;  1O75 A;  2EJG A;  1VQ8 A;  2DXB A;  2CYZ B;  4BY6 B;  1N8R C;  1KQS A;  2Y4Y A;  3E1S A;  3PGG A;  1VQ9 T;  1BKB A;  2ZPI B;  3CPF A;  1JJ2 A;  2P0Q A;  1BIA A;  5LJ5 f;  3PNW C;  3E9F A;  2DZC A;  2FVU A;  4VUB A;  1NPR A;  3LGL A;  4KUI A;  3SWN A;  3JCM V;  5GAN d;  3I55 T;  1U8R A;  3AHU A;  1Q86 U;  2L8D A;  1NPP A;  3T9N A;  1KG1 A;  1IZ6 A;  2O01 E;  3OY9 A;  3OYY A;  4M7A D;  5GMK l;  1X6O A;  2IG0 A;  4E7K A;  2DEQ A;  3BFM A;  3CC7 A;  3A8G B;  4BI4 A;  1VQL A;  3H8Z A;  4JS4 A;  1WJQ A;  5CO7 A;  4PKC C;  3LYI A;  1OYX A;  1H3Z A;  1R8O B;  4C0G A;  4Z02 A;  2CKK A;  3V7R A;  2LX9 A;  4A4K A;  3OYL A;  1VQK A;  4RKU E;  5GAN 8;  2E70 A;  2KQW A;  1VQN T;  1VQ7 T;  3MP6 A;  3A5Z B;  4M77 B;  2KMT A;  4Y91 A;  3L2U A;  4PJO A;  3JAM E;  2XDB A;  5CQX A;  1S72 A;  4OB1 B;  2KY9 A;  3S3O A;  1Q7Y U;  3PT9 A;  3JB9 H;  1I81 A;  1KQ1 A;  5LJ3 f;  4M7D D;  1QVF S;  1PSF A;  3QJY A;  1QVG S;  3ZEH A;  3OS1 A;  4M7D B;  4E7J A;  4M7A G;  2WSC E;  2GQV A;  1XOV A;  1M1G A;  5GAM d;  5GMK h;  4JJN K;  3M9Q A;  2P0P A;  4KBM B;  5GAN 3;  4XQ3 A;  2E64 A;  4M77 D;  3M55 A;  3JCM J;  3DLL A;  2PVO B;  4BD3 A;  2E10 A;  5IN1 A;  4C8Q B;  1Y7X A;  3CCL T;  1D3B B;  1S72 T;  1U1S A;  3G6E A;  3ER0 A;  2QQS A;  1JB0 E;  3OYF A;  3LWI A;  1VQ9 A;  2XI9 A;  1XNI A;  3L2Z A;  2LT4 A;  4XTX A;  5A0D A;  3OYH A;  5GAO p;  2JOY A;  4A4H A;  2PQW A;  5GAN 2;  5GAM g;  2EQK A;  3G71 A;  3CCQ A;  4PL6 A;  5CCA A;  3KUF A;  3CCS T;  4IUT A;  2Y4X A;  5GAM e;  3MHX A;  4JRP A;  2XID A;  3PTA A;  1LNX A;  5A0L A;  2LCL A;  3TCJ A;  4II1 A;  1Y96 A;  2RHX A;  4N4G A;  5DM7 R;  4IKF A;  1UEB A;  4C8Q A;  2XDP A;  3HKS A;  4C0D B;  5M9O A;  1JBM A;  5LJ5 e;  2PU9 B;  2RB6 A;  1H64 1;  3ZFJ A;  2RJD A;  3RMQ A;  4BY6 C;  3URG A;  1OZ2 A;  4N4H A;  3SDZ A;  4BUG A;  3UPU A;  3CCE T;  2RHZ A;  2WAC A;  2JNG A;  3MP1 A;  5GAO l;  2QA4 A;  2K3X A;  2DXU A;  4PLL A;  3OW2 S;  2CZ6 B;  2FB7 A;  3P8D A;  5CQY A;  3MP8 A;  4F7U B;  1VQP A;  3PIO A;  4M7D G;  4DA4 A;  4PJO B;  1N27 A;  4MZT A;  4C0D C;  3CCU T;  3JB9 F;  3OQ5 A;  3JCM d;  4M78 G;  3OYB A;  3UWN A;  4PLI A;  3QXE B;  4D6W A;  3JB9 D;  3QG1 A;  3CCS A;  3CCV T;  3INZ A;  3PMT A;  5CVI A;  2O4X B;  1Y96 B;  5GAM j;  3CCU A;  1UGS B;  4M78 D;  2ZGW A;  3DLM A;  1G3Y A;  2ZZD A;  2BUD A;  3OSS C;  3R6O A;  4IUQ A;  4M78 F;  4QQG A;  1BI0 A;  4F7U G;  3J81 E;  3FIF A;  3EAE A;  3FJP A;  2R57 A;  2PUO B;  5I2S A;  4BE0 A;  2DJZ A;  1YJN A;  4DQ2 A;  3E9G A;  2QA4 T;  1UGR B;  3CPW S;  1Y07 A;  3G4S A;  4B9W A;  2ZPH B;  3CD6 A;  3M5A A;  3SFM A;  5CAI A;  3QJ6 A;  5GAO n;  2XDD A;  1KC8 C;  1N8R U;  4IUP A;  5GAO r;  4O5V A;  3BY7 A;  2BKD N;  4XU3 A;  5GMK e;  3HRS A;  3NTH A;  3G6E T;  1JRI A;  3VYG A;  3JCM e;  2GFA A;  3ME9 A;  4XTZ A;  4C92 A;  1UB4 A;  2R58 A;  2X35 A;  3EFR A;  3RKW A;  1YCY A;  2X4W A;  1VQ5 T;  4PJO D;  1Q86 C;  3E19 A;  3QBY A;  5CK9 A;  2QEX A;  1B34 B;  4OB0 B;  3OYJ A;  4M7D C;  4LDU A;  2EYQ A;  2K57 A;  4CI0 C;  1WQW A;  4LD6 A;  1MHN A;  4DOV A;  2R5A A;  3TRE A;  4BDZ A;  2A3L A;  2LRQ A;  3RES A;  1Y71 A;  1VQK T;  3RMS A;  1K8A U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...