The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
34
|
sequence length |
133
|
structure length |
133
|
Chain Sequence |
MDLTSKVNRLLAEFAGRIGLPSLSLDEEGMASLLFDEQVGVTLLLLAERERLLLEADVVGIDVLGEGIFRQLASFNRHWHRFDLHFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCAS
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Chaperone/transcription inhibitor
|
molecule keywords |
Exoenzyme S synthesis protein C
|
publication title |
Analysis of the Crystal Structure of the ExsC.ExsE Complex Reveals Distinctive Binding Interactions of the Pseudomonas aeruginosa Type III Secretion Chaperone ExsC with ExsE and ExsD.
pubmed doi rcsb |
source organism |
Pseudomonas aeruginosa
|
total genus |
34
|
structure length |
133
|
sequence length |
133
|
chains with identical sequence |
B, C, D, E, F, G, H, I, J, K, L
|
ec nomenclature | |
pdb deposition date | 2009-12-04 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF05932 | CesT | Tir chaperone protein (CesT) family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Yope Regulator; Chain: A, | Yope Regulator; Chain: A, |
#chains in the Genus database with same CATH superfamily 1L2W A; 4AKX A; 1N5B A; 1RY9 A; 2BSH A; 1JYA A; 3KXY A; 1XKP C; 3TU3 A; 1K3S A; 2BSJ A; 3EPU A; 2BSI A; 3CXJ A; 1JYO A; 4GF3 A; 4JMF B; 4G6T A; 2FM8 A; 2BHO A; 1XKP B; 1TTW A; 1K6Z A; 1S28 A; 2PLG A; 2XGA A; 1K3E A; #chains in the Genus database with same CATH topology 2P9K D; 1L2W A; 2P9S D; 2P9P F; 2LPU A; 3DXK F; 4AKX A; 2P9I F; 1N5B A; 1RY9 A; 1TYQ D; 2BSH A; 1K3E A; 1JYA A; 2P9L F; 3UKU D; 3KXY A; 3DWL D; 1XKP C; 2OD0 A; 3DXM D; 3TU3 A; 3UKR D; 1K3S A; 1U2V D; 2P9N D; 2P9U F; 4XEI F; 3RSE D; 1K8K F; 2BSJ A; 3EPU A; 2BSI A; 3ULE F; 2MQD A; 1JYO A; 3CXJ A; 2P9K F; 2DYT A; 4GF3 A; 4EBR A; 2P9S F; 2KC5 A; 4JD2 D; 1TYQ F; 4JMF B; 4G6T A; 3UKR F; 3DXM F; 3UKU F; 2FM8 A; 3DWL F; 3DXK D; 2BHO A; 1XKP B; 2P9I D; 2P9P D; 4H5B A; 1U2V F; 1TTW A; 3VX8 B; 1K6Z A; 2P9N F; 3ULE D; 4GSL C; 2P9L D; 3RSE F; 3VX7 B; 1S28 A; 2P9U D; 2PLG A; 2XGA A; 1K8K D; 4XEI D; 4JD2 F; #chains in the Genus database with same CATH homology 2P9K D; 1L2W A; 2P9S D; 2P9P F; 2LPU A; 3DXK F; 4AKX A; 2P9I F; 1N5B A; 1RY9 A; 1TYQ D; 2BSH A; 1K3E A; 1JYA A; 2P9L F; 3UKU D; 3KXY A; 3DWL D; 1XKP C; 3DXM D; 3TU3 A; 3UKR D; 1K3S A; 1U2V D; 2P9N D; 2P9U F; 4XEI F; 3RSE D; 1K8K F; 2BSJ A; 3EPU A; 2BSI A; 3ULE F; 2MQD A; 1JYO A; 3CXJ A; 2P9K F; 2DYT A; 4GF3 A; 4EBR A; 2P9S F; 2KC5 A; 4JD2 D; 1TYQ F; 4JMF B; 4G6T A; 3UKR F; 3DXM F; 3UKU F; 2FM8 A; 3DWL F; 3DXK D; 2BHO A; 1XKP B; 2P9I D; 2P9P D; 4H5B A; 1U2V F; 1TTW A; 3VX8 B; 1K6Z A; 2P9N F; 3ULE D; 4GSL C; 2P9L D; 3RSE F; 3VX7 B; 1S28 A; 2P9U D; 2PLG A; 2XGA A; 1K8K D; 4XEI D; 4JD2 F;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...