3KY7A

2.35 angstrom resolution crystal structure of a putative trna (guanine-7-)-methyltransferase (trmd) from staphylococcus aureus subsp. aureus mrsa252
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
Knots found
sequence length
243
structure length
228
Chain Sequence
MKIDYLTLFPEMFDGVLNHSIMKRAQENNKLQINTVNFRDYANKHNQVDDYPYGGGQGMVLKPEPVFNAMEDLDVTEQARVILMPQGEPFSHQKAVELSKADHIVFICGHYEGYDERIRTHLVTDEISMGDYVLTGGELPAMTMTDAIVRLIPGSDGLLEFPQYTRPREFKGLTVPDVLLSGNHANIDAWRHEQKLIRTYNKRPDLIEKYPLTNADKQILERYKIGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title 2.35 Angstrom resolution crystal structure of a putative tRNA (guanine-7-)-methyltransferase (trmD) from Staphylococcus aureus subsp. aureus MRSA252
rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transferase
total genus 61
structure length 228
sequence length 243
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2009-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 3ky7A02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3ky7A01
1UAJA 1NXZA 1TO0A 5GMCA 5GMBA 1ZJRA 3N4JA 4JAKA 4YQ4A 3AI9X 3KY7A 1UALA 4YQ1A 3OIJA 1P9PA 4YQ0A 2QMMA 4YPZA 3AIAA 4MCDA 4YVIA 5GM8A 4YQ3A 4YVJA 1V6ZA 4H3YA 3NK6A 4YQDA 4L69A 2CX8A 4YQNA 2O3AA 4CNFA 1J85A 1O6DA 3OINA 3NK7A 2YY8A 2QWVA 4E8BA 2HA8A 3DCMX 4YQAA 4YQKA 4KDZA 3AXZA 5CO4A 4YQOA 3IEFA 3QUVA 4YQIA 3E5YA 3KNUA 4YVHA 4YQJA 3BBEA 1X7PA 4YPXA 4YQBA 4YQCA 4YQQA 1V2XA 4CNDA 2I6DA 4YQ5A 2EGVA 1K3RA 4YQ7A 4YQTA 4H3ZA 1IPAA 4CNGA 1X7OA 3ONPA 4IG6A 3IC6A 5FAIA 1UAKA 4X3MA 1OY5A 4XBOA 4MCBA 3L8UA 4CNEA 3KW2A 5D9FA 3N4KA 4YVKA 1VH0A 4YPYA 4YQ2A 2EGWA 4YQPA 3GYQA 4JALA 4MCCA 4J3CA 3KTYA 1NS5A 2V3JA 3ILKA 1GZ0A 4YQ9A 4FAKA 2V3KA 4X3LA 4YQLA 4RG1A 4YPWA 3O7BA 3BBDA 4YQRA 4YQ6A 1MXIA 4YQSA 1VHKA 3OIIA 1UAMA 4YQ8A 3BBHA 2Z0YA 1VHYA 4KGNA 4YQGA 4PZKA 1Z85A 4YVGA
chains in the Genus database with same CATH superfamily
1UAJA 1NXZA 1TO0A 5GMCA 5GMBA 1ZJRA 3N4JA 4JAKA 4YQ4A 3AI9X 3KY7A 1UALA 3WRPA 4YQ1A 3OIJA 1WRPR 1P9PA 1JHGA 4YQ0A 4YPZA 2QMMA 4MCDA 4YVIA 3AIAA 5GM8A 4JWJA 4YQ3A 4YVJA 1V6ZA 4H3YA 3NK6A 4YQDA 4L69A 1RCSA 2CX8A 4YQNA 2O3AA 4CNFA 1J85A 1O6DA 3OINA 3NK7A 2YY8A 2QWVA 3KORA 4E8BA 2HA8A 3DCMX 4YQAA 4YQKA 4KDZA 3AXZA 5CO4A 1WRTR 4YQOA 3IEFA 3QUVA 4YQIA 3E5YA 3KNUA 4YVHA 4YQJA 3BBEA 1X7PA 1MI7R 4YPXA 4YQBA 4YQCA 2OZ9R 4YQQA 4JWFA 1V2XA 1ZT9A 4CNDA 2I6DA 3SSXN 4YQ5A 2EGVA 1K3RA 4YQ7A 4YQTA 4H3ZA 1IPAA 4CNGA 1X7OA 3ONPA 4IG6A 3IC6A 5FAIA 1UAKA 4X3MA 1OY5A 4XBOA 4MCBA 3L8UA 4CNEA 3G1CA 3KW2A 4FMWA 5D9FA 3N4KA 4YVKA 1VH0A 4YPYA 4YQ2A 2EGWA 4YQPA 3GYQA 4JALA 1CO0A 4MCCA 4J3CA 3KTYA 1NS5A 2V3JA 3ILKA 4JWGA 1WRSR 1GZ0A 4YQ9A 4FAKA 3FRWA 2V3KA 4X3LA 4YQLA 4RG1A 3SSWN 4YPWA 3O7BA 3BBDA 4YQRA 1TROA 4YQ6A 1MXIA 4JWHA 4YQSA 1VHKA 3OIIA 1UAMA 4YQ8A 3BBHA 2Z0YA 1TRRA 1VHYA 4KGNA 4YQGA 4PZKA 1Z85A 2XDIA 4YVGA
chains in the Genus database with same CATH topology
1UAJA 1NXZA 1TO0A 5GMCA 5GMBA 1ZJRA 3N4JA 4JAKA 4YQ4A 3AI9X 3KY7A 1UALA 4YQ1A 3OIJA 1P9PA 4YQ0A 2QMMA 4YPZA 3AIAA 4MCDA 4YVIA 5GM8A 4JWJA 4YQ3A 4YVJA 1V6ZA 4H3YA 3NK6A 4YQDA 4L69A 2CX8A 4YQNA 2O3AA 4CNFA 1J85A 1O6DA 3OINA 3NK7A 2YY8A 2QWVA 4E8BA 2HA8A 3DCMX 4YQAA 4YQKA 4KDZA 3AXZA 5CO4A 4YQOA 3IEFA 3QUVA 4YQIA 3E5YA 3KNUA 4YVHA 4YQJA 3BBEA 1X7PA 4YPXA 4YQBA 4YQCA 4YQQA 4JWFA 1V2XA 4CNDA 2I6DA 4YQ5A 2EGVA 1K3RA 4YQ7A 4YQTA 4H3ZA 1IPAA 4CNGA 1X7OA 3ONPA 4IG6A 3IC6A 5FAIA 1UAKA 4X3MA 1OY5A 4XBOA 4MCBA 3L8UA 4CNEA 3KW2A 4FMWA 5D9FA 3N4KA 4YVKA 1VH0A 4YPYA 4YQ2A 2EGWA 4YQPA 3GYQA 4JALA 4MCCA 4J3CA 3KTYA 1NS5A 2V3JA 3ILKA 4JWGA 1GZ0A 4YQ9A 4FAKA 2V3KA 4X3LA 4YQLA 4RG1A 4YPWA 3O7BA 3BBDA 4YQRA 4YQ6A 1MXIA 4JWHA 4YQSA 1VHKA 3OIIA 1UAMA 4YQ8A 3BBHA 2Z0YA 1VHYA 4KGNA 4YQGA 4PZKA 1Z85A 4YVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UAJ A;  1NXZ A;  1TO0 A;  5GMC A;  5GMB A;  1ZJR A;  3N4J A;  4JAK A;  4YQ4 A;  3AI9 X;  3KY7 A;  1UAL A;  4YQ1 A;  3OIJ A;  1P9P A;  4YQ0 A;  2QMM A;  4YPZ A;  3AIA A;  4MCD A;  4YVI A;  5GM8 A;  4YQ3 A;  4YVJ A;  1V6Z A;  4H3Y A;  3NK6 A;  4YQD A;  4L69 A;  2CX8 A;  4YQN A;  2O3A A;  4CNF A;  1J85 A;  1O6D A;  3OIN A;  3NK7 A;  2YY8 A;  2QWV A;  4E8B A;  2HA8 A;  3DCM X;  4YQA A;  4YQK A;  4KDZ A;  3AXZ A;  5CO4 A;  4YQO A;  3IEF A;  3QUV A;  4YQI A;  3E5Y A;  3KNU A;  4YVH A;  4YQJ A;  3BBE A;  1X7P A;  4YPX A;  4YQB A;  4YQC A;  4YQQ A;  1V2X A;  4CND A;  2I6D A;  4YQ5 A;  2EGV A;  1K3R A;  4YQ7 A;  4YQT A;  4H3Z A;  1IPA A;  4CNG A;  1X7O A;  3ONP A;  4IG6 A;  3IC6 A;  5FAI A;  1UAK A;  4X3M A;  1OY5 A;  4XBO A;  4MCB A;  3L8U A;  4CNE A;  3KW2 A;  5D9F A;  3N4K A;  4YVK A;  1VH0 A;  4YPY A;  4YQ2 A;  2EGW A;  4YQP A;  3GYQ A;  4JAL A;  4MCC A;  4J3C A;  3KTY A;  1NS5 A;  2V3J A;  3ILK A;  1GZ0 A;  4YQ9 A;  4FAK A;  2V3K A;  4X3L A;  4YQL A;  4RG1 A;  4YPW A;  3O7B A;  3BBD A;  4YQR A;  4YQ6 A;  1MXI A;  4YQS A;  1VHK A;  3OII A;  1UAM A;  4YQ8 A;  3BBH A;  2Z0Y A;  1VHY A;  4KGN A;  4YQG A;  4PZK A;  1Z85 A;  4YVG A; 
#chains in the Genus database with same CATH topology
 1UAJ A;  1NXZ A;  1TO0 A;  5GMC A;  5GMB A;  1ZJR A;  3N4J A;  4JAK A;  4YQ4 A;  3AI9 X;  3KY7 A;  1UAL A;  3WRP A;  4YQ1 A;  3OIJ A;  1WRP R;  1P9P A;  1JHG A;  4YQ0 A;  4YPZ A;  2QMM A;  4MCD A;  4YVI A;  3AIA A;  5GM8 A;  4JWJ A;  4YQ3 A;  4YVJ A;  1V6Z A;  4H3Y A;  3NK6 A;  4YQD A;  4L69 A;  1RCS A;  2CX8 A;  4YQN A;  2O3A A;  4CNF A;  1J85 A;  1O6D A;  3OIN A;  3NK7 A;  2YY8 A;  2QWV A;  3KOR A;  4E8B A;  2HA8 A;  3DCM X;  4YQA A;  4YQK A;  4KDZ A;  3AXZ A;  5CO4 A;  1WRT R;  4YQO A;  3IEF A;  3QUV A;  4YQI A;  3E5Y A;  3KNU A;  4YVH A;  4YQJ A;  3BBE A;  1X7P A;  1MI7 R;  4YPX A;  4YQB A;  4YQC A;  2OZ9 R;  4YQQ A;  4JWF A;  1V2X A;  1ZT9 A;  4CND A;  2I6D A;  3SSX N;  4YQ5 A;  2EGV A;  1K3R A;  4YQ7 A;  4YQT A;  4H3Z A;  1IPA A;  4CNG A;  1X7O A;  3ONP A;  4IG6 A;  3IC6 A;  5FAI A;  1UAK A;  4X3M A;  1OY5 A;  4XBO A;  4MCB A;  3L8U A;  4CNE A;  3G1C A;  3KW2 A;  4FMW A;  5D9F A;  3N4K A;  4YVK A;  1VH0 A;  4YPY A;  4YQ2 A;  2EGW A;  4YQP A;  3GYQ A;  4JAL A;  1CO0 A;  4MCC A;  4J3C A;  3KTY A;  1NS5 A;  2V3J A;  3ILK A;  4JWG A;  1WRS R;  1GZ0 A;  4YQ9 A;  4FAK A;  3FRW A;  2V3K A;  4X3L A;  4YQL A;  4RG1 A;  3SSW N;  4YPW A;  3O7B A;  3BBD A;  4YQR A;  1TRO A;  4YQ6 A;  1MXI A;  4JWH A;  4YQS A;  1VHK A;  3OII A;  1UAM A;  4YQ8 A;  3BBH A;  2Z0Y A;  1TRR A;  1VHY A;  4KGN A;  4YQG A;  4PZK A;  1Z85 A;  2XDI A;  4YVG A; 
#chains in the Genus database with same CATH homology
 1UAJ A;  1NXZ A;  1TO0 A;  5GMC A;  5GMB A;  1ZJR A;  3N4J A;  4JAK A;  4YQ4 A;  3AI9 X;  3KY7 A;  1UAL A;  4YQ1 A;  3OIJ A;  1P9P A;  4YQ0 A;  2QMM A;  4YPZ A;  3AIA A;  4MCD A;  4YVI A;  5GM8 A;  4JWJ A;  4YQ3 A;  4YVJ A;  1V6Z A;  4H3Y A;  3NK6 A;  4YQD A;  4L69 A;  2CX8 A;  4YQN A;  2O3A A;  4CNF A;  1J85 A;  1O6D A;  3OIN A;  3NK7 A;  2YY8 A;  2QWV A;  4E8B A;  2HA8 A;  3DCM X;  4YQA A;  4YQK A;  4KDZ A;  3AXZ A;  5CO4 A;  4YQO A;  3IEF A;  3QUV A;  4YQI A;  3E5Y A;  3KNU A;  4YVH A;  4YQJ A;  3BBE A;  1X7P A;  4YPX A;  4YQB A;  4YQC A;  4YQQ A;  4JWF A;  1V2X A;  4CND A;  2I6D A;  4YQ5 A;  2EGV A;  1K3R A;  4YQ7 A;  4YQT A;  4H3Z A;  1IPA A;  4CNG A;  1X7O A;  3ONP A;  4IG6 A;  3IC6 A;  5FAI A;  1UAK A;  4X3M A;  1OY5 A;  4XBO A;  4MCB A;  3L8U A;  4CNE A;  3KW2 A;  4FMW A;  5D9F A;  3N4K A;  4YVK A;  1VH0 A;  4YPY A;  4YQ2 A;  2EGW A;  4YQP A;  3GYQ A;  4JAL A;  4MCC A;  4J3C A;  3KTY A;  1NS5 A;  2V3J A;  3ILK A;  4JWG A;  1GZ0 A;  4YQ9 A;  4FAK A;  2V3K A;  4X3L A;  4YQL A;  4RG1 A;  4YPW A;  3O7B A;  3BBD A;  4YQR A;  4YQ6 A;  1MXI A;  4JWH A;  4YQS A;  1VHK A;  3OII A;  1UAM A;  4YQ8 A;  3BBH A;  2Z0Y A;  1VHY A;  4KGN A;  4YQG A;  4PZK A;  1Z85 A;  4YVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...