3KYDA

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
321
structure length
301
Chain Sequence
b'LWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKTTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 93
structure length 301
sequence length 321
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydA00
2GCGA 2NVUA 2C0CA 4KWIA 4RF4A 2X0RA 4GX2A 4D3DA 2VT2A 4MVJM 1HE2A 4YXFA 3WNVA 1HZJA 4G2NA 4OQYA 1U28A 2QRKA 3NJ4A 4HWKA 3CH6A 4TSKA 4CM1A 3WWYA 2P5YA 4OM8A 1W0CA 2VUSA 4ZQHA 2I9PA 1YE3A 4N7RA 3WQRA 5HS6A 1TT5A 5IN4A 1T24A 1I0ZA 4PVDA 4CPDA 1A4IA 1BXZA 3UH1A 1DXYA 4ITUA 4B4VA 2FSSA 4LISA 4C7KA 2Q99A 4NIMA 1WVGA 1VE9A 4D43A 1E3EA 1XDWA 3GMSA 3ANMA 5JAIA 3WXBA 1P45A 3K2EA 1UZMA 5JC1A 3W8FA 3MEQA 2FP4A 4XYGA 1U8XX 1G0NA 3TFQA 2BGLA 4HNHA 2Y99A 4Z6KA 1U3TA 4GL4A 3RUIA 4GSLA 2J3HA 1I30A 2WTBA 3B6ZA 4ZJUA 1YJ8A 2IEDA 4I5FA 4LGVA 1R4MB 4RO0A 3UN1A 1PR9A 2GN6A 1YL6A 4E31A 4R1NA 2CUKA 3ROQA 3ZWVA 1PWZA 4PIVA 2AW5A 4CMBA 1LDGA 4NBWA 3JD0A 4CM7A 4GAEA 2X0JA 5DNAA 1NWHA 2VZ0A 4OAQA 4WKGA 3DZGA 4OYRA 2PD3A 3PQEA 1VPDA 3M2TA 2JL1A 5IZ4A 4XYLA 5THKA 2EP5A 1A72A 3GH3A 4M89A 3VZSA 1LBEA 3GPIA 3ULKA 1UAGA 4BNGA 2E6UX 4HFNA 4PRLA 3WX0A 5LCXA 3AOEC 1IPFA 1AXGA 1D8AA 4R16A 4ALNA 3BYZA 4DREA 1QORA 4XYEA 2IZ0A 2PKRA 4XA8A 4NBRA 4LCJA 1RM5A 1NVTA 2DUUA 1KERA 1Z74A 1OI7A 3GT0A 1BSVA 2RHRA 3K6JA 1ULSA 1DC3A 1TI7A 2Y0EA 3GHHA 1Y5RA 4N5LA 3AFMA 5I8WA 2DBRA 2HMVA 4FSHA 1DEHA 1M66A 4K9DA 4IINA 3OF2A 1NPYA 4NBTA 3FF4A 5KKAA 3A14A 4CQMD 4JX8A 4K26A 2C5AA 4FW8A 4RLSA 3ZDFA 1MXFA 5KCZA 1HYHA 5TT1A 4BHTA 1EFKA 2W90A 2VTEA 3JQFC 1AHHA 4JCOA 5KJFA 5G0TA 5IDXA 4NI5A 3VPFA 3HUDA 4WLNA 4RQTA 3ZV4A 4DUPA 3UCXA 1PWXA 3ANLA 3LSYA 4TZKA 4GBJA 4KMSA 4CMEC 4P4GA 2ZB7A 3LVFO 1LEHA 2AXQA 1YO6A 2SCUA 3AUTA 4Y6RA 1FDVA 2NTJA 1LSUA 2CDCA 2E48A 2JD1A 4LCEA 4FGSA 4OL9A 5AOVA 1Q7GA 5F3RA 1Z82A 1UUFA 3EVTA 3F47A 3ZWAA 3RJ9A 4JN6B 3JD4A 4MIYA 4YT4A 4BKQA 4XRRA 4E13A 4J6FA 2W2LA 1Z73A 4AJ2A 4L8VA 4TVOA 3TOZA 3DBHB 4MVJP 4FFLA 3H9QA 1PR3A 4B4OA 4E21A 2CSUA 1RPNA 5JAQA 2V7PA 5JBIA 4RDIA 1EBUA 3DL2A 5FYDA 2B5WA 3I4FA 3UVEA 3GFGA 2O2SA 4AJIA 2VRCD 4RCVA 4UAGA 4GKBA 2Y1FA 2O50A 2EKQA 3ZHYA 5C7LO 4AVYA 3QP9A 1PJ3A 2PV7A 3BMOA 2YFHA 4KZPA 4HBGA 3EW7A 1TT5B 5IAAA 4UUNA 3STHA 1O94A 1P74A 4MOWA 4P38A 5JDCA 1QV7A 4JXKA 2Q50A 3CPSA 2W98A 4U0KA 4Z0TA 4J7CA 4R41A 4RGBA 3UAGA 4M54A 4NQZA 4U5QA 4IMPA 3ZU3A 2AG8A 2Q1SA 1XELA 4XEHA 3GGPA 5CAEA 3MJCA 3S8MA 1RM4A 1QP8A 3COSA 1H6BA 2OOSA 2ZK7A 3ASUA 4GX0A 2V6BA 2PZJA 2ZB8A 1AN9A 3JCZA 1V9LA 3HQ4O 3S55A 3BXXA 4OGWA 4G81A 4OOFA 2VHXA 3DMTA 4XD2A 2O4UX 2ILTA 2PK3A 3HSKA 3K2BA 2JCYA 3C24A 4R54A 4RPGA 4CJXA 1PL7A 3BMNA 5CPBA 4QO8A 1RM3A 1ZEJA 3PHLA 4PVCA 3RBZA 3FN4A 3L9WA 4Z0PA 3SEFA 5ICSA 2NQ8A 1K6JA 1DLIA 4FIZA 4YJGB 5IN5A 3Q9NA 1DPGA 4KP7A 3AUAA 3QVSA 3L0DA 3QWBA 3X2FA 1ID1A 1G1AA 2QRLA 2CDBA 3CEAA 3DBLA 1W73A 1PL8A 3OICA 1BW9A 3FR7A 1K2WA 4AJ4A 1TEHA 2DBVO 2QZ9A 1J49A 2IXBA 3JQAB 5C7OO 1LQUA 4BNFA 3DO5A 3ZWPA 3ZWYA 1H0KA 3PWSA 4RPLA 3TWOA 2PA3A 1G0OA 1NTOA 1HDXA 3D3WB 1N1EA 3NGLA 1PGJA 1L1FA 1A9YA 1MLDA 4B3IA 5T8KA 3L4BC 1DFHA 2PWZA 5JE8A 4CMAA 4EJMA 3LT2A 4UUOA 1YRLA 2LDBA 4L4RA 5B37A 2HAEA 4LK3A 4UVGA 3QIVA 5JCJD 1J0XO 4WEQA 3C7CB 3EY4A 5GZ3A 4IQGA 4NH4A 2Q49A 3C1AA 3I9KA 4FCCA 4NFSA 3WB9A 3OHSX 1NQAO 3KUXA 3OJ0A 5TGDA 4IGEA 2X4GA 1YBMA 4PCVA 4AJNA 1GEGA 3NUGA 2A4KA 4CQMA 1K6XA 1HYEA 3ETDA 4DBZA 1OFGA 1SCUA 3RSHA 1ENZA 2G76A 1ZZEA 3SXPA 3V5NA 3LT4A 4HFMA 3ITDA 1DRWA 3AFNA 2ZTMA 1C0IA 3HFSA 2Y1DA 4PG7A 4I5EA 2H1SA 4E2WA 2VZ9A 3C7AA 2EJWA 1NVMB 1Z45A 5JW6A 3ONDA 1ZKMA 2RIRA 2GRAA 1RYEA 4J1TA 4MP8A 3JD3A 1A5ZA 1OC2A 2DQ4A 2O3UA 3GOHA 3HB5X 5G0WA 1HE3A 4MVJH 4HNGA 1BXGA 1Q7CA 2UUPA 3DZIA 4I08A 4WPGA 4H15A 1P1HA 4YA6A 4OH1A 3NKLA 1WLYA 4PZDA 4DLAA 2ZKLA 4PLZA 4Y6PA 3A4VA 1ENPA 4IZHA 2WJPA 4PG6A 2P2SA 1BWSA 4CUKA 4DIBA 3MJEA 5A9SA 3GA0A 3U49A 4BOYA 1C0KA 1DC6A 1OOEA 2D2IA 2UAGA 3D64A 1G6KA 1PQUA 4NJMB 4FC6A 4IMRA 2XXBA 3DB2A 3PZBA 2BFAA 4J4HA 5ES3A 3WIDA 6ADHA 4GPD1 5T6BA 3LC7O 4G5HA 5EERA 1C0LA 5HA5A 1Q0QA 2NADA 2I5PO 4JK3A 1T4DA 3BMOB 4ROSA 3H6KA 5DOZA 1IUKA 3RD5A 3TOXA 4BNNA 3GLQA 3RIHA 3AK4A 1MXHA 4TKMA 3NV9A 3EUWA 3RFVA 2NLOA 5KVVA 3VC7A 4LMRA 8LDHA 4L74A 3OMLA 1N1GA 4CQLA 1YOVA 5JSFA 5ADHA 4UREA 1GU7A 3NTOA 3O9ZA 1YQDA 3F46A 1R37A 1JU9A 2PD4A 2QIOA 3GDOA 1HT0A 2DTXA 3N58A 1KC1A 1BTOA 3GVPA 1KEPA 4BNKA 3LDHA 3BTOA 2NNLD 3MOGA 3IQDB 1VSUA 5L9AA 2FR0A 5MGBA 1VM6A 1Q1NA 4INAA 4LRSB 1NHGA 3DOJA 1NNUA 4PLGA 3S2EA 3U0BA 4ZQEA 1CETA 2E4AA 1CEQA 2HDHA 2RAFA 3DBRA 3O4RA 3RROA 4ALKA 1JVSA 2Y05A 4DPMA 1ARZA 2NM0A 3FCOA 2WE8A 2WMDA 1EUZA 2Q45A 1W4ZA 5IG2A 4I1IA 1FK8A 1DOHA 2E37A 4MVJG 5DP2A 2VYVD 3PFFA 3WICA 3S1LA 4O0LA 2GSDA 5JAZA 4U6SA 4D44A 2W4QA 3DMYA 4CLRA 2J6IA 2BKAA 5TNXA 5JYDA 4NU5A 1UR5A 3U09A 3I9LA 1XEAA 3L6EA 4FFMA 3AOEA 4Z9YA 2Q4BA 5JO9A 1KEWA 3ZWXA 3QWIA 1FJHA 1PJCA 2IZZA 2OMEA 2V65A 1YBAA 3INTA 4E5PA 3RU9A 4QECA 4ZQGA 4GI2A 1DIHA 1ZNQO 2O2YA 3L07A 4CM9D 3TZKA 3HNPA 4CV3A 2C07A 3U5TA 8ADHA 4JBHA 3MTJA 4I5GA 3ENKA 3CSDA 3FTPA 2H6EA 3V2UA 3GR6A 4I9HA 4P4NA 4DXHA 3WFIA 1I3LA 1ZSYA 2EWMA 3W6ZA 3BMQA 2AMFA 4UVDA 5JCJA 2GYYA 2C54A 4R1TA 2JFFA 1ENYA 4BGIA 3B1JA 3ICCA 1UXIA 2HU2A 3IOYA 1OBFO 1ADCA 1M6WA 5KOIA 3PJFA 3D1LA 3JQBC 4P8RA 3WTCA 4D46A 1GDHA 3JQFA 1VRWA 2B83A 2FSVA 5EMHA 1MG0A 5TIIA 5L7TA 2O4CA 5L4LA 5FF9A 3Q6IA 1GZ3A 2EXXA 4KTVE 3R6DA 1KVSA 3FR8A 3I6QA 3KEQA 3KLMX 2OP0A 1JKFA 4CMEA 1CDOA 4YAJA 4RVDA 1AHIA 1FDUA 3K92A 5LC1A 2GNAA 1BXGB 4OXNA 3I83A 3MWEB 1YH3A 3EK2A 3JQ9C 2B69A 5CFZA 1HRDA 1R12A 2BH9A 3D5QA 3ZU2A 2QQ5A 3TPCA 3WLFA 1HDGO 1WDLA 2OL4A 3WQQA 3H2SA 3H5NA 4YAKA 1HDCA 4MP6A 1L7DA 3QWAA 2X86A 5HM8A 1B3BA 1LDYA 3DC2A 1ISMA 4BB5A 1H9BA 1HTBA 1MA0A 1U3WA 3GY0A 3VOSA 1IHXA 4RLHA 3RC1A 2ZIZA 3NT4A 1R0LA 1NVGA 2DUWA 2VHYA 4DTIA 2WD7B 4F6LA 1AGNA 1CERA 3UUWA 3W4JA 3DTYA 4XZ3A 1UXJA 1ENOA 1YL7A 2P9GA 1DRUA 4MJLA 2GUGA 1R4NA 2J3KA 5AXBA 3ZNNA 2FPGA 2NQTA 2QRJA 1N7HA 2AQ8A 2W2KA 5JC8A 3QVWA 3PYMA 1CJCA 3EZLA 4FJ1A 2J5RA 4JJGA 4NR0A 4R9RA 3V2HA 4R9SA 3A1NA 3L77A 1HWYA 2OXIA 5T5QA 2WYVA 3RJ5A 3F6YA 4ZA2A 4JBGA 1KEVA 1XU9A 2PH5A 4LVUA 5F1KA 4JJFA 1Y9EA 4E2XA 4YBZA 5EQFA 1BG6A 5T57A 3I9OA 3Q3CA 4WLFA 4ZICA 4E5YA 3U4IA 2NV6A 2Q1UA 5KIAA 1JDJA 1H9AA 1LA2A 3WGOA 1E92A 2VYND 3C85A 3L4SO 1CRWG 4NBVA 4GGOA 5TJHA 1HLPA 5AXAA 3I9MA 5I9LA 1CWUA 4RF5A 3RC9A 1PZHA 3NTQA 4CUZA 1LX6A 4QQRA 3WJ7A 1Z7EA 2G0TA 2RH4A 5CDYA 1E3IA 3U3XA 2JAPA 1NXQA 3HFGA 1UZLA 1JQBA 4RDHA 1X0XA 4LMPA 4CV2A 3SJUA 1IL0A 2VT3A 1TXGA 3HG7A 4RPJA 1IYZA 1Y9AA 4TQGA 5A1TA 5AQ1A 4BO0A 4J1NA 3QE3A 3VKUA 4WE3A 1GQ2A 3DTTA 2A92A 2GZ2A 2HRBA 1DFGA 4X54A 2IZ1A 4CLRB 3RU7A 3ZU4A 1O8CA 4XB2A 1WMBA 3B1KA 4MIOA 4TRNA 3LYLA 4J4TA 2VYVA 2CZCA 4BV8A 5DCYA 4GVXA 3KTDA 1I24A 4IJVA 2ZB3A 2Y0CA 2CVQA 3W8DA 3ZHXA 2IDZA 3RUCA 2DAPA 1C0PA 2FY8A 3K30A 4NHEA 1T2FA 3UCFA 4ZQFA 4Q9NA 1GL3A 5IDYA 4ZHSA 2BLLA 3L4BA 4F6CA 1LLDA 4AL4A 4YPOA 1PU2A 3E9MA 5ENVA 4ID9A 4LSMA 1JWBB 3SC6A 2EGGA 5A9TA 3GEDA 4CM9A 4GQAA 2ZB4A 3LC1O 4KQWA 1ISGA 5GY7A 3HE3A 1V3VA 1JW9B 3VPSA 5DZSA 3ICPA 3V1UA 2YZ7A 2GGSA 1D1SA 3B1FA 3LT0A 1EDOA 2OUIA 3KSDO 4IS2A 4E5KA 2J3JA 4IDFA 1Z6ZA 4PLVA 5IJZA 4WASA 3ZCXA 4DMLA 4CMIA 4E5NA 4K6CA 4OKIA 4XGKA 1T2DA 3DHEA 3UKOA 3JD2A 5U1PA 1ADBA 1UP4A 4ALLA 3O8QB 1ADFA 4MVJF 5IDQA 1LI4A 1KETA 4QX6A 3WJAA 4DPKA 4WJZA 3BMCB 4GMFA 3TNLA 3H65A 3OSUA 4D3FA 1E7WA 4R5HA 3S2GA 4DMMA 3ONFA 3WWZA 2C5EA 4FS3A 4BNVA 1FF9A 2Y1OA 3KRTA 1YB1A 4GVLA 4IJUA 1IZ0A 2DPHA 3NDRA 4TRMA 4DQVA 4BNLA 4UVEA 2FN7A 4BNHA 1I36A 4EI2A 3X2EA 2B4RO 5A04A 4CL8A 1FDSA 1E3WA 1UXGA 1JLLA 3H9EO 1CYDA 4ZRNA 3UHAA 4BNWA 4W4TA 5BSGA 3WSVA 1KVTA 2NVWA 4IQ8A 4Q39A 4Z9FA 3W4KA 3ZV5A 3PK0A 5G0SA 2CVZA 3OIFA 4PGFA 3D4OA 4WOJA 2PLAA 3IKVA 4BGUA 5JFOA 4EYEA 1KIFA 3V2GA 4JLWA 4IDGA 1ZMOA 3PLNA 4M1QA 4KDEA 4WUVA 3TSCA 3Q2KA 4FJ2A 4W82A 3G0OA 5A3VA 4D45A 1PEDA 1J5PA 1GFSA 3UW3A 4Y67A 4DBVO 4JQCA 4IXWA 5ITWA 1YKFA 5G4LA 3F5QA 4WCFC 3E48A 4B4WA 1N9GB 4E6PA 3JQ7B 4L0QA 3H3FA 3GN2A 1CIVA 2OORA 4PFJA 1ZO8A 3DZKA 1HF3A 3KEOA 3M1AA 3QWHA 1LXCA 3PJGA 1WAMA 1GYQA 3MTGA 3VH3A 4WCDA 2VHVA 3RI3A 1K0UA 3KBOA 4F3YA 1E7SA 1UXHA 3TZ6A 3FNEA 4QFCA 4BQPA 4NK5A 2BRUA 3FPCA 5CDTA 1FDTA 1T1SA 4BNTA 4BNXA 4I9NA 2J8ZA 1YQGA 1GUYA 2VYNA 3EMKA 3WNQA 1LDNA 4TKLA 1QYDA 1MUUA 4AICA 2O48X 1A7KA 3GGOA 4J0FA 1LDMA 5TJ9A 3HADA 1NR1A 3CMMA 2OHXA 2DPGA 3Q1LA 4RZIA 1QG6A 3TJRA 3AM5A 2IRWA 1I32A 1KS9A 2Y1EA 4WEOA 2ZTUA 3GG9A 2WYUA 4FC7A 3NYWA 5L3ZA 4J2OA 4BMNA 2ZATA 4BUCA 4K6FA 1B3RA 3JYQA 4YEDA 3GF4A 3UFXA 3K8ZA 3WMWA 4BGVA 1NQOA 1U4OA 2X0IA 3GDGA 2AEFA 1QLJA 4RF3A 3RFTA 2JJYA 3VAZA 2IYPA 2O3JA 4MO2A 4BO3A 2YHIB 2ZYAA 3TQHA 3UCEA 2JHFA 3VPHA 3FRJA 2WWRA 4A2CA 4AJKA 3JQ6A 5BNTA 3HZZA 2X9VA 1B15A 4HFJA 2VHWA 5DF1A 2DLDA 1U7HA 3I23A 3C1OA 1W8DA 2OBYA 3C1TA 3TN7A 3HWRA 3WGGA 4FR5A 2AG5A 1E7QA 3FPLA 5IZCC 4YVFA 3ZWCA 3NAQA 4II3A 1B0AA 4QO7A 3ZNPA 4HADA 1JWAB 4TROA 5DP1A 5BNFA 1GR0A 4BO8A 1MGOA 1Y6JA 2NVUB 4CMIB 3WFJA 3JQBA 3MJTA 5KJEA 4E30A 4UEOA 4S1VA 1Y8QA 1SC6A 1SZJG 3LT1A 2BD0A 3E9QA 3LLVA 3OEWA 3D4NA 1EUCA 1Y1PA 3I9JA 1LC3A 2HQ1A 4ILKA 3C3XA 5CDSA 1ZFNA 3QVTA 5KJ1A 1EVYA 1DHRA 4E0BA 4IIVA 5HBRA 1D4FA 3CXRA 5CG1A 2JFGA 5L4SA 2P5UA 3OA2A 2VOEA 3AM3A 1E3LA 1Z7BA 1UP6A 1GYRA 4XDZA 4E5MA 2JCXA 2NVBA 4CR6A 1HZZA 1I5RA 1JVBA 4HX5A 2FR1A 4M86A 4M55A 2ZQYA 1E3WB 4FOSA 4MIEA 3I52A 4GWGA 4NG5A 1JAXA 4OMUA 5IFLA 5LDHA 3OBBA 3BTVA 2FWMX 1ONPA 1PS9A 1SEVA 5EJ2A 1FMCA 3LC2O 1PGOA 3WSWA 4A5OA 2A9FA 2QG4A 1P1KA 1TT7A 3BTUA 1H6DA 1PQPA 3OP4A 1P44A 4B7XA 2AE2A 4J1QA 2VQ3A 1R0SA 1GPJA 4PLPA 1BMDA 4NPCA 1AE1A 2W8ZA 4J7UA 4DIFA 1E5LA 3LF2A 2TMGA 1P77A 1GCUA 1NQ5A 2J3IA 2PY6A 3AI2A 4Z0HO 3GVIA 3ZZNA 2E82A 3KVOA 3PDUA 2FHSA 2D0IA 1EE2A 5COAA 1LSJA 1XU7A 5JY6A 2GO1A 2XF8A 3IAHA 4CLXA 1DDOA 1RM0A 3DBVO 5HRUA 1T25A 4AFNA 4QSMA 1T1RA 1F14A 5JNLA 1K6IA 4YJHA 3PYXA 2JCVA 4XIYA 2C7GA 1Y8RA 3KZVA 3EZYA 1E7RA 3CINA 3Q11A 5BSFA 1B8PA 3KLPX 5KKCA 3H7AA 3KB6A 1U5AA 3TL3A 3PQDA 2BELA 1MC4A 2AQIA 4AJLA 3VDQA 4XB1A 3AUUA 2GN4A 1E5QA 1DBVO 3T4EA 3NDIA 1XHLA 3KXDA 1SNYA 5JDIA 2GN8A 3CMCO 5FEUA 1HE4A 1YBVA 3N74A 1V35A 1FDWA 3SX2A 2VZ8A 4TZTA 4ALIA 3GC6A 1GD1O 4NMHA 1V8BA 4DC0A 1DIAA 3QWFA 3GAFA 4PLCA 2QW8A 4AJJA 2BGMA 3G1UA 4L4XA 4BV9A 1D1TA 1NFRA 2OGUA 3F5SA 4B7UA 5I7EA 1C1DA 1HE5A 3FTNA 2AEMA 1VLLA 3DHNA 2PD6A 2DM6A 3NT2A 3ZWWA 1P9LA 3U9LA 3AY6A 1RWBA 1LJ8A 2C29D 1OZAA 2V6MA 4IDBA 2O7QA 2Y93A 3OQ1A 3ZNOA 1YGYA 2JHGA 2B5VA 3DZFA 1ZVMA 4O6VA 3OEYA 4CM4A 2FPIA 3GNTA 5EN4A 1DAOA 2O7SA 4ESOA 2B4QA 1I2CA 3AY7A 5G2OA 5I9MA 2YJZA 3PPIA 2Q2WA 4YB8A 5B12A 5TSDA 2QZZA 2EW8A 2HJSA 3JD1A 3OQBA 3IL2A 2YV3A 3G17A 3WBFA 3GUYA 1Y8QB 2HO5A 4HFRA 5L40A 1LUAA 1XIVA 5JY1A 3RAJA 4XKJA 2CF6A 1WPQA 1WWKA 3JTMA 1SB8A 3RUAA 1ISJA 4RV9A 3GEGA 2Q1WA 2YQ4A 4D41A 3K5PA 1VSVA 3DONA 2QYTA 4J43A 2A94A 4LSWA 5DBIA 4AJOA 4AJPA 2HJRA 4BIIA 2VRCA 4Y9DA 2PGJA 3VZPA 1QR6A 3PTZA 4AJHA 4E12A 3KYDA 4PZCA 2GDZA 4YCAA 4JIGA 1PJ4A 4A73A 3UOGA 4WGGA 2J5QA 2WYWA 3S2FA 2FPPA 3SLKA 4KUHA 5THQA 5A03A 5I7VA 1Y5MA 1LRLA 3ETGA 4YJFA 1BVUA 5K9ZA 2F00A 4I9UA 7MDHA 3AUSA 1NQTA 1I2ZA 4BNMA 4TRJA 1SAYA 3HN7A 1HYGA 4OIMA 4R1UA 2X9GA 1P1FA 4HV4A 3QLJA 3VVCA 1U7TA 4XQEA 1DLJA 4WOKA 5AVOA 1K3TA 4EUHA 1GV0A 3ADPA 3ZI0A 4PG8A 1WP4A 3ZWOA 1XCBA 2Y66A 3WDSA 3BMNB 4HKTA 4UVHA 1VL6A 1I3MA 4JJIA 4OHUA 4WECA 9LDTA 4CM8A 1LRJA 3GUCA 4XQCA 1DC5A 3N7UA 4DRYA 2ZYDA 3DBLB 3NJ8A 4GSKA 4UEJA 7ADHA 4YWJA 3IDSA 4WCFA 1BW9B 1YDEA 3PQFA 2YDXA 4XJSA 4RPHA 3O26A 5JCXA 2GLXA 1BHSA 1PJTA 3RQSA 3VPXA 3DAGA 3KHUA 3TL2A 2CVOA 2QYSA 1SMKA 2AA3A 3QSGA 2ZCUA 3JQ8A 4BKPA 4Z9XA 5A9RA 3FBTA 4CMHA 1JN0A 2ZJ0A 4YJDA 4ND2A 3D3EA 4BMVA 1U3VA 4XWYA 4GH5A 3ZN2A 3P2YA 1YJQA 1IOLA 1X14A 5CEEA 2I65A 3W1VA 3PVZA 2ZYGA 3DZBA 1I8TA 2C82A 3WGHA 2OP1A 4NJOA 2AQKA 1LC0A 2O3QA 3RVDA 1GYPA 1I2BA 4CQMB 1ZBQA 4Z3DA 1NAHA 1H2HA 4CM5A 1ZCJA 4XQGA 2NTNA 1PX0A 3RUFA 1YXMA 3JV7A 3P5SA 3FHLA 3KSZO 3MWDB 3W6UA 5BSEA 1V0JA 3DWFA 4BVAA 5G4KA 3PGXA 2X6TA 4HXYA 1HKUA 3KOUA 3VZQA 3GK3A 4JBIA 5F5LA 4CL3A 2PGDA 4YRBA 4Z3KA 2QX7A 3PZRA 4G65A 3IJPA 1Y81A 4XYMA 3EC7A 3KETA 1DIGA 1C1DB 5I8ZA 2YUTA 1ZK2A 1E1NA 1M76A 4EEXA 1C3VA 3IC5A 3LLSA 3P19A 1IY8A 3ABIA 2VWQA 5JMWA 1MP0A 1ZUD1 5DULA 3ZWNA 2JKVA 1SB9A 1OC4A 1GTMA 4CMKA 1NWCA 2WSBA 1P1JA 3GPDG 3NTRA 3DXFA 1ZK0A 2ZJ1A 3JYPA 3WG9A 4CM4B 1KY4A 3PGJA 3F1LA 4PLWA 4ZU3A 1PS8A 3NDJA 4IDEA 1U5CA 3ONEA 4D42A 4BNJA 4FPXA 4D0SA 5I7FA 3H5RA 1I33A 5GZ6A 2X5OA 5HS4A 5CHEA 3LZ6A 3R0IA 5IZCA 3U4DA 2TMDA 2GF2A 5H83A 5A9SB 3DFZA 4J49A 5TX7A 1I10A 3ZV3A 3DOCA 1X15A 4CLOA 3GZNA 2NUAA 4F45A 5DDIP 2EW2A 1V6AA 1A7AA 2IEBA 1NX6A 1NBOA 3TDKA 5AXDA 4PLFA 4FB5A 4R68A 4MDHA 4R51A 2NTVA 5I9NA 4BNUA 2D1YA 3PJEA 4NNJA 4R1SA 1SO8A 3OH8A 1KBZA 2YY7A 5FFFA 4DPLA 3CUKA 2PZMA 3F3SA 1A27A 3RFXA 4P4LA 1PJSA 2F1KA 4CQLB 5DN9A 1VJ0A 1YOVB 3I5MA 4MINA 4XX0A 4DWVA 1U3UA 2IXAA 1ISFA 1FXSA 1LDEA 1EZ4A 4ZVVA 1TB4A 3DAFA 1P3DA 4IJWA 3VKVA 4JGBA 3EYWA 2PKQO 2A35A 4BMSA 1ULUA 4DYDA 4GMGA 1DJQA 1IB6A 1LLUA 2D8AA 3H9JA 3PIDA 5G0VA 3WGZA 4DL9A 3GAZA 5KVQA 4DQUA 3BA1A 3G1TA 2I3AA 4ZQBA 3HDJA 4XRGA 1H94A 1QKIA 2B4TO 3RC2A 3PLRA 3JQAD 3G49A 3DBRB 3FWNA 4FFNA 1YWGO 1XKQA 1E7MA 2HK8A 3WGIA 2GZ1A 1PS0A 3SC4A 1DO8A 2I66A 2Q46A 2Z95A 4IUYA 3K9QO 4ZD6A 2XPCA 2EKPA 4J2HA 1VL8A 1B8UA 3TZCA 1Q2XA 4F46A 5DCWA 2HCTA 3L6OO 5EPOA 1JKIA 4IQ0A 4B4UA 2WDZA 2GASA 3RUHA 4DGSA 4S3MA 5JXWA 1O5IA 4HY3A 1IE3A 2BFPA 1SEPA 1EDZA 2BFMA 1VKOA 3TZHA 2CD9A 5HTOA 4NDNE 1KY5A 3RUEA 1UJMA 3ASVA 4O5OA 3PWZA 4XGIA 1HDZA 3OJOA 4RJTA 5IF3A 4YACA 1OAAA 4BO5A 2YHUA 3JQEA 4R4JA 4EITA 1X13A 3H9GA 4AG3A 4I8XA 4XR9A 2D4AA 3FI9A 3HHPA 1NHWA 2D5CA 1E6UA 3BMQB 3T4XA 3ZWMA 5ILOA 1I3KA 2P4QA 3SLGA 4RPKA 4QTZA 1CQJA 3SVTA 3TZQA 4BO7A 1TVEA 5HWSA 5BR7A 5C7IO 2E49A 1SOWA 4IGFA 5KJ6A 4U8GA 4GLLA 4YYZA 1DAPA 2I99A 4PN3A 2HK7A 4W99A 2P9CA 1NFQA 1QXSA 4PRKA 3FWZA 2V6GA 4MVJD 1IPEA 3WYBA 2RHCA 3EHEA 3ON5A 4HUJA 4RZHA 3UGKA 3IP1A 3G79A 2B35A 4MP3A 3TRIA 4GLOA 1PGQA 1DFIA 3H8VA 5I7SA 4N54A 3OJFA 1LQTA 2I6TA 2UDPA 3GQVA 3L9XA 4RVUA 1EEHA 3E9NA 5COBA 5A5FA 5JO0A 2WM3A 1ZMTA 3Q9UA 3QRWA 1BGVA 1HDYA 1M2WA 1YONA 3PHGA 3DBHA 1PJQA 3FSRA 1NPDA 5EQDA 4MPDA 1DRVA 5A5EA 2B0JA 1GY8A 2XOXA 1F0YA 4O1MA 4Q3AA 3WGQA 2PH3A 3B20A 4KTTE 3VDRA 4CR7A 5KTKA 4II2A 1VJ1A 1CF2O 1R15A 2Q2QA 4CR8A 3NX4A 1EE9A 4CLOB 4K1LA 1E77A 4A10A 4ND4A 3GZNB 1EQUA 5MDHA 2PTGA 2GN9A 3PWKA 3VVBA 4IPTA 2BI7A 2ZCVA 2FOIA 3QW2A 4W9NC 1VI2A 2R00C 3O03A 1ZK4A 1ML3A 1R4NB 2HRZA 1DB3A 3ORFA 2EV9A 1XA0A 4OSOA 5DBGA 2W2KB 3L6DA 5IDWA 3GEMA 2FR8A 3I1JA 4AJEA 3P7MA 3MJSA 1HXHA 4KUGA 1GZ6A 3DEYX 3E8XA 4QT0A 1TA4A 2ZTVA 3GVXA 1XLTA 1NM5A 1SPXA 3ROKA 1QMGA 3DHYA 3KM0A 1MG5A 1VJTA 1YB5A 3DR3A 3GDFA 2XXJA 3WGYA 5A02A 2DVMA 3HDHA 2DTEA 1QRRA 1HEUA 5A05A 2ZQZA 5L51A 1ZXLA 5AYVA 2NU8A 2BMAA 4KWHA 3DZJA 2R6JA 4DLLA 3TFOA 3AI3A 3S2IA 1E6WA 1BXKA 3GMDA 2BF7A 1U9JA 2OO5A 2VNAA 1ZSNA 2FMUA 2YQ5A 4XDYA 4XYBA 1J6UA 1ZJZA 2EJVA 3QA9A 4L9RA 4BO2A 2PGLA 4EW6A 4YJGA 1HSZA 5ER9A 2EG9A 3KSUA 1GAEO 1KVQA 1N2SA 1PIWA 3GG2A 1SOVA 4CLHA 5BSHA 3OJLA 4RVGA 3F4LA 2PR2A 3JQAA 2NU6A 4RL6A 9LDBA 2V6FA 4NFHA 3CZRA 3FBGA 3GN1A 3KYBA 5TF4A 3U62A 2CMDA 4CODB 1ZSVA 2X23A 3D3WA 1EBFA 5BT9A 1H93A 4R69A 1H2BA 4YAEA 4BO9A 2EF1A 2X8LA 1Q0LA 4CLEA 3PIIA 4IJKA 3F4BA 3F9IA 4JP3A 1LSSA 3UF0A 3QVXA 1W6UA 4TWRA 1E7YA 5G0UA 2VNSA 3ITKA 3WBBA 4B3HA 1F12A 3DOOA 2Q4EA 1AXEA 1PGNA 1HL3A 3GVCA 4BO4A 4PLHA 3PRJA 2HK9A 5ENDA 4B8WA 2NACA 3OA0A 1N7GA 2EEZA 1A4UA 3D7LA 4HP8A 1ISIA 4BS9A 1DSSG 3QV1A 1I01A 4MVJE 2DFVA 3AM4A 3IMFA 4IS3A 1C1XA 3JQCA 1B26A 4J16A 4EUFA 1E6EA 3E03A 3WIEA 1P33A 2D5AA 3W8EA 1PJ2A 1LNQA 4B8ZA 4GKVA 4TVBA 2PKQP 4QFDA 3PHHA 2P91A 4EUEA 1E3SA 3GRKA 4QUKA 1T2AA 3BIOA 2RCYA 1DC4A 1PTJA 3E82A 3ST7A 4LVCA 4QXMA 2GR9A 5TC4A 1XGKA 2Q2VA 2X9NA 3M1LA 4N5NA 1ISHA 1PGPA 3QY9A 4J9VA 3LK7A 3FNGA 2X22A 3T7EA 3A9WA 3V1TC 3E1KA 3INRA 4QEDA 5JS6A 1R0KA 1T2EA 3DDNA 4Y8VA 1P1IA 1E1MA 4MVJA 3ROPA 4K28A 4MVJI 1ZEMA 3ZNQA 4IY1A 4CUJA 3LU1A 3VPGA 1O6ZA 3PHJA 3EGOA 4UEKA 3GRPA 2DFDA 4J1SA 4YRAA 4E3ZA 4RVSA 4CV1A 5BQFA 3SJ7A 1X1TA 4FDAA 1F17A 2Q3EA 3EAGA 3I6IA 4PLYA 4R3NA 4PZEA 1B2LA 4BKOA 3JQ9A 3HJAA 1GADO 1EVJA 5CG2A 3HDQA 4OQZA 1E3JA 2FZWA 3HB4X 4NJMA 3DQPA 1GQQA 4YT5A 4L76A 5CDUA 1B7GO 1WNTA 3D4PA 4YQYA 1ONOA 3KYCA 2CDAA 2Y67A 3JSAA 4LW8A 5C3MA 5LDGA 4ZN6A 5ITVA 3PJDA 3B70A 2G82A 4DC1A 1QSGA 3QQPA 3FNFA 3QHAA 4BO6A 4FOOA 3DFUA 3GHYA 4KOAA 4JNKA 1KOLA 4GX1A 4OJNA 1MC5A 2JD0A 4D79A 1LSOA 2VWGA 1D7OA 3OIGA 5L53A 1Q7BA 2AHRA 1WDMA 1R16A 3LQFA 4Q3CA 2CFCA 4YTEA 5CEJA 3JYLA 1EMDA 1EVIA 1EFLA 3R3SA 5KJCA 1IZ9A 3RKRA 2AE1A 2UYYA 2YYYA 5U9CA 3WYCA 3WGTA 4EGFA 3V8BA 3VTZA 4UUMA 5TLSA 1T26A 3MJVA 4ND5A 3ZGYA 1KVUA 4BQRA 1MFZA 1QYCA 5KVSA 2WE7A 4YR9A 4E4YA 1T2CA 3WMXA 2YW9A 3ZW8A 1IHYA 3VHRA 3ZV6A 4CMJA 4W7HA 3BTSA 3WS7A 1YB4A 3VH4A 4XIJA 5JAMA 4D0RA 1ZH8A 4J9UE 3RCBA 5TT0A 3T7CA 4RVFA 1P0FA 1UZNA 2HSDA 3CTMA 4M49A 1GUFA 5H81A 3FNHA 5TS3A 1F8GA 1O0SA 3M2PA 1ZXBA 2ZTLA 3GVHA 2FRDA 4EJ0A 4FJ0A 3ETEA 4A7PA 5BNIA 1B14A 4U0JA 4FD3A 3HN2A 4MKXA 3V1YA 4CM3A 2O23A 4MKZA 2Y1GA 5K6AC 3CE6A 5GMOA 3BAZA 1EUDA 1KYQA 2Y0DA 5F1OA 5L95A 3H4VA 5B1YA 4NK4A 1U1IA 4H16A 4WLEA 3JQDA 5JPIA 5K0ZA 2D3TA 1U4SA 1EK5A 1GCOA 4IDCA 5JLAA 1PZEA 3U4CA 1K5HA 1UP7A 3IJRA 3RUDA 2HMSA 4WLUA 1C1XB 1PQWA 4UVIA 4N18A 1LLQA 4ONEA 4LN1A 2NSDA 4CLDA 3M6IA 3W4IA 3Q2IA 4GX5A 4C4OA 5EESA 4KDFA 1LTHR 3INGA 3NGXA 1KEUA 1SBYA 3BZUA 4YT8A 3PDJA 3NEPX 3WQSB 4YAIA 1DHTA 1X7HA 1P0CA 2CF5A 2YFQA 3D0OA 3E18A 1IULA 1GUZA 4GGPA 4J91A 3MJ4A 2I76A 5B4UA 5F5NA 2DC1A 4EEZA 5ICMA 4C7JA 2OZPA 4E33A 1HDOA 4D7AA 4BKUA 5JYEA 4BNIA 1X1EA 4OOEA 3WLEA 1GPDG 4A26A 3BHMA 4UUPA 4ALMA 5COQA 2JAHA 5CP8A 3R1IA 2YDYA 2J5KA 3VH2A 1E0DA 2OBNA 2X5KO 1E1LA 3AJRA 2AQHA 1DIBA 1HDRA 3BHIA 4RVHA 4Y98A 3JYOA 4OO3A 1B8VA 4CM6A 5FWNA 2WD8A 3PYLA 4JP2A 4L75A 1GEEA 2H63A 2P9EA 2VOJA 1O89A 4Q3EA 1P1RA 4BNZA 2HKIA 1X7DA 2RH8A 3SBOA 5EL0A 2B37A 4ND1A 4L4SA 1ONNA 2EGHA 2HUNA 4YT2A 3WTBA 3ANNA 3G3EA 4UULA 1C14A 2WD7A 1XQ6A 3CZMA 4AJ1A 3Q0EA 4FGWA 5TRTA 4IXTA 5FI3A 3KYCB 4YRDA 1XSEA 2VHZA 1M75A 2EHDA 4DA9A 5A4DA 2UUOA 2NWQA 3KV3O 4DLBA 5L45A 3VTFA 1TLTA 5CDGA 3QJ5A 3E5MA 4EDFA 1WMAA 4B7CA 2PZLA 4FFRA 4YDRA 1JAYA 2O3TA 1UDAA 1RJWA 4WLOA 1JTVA 4MKRA 1GQYA 1UAYA 2DT5A 4P22A 4JROA 2JD2A 2UV8A 4FBGA 4Q3BA 4W7IA 1LLCA 4M8SA 4W9NA 4BGEA 3H9UA 1AUPA 2R00A 4XR4A 4B79A 2B36A 4U7WA 1PL6A 2IE0A 2Z5LA 4FQ8A 1UH5A 3A28A 4RF2A 4OSPA 1XG5A 2C7VA 3GFBA 4RQUA 2X5JO 1DJNA 3EVNA 3KO8A 3OIDA 4PG5A 3ENNA 1VL0A 3IKTA 1HSOA 3WR5A 3CIFA 1H6AA 2NU9A 2IYOA 4A0SA 3AOGA 4A27A 5DOVA 2HMWA 4Q3DA 1N5DA 3F1KA 5T67A 5C5IA 3IP3A 5CPFA 1LU9A 1VKNA 5F21A 1XQ1A 4XCVA 3RBXA 3WYEA 3DAPA 3AI1A 1H5QA 4YJHB 5ER6A 5L4NA 1U8FO 1B16A 2PFGA 1Y8RB 3H3JA 5U4QA 4W6ZA 1QV6A 3MZ0A 1S7CA 2AEJA 2GERA 2P4HX 3K96A 3PI7A 4R5MA 3H2ZA 3H5AA 4IM7A 1N8KA 2DBZA 4N5MA 4TRRA 4R3WA 1YS4A 1XWFA 4O63O 3AWDA 5KNLA 1EVZA 4KUEA 5IXYA 3RC7A 4DYVA 4WK6A 1OMOA 3ZH2A 4J0EA 2Q1TA 2CNBA 4M87A 4FFOA 3JQGA 3VZRA 4WLVA 1YL5A 3UICA 4YQZA 5IXSA 3IUSA 2G5CA 4ND3A 5CEFA 1X0VA 1NASA 2OFPA 3ZHBA 3QVOA 5JMPA 3ZHZA 1CQIA 2X1HA 3C8MA 3IS3A 1ZK1A 5FI5A 1RKXA 2EERA 1YVEI 4XGNA 3D5TA 2EIHA 4E2ZA 4ZGWA 5C37A 1QYWA 2BFOA 1NR7A 3C7DB 1UDCA 3RWBA 1WW8A 1K89A 2POQX 2JFHA 4A03A 4NU6A 4GWKA 2WEKA 5DBFA 5L7YA 2XAAA 4EZBA 3AW9A 4Q3NA 1XYGA 4B3JA 5EIOA 2VWHA 2PZKA 1X7GA 1KVRA 1WDKA 4NZ9A 3OECA 5EINA 3ZU5A 3BHJA 5GZ1A 1O9BA 3ZWBA 4L73A 1MX3A 3O8QA 4E32A 2HMTA 1LRKA 2X0NA 3BMCA 5DT9A 3FD8A 1WZEA 3GNSA 3OQ6A 4PG4A 5JDCC 2R2GA 5B4TA 3IUPA 4URFA 3GZ4A 4CMGA 2DTDA 3PFWO 4FFPA 1MFPA 4I5DA 2VUTA 4J3FA 4WNIA 3U4HA 3O38A 4FN4A 2X7HA 1UDBA 2GZ3A 2H5LA 3E6AA 1RYDA 1UXKA 3MOIA 1HLDA 1L7EA 2EP7A 2EKLA 2YV1A 3AU9A 2VTDA 1E1KA 1ZIDA 4KQXA 4IZIA 1ADGA 4CMCA 5KVCA 1T4BA 4XJTA 2G1UA 1NP3A 4RORA 1WXDA 3RASA 3I9NA 3KYDB 1M6HA 3ROMA 3ZW9A 1BVRA 2YV2A 1O95A 3A06A 1H6CA 1PZFA 2Z1MA 1M67A 4NBUA 3WOHA 1R66A 1F8FA 2DKNA 2FZEA 4EBFA 1A71A 1YQXA 1Z75A 2VRBA 3DMTC 4J90A 1R6DA 4YJFB 3UXYA 2ET6A 1GV1A 4H3VA 1BDBA 2QHXA 1R4MA 3PXXA 1MB4A 3RBVA 1DIRA 4LRTB 2C20A 5B4VA 2HLPA 2HMUA 5A3JA 2I67A 4IDDA 3AU8A 1PJBA 3DZHA 3GNQA 2C2XA 4BKRA 1N92A 3PEFA 3RKUA 3K73O 3PP8A 1YDWA 4DQXA 1NAIA 1ZJYA 1PSDA 3R3JA 4XQ9A 1N9GA 3JQ7A 2O3RA 3PHIA 2C2YA 2BHLA 3OETA 4H7PA 5L7WA 3P2OA 1HETA 1QYVA 1NFFA 2CY0A 5ILGA 4CM8B 2BI8A 3EDMA 2Y68A 4IDAA 1V3TA 3NT5A 1GZ4A 1QYXA 4J7XA 4DIOA 2VUUA 3E5RA 4J4BA 4R01A 5KWEA 5T8KC 2UVDA 3OM9A 4IIUA 5J23A 3JYNA 1D3AA 4WCFB 4BB6A 3TF5A 2DBQA 1I3NA 4EJ6A 6LDHA 5F1PA 1JA9A 1MV8A 1ZK3A 4TMFA 2LDXA 3NRCA 1Q0HA 5DCUA 3JQ8B 1WZIA 2O3SA 2I3GA 4D3SA 2PNFA 1NYTA 2P68A 5T64A 1PJLA 4BNYA 5JDIC 3I4CA 4ALJA 2Y1CA 3HDYA 1ORRA 4ZRMA 3CKYA 1JKJA 2IODA 4NFYA 4BO1A 5AXCA 5H82A 1EQ2A 3IIEA 3MCVA 4OXYA 1KC3A 4Y6SA 1A9ZA 3GGGA 2Z1NA 2D59A 2DU8A 1BRMA 2G17A 1VC2A 2C59A 1PZGA 1EK6A 3JQGB 3ADOA 1U2DA 2X58A 3VH1A 1NPTO 4OKNA 5G4KB 1Y7TA 5TQVA 5K6AA 4E2YA 4O59O 2YHIA 4OXKA 4U6QA 4BL5A 2NU7A 2VWPA 3K31A 4IBOA 4CV0A 2VN8A 1ZW1A 1P31A 2H9IA 3OJEA 1F06A 3AY3A 5A06A 3LF1A 1XR3A 1V3UA 2GD1O 1BDMA 4WNCA 2RBEA 4YAGA 2GPTA 1LDBA 2W2LD 2VCYA 1U2GA 4DVJA 1QLHA 1J4AA 3I3OA 1S6YA 2BGKA 4PLTA 3OFSA
chains in the Genus database with same CATH superfamily
3ZDRA 4G5XA 3OKAA 4TKUA 1Y8ZA 1WBDA 2BZ1A 2GCGA 1NI3A 2AN3A 1TJNA 1GTVA 1O6FA 3BXFA 4M2LA 4ENSA 2VT2A 3T6KA 1HE2A 3CN9A 4YXFA 4JBYA 1HZJA 1PJ8A 1M10A 3QVJA 4OQYA 4QDXA 4Y6QA 4I3GA 5G40A 2QPTA 2QRKA 2EW1A 4GL2A 2EF0A 1G18A 4WL0A 1IQPA 2P5YA 3WWYA 1W0CA 2GZMA 2BFFA 4WA8A 4XKJA 2PT7A 2P2YA 1GNVA 2VKTA 2W22A 2X14A 5SZHB 3CNQS 1PRYA 1YE3A 3LGSA 3IR6A 4G97A 2HRCA 3WRYA 1M8JA 3BXEA 4OFBA 4WOCA 3U80A 4GVPA 1C9YA 1J00A 1G9SA 1I0ZA 1P2UA 2FWJA 2A0FA 3JARA 3P9PA 4WN9B 4BFVA 4ZTZB 3K4PA 2G9RA 4X6UA 4Y2HA 5H0IA 5HFAA 1OBCA 1E2QA 3NBAA 1Y8CA 2PM8A 4LI3X 5HF9A 3VNRA 2PGNA 4C7KA 4OX9Y 1UBRS 2IE8A 5AW1A 4MCAA 1OFTA 2WM9B 4H18A 2J46A 1ZH0A 4C5CA 5FXMA 2GUWA 2EJTA 3B85A 5EWMB 5JAIA 3NBFA 5MGNA 3CJTA 3IKJA 4HUQB 5J5CA 1ADJA 2W43A 3ZS8A 1XDBA 3D6JA 4XYGA 1EFVB 3EXHB 1XHEA 4P33A 4DVGA 5FBVB 2XX3A 1U3TA 1QZZA 2XZPA 4Z6KA 1IN6A 1VKHA 2J3HA 1I4EB 3FYUB 4N01A 4ZJUA 5ULLA 2ZOSA 2IEDA 2OG2A 2EOAA 5IAJA 5TQ0A 2LWIA 5A62A 4HC4A 3R8CA 1PR9A 4WRRA 1CUFA 2J1LA 3EVZA 3OOEA 3ZWVA 1TYDE 1BOOA 3TXAA 2VYFA 1W87A 4CMBA 1SZPA 1LDGA 5JJCA 2RHGB 2MDTA 3RABA 3ICEA 5IVIA 1T10A 5D86A 2X0JA 4QWMA 1NWHA 1RYBA 1UM9A 2PCJA 3O8OB 2JJ1D 4R2KA 3DZGA 5DNAA 3OZVA 1DELA 4OBWA 1XMXA 3LCJA 1XE3A 1C9EA 4JH0A 1WETA 2GCNA 5IZ4A 2ADFA 4BECA 2BKUA 4I9FA 4DQDA 3VZSA 5B2EA 1IHDA 1Z6XA 3ZE1B 1UEIA 3Q8MA 1C7ZA 3AI7A 3MFQA 4B4KA 4CFYA 4HFNA 7YASA 4Q34A 4QDUA 5EJEA 1F7VA 3KPWA 2QLFA 3N8IA 5LCXA 1AXGA 1D8AA 4PV7A 5JJIA 4R16A 4URWR 4DREA 2BEWB 3SHFA 5BR4A 1OPRA 4LCJA 4TN1A 3DA8A 4UASA 1T2UA 3A4MA 2YFYA 1KERA 3ABZA 5FAXA 4MRPA 1Z5VA 3RSZA 3TRFA 2ZIFA 4K9MA 4L22A 3IAEA 4YQFA 2RHRA 3I5AA 3EDCA 3K6JA 1ULSA 1DC3A 1V1MB 2B2NA 2GHRA 3D59A 4XX1A 3GHHA 5DM4A 3WBKA 4CVNA 5K7SA 1Y5RA 3U6BA 5J58A 3UANA 4FSHA 1UK9A 3LHKA 3B3GA 4IOKA 1M66A 3U3RA 1XZFA 1CQWA 1KDOA 5JPCA 4IINA 1TQ4A 4NBTA 5K4GA 3CH5A 5HEKA 3VHLB 2ZYWX 3NCHA 4CQMD 1JLMA 4Z2AA 1ISSA 3DD1A 3AONB 4FW8A 1GNSA 2X19A 4QOJA 4RLSA 4WFIA 5EFOA 3S29A 2GBLC 3ZDFA 2CL5A 2R6HA 3Q7TA 5JIBA 1MU0A 1EFKA 3TR5A 2C77A 3G0DA 4GP6A 2O0JA 2I2DA 2FLVA 1AHHA 1E8MA 3FIUA 2CK3D 1AHPA 2OBBA 2OYCA 2OOKA 1QOZA 3BGDA 4NI5A 3ID6C 2O2EA 1QZTA 1Y0BA 1O96B 1KHTA 1P0IA 1U7XA 4ZV7A 1DDGA 2DR0A 4RH3A 5CFQA 2DE0X 2BHTA 3C0KA 1PWXA 2AZXA 1DX9A 3BXOA 1EP3B 4TL6A 1NYLA 1K8RA 3A36A 4CMEC 2Q9AA 1VMIA 3AC0A 1IK6A 2ZB7A 3HH8A 1RLTA 2YJGA 4HDNA 2GPNA 4GQIA 2ZIAA 1C8BA 3EVDA 4QTUB 1OAKA 3K0KA 3SMVA 1CP2A 3AVXA 4L08A 3E84A 1IBLB 2CNDA 2DWPA 3T06B 2JD1A 3EC2A 4LCEA 4EMUA 1N6NA 1VCHA 4P2GA 3EQ9A 5AHKA 2Z3WA 3HDTA 4OUDA 5FL7D 3D7MA 4DSOA 1Z82A 3EVTA 5A3SA 5FTNA 4F7WA 5EZQA 1QR2A 3X1XA 1Y82A 1XL1A 3TLMA 3JD4A 1AS2A 3WLQA 4BKQA 4YT4A 4QTXA 3MF4A 1RWOA 3ONNA 2QG9A 4XRRA 4Q1CA 3ZOZA 2PU7A 5I6DA 5BRJA 4E13A 3SE0A 3L8GA 2XUZA 2W2LA 1J8YF 2Y71A 1XTSA 3OZEA 4HS9A 3AB7A 4UQPA 3QKUA 5HKKD 4NAVA 4MVJP 3TD6A 4RS3A 3HHEA 5F2NA 2GEKA 2OV6A 3KHKA 2O8CB 1PNRA 5FH9A 3FCSB 5JBIA 1EBUA 1EGQA 2WUGA 1BNCA 3M1IA 4HQOA 3T5BA 2B5WA 4UFNA 1P7WA 2O2SA 3GFGA 3TCKA 4AJIA 2YMQA 4ER6A 4GLJA 3OE7A 2VRCD 3KKNA 2O50A 3C7TA 5K5EA 1F8YA 1KZGB 2IHTA 3DE5X 3NYQA 2YFHA 4XVRA 4URZR 1VYUA 2WG1A 1NJ8A 4HBGA 4LJ6A 4TLMB 4CKBB 5IAAA 4UUNA 3H8JA 4MOWA 5FB3A 5JDCA 1NJ5A 4NBSA 4X5OA 4L1KA 1JU3A 1B00A 2CHQA 3CPSA 4F9FA 5E6RA 4C3VA 4K05A 5GIOE 4J7CA 4ND8A 4R41A 3UAGA 2FA9A 3O4FA 3AV3A 4M54A 1SPBS 2HBZA 4U63A 5HHTA 2PUEA 2AG8A 1SRQA 3DTVA 1QIIA 4X8HA 4TT3D 1WW2A 4EA6A 3PEVA 5FPQA 4IKPA 4OIFA 3SFZA 1O08A 2QRQA 4X91A 3MJCA 4O2BF 3S8MA 4KE9A 1RP1A 1DVRA 4LMAA 4ENRA 1ZAYA 5HMLA 1JEYB 3WLTA 1SXJC 2C3OA 1Z33A 5ALKA 1JH9A 4XOUA 3O1HB 4YREA 4BMOB 5CA1B 2ZBUA 1FXUA 4OGWA 1PE0A 2N42A 3AT1A 1IBSA 1DINA 1V2HE 1UZUA 3T5GA 4IILA 4YCJA 4DDUA 1J97A 3RJZA 1W35A 1Z3CA 3SEQA 4QO8A 3QMMA 3RBZA 5E3JA 3ZWQA 3CV3A 4Z0PA 3W5UA 4DJFC 3FVRA 1ZM9A 3HUEA 3CZ4A 1OXSC 1F0NA 3LGAA 1ZGZA 4LTMA 1N4AA 1V9SA 1WPGA 1JDVA 2ZJ3A 1GNLA 1FP1D 4KVAA 3V7UA 5IT0A 3JAKA 4G1UC 5IJAA 1OX6A 3X2FA 2XOKD 2WDPA 4AY6A 1PL8A 3TNFA 4HT3B 3B1WA 1BJRE 1BW9A 1KPIA 3H1GA 4LWOA 4MLDA 5AMXA 3ZQ6A 1TEHA 2ON6A 2IH2A 3IA7A 1J49A 1UMKA 2IPLA 2Y3IA 3AUFA 4YECA 3I2HA 1SVMA 3BRSA 5C5DA 2N75A 3LBFA 1YQWA 4CEIB 1BD3A 1J21A 4OFXA 1G0OA 1NTOA 3KALA 4QPNA 2QL6A 5B64A 4M1EA 1GSAA 3K32A 4PHGA 4B3IA 4M1KA 5IJXA 1YRQA 2W37A 3L4BC 4MQEB 1MIOA 3KPVA 4C7BA 3PICA 1IN4A 5AP9A 1YASA 4IH9A 3RLIA 4DG9A 2LDBA 1K6MA 2Q5HA 3HVIA 5B37A 2P2DA 4F5DA 2FEXA 2KQUA 4MQFA 3HVHA 2W6ID 3OQNA 4WEQA 4DR1B 2B82A 2ZWIA 3C7CB 3TOCA 2VAMA 2E9SA 2MYTA 1NZFA 2PWYA 4NFSA 4QGAA 2UYCA 3IT1A 4XOIA 2XQIA 3KUXA 5TGDA 1OLSA 1E9BA 2X4GA 3NUGA 2A4KA 5C4IA 1OZFA 1K6XA 2OZLB 4C22A 5AKKA 2XVAA 3DPSA 3GPCA 1WQ1R 3SXPA 3E70C 2JAWA 4RK0A 3CLUC 3CGWA 3S2SA 3TSYA 4LOJA 1TUBB 3B7GA 3K2QA 2FSUA 1C0IA 3FPEA 1ZI6A 3HFSA 2V4MA 1QHSA 2OCBA 5HPYB 1KEEB 1PX2A 2Q3MA 4LY3A 5TMPA 2D1RA 1Q1AA 2EJWA 2PU5A 4JJ4A 4JC5A 4OB6A 1Z45A 5JQGF 5K05A 2GM4A 5L3VA 2FDCA 4B43A 5FL3A 3QVKA 5ALZA 2Q3JA 3N8DA 1Z7WA 3TLJA 3ILXA 3GCZA 5D5HA 4EF4A 4JP1A 5IPFA 2EFDB 2O3UA 5G0WA 2JEZA 5KSOA 2FUCA 4CCSA 4JVMA 2JG3A 1Q7CA 3DZIA 5TMEA 4UTZA 1D1QA 4F2WA 1Q3HA 4FSXA 5IKPA 3A1CA 4G0UA 1FSZA 1UCFA 4QG7A 3NWPA 2PGAA 1YRBA 4D0GA 1P1HA 3S27A 5FA5A 4MULA 3G5LA 1XDUA 4ND7A 5ECDA 4RTQA 5F9MA 3SZMA 2WNHA 5DASA 2EIXA 5KDLA 1R0RE 3G8DA 1VLQA 3HBNA 4F86A 1ETHA 2C57A 4Y6PA 1W2GA 2WA1A 3OQJA 1D2CA 4D74A 4IZHA 3WGJA 1BWSA 1C7QA 4CUKA 4JI1B 3UBTA 2JGLA 1Z2AA 1E2GA 2CZQA 4LDPA 5A9SA 5B5SA 3GA0A 1FNBA 5AVXA 4HI0E 2FZLA 4MR9A 4NMXB 4XDHA 3U49A 1C0KA 5UKDA 1TMOA 3NWJA 1OOEA 5IC6A 3D64A 1UZAA 5AM2A 1X1DA 5F7ZA 3VR5D 1U7UA 1JDTA 4N5HX 2GSWA 1ZMBA 2YXEA 3PZBA 4J4HA 5LZ2A 3COWA 2ODEA 2DR2A 3EGDB 5T6BA 2PSJA 4Y1GA 3SZRA 1QGOA 2C1ZA 2FX5A 1VCMA 2V7VA 1TTPB 1QQTA 2YYZA 3L3BA 1OH8A 2CYAA 1T4DA 2WWXA 4KQHA 2H1CA 4FZJA 3CPEA 3H6KA 1I6KA 5DOZA 3HKCA 5E7MA 3IVMA 2NXNA 5EXTA 3TOXA 4M0MA 4BRZA 1YK1A 4KIUA 2YHAA 3P0FA 2P6RA 4NOMA 4MV7A 1R9MA 5KVVA 1HX7A 2IF0A 3FDIA 2BGTA 3T54A 5J4KA 3AYXB 3P9XA 8LDHA 5CCBA 4H6XA 1TRKA 3C3BA 2HGSA 2YYSA 4RY8A 1PWHA 1Y4UA 5JSFA 5ADHA 4DCMA 2QE7D 1IN5A 1WY5A 2GX6A 1GU7A 1RXSA 2HRDA 4N3CA 3VPDA 4ARZB 3O9ZA 3L8MA 3I1FA 3HU3A 1Q1BA 1RQGA 5E4YA 2QIOA 1JHVA 3QFCA 1HT0A 3BE8A 5DTIA 2FB9A 3KAJA 1KEPA 1XJWA 3IDOA 4TXJA 1QF6A 2I8LA 2UYQA 3BTOA 5K8TA 5KVAA 1Y3BE 4Q82A 1XPRA 3BIXA 4XB6B 3L43A 4M1SA 3IQDB 2NYRA 2FR0A 3R6WA 4KYVA 5BPHA 5MGBA 1VM6A 3QU2A 3SR0A 4LRSB 1RI4A 3NEYA 4ZEWA 4AZ0A 4YCBA 4F9TA 4WJLA 4PLGA 2ZYHA 2ODBA 3S2EA 5D84A 1CETA 2VPTA 3Q9LA 3MRXA 3EUAA 5JWRA 3L05A 2QU7A 3D7RA 1ARZA 2M1ZA 3GLFE 1ZIPA 3K0SA 2WMDA 1F2UB 1EUZA 1KI6B 3TLGA 1M6EX 3RPEA 1DMRA 5AWFC 4PPGA 5CVDA 3OOWA 1FK8A 3JWJA 4IHJA 2XNDA 1DOHA 4MDEA 4G0PA 1UAAA 4ZZ2A 4IZOA 2WW8A 2EBWA 3QLUA 4R6WA 5IT9A 4CTMA 4MVJG 5DP2A 3QFFA 3S1LA 1VPEA 3EEOA 3QOFA 2GSDA 2QPLA 3ZY4A 4CLRA 5JYDA 3VU3A 1O5OA 5E2IA 4NU5A 1UR5A 4JUBA 4I1PA 4N7MA 2GAAA 1Z7GA 2OD7A 3L6EA 2P8JA 1BKDR 3AR5A 5BOVA 1K4KA 3AOEA 3T1YB 2DUNA 1E1RD 1KXJA 5JO9A 3ZWXA 1NBME 3IBTA 4WESA 1INLA 1AZSC 3QWIA 2OMEA 2V9CA 2HHJA 3MWGA 3CEMA 1KDZA 3U3KA 1NW7A 3RU9A 4QECA 4LXGA 4UQLA 1DIHA 2J7KA 3PC8C 1CUCA 1VE1A 2QJTA 3FSJX 4KDCA 2O2YA 1M8PA 4O2LA 3TZKA 3HNPA 4CV3A 2HA5A 4FYIA 4D82A 3O8CA 4C7OA 1CY4A 1M73E 3MTJA 4JBHA 3ENKA 3ZQUA 3CSDA 2V1UA 3JWIA 3V2UA 3KOWA 4IRUB 5IC5A 1I3LA 4EHNA 2YZMA 3BMQA 2Y9PB 5JCJA 1D5WA 3H05A 1G41A 1Y48E 3S81A 4TXHA 3HLKA 3KPJA 2BGIA 4OYYA 3RW9A 1MT0A 3B1JA 5AW8A 1UXIA 1CRZA 2HU2A 4BAGA 1M6WA 3A1TA 4QOHA 3W2EA 5KOIA 5JWHA 1QIGA 4PTZA 4G89A 1VCNA 2UZ4A 2O0MA 1TCVA 3V80A 3WTCA 1GDHA 1US8A 3JQFA 2B83A 2FSVA 2JIBA 4JVOA 4RY2A 5TIIA 1RCFA 3H16A 5IH7A 3TQFA 2FWBA 4KTVE 1RJEA 4MRSA 1E1YA 1EFTA 2VAWA 2WJGA 3HJUA 2H9YA 3Q3VA 3L1JA 3R6DA 4EI9A 1Y42X 3I6QA 5DH9A 5HKOA 3UGQA 1JG2A 2D74A 1X86B 5E1BA 1OWPA 4WACA 3WRVA 1OZ0A 1CDOA 2QR5A 4PZZA 3G9UA 5DI9A 1AHIA 1MVOA 3PUXA 1KK0A 1BXGB 4G41A 4B40A 1P91A 1C8LA 5M04A 3PF9A 3I83A 1MTOA 2AFIE 2PUCA 5ECWA 1TO6A 1YH3A 3EK2A 1SD1A 3N3BC 1R12A 4I66A 4MW2A 2QQ5A 3T15A 3TPCA 1HZZC 1HDGO 2ZAYA 2OL4A 1ZS9A 3WQQA 1G5PA 5B1DA 3H5NA 1DKNA 2DERA 2ZQ5A 4CQNA 1IJFA 2GM3A 1P5ZB 2J6CA 5K8VA 1I4WA 5DB4A 3RYTC 5E3HA 5AIAA 1TAHA 1KRWA 1SN7A 1UM8A 1VRCA 2XTNA 4RQAA 3QU5A 4QQNA 3TLYA 1N6HA 2REOA 3GX1A 4NDAA 3BRQA 5LZ8A 4AT1A 3KSRA 1HTBA 3MB8A 1I3OA 1SELA 5JSYA 4RA9B 2ZSJA 2R9VA 5KOHB 5TVGA 3WL7A 2E4VA 1XDGA 4KB5A 3SHOA 1RBMA 4DARA 3NT4A 5LKRA 1OX4A 1R0LA 2H2FA 2R751 3UV7A 3W6OA 2NZUG 3DF9A 3OAAD 1JXAA 3OLCX 3TE7A 2VHYA 4DTIA 3J80A 3F8TA 3SEZA 3L93A 2QTFA 3NBQA 1W5SA 3BD6A 3A4NA 5FOUA 3AEUA 4HCJA 3W4JA 5IKMA 2FWPA 1P39A 1FFXB 3SZGA 1YL7A 4RHYA 4AYXA 4MJLA 4XPIA 3LW7A 1KS2A 4GG1A 4JI3B 4QOGA 5K0LA 3X1MA 5EKXA 2W2KA 1N7HA 1OYOA 2X2EA 5JROA 3AHJA 5CX4A 2F7SA 4HF7A 4AMGA 3V34A 3P9NA 1CJCA 3EZLA 4R9RA 1G64A 1M34B 3V2HA 4R9SA 4JOBA 3Q2OA 1MB2A 4QOEA 2XTMA 3T0IA 1RTTA 5T5QA 4X6XA 3X1YA 1Y5IA 3OMXA 5CA1F 2XY4A 4M8KA 1L8XA 1UJ5A 3GLGB 2AV6A 2QSYA 4E2XA 3R7NA 3DE1X 1L7XA 3Q87B 5EQFA 1BG6A 3OT4A 3GLUA 5T57A 1YFZA 5EHZA 3EGXB 4KQMA 4UTVA 1ZOSA 2NV6A 2V55B 2ZUDA 2BFBA 3GD5A 5B3AA 4BX8A 4QGBA 3CCBA 2ZUBA 1ZP6A 3WGOA 1IY0A 1X9HA 2VYND 3BSSA 1DX6A 1P2VA 3CZPA 1YFJA 4MW1A 5LPNA 4NBLA 5EJ5A 2RHJA 1MW8X 2OCYC 3NRJA 4MUKA 4S1OA 5LA6B 3VZDA 3IEMA 3OQIB 2J0SA 3NTQA 1ZVJA 2JKYA 1OXBB 5LSAA 1NZJA 3WJ7A 2BJWA 2BE7A 5ITSA 1GVNB 3NFYA 1RAAA 1SULA 1SVIA 2V0CA 2G0TA 2WUDA 1KFBB 3CN7A 1F38A 4FGKA 4KSCA 4RZQA 5JWOA 5IH3A 1USWA 2X76A 1K9VF 3ZJVA 4IIDA 1XTIA 1VLJA 3N8HA 4RDHA 3TEFA 4U8HA 3ZHTA 4OM7A 3HB9A 2K87A 3TG2A 4IIJB 4POAA 4MUYA 5EJ4A 1G5HA 1H0SA 1TXGA 1IYZA 2C95A 3I58A 1OD6A 3K1AA 3Q85A 5K2MA 5AQ1A 3MW8A 3FRHA 3IEPA 3L8ZA 3PGVA 4J1NA 4E6EA 2HCRA 1I1QB 1DFGA 4NBKA 2IZ1A 3RU7A 1XXHB 3ZU4A 4XB2A 4ERNA 1N9ZA 3B1KA 5CH5A 1UEJA 3A31A 1U3FA 4F97A 4J4TA 2L0XA 2R60A 2XE8A 4JP2A 2JGJA 2CZCA 3L0SA 4LF6B 1H22A 1QWOA 1I24A 3KTDA 3E1SA 4M0KA 2C2KA 1ZGGA 4HHEA 5CUQA 3W8DA 3RRYA 1UINA 1C0PA 3WE7A 1LB1B 1A04A 4A9AA 2CV2A 4PC7A 1H3NA 1E79D 1HFEL 1T2FA 1FFBA 3LRXA 4FE7A 1XC7A 1W59A 4NHEA 5EIHA 4ZVUA 3B89A 5IDYA 4PYJA 3TO5A 5EXEA 4F6CA 3EISA 4AL4A 4YPOA 1V71A 3PA8A 4W63A 4QE3A 1K97A 1XCGB 3F74A 3HXOA 5BQPA 4CM9A 4GMDA 2GRUA 3KP1A 2ZB4A 3W7BA 3E7XA 3PQ5A 4W1QA 1TTQB 3A4YA 5DZSA 5SY6A 5A6SB 3NHKA 1QOPB 3JWGA 3V1UA 3B1FA 3TGPA 1D1SA 2AR7A 5LMNB 3LQRA 3FH0A 5KSZA 2DLCX 3KSDO 4IS2A 4E5KA 3THRA 4YMSA 2I7TA 3KFXA 5FUWA 1M83A 1NY5A 4FX5A 3ZCXA 3QMVA 2C8LA 4MR7A 3HB7A 3OCXA 5E9WA 4CMIA 4ZZ0A 4WZZA 4K6CA 4OKIA 3R0XA 4GOKA 3UKOA 1V4NA 3DHEA 4V0LA 3OTOB 4MV5A 1ADBA 5KTMA 5ILOA 1VBKA 4ON9A 5LD2B 2DEUA 2YWFA 2XCLA 1NP6A 3HEMA 3LQYA 3FPBA 4MVJF 1LI4A 4F2PA 5CFNA 4OHKA 4GBED 2IS1A 1KI7A 1JEDA 1G8JA 1TZJA 4GMFA 4Y0AA 4U7DA 5F73A 2QORA 2R7AA 1JIVA 1X6VA 1JJIA 2Q5CA 4REQB 5BW8A 1E7WA 2X6RA 4ID3A 4K8RB 3GGCA 4LY9A 4R5HA 3A7DA 2A5YB 2FEWB 3VR1A 5LIPA 2RD2A 1FF9A 2O8EB 1QHEA 3KRTA 1A5SB 1RQRA 1YB1A 4OHZA 1X2BA 1ZHHA 1W44A 1AKVA 3NONA 2CL6X 2XZDA 2HW8A 2V7GA 3M81A 2Q0QA 3TVDA 5A04A 2QBYB 4AY3A 1YFLA 3W34A 3AUYA 5DEOA 5AW0A 2PO7A 4BNWA 1DP4A 1AKEA 5EUQB 2WTMA 5FO1A 5BSVA 1JLKA 4PCAA 3H2KA 1KIMA 4CE6A 1IATA 3AERB 4Q39A 4F1WA 1ISRA 1SQSA 1U8YA 4TTRA 3ZV5A 4B5LA 2IH5A 1UPAA 3QSYA 2CVZA 4ZGGA 1KYTA 4UCWA 1BO6A 2X3UA 2CSXA 3UK2A 2C8KA 5F2KA 1XAIA 3MOSA 3IOBA 1I4LD 3UMGA 1EHCA 1LWOA 2ZVDA 3E9YA 1EVEA 1WXGA 4IDGA 3Q2KA 4KDEA 1R9GA 2XWBF 4WUVA 3P0EA 4JGIA 4GE3A 2F55A 4QPCA 2LD4A 1KE1A 5A3VA 4A23A 1I9CA 4J75A 4LJYA 1SUCA 2ZXEA 1Z8NA 3BH6A 3NBXX 3LT5A 3UW3A 2HXSA 4JQCA 3P4YA 4IXWA 1N77A 2AXNA 3HR8A 2IPOA 1YCDA 2N46A 4FR2A 3FAZA 1QBGA 1WEKA 1P29A 3IOEA 4DNPA 1N9GB 4E6PA 1WHTB 3H3FA 1SZDA 4QTTB 1DT3A 2TSYB 4UMEA 4M0LA 1CIVA 2OORA 1F6BA 2ORIA 4G0ZA 4PFJA 1M2NA 3DZKA 1U0NA 3NTXA 3V4OA 4WA7A 4QUIA 5L6MB 1VG9B 1LXCA 3PJGA 1GYQA 1E4EB 1XRSB 2PA0A 3IOMA 4WCDA 2A30A 2VHVA 1UK6A 4WZBB 3RI3A 1W6RA 1WCIA 1XD2B 3KBOA 5GADl 4L07A 4HQKA 4OHBA 5DHPA 4F3YA 5AVWA 1C8VB 4IWXA 2GAJA 5K0GA 1LV7A 3FNEA 2GO7A 2CZGA 1C4OA 4NK5A 2ZLBA 3HB1A 4DNQA 5B3LA 3OQVA 4IICA 1KZ6A 2F9LA 1GUYA 4LF8B 3ZKWB 3TEMA 4AKEA 3EMKA 3WNQA 1AU9A 4MARA 1FU7A 2YMPA 3AP2A 2NO0A 3I34X 2D0PB 2WF7A 3L04A 4ZFNA 2I22A 2V59A 3IQFA 4J0FA 1GRQA 1LDMA 3OKFA 3UHJA 5JRDS 2Z9DA 1NR1A 2ZFUA 5ALUA 2OHXA 4KNVA 3NI2A 3Q1LA 4ASUA 1QG6A 1NY6A 2GK6A 1NE7A 2IRWA 3O4HA 4BFZA 5HF8A 3G5AA 2WTAA 3UJ9A 2ZTUA 4EQZA 1RMYA 2CVFA 2WYUA 4J2OA 5IF9A 3IVRA 3LE8A 2ZATA 3CVYA 4BUCA 4K6FA 3NKFA 1B3RA 1JEOA 3O73A 3GF4A 3K8ZA 4Z86A 1YT5A 1F0KA 3FDXA 5EOVA 4LGCA 4BDSA 4JWKA 2AD1A 4HWOA 2X0IA 9GPBA 4ZKDA 2CFSA 3PDIB 3Q72A 4ZKEA 5NLLA 2AEFA 1QVVA 5BN3A 4PG8A 4BX3A 4RF3A 2JJYA 2VZEA 2IYPA 1X19A 4MLPA 4MO2A 1NW5A 3FMIA 3QOXA 2JHCA 1RJ9A 2YHIB 1AUQA 5K8IA 2WWRA 2NU7B 2BFWA 1F6WA 4WK4B 4X1YB 4AXBA 2J3LA 3JQ6A 2X9VA 1NDUA 4UATA 3BB4A 3SJZA 2P77A 4HFJA 2VHWA 5DF1A 2I7DA 4LJAA 3U37A 2ONYA 3PNKA 2HPHA 2GN1A 2V6IA 4YO7A 4RKEA 3TN7A 3WGGA 3HRKA 2DECA 4FR5A 4HAZA 1E7QA 4Y1FA 3DNMA 1EFPB 4Q1EA 1NMXA 5DM0A 5E6SB 1DMSA 5EWJA 3VX3A 4CNBA 1B0AA 3C45A 1JR4A 5EA2A 3CZCA 2RI0A 2RGCA 5CDFE 4MCJA 2VNHA 3CHYA 2DHCA 3JQBA 5F52A 4OYHA 1UIRA 1V7QA 4Z4EA 4BFYA 1Y8QA 3A2KA 1TFUA 3LT1A 1DZ3A 4BYMA 4XSGA 4A0GA 1EUCA 3I9JA 2Q27A 1KJZA 2PVSA 2ZG6A 3OIWA 2X0EA 4HDCA 1YIOA 2AC7A 1U6IA 3PDWA 2J4FA 4M46A 3C3XA 2R65A 2HLDA 1MQAA 3QVTA 4UZEA 1DHRA 3IX7A 1MVNA 3CXRA 3ZHCA 5C1BA 4WK0B 1DQRA 1FVXA 3LVQE 2YIDA 4O33A 5LQJA 3IHWA 2VOEA 3EXHC 4FYMA 3DCIA 4G85A 1E3LA 1F4VA 4PX3A 3UEOA 5A5VA 2YL2A 3A4LA 4XCQA 4A82A 3UB3A 2P30A 4BX9A 3FYUC 2QAJA 4KXFB 3QJGA 1ZBDA 1MPXA 2NVBA 5SY4A 2I87A 1PT6A 3IULA 2WYHA 3Q40A 4ZIRB 3IP7A 5DMHA 4MIEA 3W5AA 3I52A 3O3NB 4OMUA 4UTPA 1QUEA 1LPMA 1Q0SA 2GJAA 2WIKA 1PVVA 2QRZA 5K0NA 3BTVA 2FWMX 3AKEA 2OEPA 1PS9A 4J76A 3DF7A 4PXSA 1TYCA 1H2WA 4G1CA 3VO9A 3VR6A 2GD6A 3LC2O 4XVUA 5IJ0B 2QG4A 1GGJA 1P1KA 1D2GA 4RFLA 2BMWA 1ZNZA 2WTNA 5AOAA 4DBLE 4HEHA 3F3KA 4GYKA 5ALYA 4F1JA 1JEYA 1UOPA 1DQNA 1P44A 5ICCA 3LPDA 2OLEA 1KJ8A 2WV7A 3BN3A 2VBGA 2HZBA 2NYAA 4YS6A 1AKTA 3P20A 2RGEA 4NPCA 1ZU5A 2FPXA 1T9AA 1NW8A 1SVWA 1WNFA 1FDRA 2G5PA 2F1IA 1XL0A 1LZLA 2N1BA 3SHWA 5CLIA 1P77A 4EPXA 1NQ5A 2HF7A 1C4WA 1W2WB 3EZNA 2PY6A 2WJZB 3HMQA 4E94A 2CLMB 5ERYA 1RRCA 5TS2A 2D7JA 3RNLA 4QJ3A 3GVIA 5LA6F 2FQQA 3ZZNA 4OB7A 4BZZA 1RRVA 4CKXA 2GNPA 4NSNA 2D0IA 3ABRB 5COAA 3RVQA 4R2IA 4BATA 3CVXA 5DGHA 2GO1A 2XF8A 2DFPA 4XUEA 3RJMA 1J9GA 2GJ9A 2Z04A 1JVNA 5HRUA 1RM0A 4MS1B 4J29A 2P6NA 1UMDB 3SYNA 3EB9A 5AK6A 1RCTE 3MQ2A 1HDIA 4R1OA 1CBUA 2E4XA 2YVKA 5E9JA 4DMUB 3LY8A 1Y8RA 3NALA 2OE2A 5JFGA 1NRWA 2JGKA 3W7VA 5BSFA 1VHJA 5E6UA 1S3IA 3N2KB 5EZYF 1FQWA 1N2ZA 4G24A 2IYEA 3H7AA 1SKYE 5FQOA 1M74A 1MC4A 3PXDA 4D98A 3LBNA 3HU1A 3QLVA 2RAPA 3KZMA 4Q19A 5HDQA 4UZSA 1ZW6A 2BISA 2GN4A 3N2ZB 5LZ5A 2VA9A 3O75A 1E5QA 1M7HA 4G23A 1ZUNA 4DA8A 5HCUA 1DBVO 3T4EA 1EM8A 1QUFA 3KXDA 3T9EA 2P11A 3UA3A 5FEUA 3ZY3A 1THMA 1XMIA 5KMGA 3VJMA 4GZLA 4BX0A 3CU5A 4LC0A 4Q48A 4XXHA 3S5UA 4MA4A 4TZTA 3LKZA 2CBXA 3GC6A 5K3CA 1DAHA 1DCFA 1F48A 3MNFA 4U9IS 2NO6A 1OLUB 4NEHB 1MHPA 3H2HA 4ERXA 4EO9A 1E9AA 2R79A 1KJNA 3G1UA 1OF1A 4IHQA 4YV0A 1RADA 4C87A 1D1TA 4FHDA 4E70A 4KRXA 5FTLA 4KQ2A 5J47A 2FUEA 3QTBA 3KE9A 3LXRA 3DHNA 3EXG1 5AFSA 5D5QA 4AY2A 1TYAE 2W6JD 2D7DA 3BB3A 1H9CA 3FM9A 3BWYA 1F20A 3AY6A 3RYFB 1OZAA 1J99A 4M9QA 2JBHA 2Y93A 3I39X 3OD5A 1U2QA 1XCLA 2JHGA 2MSLA 2VK4A 3DZFA 5LQCA 3THYA 3A9VA 3GFQA 4YR7A 2V3CC 5EN4A 2HJHA 1FP2A 4ESOA 4CG1A 5KNBA 3AY7A 3FCEA 2WFAA 1Q0PA 1SRRA 4L3VA 3PPIA 5BN5A 1NBEA 2IL1A 2DFLA 4Q9DA 1XAGA 2QMQA 3C6BA 4P4UA 5IKOA 3VVMA 4BEWA 2X9QA 4EA7A 2IGTA 3JD1A 5JFTA 4HNUA 2BP7B 3NPMA 3GRAA 1VGQA 3GUYA 2HO5A 5KWIA 5L40A 4UXHA 3SWWA 1CJKC 4ZEXA 4RELA 2Q4DA 3VX4A 2FG5A 4PNEA 4G86A 2ZULA 5JCPA 3GIDA 2CF6A 2HZ7A 4C0QC 3G2OA 3RUAA 5FOXA 4RV9A 3SK0A 4B3GA 1NJ1A 3GJ5A 4DN6A 3CURA 1VSVA 3FJ1A 4GGMX 2A94A 3CH4B 3L8FA 4JQYA 4LSWA 3H8SA 3Q41A 5DBIA 2HJRA 4UQOA 4OAOA 4Y9DA 4ZCRA 1RXIA 5FV4A 3DEKA 5IANA 5TEVA 3VZPA 4UNNA 3RS8A 5CXSA 3GFOA 5JALA 2LPMA 2UZAA 3KR2A 4V0KA 2TS1A 1I1HA 1OPXA 3REGA 7ABPA 2HRRA 2J5QA 1DXQA 5I7VA 3KXPA 1EWTA 3NXSA 2XWJI 1Y5MA 4A6PA 2WJYA 3HTXA 1BVUA 4KFRA 4FSDA 3EDYA 1JQLB 4OGFA 1XRJA 1Q20A 3ETNA 3OZ7A 4LHYA 5B58T 7MDHA 1E2UA 4KE6A 1QOQB 4OJQA 1KWGA 2P4SA 3KOYA 3HN7A 4KN6A 2JFZA 4E11A 4R1UA 3G59A 4ZT2A 5HILA 1P1FA 2NSJA 4RD0A 4XCXA 3TK1A 1U7TA 2XKBA 4MQ5A 4RFSA 1Z2DA 2PR7A 3LO5A 5AVOA 4AKSA 2Z9BA 1GV0A 2W48A 4O4IA 3ZI0A 1WP4A 4EUHA 3GEEA 4O29A 2JLSA 3BWXA 1HG1A 3NHYA 2A9KA 2CEKA 5LBIA 4ZEOA 1Z88A 4HKTA 1PQYA 4D8VA 4UVHA 1C7RA 3OCWA 5CVUA 1VL6A 1J5XA 1U9ZA 4PW0A 2W4MA 2E5LB 3U44A 2COUA 4UHHA 1AZWA 1XVLA 3BE6A 1N5RA 4OA5A 3N2YA 2C7RA 4NICA 5AVJA 2CLDX 2KYRA 3O3OB 3P27A 5I5EA 2ZJFA 2DHEA 3RSOA 2NVOA 2OCAA 5DIZA 4DM4A 3DBLB 2H1OA 1PT5A 1QDEA 1TJPB 1IPHA 2J9RA 3IDSA 7ADHA 4M88A 3D43A 1ECGA 1H2RS 1KK1A 2WU8A 3QA3E 2JA1A 4OKSA 4HLNA 4R83A 4QT4A 4QYIA 5DIFA 5FUQA 3BL5A 3CNEA 2CCJA 4BLWA 4PSAA 2OMKA 2XCOA 3TL2A 2CVOA 4MICA 4HEA6 2FWRA 1L7MA 3FGPA 5AI5A 3IELA 2ZCUA 3JQ8A 2J67A 1COWA 2Z2ZA 3HXMA 1GZ7A 4OK6A 1KOJA 5T6MA 4F4DA 5A9RA 1MB0A 2OT3B 4QRIA 1JG4A 2AHOA 4HWTA 3NWOA 4GH5A 4NKRA 3IHLA 4XFKA 1I7SB 1GT6A 1NLZA 1PV4A 3TB6A 3WK6A 4JELA 4D9HA 4TT8A 4YHHB 4INZA 1TA0A 5HIMA 2I65A 1AB5A 2VDKB 2V1XA 1P7ZA 3E9CA 3O82A 3BEOA 1C4XA 3TUJC 3UG7A 1KY2A 4NXMB 1KGSA 3IP6A 4DUGD 2AQKA 3ZDCA 2CLKB 1DBIA 1C3OB 3Q7RA 2J9GA 4TTJA 1PR2A 1GYPA 4N3BA 2CFTA 4CQMB 1ZBQA 1K9SA 1NAHA 3ELBA 4WCVA 4YPVA 3CRZA 1SHZA 4CM5A 1SCUB 2NTNA 1PX0A 3FSGA 1YXMA 3GJ8A 3JV7A 3LCRA 4X8MA 4XWOA 1NN0A 3MWDB 5FNVB 3PNVA 1F5NA 2YHBA 2X42A 3BIWA 4G1EB 2Z98A 3BEDA 4ZTBA 3CX4A 1AM4D 1X7WB 3PGXA 4Q4HA 2G09A 4U3JB 4EB6B 1RQNA 2A1UA 1T8TA 5DKFA 1IY9A 4CL3A 2PO5A 3DHVA 4JBIA 5F5LA 2PGDA 3PD7A 4TYMA 1POXA 5F76A 4ETWA 3TEJA 4Z3KA 4G65A 2WSSD 3KETA 2IYSA 2A3NA 4GBGA 4CCYA 1DEXA 4IIGA 1BMFA 1L7RA 2Y2VA 3U7JA 1I7QB 3TL6A 4BGDA 4OQQA 3FWYA 3MLBA 1ZNXA 2IPMA 1H2FA 4C6TA 4Q93A 2CMGA 2VWQA 3GA5A 5DULA 1BFUA 2QGFA 3KTAA 1IDN1 4CMKA 3DXFA 3RSGA 2ZUUA 2A0UA 1QHHA 3QENA 4HPWA 2FUG6 1OT5A 2ANCA 3AINA 3JYPA 2FEKA 3ZCPA 2IHUA 4AZSA 3C7KA 3EVBA 3F6RA 3PPYA 4RVCA 5KYTA 1CT9A 2RONA 2GARA 4Q6BA 1BCSA 4D42A 5CA0B 4NJEA 3RUPA 4D0SA 5DN6A 5GZ6A 1N5JA 1JHOA 3EF3A 3LNTA 1A7UA 4B81A 2P2ZA 5DCLA 5HS4A 3NBYC 4DCUA 5AQEA 2TMDA 5H83A 3W6NA 3FDFA 3MSXA 3JZDA 4MCHA 5CB0A 5EZ5A 1DTEA 1G5QA 4V0SA 4LWZA 1UJ6A 2JDIA 4LYJA 2XJ9A 4M3NA 4Q6WA 1EX6A 5KTNA 1PFUA 3SYLA 2QDKA 3VZBA 3U40A 3O0DA 1X1CA 3A9TA 5D8DA 1ATIA 1GG8A 2WA2A 2FMXA 3B8EA 3I72A 4INPA 4PLFA 4RHXA 1O6CA 5GWXA 4D6XA 4ENWA 1H05A 4R68A 4R51A 4UXIA 3IHTA 3T3PB 3WJ1A 4BNDB 4C5AA 3D8TA 3DOIA 3OX4A 1AQUA 2C4NA 3IQXA 1P0PA 4NNJA 3VNSA 3SIXA 4I0WB 1KBZA 5FFFA 3BGVA 3FLMA 4B73A 2VTBB 1BQ4A 4OXRA 2PZMA 3AEKA 1A27A 1A2QA 3ANTA 4NV1A 3ZJ4A 1T29A 3M6AA 4DZRA 4ENUA 4GOXA 3G2JA 3MAAC 2VATA 2PXHA 1VJ0A 3W3AD 1C7IA 1CVRA 5KOJA 4RL4A 5CNJA 3J81k 1SKAA 2F6RA 1U3UA 2IXAA 3A1WA 3DVQX 3C1UA 1P6UA 3S4YA 3PTAA 1I80A 4PSDA 1Q3TA 4YBRA 1E58A 4OJYA 4X00A 3G8BA 1XTTA 3EFHA 5JVDA 3NJRA 4ZU1X 4ZVVA 4EG5A 1TB4A 3DAFA 4KQGA 1PUIA 5DLQC 4S12A 1CR0A 4GYYA 521PA 3VKVA 1M2GA 3LUHA 2PKQO 1P4HA 2A35A 2G1KA 4RIIA 4UU7A 1QQBA 4GMGA 1LLUA 3PIDA 5G0VA 1PDWA 1QAQA 5FOTA 4PIMA 4TXNA 3WGZA 2Q5QA 1M33A 2PS0A 2EBUA 3CA8A 4E5DA 4DT1B 1XT6A 2B4YA 3BA1A 3G1TA 2I3AA 1PFVA 1SIOA 2PH1A 3HDJA 5CCEA 5KKNB 4RTLA 3F90A 3DBRB 3FWNA 1YZVA 1NUSA 1NMYA 2D0DA 4AXXA 4I14A 4Q15A 1OZGA 5GJVC 5KTYA 1DO8A 2I66A 3GMTA 1GUBA 2Q46A 1BE1A 1QCYA 3ND8A 4CKWA 1Z4MA 1RHRA </