3KYDA

Human sumo e1~sumo1-amp tetrahedral intermediate mimic
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
321
structure length
301
Chain Sequence
LWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKTTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-activating enzyme subunit 1
publication title Active site remodelling accompanies thioester bond formation in the SUMO E1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 93
structure length 301
sequence length 321
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3kydA00
3QW2A 1KIFA 4RDHA 2EIHA 1ONNA 1XYGA 3ZWNA 2PKRA 1T2FA 4OGWA 4XRGA 4D41A 4ILKA 2HRZA 2C29D 4K6CA 4MIEA 5TNXA 1ZSVA 4FQ8A 1NPYA 4BGIA 1I30A 1FJHA 2PH3A 3RU9A 2B4TO 4U0JA 2VRBA 7MDHA 3AOEA 1ULSA 3JQFC 3H3FA 1W0CA 2ZJ1A 3EK2A 1RYEA 2DBRA 3FF4A 3SX2A 3Q2KA 2VWQA 2AEFA 2O3UA 3ADOA 4Q3EA 1ZJYA 5JS6A 3BIOA 4R51A 4BMSA 4CLHA 1GCUA 3H5RA 1XKQA 3BMNB 4PCVA 4B3IA 4ALNA 2J3IA 3E9MA 3GZNB 3VPSA 4TRNA 4YT8A 2FOIA 2O4UX 3KLPX 3CINA 4XQCA 4FOSA 1QV7A 1PL7A 1VKOA 1YL5A 3FR8A 1DJNA 2NQ8A 3PGJA 4BMVA 3RI3A 2UYYA 1A4IA 4FFRA 1KEVA 4GX5A 4OOFA 5KVCA 4WLEA 4PGFA 2WYUA 4UREA 3PTZA 3LVFO 3E5MA 4ZICA 3PYLA 3PJDA 5I7VA 1C1XB 1NM5A 3VDRA 1LDBA 4Z9FA 3IS3A 1V8BA 4BKUA 1QORA 4WLNA 5IDYA 3UVEA 3PEFA 1M66A 1P1KA 2X0IA 1O9BA 1ISJA 3R6DA 5A5EA 4NMHA 1IZ9A 1ORRA 4JXKA 1CRWG 1HT0A 4J4HA 5ER9A 3UGKA 4CR6A 3GLQA 4R54A 3ITKA 5DNAA 3TZCA 4HV4A 4DWVA 3PHGA 3JD2A 2JFHA 3P2YA 1ISIA 4IJUA 5TS3A 1ZEMA 2PGDA 1W8DA 4BNUA 2C82A 3M6IA 2W90A 3KSUA 4FOOA 1DFGA 1N1EA 1XWFA 3MJ4A 1ONOA 3O38A 3JD0A 5TQVA 1VI2A 4N7RA 4NIMA 4DC1A 1LDMA 4HADA 1B26A 1W73A 3GDFA 2OO5A 4DC0A 1ISMA 4E5YA 3MJEA 4LVCA 1F8FA 1IULA 4XYEA 2ZYGA 2BGKA 1MA0A 4I9UA 4RGBA 2OXIA 5CDUA 4OQYA 2H6EA 3JQCA 2YY7A 1BW9A 3OHSX 5EERA 3GFBA 1PJTA 3TSCA 3VAZA 5LCXA 2YJZA 3CUKA 4LISA 3FPCA 3UH1A 3BHJA 1DFIA 2NV6A 3RKRA 4EITA 4YT5A 4BO9A 4FIZA 2CDCA 2FSVA 2Q4EA 2AEMA 3JQBA 4RVUA 4J7XA 3I23A 1P31A 2A94A 3NUGA 5EN4A 2PD4A 4YT4A 3A06A 4CMGA 4W82A 4AVYA 1IPEA 4WLOA 3DOCA 3RAJA 5K0ZA 3ZNQA 3F47A 3JTMA 1BXGA 3LF2A 2QYSA 3V2UA 4W9NC 2YHUA 4MVJP 1GZ4A 3NKLA 3FTNA 5H81A 1LLQA 4IZIA 2HJSA 2YV1A 3FI9A 2Z1NA 1TT5B 4A03A 5ICSA 4A73A 4K26A 4PIVA 1BG6A 3KYDB 3RBXA 3ONFA 1CYDA 3BYZA 2RH4A 4J1TA 1PZGA 1XA0A 5CEJA 4RF4A 3VPGA 1GL3A 3JD3A 2AE2A 5U4QA 4XR4A 2PZMA 1ZZEA 2X0RA 3M2TA 3QHAA 3V2HA 4BO0A 4CM8B 2YDXA 1TLTA 3HUDA 4BGVA 2W2LD 4R5HA 3C3XA 1YL7A 2X0NA 2VWHA 4YJGA 1HLDA 4DQXA 4PN3A 5GMOA 3TOXA 4RF5A 2DFDA 2HMVA 1Z45A 1YOVB 1A9YA 4XX0A 1KVRA 3CSDA 5CG1A 4YAEA 3H5NA 4ESOA 5CDSA 4UAGA 3OIGA 4Y98A 2JHGA 2FWMX 1ZIDA 5ENVA 2DPGA 4BNJA 4NU5A 4ZA2A 3DBHA 4OKIA 4XEHA 2B69A 4NG5A 1IE3A 4ZQHA 4NBUA 4CM9A 4MO2A 3RC7A 3JQAD 5HRUA 3ZU5A 1HYEA 5L7YA 3RBZA 4EUHA 1ULUA 3IUPA 4IDCA 4Q3AA 3WSWA 4CODB 3B1KA 3OM9A 3I83A 4F6LA 5L4LA 1I3KA 4YEDA 4B4WA 2JHFA 3GNSA 4GVXA 3MJCA 1E3LA 2PKQO 1OI7A 4OKNA 4BGEA 1NAHA 3ABIA 1TVEA 3BXXA 3GQVA 3S2GA 2CF6A 1XCBA 1RYDA 3IIEA 1V0JA 2ZCUA 2HRBA 2Z5LA 3AFMA 4GI2A 4IJWA 1IY8A 3BMOB 1UDBA 5BSHA 1OMOA 3DMTC 2NU8A 4UUMA 5CAEA 2WYVA 3Q3CA 4D3SA 1F0YA 1JDJA 2Q45A 5DDIP 2PFGA 2D4AA 2NU9A 4FR5A 1QXSA 4IUYA 4XGNA 1K6IA 1DRUA 3IJRA 4PRKA 3GUYA 3QQPA 4B4UA 3WMXA 1T24A 3ICCA 2ZTMA 1EDZA 3C85A 1E1MA 2BRUA 2D8AA 3L4BC 4FJ1A 3GH3A 3EDMA 4JK3A 3M1LA 2UDPA 4H15A 2PGLA 1NBOA 3DZFA 5B1YA 5IDWA 3AY3A 5L51A 3QWHA 2SCUA 3PYMA 3GMDA 3E1KA 3H65A 4GKBA 2VYNA 3WGGA 4DVJA 1J6UA 4XDYA 3IMFA 2X4GA 5DOZA 1WNTA 5I7SA 3COSA 4QT0A 1CERA 4ZQFA 1T26A 3FNEA 5JE8A 4AICA 2X9VA 4IMRA 1ZH8A 3DDNA 3NT4A 5GZ3A 4PLTA 3WQSB 3I9KA 4YWJA 4GQAA 5G4KB 4O5OA 4AJ1A 1RJWA 3PHHA 4OXYA 1HSZA 3JQEA 2G82A 2W2KB 3DBVO 4FFLA 2HO5A 3PI7A 4FDAA 3K96A 1U5AA 4DREA 1BSVA 1SNYA 2CMDA 3VZPA 1WZEA 4E5PA 4D44A 4XB1A 4HNHA 1GUYA 4YA6A 3DBRB 2BFOA 2DT5A 2OORA 3DXFA 2HSDA 1OAAA 3DR3A 4E33A 4E21A 2J5RA 1ZBQA 4JQCA 5A5FA 4NBWA 2ZYDA 2B5VA 1DIAA 5T8KA 1I2ZA 1UDAA 1ZO8A 3DTYA 4YTEA 5BNTA 1C0KA 4YAJA 3B1JA 3ZW8A 2VWPA 3Q1LA 5L7WA 5KIAA 3HQ4O 3AUSA 3JQ6A 1MB4A 2YFQA 4QO8A 1ZNQO 4JBIA 4TZKA 1YXMA 4Q3BA 5DZSA 1GUZA 2VYVA 1NASA 4LMRA 4CM4A 1SB8A 4L9RA 3WFIA 4GWGA 4R69A 2ZQYA 4LCEA 1VLLA 1I32A 2EWMA 3IOYA 3C8MA 3K5PA 3CEAA 4JP2A 4NFSA 3D3WA 3W4KA 1DB3A 1QYCA 1YB1A 4HY3A 3PJFA 2P91A 2IEDA 3RC2A 2DVMA 3PWKA 4MJLA 4FC7A 1LX6A 3K92A 2I6TA 2ZIZA 3SLKA 4RL6A 4WCFA 3OJEA 3RBVA 5A06A 3ANMA 4IY1A 4AL4A 5JDCA 1HRDA 3GEGA 2CVQA 3BHMA 3RU7A 1LJ8A 1ZMTA 1A4UA 2NVBA 3C24A 4IDAA 3LT2A 5I9MA 4CMIB 1G1AA 3QJ5A 2JAHA 3GEDA 2FRDA 5KJ6A 3ANNA 3E18A 2Q1UA 3Q11A 4YXFA 1JVSA 3F4LA 4N54A 2B0JA 2HMWA 2ZTVA 3WJAA 4JCOA 3DBLA 4QEDA 4ZRNA 4EW6A 1FDWA 1BGVA 1U4OA 2H63A 3E9QA 3ZV3A 3OETA 1PJQA 4LW8A 3RC1A 5EESA 2ZYAA 3WQRA 4AJ4A 3LT4A 4TVBA 3VOSA 4E5NA 1IUKA 4NPCA 2NACA 2D5AA 4CLOA 4BO4A 4I9NA 3UFXA 3UCEA 1KEPA 1GYPA 4PG8A 2AQIA 1B7GO 4XKJA 2G76A 4YQZA 3U5TA 2J5QA 4IPTA 3WGYA 2X23A 4DMLA 2WDZA 1PIWA 3M1AA 1NQ5A 3TFOA 4CQMD 1T2EA 1UP6A 2X9NA 3UCXA 1O0SA 4R9SA 3KM0A 4NK5A 3O03A 3DB2A 3HB5X 3OJFA 1E3WA 1MP0A 2BELA 4WASA 4UVDA 4MVJG 3DL2A 1UUFA 1HETA 1ID1A 3HDJA 5DT9A 1I10A 5EQDA 3U4DA 4DYDA 2JFFA 2HJRA 3FHLA 1GEGA 1LQTA 4DXHA 1O95A 1EVZA 1GAEO 1SEVA 3U4IA 5JDIC 5IZCC 4HFNA 3ZV4A 3OEWA 2ZQZA 4WJZA 1RPNA 3ASUA 4MVJM 3IKVA 1UH5A 1DSSG 1KBZA 4WLVA 2Z1MA 3RFTA 1AHIA 1XLTA 2PLAA 2OMEA 1UZMA 3D3EA 4KTTE 4OOEA 4YACA 1JKFA 3X2EA 3R0IA 3OA0A 5LDHA 3QE3A 1MV8A 3BHIA 2E82A 4EEZA 1J4AA 1OZAA 4RQUA 1FDUA 2Y0CA 5CPBA 1C1DB 3IJPA 3W1VA 2X9GA 3I9NA 4W4TA 3WGHA 4XYLA 3V1YA 2DQ4A 3H8VA 1Q0LA 3AJRA 3HHPA 4IXTA 1ONPA 3P19A 1AHHA 1FF9A 4ZD6A 2IEBA 5JCJA 2HU2A 2NM0A 3LC7O 4BKQA 1HTBA 1YJ8A 4JN6B 3LT0A 3SXPA 2VHWA 3RCBA 1G0OA 3ENKA 3GOHA 1B3RA 2I9PA 5HS4A 1GV0A 3RUCA 2FHSA 3JD1A 2NLOA 1E7WA 1XQ1A 4B7UA 2PY6A 3OIFA 1B15A 1F17A 1GPDG 3LSYA 1NPTO 1EE2A 3MTGA 4B8WA 1E0DA 2DBZA 1JAYA 3ZWWA 3TNLA 1HEUA 4OQZA 1PL6A 1WLYA 1EVIA 2X1HA 1P1JA 3TZQA 1HZJA 2VZ9A 5J23A 4I5GA 3INTA 4AJIA 4Q39A 3E5RA 4FB5A 2GYYA 4RVFA 4E2YA 3FD8A 2POQX 4L75A 1E7QA 4BGUA 4CLRA 3VKUA 1MXHA 2PZJA 1ZMOA 1NFFA 2BH9A 3PWZA 3QP9A 4E2ZA 3VZRA 1B8PA 1W4ZA 1YBVA 1DC4A 2CNBA 1KYQA 1NQAO 1PEDA 3F4BA 3I6IA 3JQ8B 4WEQA 1RM0A 3N7UA 3PRJA 2B35A 1BW9B 4P8RA 1D1SA 1MG0A 1NYTA 4BO8A 4TZTA 1Q2XA 4EI2A 4BOYA 2E49A 4AJJA 1LDNA 1LU9A 2EEZA 1DDOA 1PTJA 2BI7A 3KV3O 3ZDFA 4J1QA 1VL0A 5L45A 1R0SA 1PZFA 2P4QA 3WDSA 2O48X 3AUAA 5A3JA 1CF2O 1P45A 5L40A 3GVHA 3TWOA 3F46A 2HK8A 5I7FA 4IS3A 1E3EA 4PLZA 3TJRA 1WWKA 3JYLA 4RVHA 5DP1A 2GF2A 3NYWA 1JVBA 4IMPA 1SAYA 2VHZA 4NI5A 3QVTA 5A9TA 4BO7A 4DBZA 4KUHA 2DAPA 4ZRMA 1WZIA 2B4RO 4ALKA 2P68A 4GAEA 2GCGA 3PJGA 2Q4BA 4E13A 4BV9A 1E6UA 4PLYA 3H6KA 5CDGA 4ZHSA 2D59A 1VSVA 1HZZA 4BO5A 1HE2A 3MZ0A 4I9HA 1HDOA 4A27A 2O3TA 4RZIA 4YVFA 4CLXA 5L95A 2IYOA 2HLPA 2PR2A 2TMGA 4B7CA 5JAIA 1CQJA 2QYTA 4WNIA 4BQRA 1ZKMA 1JWBB 4YRBA 1LBEA 5JO0A 5BT9A 3DHNA 3DAFA 1C14A 4P4LA 3BZUA 1K2WA 1ZCJA 1GDHA 3ZGYA 2WYWA 1XELA 1DEHA 2WSBA 4PFJA 5COQA 3OP4A 3QVXA 4YBZA 3AK4A 2QQ5A 5C3MA 1EFLA 1O94A 1TA4A 3GAZA 2DC1A 4PLVA 5L3ZA 4XQGA 1H93A 4IJVA 2BFPA 2PA3A 3TL2A 3GAFA 4Z3DA 3EZYA 1I36A 3LLVA 5TRTA 1HF3A 3M2PA 3RFVA 1Q0HA 2XXBA 1GD1O 4CR8A 3DZGA 2ZATA 3U9LA 4DLAA 4YR9A 4IDEA 3QWFA 5DBGA 4TRJA 4ZU3A 2JD2A 4D3FA 1R66A 4RDIA 3UHAA 1GUFA 1K0UA 3AI1A 1DRVA 4M1QA 4WGGA 4E5KA 5JFOA 4UEJA 1X14A 4GH5A 2I67A 3OJ0A 2IYPA 1N2SA 4NH4A 1RKXA 2PK3A 5AXBA 4AJPA 1YJQA 3WS7A 2BD0A 4M89A 4ND2A 2VRCD 4I5FA 2TMDA 1YDEA 3BMQB 1WW8A 1E1KA 4PLFA 1VM6A 4JBGA 4WOKA 2P4HX 5KNLA 5FEUA 4YJHB 1A27A 2ZB4A 1NHGA 2YQ4A 2OOSA 5G0VA 1GZ3A 1X7DA 3E6AA 3QWAA 4IDFA 3I9OA 3VH4A 4IDGA 1GEEA 3EHEA 2R00A 1IL0A 4D42A 5DBFA 4NFYA 2VCYA 3C7DB 2BHLA 2UUOA 5G0SA 1H9BA 2PV7A 1LSOA 4S3MA 1U9JA 3L6DA 4NHEA 1MUUA 1I3MA 3UXYA 1IOLA 4H16A 4MINA 3ZWYA 4W6ZA 1SBYA 3H3JA 5DBIA 3ADPA 1N8KA 4GX0A 2HMUA 4U0KA 1NPDA 1NFQA 2XAAA 1EUCA 1HDZA 2V6GA 5FYDA 2EG9A 5FI3A 4TWRA 2AXQA 4MOWA 3NTRA 1I2BA 2F00A 3HSKA 5EL0A 1TEHA 3AY7A 4R5MA 1R6DA 2EP5A 1YQXA 4A26A 2EKQA 3GUCA 2WEKA 1PS0A 5DCUA 1JWAB 3HFGA 2VTEA 2Q46A 3VPFA 3DZIA 2QRKA 2J6IA 3PZRA 2IZZA 1PQWA 2X5OA 3JQ7A 4MP6A 4OSPA 3RUDA 4Z3KA 4NDNE 1BTOA 4LMPA 4CMKA 5K9ZA 3JQ9C 3RJ9A 2QHXA 3H4VA 5F21A 1A7AA 4O0LA 1LRJA 4C7JA 3TPCA 4B3HA 3JQGA 3N74A 5TGDA 3ZHXA 4P22A 4FS3A 2IXAA 1ZK3A 3PPIA 4CMJA 4XWYA 3HADA 4QTZA 1ISFA 4R41A 3WLEA 4XYBA 3IKTA 2EF1A 1QMGA 3OA2A 1S6YA 4JJGA 5KJFA 4FGWA 4P4GA 1PQPA 4J16A 4CV1A 1U8FO 3ZH2A 2AG5A 3ZWAA 3PLRA 4IS2A 5JY6A 3LK7A 2Q50A 4CMCA 4P4NA 4QQRA 1R37A 2HMSA 3K2BA 3RWBA 1Z7BA 2J3JA 5CEEA 2C07A 3BAZA 1AN9A 2Q1SA 3A9WA 5C7LO 1ZSYA 1PJBA 4O63O 5G0WA 3A1NA 5A1TA 5BSGA 3JD4A 5LDGA 4OMUA 3UOGA 5HWSA 3LC2O 1ZUD1 1W6UA 1LQUA 4XZ3A 1NVGA 3NTOA 4MKRA 1UP7A 3L6OO 1YS4A 3D3WB 2VHVA 4XD2A 4BUCA 4O6VA 5JC1A 4HFJA 2Y1DA 5K6AC 1UZLA 3UF0A 3WIDA 3GVXA 2Y1OA 4WE3A 3K31A 4WCFB 3ORFA 5EJ2A 5BSEA 1B14A 1E77A 4PG7A 3P5SA 4WLUA 2DTXA 5IDXA 3FCOA 4NR0A 2VHYA 1CJCA 5KJ1A 4XCVA 3VZSA 2A35A 4B4OA 1QV6A 3NJ4A 4GMFA 3UUWA 3S1LA 4RLHA 5TT1A 5CEFA 1EFKA 3OJOA 1KEWA 4AJNA 2RHCA 1P0FA 4BNXA 1KC1A 1KERA 2AG8A 3EVTA 4PG4A 3DBLB 4Z6KA 2AQ8A 3I9MA 3SLGA 4DPKA 4GPD1 4E12A 1JQBA 3WX0A 2BLLA 3PHIA 5KWEA 5AVOA 4XQ9A 3WWZA 4DIFA 1PZEA 1M67A 1VKNA 3RFXA 2P2SA 1IPFA 1XU9A 3ST7A 1KY5A 3EUWA 5G0UA 4E6PA 3LT1A 3DEYX 4PVDA 3LDHA 4WEOA 4WOJA 3RSHA 4JLWA 2Q2WA 3KEOA 3NGXA 1TXGA 1VJ0A 2Q99A 1U7HA 1U1IA 5AOVA 2VN8A 1L7DA 4YPOA 1IYZA 1ML3A 4NJMA 2VHXA 3D4PA 4TROA 3WSVA 5KJCA 1WP4A 2DLDA 2Y1CA 3I6QA 1I24A 3KO8A 1ZK2A 1PQUA 4PLGA 1DC3A 1GY8A 4YRDA 3WYBA 1B8VA 3FNFA 3PHLA 4ALMA 4BNLA 3D0OA 2NWQA 5A02A 1DHTA 1PWZA 3D5TA 3GZ4A 3FWNA 1RM4A 3KRTA 4E31A 1G6KA 3S55A 3RUFA 2CFCA 3RQSA 3BMCB 3NDJA 4KMSA 3NTQA 4BNTA 1JAXA 1X13A 4Z0PA 4AJKA 4ND1A 1MC5A 4M87A 3VH1A 2RCYA 1E92A 3AOEC 2VQ3A 2BFMA 4XYMA 1U28A 2YV2A 3ZHYA 2AQKA 3PFFA 4YJDA 2CSUA 4X54A 1LDYA 2HK9A 3CE6A 3CMCO 2R2GA 4MP3A 1BXZA 3G3EA 3RVDA 3NDIA 1GCOA 4NBRA 3DOJA 3E48A 2O3QA 4MVJF 2DKNA 3GVCA 2J3HA 4BKRA 2C2YA 3WJ7A 3ANLA 3HE3A 3KBOA 4N5NA 5DN9A 3ETGA 3Q9NA 2VT3A 1OOEA 4NBTA 3GG2A 4RF2A 4EDFA 1JKIA 1NFRA 1O5IA 4O1MA 3FN4A 1PJSA 2DUUA 3DC2A 2ILTA 1V35A 1PJ3A 2FR8A 3EY4A 3KSZO 3AU8A 3HDYA 1JA9A 3QLJA 4MKZA 5TJHA 5C37A 3PFWO 3F5QA 1WAMA 4CV3A 1ENOA 2PKQP 2HUNA 1V6AA 4GBJA 3H9QA 4RPHA 3RUIA 3BTVA 3TZHA 2O23A 2WWRA 3AUTA 1AXGA 3L6EA 1EQUA 5F1PA 1N7HA 3MTJA 4F46A 2H1SA 4BKPA 2ZB8A 4EJ0A 1BXKA 3S2FA 3GGGA 1KVTA 1I8TA 4PZCA 3B70A 1TI7A 1BVUA 1Q1NA 5ER6A 1LC0A 1R4NA 4YJFB 1LDGA 1NAIA 3GMSA 4XRRA 5EMHA 4BO6A 3H2SA 1DIGA 4OIMA 1UXIA 5G2OA 3FBGA 1CETA 5JAMA 1HXHA 3I52A 4GGOA 4ITUA 3GDOA 3AM4A 3INGA 2PZKA 2O2YA 4D7AA 1E7YA 4XJSA 2Z95A 2W2LA 1BVRA 2FMUA 4K6FA 4L4XA 2C5AA 4ALLA 4BNKA 4FJ0A 1T4DA 3TZKA 1ZVMA 4CLRB 4DIOA 3ZWMA 3ZN2A 1T2DA 1TT7A 3A4VA 3DONA 3D7LA 4EUFA 4OH1A 4XJTA 2P9EA 1IZ0A 4KUGA 4KWIA 4B3JA 3UCFA 2VNSA 1ADCA 1Q7GA 2B4QA 2OZPA 3DTTA 4F45A 1LLUA 1UXKA 4QFCA 1YDWA 2ZK7A 2PZLA 3RKUA 3S8MA 1QYXA 5HBRA 1ENZA 4KOAA 3ZW9A 3ON5A 1A72A 1GFSA 4CQLB 5HS6A 1NQTA 2W98A 1Y8QA 3JQAA 3JQBC 4CM7A 3SC6A 1M6HA 1EZ4A 4IIVA 1YGYA 3OMLA 4BNZA 2IXBA 1Z73A 4BVAA 9LDTA 3GPDG 3OEYA 4CJXA 3F3SA 4QO7A 3KVOA 5A9SB 4CLEA 3JYPA 1LSUA 2O4CA 1BRMA 4TQGA 3ROQA 4HXYA 1NR7A 1EK5A 5I9NA 2GN9A 3WTCA 5ADHA 1D4FA 2D0IA 1ZK0A 1PS9A 3K9QO 3C7AA 4TKLA 4ZQBA 4BNYA 1K6XA 4AG3A 3H7AA 1U8XX 2D1YA 4HWKA 2DFVA 1VPDA 4BB5A 4DL9A 2J3KA 4BKOA 1VE9A 3RROA 1GQQA 2YW9A 3KYBA 4D43A 5F5LA 3QVWA 1UXHA 2V6FA 2XXJA 3WTBA 1CQIA 1GPJA 2IE0A 4ALIA 5TT0A 4IXWA 1L1FA 3IQDB 1P3DA 5H83A 3Q0EA 1C3VA 3PJEA 3OICA 4BMNA 1GR0A 2G0TA 3AM5A 3ZV5A 2HCTA 1PX0A 3W8EA 3E82A 1N1GA 2CY0A 2X6TA 4FFOA 4KUEA 4XIJA 2H5LA 3EW7A 1T2CA 1QP8A 4J2HA 4Z0TA 3W6ZA 1SB9A 3X2FA 2EP7A 3HN2A 1NVTA 1R16A 4H3VA 1Y8RA 3V2GA 1EVJA 4F6CA 4UEKA 3TOZA 1FK8A 1EVYA 4MVJH 1T25A 4L8VA 5KOIA 1AXEA 3QVOA 1U2DA 2DTEA 1EBFA 2Y0DA 3HJAA 4W7IA 2CF5A 5FFFA 1VL8A 1PL8A 2RAFA 1NNUA 3T7CA 3FBTA 3QRWA 2OBNA 2O7SA 4YAGA 3EVNA 5CG2A 3VKVA 5EIOA 3VTZA 2NVUB 4Y6RA 3GN2A 4ONEA 3OF2A 3KXDA 1F14A 1SO8A 3EZLA 4E4YA 1VL6A 1XIVA 2UAGA 4WNCA 2VT2A 4Z9XA 4CMEA 3OQ1A 1FDSA 4RVGA 1ZXLA 1QYVA 1GU7A 1TT5A 3RJ5A 1HDGO 4CM5A 4CL8A 5IDQA 5EQFA 2I65A 1DOHA 3AFNA 1L7EA 4TRMA 4I8XA 3U4CA 1XGKA 1NWHA 2C7VA 3ZHBA 4E5MA 4D0SA 4GLLA 5TSDA 2RHRA 4PRLA 3VPXA 4J7CA 4W99A 1DIBA 1I3LA 2C20A 1H6CA 3MJSA 2Q3EA 2UVDA 3G1UA 2B83A 2FR1A 5LC1A 2BKAA 2ZKLA 3F9IA 3D5QA 2GN8A 2WMDA 1SPXA 4JGBA 3MWDB 4N5LA 4RVDA 4ROSA 1ENYA 4EZBA 4ZVVA 1PJLA 2EW8A 4FFNA 1X0VA 3L0DA 3ZNPA 4B7XA 5JNLA 3U4HA 2I3GA 9LDBA 4L76A 1SOVA 2GZ2A 2NTNA 1ZJZA 5T64A 3ZWVA 1LTHR 4J4BA 1WDMA 3H5AA 1NQOA 3AI3A 1I33A 3TFQA 4DGSA 2WTBA 3SVTA 3HDHA 3ZNOA 3MJVA 2AA3A 2VNAA 4BIIA 3DZKA 1DC5A 1VRWA 3OH8A 1YH3A 5KTKA 1H2HA 2NTVA 2OHXA 1PGPA 3RIHA 3MWEB 1H2BA 3P7MA 4ZQEA 4J9UE 1H6DA 3KEQA 3V1UA 1DLJA 3VDQA 3U09A 2DUWA 2NQTA 1DC6A 3NRCA 1B16A 5JBIA 4BV8A 1WVGA 1P1HA 3JQ7B 4JBHA 3WMWA 3O8QA 3BTSA 4R1SA 4KDFA 1YQGA 1R12A 3DMYA 1QLJA 1XG5A 2WE8A 4Q9NA 2WD8A 2B5WA 4I1IA 1YB5A 2ET6A 3JQGB 1V3UA 1AUPA 1Y7TA 4FCCA 2A92A 5IN4A 3TL3A 2YHIA 2GSDA 5T8KC 4J0FA 4LRTB 4RF3A 1JKJA 2EW2A 3ZU4A 4NU6A 2CVZA 3GGPA 1H5QA 2P5UA 3JQFA 1T2AA 3ONDA 4HX5A 5ES3A 4YYZA 4JJFA 1X0XA 3EGOA 3GG9A 1NWCA 3EAGA 1E5QA 4G65A 2V65A 1OFGA 3TQHA 1E6WA 1R15A 2AHRA 3CPSA 3H2ZA 4CQMA 3PDJA 3GVPA 4K28A 4G5HA 2X8LA 3PK0A 2YFHA 5KVSA 2FR0A 3RD5A 1A71A 1HDRA 2C0CA 4FD3A 3JCZA 2OBYA 2HKIA 4PLWA 1EMDA 1DRWA 1BHSA 4XR9A 2V7PA 4GGPA 5AXDA 3FRJA 2Y1FA 1GV1A 2IDZA 2RH8A 4PZDA 3AUUA 2VOJA 4WCFC 2X58A 5H82A 4J43A 5JDCC 2Y0EA 1HKUA 4FPXA 2IZ1A 4LRSB 2W8ZA 3GRKA 3KYCA 4E30A 4CMAA 4TSKA 3VZQA 3K8ZA 3OQ6A 3DZHA 4BS9A 1H94A 4BO3A 4YRAA 1BXGB 1EE9A 2OUIA 2RBEA 2E6UX 4TKMA 3GRPA 3UICA 4E0BA 4XB2A 2JCVA 4MPDA 4NFHA 1O6ZA 4U6SA 2DPHA 1YBAA 4LVUA 4Q3DA 1F06A 3HNPA 4R3NA 3MOGA 4R9RA 2EHDA 2H9IA 1PGJA 4ND4A 4A2CA 5L4NA 3VH2A 1PJCA 4XA8A 2VWGA 1MLDA 4P38A 3GDGA 3C1TA 4KQWA 3V8BA 4D79A 4TMFA 4FBGA 4PG5A 4FGSA 1E7MA 4BHTA 4DRYA 2Q2QA 3FTPA 3PLNA 5EINA 3WNQA 1BMDA 1ZSNA 4ZQGA 3FSRA 3ZHZA 1QKIA 4GLOA 5B4UA 4YJGB 1Z7EA 2GGSA 3D1LA 3PIDA 4GX1A 1TB4A 5AYVA 3B6ZA 3MOIA 4IIUA 2HQ1A 1MXFA 1HDCA 5IF3A 2I5PO 1QYDA 4PVCA 3I4FA 1LLDA 2QX7A 2Y1EA 1PS8A 1VJ1A 1KS9A 5DCYA 4BO2A 1NVMB 2WM3A 3A14A 1Y9AA 3E03A 4PLHA 5TJ9A 4AJOA 4BO1A 4DQVA 3KUXA 4CLDA 5AXAA 1LC3A 2EXXA 5HM8A 1DHRA 5JCXA 3DBHB 2GASA 4URFA 1T1SA 4UVIA 1B3BA 1ADBA 1UZNA 1U7TA 1EUDA 3S2EA 4W9NA 3HWRA 3ETEA 3NDRA 2WD7A 2IRWA 1LRLA 4S1VA 4J1NA 1XDWA 4KTVE 1K5HA 3VVBA 3HG7A 5IXSA 5TIIA 5IG2A 3UW3A 4DPLA 3H9JA 2I3AA 4MKXA 1DAPA 3WR5A 1U3VA 3CH6A 1RM3A 1ZK4A 3B1FA 3JQDA 2WE7A 3EMKA 3PZBA 2C5EA 2X5KO 2WJPA 3CZRA 2BGLA 2AMFA 1ISGA 1OC4A 1JN0A 1DJQA 1ADGA 2V6MA 2E4AA 2QIOA 4L74A 4G2NA 5L9AA 3WGZA 3GGOA 4R16A 3GA0A 1LRKA 1ARZA 1U5CA 1ZK1A 3W8FA 3RUEA 3KOUA 5GZ6A 4RPLA 4K9DA 1C0PA 1U3WA 4MDHA 4QSMA 4A7PA 5JC8A 3DZJA 2E48A 1GZ6A 5T67A 6LDHA 3ENNA 6ADHA 3OBBA 1R4NB 1CWUA 3C1AA 4DBVO 4KWHA 2C2XA 1T1RA 2Q2VA 3GHHA 4E3ZA 1LXCA 3DZBA 3GK3A 2GN6A 5KJEA 1U3UA 4MVJD 1E3IA 1HDYA 1U3TA 3Q6IA 1FMCA 2O3SA 4DUPA 1Q7CA 3DQPA 3ETDA 4LN1A 3NX4A 5CP8A 4BNIA 2BGMA 2C54A 4FC6A 1ZXBA 3INRA 3DAGA 1DPGA 4D0RA 4QECA 2ZB3A 1X1EA 4OHUA 4UUPA 1V9LA 1I5RA 4UULA 1P44A 1VJTA 3WGTA 1CEQA 1BWSA 2ZCVA 4OO3A 2O3JA 1XU7A 1DFHA 3GFGA 2Y93A 1C1DA 1KY4A 3H9EO 4M49A 3NT5A 1ISHA 1NX6A 3NV9A 4NZ9A 3TZ6A 3DMTA 3ZU3A 3G0OA 3PIIA 2B36A 4IGFA 2NNLD 4R4JA 3WFJA 4OAQA 3LZ6A 1ZW1A 3FNGA 1Z74A 5JYDA 2JD0A 4J49A 3KHUA 2EJVA 4IINA 5A04A 2GO1A 4RPKA 5B37A 1SCUA 4IGEA 4K1LA 4RPJA 3JQAB 1Y8QB 3ROKA 4II3A 3L4BA 5ILGA 2G17A 4WUVA 3PVZA 2EV9A 2P9CA 4RV9A 3IAHA 5L53A 4QUKA 1N9GA 3OQBA 2XPCA 4NJOA 4N18A 1YKFA 3CXRA 5T5QA 1SC6A 4FW8A 3LLSA 4C4OA 4CM4B 4YT2A 1BDMA 1PR9A 4LSMA 4CM6A 1SMKA 3ZCXA 3K2EA 3RC9A 1R4MA 5G4LA 1LNQA 4BB6A 2VRCA 1QG6A 3D64A 5KCZA 1UXGA 2GN4A 1DLIA 4NBVA 5AQ1A 4LGVA 4PZEA 1YVEI 3AW9A 4CM9D 1E3JA 3L9WA 3KZVA 3O9ZA 4RCVA 4WCDA 5COBA 3HN7A 4XGIA 3W4JA 1KVQA 2CD9A 1UXJA 4CMHA 2OP1A 4CM3A 5TLSA 1QLHA 4RO0A 3Q2IA 2AEJA 2YUTA 5FWNA 3K6JA 2BF7A 3JQ8A 3DHYA 1N92A 1Y8RB 4ZGWA 3ZV6A 5JSFA 1R0KA 3G17A 1HLPA 1UJMA 1QYWA 2IZ0A 1H9AA 3B20A 3AOGA 4MVJA 3D4NA 2IODA 1Y1PA 5JAQA 4YQYA 5T6BA 4HFRA 3CKYA 4Q3NA 4ND3A 3ROMA 3WNVA 4U5QA 1NR1A 1M75A 3TRIA 5BSFA 3WBFA 4BNVA 4BQPA 1EBUA 3SJ7A 1AGNA 4CLOB 5KVVA 4IM7A 3QV1A 3PXXA 4UUOA 4N5MA 2X7HA 3AI2A 2QRJA 4A5OA 2HMTA 3TF5A 3VPHA 3LF1A 3ZNNA 2FPIA 4Y9DA 5JAZA 4EJ6A 2RIRA 3FWZA 4HKTA 1XQ6A 1LSSA 2HAEA 3CMMA 2FZWA 2VYND 4MIYA 3SEFA 5KVQA 3JV7A 2GNAA 1E3WB 4JX8A 5C5IA 1B8UA 3F6YA 1LDEA 1PGQA 4H7PA 4J0EA 4YDRA 1GQYA 3ZZNA 1PGOA 4CL3A 2VTDA 4DTIA 3FPLA 4J7UA 2DTDA 2GERA 1PR3A 4R1TA 3D4OA 1E1NA 5FF9A 2VUSA 3IP1A 2R00C 4GKVA 4Z0HO 2QZZA 2OP0A 5B4VA 3HB4X 1MGOA 4HP8A 3GR6A 4J4TA 4I08A 1D1TA 3DAPA 3JSAA 4G81A 1WMAA 3BTOA 2HDHA 4ND5A 4XQEA 4MVJI 2PD6A 1U2GA 3F1KA 3GHYA 3VVCA 2A4KA 1H6AA 3MEQA 5TX7A 3JYQA 4MVJE 1FDTA 2NUAA 1HL3A 1I3NA 2XOXA 3PQEA 3V5NA 3IUSA 4DMMA 2VZ8A 4EYEA 3WICA 1IB6A 4AJHA 3WOHA 5IN5A 1NXQA 3UKOA 1P9LA 3NEPX 5C7OO 3L07A 1CDOA 1OBFO 1VC2A 1Z6ZA 5GZ1A 1YBMA 4XIYA 4J2OA 4WKGA 4J9VA 2VYVD 3A28A 4Y6PA 5MGBA 1D7OA 1GQ2A 5F3RA 2OFPA 1QRRA 3OFSA 2NVWA 3KSDO 4WLFA 1DIRA 4KDEA 3S2IA 1WXDA 1MC4A 1Y5RA 3F1LA 3O8QB 4GL4A 5HA5A 2QW8A 3QY9A 4D46A 4HFMA 2GR9A 3BMQA 4EEXA 1PWXA 3WYCA 2ZB7A 4YJHA 3LYLA 2HK7A 3GF4A 2Y66A 4B4VA 5BNIA 1O89A 2Y67A 1P1RA 2YHIB 4B79A 5THKA 3IDSA 3KETA 3FR7A 1GADO 3U3XA 4YAIA 3RASA 5IZCA 5JDIA 4DPMA 1IHYA 2PH5A 2XF8A 4YB8A 1DXYA 5DF1A 1PJ2A 3W6UA 2JKVA 1E7RA 2EKLA 3MJTA 4L4RA 4R01A 5DOVA 1MFZA 2DBVO 5BR7A 5G0TA 2QG4A 4FFMA 3BMNA 4BNMA 3ASVA 3VHRA 4CQMB 3IC5A 5B4TA 2P5YA 3GZNA 1YWGO 8ADHA 1JLLA 4GWKA 4ZJUA 1I2CA 3I3OA 4GSKA 4GX2A 2FP4A 3ZWCA 1NTOA 3LU1A 1E3SA 5BNFA 3ULKA 1KEUA 1E7SA 5ITWA 1WMBA 2JCYA 4F3YA 3NGLA 4DLLA 4CV2A 1U4SA 5ICMA 3E8XA 5A03A 1N7GA 3GN1A 3P2OA 3KYCB 3LQFA 1YB4A 4CPDA 5L4SA 1C1XA 8LDHA 3DFUA 2I99A 3G1TA 1DIHA 4JP3A 3UAGA 4IQ0A 2C59A 1PZHA 1GYRA 2Q1TA 3H9GA 3RUHA 3W8DA 1YE3A 1Y5MA 2VUTA 1PU2A 2P9GA 2BFAA 2NADA 3Q9UA 4BNGA 5ENDA 4BNFA 1YO6A 3QWIA 3E9NA 1HYGA 3W4IA 3OECA 4LCJA 1WDLA 4II2A 3WG9A 1KVSA 2YDYA 2GLXA 2X0JA 2JAPA 3IP3A 4DIBA 1F8GA 2JCXA 3GT0A 1E5LA 3CZMA 2NSDA 4AJ2A 2Q1WA 1LUAA 1ADFA 4XGKA 3I9LA 3U62A 1B0AA 4NK4A 1HE3A 2NU6A 2ZTLA 3VC7A 2QRLA 2X5JO 2PNFA 3QIVA 1F12A 4M54A 2GDZA 3JYNA 4D3DA 4WECA 4RPGA 5JPIA 5TC4A 2GZ1A 3WGOA 1FXSA 1FDVA 1C0IA 2EGHA 4A10A 4IBOA 2JFGA 2O50A 2VOEA 2FY8A 4QXMA 2ZTUA 5FI5A 2YZ7A 1HWYA 4QX6A 3WLFA 2AW5A 4EGFA 4XDZA 4NQZA 5F1OA 4CUZA 2A9FA 4A0SA 3PDUA 4NNJA 4EJMA 1M2WA 3BTUA 3ZWPA 2CUKA 3KLMX 4FJ2A 3U0BA 1UDCA 5JCJD 4B8ZA 4LSWA 1RWBA 2AE1A 2W4QA 4Y8VA 1P1FA 1PJ4A 3ZWXA 3AM3A 4UVEA 1AE1A 4RVSA 2I66A 4TRRA 1ZFNA 2WD7B 3C7CB 1DO8A 1M6WA 4U6QA 5I9LA 2ZJ0A 1KC3A 4JROA 1LI4A 4W7HA 2YQ5A 1YQDA 2GUGA 4M55A 1I0ZA 4RQTA 4YCAA 5JLAA 3VTFA 3EYWA 3OJLA 4PLCA 2VUUA 2YYYA 3G49A 2O7QA 3KYDA 5KKAA 1DAOA 2CVOA 1BDBA 1J49A 1J5PA 1K89A 1X7HA 3PYXA 3SJUA 4CUKA 4GSLA 1S7CA 2J8ZA 4CM8A 1E1LA 1NP3A 1P77A 5U9CA 1SEPA 1ENPA 4DQUA 1P0CA 2PTGA 3ZWBA 4KZPA 4IDBA 4KP7A 1YOVA 1D8AA 2PD3A 3WGQA 2R6JA 3I1JA 2D5CA 1UP4A 3NAQA 4GMGA 5T57A 4UUNA 4C7KA 5COAA 4MP8A 1VSUA 3R3SA 3V1TC 3KTDA 2X86A 2LDBA 5KKCA 1UAYA 4IQGA 1XHLA 1DBVO 1JU9A 3QVSA 4JJIA 1EUZA 3GVIA 2E37A 3BMCA 4RJTA 3QWBA 3ITDA 1XSEA 4J3FA 5I8ZA 4I5EA 2V6BA 3DO5A 4M8SA 3PQDA 2CDAA 3WIEA 4ALJA 3TN7A 2OGUA 3ROPA 5ITVA 3VH3A 1Z82A 5CPFA 1SZJG 4KQXA 1KVUA 2X22A 2Q49A 3L4SO 4CV0A 3NT2A 4PLPA 3T7EA 4RZHA 3PP8A 4JIGA 4O59O 4OL9A 4FSHA 4L0QA 4EBFA 1P1IA 2F1KA 4U7WA 3SBOA 1HE4A 3BMOA 1MFPA 2GRAA 1MX3A 1H0KA 4MIOA 4U8GA 5IXYA 3OSUA 3DWFA 3L9XA 5CHEA 3R3JA 1LLCA 1Z75A 1QR6A 4M86A 1HYHA 2NU7A 5A4DA 3JYOA 3PGXA 4CUJA 3ZI0A 2Y05A 2G5CA 1M76A 3K73O 4Z9YA 4J91A 3WGIA 4AJEA 1UAGA 2JL1A 2UV8A 1XEAA 2Y68A 4R3WA 3WBBA 2LDXA 5HTOA 2G1UA 3L77A 4OSOA 4QFDA 2I76A 1IHXA 3O26A 3DFZA 4XYGA 5F1KA 4GVLA 5JYEA 4BNWA 1N9GB 1Y6JA 4E2XA 5BQFA 3H9UA 1YL6A 5CDYA 1RM5A 4YJFA 5I8WA 1LSJA 1QSGA 1HDXA 3FNHA 1EK6A 1GYQA 4J90A 5MDHA 4R68A 1P33A 5AXCA 5CDTA 4PG6A 4Y67A 1R4MB 3QA9A 2B37A 5TF4A 5I7EA 3WWYA 3LC1O 2GPTA 2J5KA 1WPQA 4BL5A 3O4RA 3GY0A 4ID9A 1T4BA 3ONEA 5DP2A 4WK6A 5G4KA 1PGNA 2PWZA 3GPIA 5JW6A 5IAAA 1P74A 3I5MA 2D3TA 4D45A 3UN1A 2W2KA 2BI8A 3AU9A 1K6JA 4IZHA 4UVHA 5IFLA 4I5DA 1N5DA 1LEHA 3SC4A 1CIVA 4ZN6A 2FPPA 3GEMA 3ZWOA 1A5ZA 5ILOA 2VZ0A 4DLBA 3JQ9A 2EKPA 1O8CA 3DBRA 1MG5A 3GNQA 2DBQA 3CTMA 4L4SA 1EEHA 4DA9A 2Y99A 1H6BA 5CFZA 5JO9A 4CMBA 4DYVA 2DM6A 1X15A 4OJNA 3IL2A 4CQLA 4UVGA 1JW9B 2QZ9A 1G0NA 1D3AA 2Y1GA 3OIDA 3U49A 3WQQA 1EQ2A 3AWDA 1I01A 2EERA 3G79A 5DULA 2CZCA 4HUJA 1EDOA 1HSOA 2FPGA 5GY7A 4YAKA 5F5NA 5A9SA 4J1SA 4INAA 5THQA 2FSSA 2UUPA 5A9RA 3PWSA 5DCWA 1XR3A 1YONA 1X7GA 4FFPA 4IDDA 1Q0QA 2FN7A 3GC6A 3T4EA 4CMEC 1Y81A 3QSGA 5B12A 1K3TA 5JMPA 1X1TA 2GZ3A 2DU8A 2JD1A 3C1OA 4NJMB 4OXNA 4HNGA 3RUAA 4CR7A 2PGJA 4FN4A 1PSDA 1GTMA 2O3RA 5A05A 5A3VA 2CDBA 3WYEA 2OL4A 3F5SA 4EUEA 5K6AA 1UR5A 4OM8A 3I9JA 4Y6SA 1V3VA 3AY6A 1HE5A 1Q7BA 5C7IO 4IQ8A 1C0LA 1E6EA 5JXWA 3PQFA 4OYRA 1KOLA 4RLSA 4CM1A 4CMIA 5L7TA 2YV3A 4RORA 4L73A 4BNNA 5EPOA 1R0LA 1OC2A 1NHWA 5U1PA 3EC7A 5JMWA 3ICPA 1A7KA 2BMAA 4HBGA 4UEOA 3GNTA 4J6FA 1ZEJA 4IJKA 5JY1A 4BNHA 3PHJA 4OXKA 3T4XA 2C7GA 3BA1A 1YRLA 2JJYA 4JNKA 2O2SA 3TDKA 3MCVA 1A9ZA 7ADHA 4TVOA 3HFSA 5IJZA 3NJ8A 3DOOA 3K30A 3DHEA 3WB9A 1LA2A 3HDQA 4Q3CA 4WPGA 4AJLA 1SOWA 1WDKA 2AQHA 4E2WA 3WXBA 1Y9EA 2D2IA 2NVUA 2EGGA 2FZEA 3ZU2A 1V3TA 4E32A 1JTVA 4AFNA 3KB6A 4R1UA 3I4CA 1KETA 2GD1O 1B2LA 3CIFA 5IZ4A 3STHA 4LK3A 1J0XO 2EJWA 3R1IA 4R1NA 3N58A 2NTJA 3HZZA
chains in the Genus database with same CATH superfamily
1H65A 3CLKA 3QW2A 3ZVMA 3SR4A 4YBRA 2ONZA 1ONNA 2QEQA 3JY6A 2XR1A 2JH9A 4TN5A 4UNPA 4D41A 4GR9A 4AZVA 1WB4A 1DV1A 1Z3IX 2XRFA 3Q85A 2AOTA 4YMGA 3VKFA 2GCNA 3DE6X 4FQ8A 4TMTA 1U98A 1IMOA 1I30A 1Q0SA 1VPLA 1TGVA 4GP7A 1FJHA 1DKMA 4ARCA 1OXTA 5ERYA 1I3CA 5BW4A 4FFBA 1R6VA 1WW2A 4P7JA 2FQ1A 1OB5A 3AJEA 2EWVA 3AX6A 1TGYA 1RYEA 3FF4A 3GV0A 1M1UA 1YHYA 1BYUA 1M54A 2C3PA 2V7UA 4G0XA 4LBYA 1X1DA 4XB6B 2R65A 4Y2GA 5GJWC 3QE9Y 4ZT3A 4M9UA 5CB6A 2OCLA 1ZJYA 3G5LA 1W36B 3COPA 2L17A 2FZLA 4FI3C 1KWGA 3OIUA 2FPLA 4F2GA 3ZDQA 2O2CA 4ALNA 3LUFA 3CCCA 3E9MA 4HNAA 3DOEA 4TRNA 4I9FA 2FOIA 1M5TA 2O4UX 3KLPX 3JAKA 4XSVA 4YALA 1SG0A 3DAYA 4QPJC 3I05A 2QTRA 4XEUA 4EOGA 4XUCA 4R71A 1E9RA 2CNLA 4YH1A 1EA7A 1I4DD 1QQ7A 1C0EA 3PQ3A 2X8WA 4I99A 4WL0A 3KQQA 4DA0A 3FR8A 5M04A 2G3YA 4YFYA 1NYRA 2PSFA 4R2LA 3NKFA 1NLUA 4BMVA 5AUQA 4CVNA 4DMHA 2VQEB 2CNWA 2R6FA 4OOFA 2O6HA 5C18A 4WLEA 3WLIA 1ZGJA 5ALTA 3OUUA 2WYUA 4QOSA 4UREA 3K0SA 4FCWA 3L84A 1ZOOA 3O3NB 3ZQ4A 4A0GA 4I3GA 2CYBA 3DMRA 2H1HA 2ZDHA 1YE8A 4IVNA 2IXDA 2XUKA 1V26A 3IQHX 1PW5A 4IZOA 4H1HA 4BJ3A 5AVUA 3U31A 5KVAA 1PI3A 4HAUA 3V1NA 3PNKA 2R7AA 1CY1A 5CGQB 4JI7B 3UVEA 2ST1A 3H1AA 1P1KA 2RHOA 1O9BA 1DT5A 2XYGA 2ZBUA 4HWRA 1OYOA 3NFRA 3TLCA 2RHLA 4E4TA 5A5EA 1D2GA 2CN1A 1SKQA 1IIBA 2EC5A 4FLFA 3PF9A 4MJ7A 4TV8A 4CR6A 5CB8A 1I14A 4F4UA 4WY8A 2W2TA 2ZU6A 1UK7A 4IJUA 2LTAA 4TWAA 4MQBA 2W90A 1NGSA 5CLIA 3EDQA 1ZM3A 4PO8A 2NUTA 3DTVB 2D2VA 4ZTBA 4N7RA 2QMHA 1N9KA 1LDMA 2PU5A 1B26A 1W73A 2P69A 3FAKA 2EFGA 2GD0A 4FZ5A 4G4JA 5HE8A 4ANFA 4LJ8A 4GNKA 5LYYA 3MJEA 4NEHB 3SJCA 1GPLA 1OV6A 4HAVA 1GZ5A 2RHWA 4TT3A 3WVNA 3REFA 3I58A 1CZUA 1NU6A 3SKXA 4E22A 3I39X 2NZ2A 2QSZA 1FTNA 1BW9A 3V2IA 2DFLA 1PJTA 4YRQA 3VAZA 4R6XA 2G4CA 3EOZA 4LHEA 4EJ2A 3UH1A 3G9XA 2CFTA 1JJAA 1PQ4A 5DH9A 3CT6A 2BZ1A 2H2FA 3TTSA 2XMPA 4FIZA 2FSVA 2GOYA 3H6GA 4PFKA 1Z0ZA 2C99A 4AF8A 2B99A 1P31A 5KI6A 2JIRA 5IULC 2N0SA 5EN4A 1KI1A 4YT4A 1C9KA 4CMGA 1BDIA 4W82A 4HDSA 1IPEA 1Z68A 5JNRA 3BWMA 3MMNA 2FXIA 3ZNQA 2G71A 4OY3A 1GQOA 3LF2A 5JAPA 4B82A 3LY8A 4Y1GA 2QYSA 3QU4A 3V2UA 2YHUA 5HUJA 4PS1A 1A69A 3FTNA 4NARA 4KSBA 5H7XA 3A32A 1LLQA 2B94A 2ORVA 1U7OA 2VNKA 2PXHA 3FI9A 2XMGA 4PNHA 2J32A 1TT5B 3BQNB 3WLPA 3F8TA 3VV3A 1RFGE 3FLMA 4OQXA 4C21A 4XFKA 1ZNZA 4CFZA 5LYJF 2F8MA 3KYDB 1H4TA 1CYDA 2A9QA 2ZAGA 3KQUA 4J1TA 5KOJA 1OBHA 2XTZA 2XEXA 1GL3A 3JYHA 3OHMA 2BH2A 3SEAA 3JD3A 5F4BA 2AE2A 3PUJA 5DX1A 4XR4A 3WAKA 4Z2AA 5AKEA 2X0RA 4Y2SA 3V2HA 5LFAA 5DN6D 2YDXA 3PDHA 1AKYA 1TLTA 2HI0A 1J2JA 2RGAA 2UVPA 2W2LD 3GEIA 1H0SA 1VMEA 1YL7A 2P8JA 3OCZA 2I3DA 2VWHA 4IJ6A 4R83A 4PN3A 3C3CA 3DZCA 5EWMA 5GMOA 4L9SA 3EXEB 3FTQA 3N7AA 2DFDA 3LBNA 5LP6A 4RKRA 3UC5A 4EY4A 4HEHA 2XYPA 1KVRA 4L8GA 4XX0A 2OHGA 1G20B 3DUWA 4X7BA 3M3PA 3L7LA 1T34A 4KE8A 3T3OA 1VJCA 4EG7A 1IONA 2DPLA 2PFKA 1QIKA 3OIGA 7REQA 4Y98A 2VG8A 2IIPA 5ENVA 3OCVA 5AK3A 4BNJA 1WABA 1ADYA 2G80A 1MC8A 3NWJA 3EBOA 1WY5A 4RX1A 2PL3A 1JEOA 1ZZGA 1VA5A 4XEHA 3KZXA 1SVIA 4F5ZA 2PMEA 4NBUA 3ND6A 2OK7A 3CR3C 5TPWA 3ZU5A 4CTNA 1M7GA 4LHXA 2D7CA 4BVKA 4Q3AA 3H2BA 3KOOA 5L4LA 3CEPB 1OV4A 2GSWA 2HLDD 3IKMB 5CB4F 3HL0A 2AX4A 3FMIA 3GNSA 2BHTA 3IT1A 3L7NA 3KJHA 4GVXA 2ZVQX 4OKNA 3SOZA 3TLZA 1HORA 1NQWA 1UEXC 2F1IA 1OXSC 1UFVA 2Q5HA 3BXXA 3FZQA 3GQVA 3H8JA 5GJCA 4ENRA 3CH4B 4LRYA 5C2JB 5LKAA 2ZBQA 1EFCA 1EVLA 1HNNA 3B89A 3U1VA 4EJSA 1K86A 1MQ9A 5ALQA 2YKGA 2NU8A 4U9IS 3TI9A 3PFIA 2FSHA 4KE9A 1BS2A 1I4OA 3P2JA 4UUMA 1BVYF 1ORWA 2ZJZA 4JA2A 2C98A 2WIAA 1NUPA 1QXSA 4KQ6A 4XGNA 4O33A 1ODCA 1CUIA 3OF5A 4PRKA 3GUYA 3OE5A 4ZC1A 3VXKA 2Z2YA 4PONA 3TAUA 2OB2A 3RLFA 2ZTMA 3MN1A 1W2HA 1E1MA 1U7DA 4LPKA 3ESQA 5ERXA 4WUTA 3GH3A 4FNOA 4NJEB 1E2BA 1ZLXA 2YJ6A 3R3ZA 3AP1A 4JK3A 4BMOB 1ZN8A 1U7ZA 3FVQA 4N9QA 5K3CA 1AH2A 5DGXA 1VL1A 5IDWA 1E6CA 3OM8A 2BIFA 3P9YA 3AY3A 4JSRA 3QWHA 3B36A 2PMKA 4EYSA 2MT9A 5LP1A 2DJ5A 1AUOA 3AR6A 5JISA 1WXHA 2VYNA 4PYRA 5ALZA 5KYWB 4DVJA 3S7ZA 1KWKA 3AVWA 2C7BA 4F6RA 4C06A 2X4GA 4D9EA 1WNTA 4QT0A 5AUPB 4ZQFA 4PIPA 3K70C 4Y2HA 3FNEA 1GXSA 3FW1A 2X9VA 4B9AA 4TPKA 1FNBA 1X1AA 1Z7WA 2Q41A 1GKKA 1JQ3A 1KBOA 1NN5A 3KVRA 4CT4B 3UK7A 3GZJA 5G4KB 2PUCA 1YI1A 4AJ1A 1T4GA 2QN2A 3PHHA 2EBHX 1GP2A 3KCQA 4OXYA 2MYTA 2W2KB 5I9SA 1T8TA 4UW9A 2HO5A 4YP0A 3OMWA 1AZLA 4LNUB 1QGAA 2D5BA 3K96A 1U5AA 1BSVA 3A4LA 3TNFA 3URKA 2CLMB 2FPPB 3BL8A 4S0ZA 3VZPA 4DR7B 3PXEA 1E2IA 1XEWX 2WAAA 3A6JA 4TQAA 3ZBPA 1W47A 1PFVA 3IE1A 1SQSA 4EVRA 3GA7A 1XWIA 3MGCA 1Q0RA 1OAAA 1UPXA 4XUEA 3T6KA 4E21A 2J5RA 4ND8A 1ZBQA 4JQCA 4PF1A 5EKXA 1UPFA 3HEBA 5E7MA 1DIAA 4Z7NB 3FLEA 2P90A 3P9PA 4E08A 1I2ZA 2Q6VA 3OPXA 3MIIA 1W0JD 2XUGA 3UAWA 3D3QA 4YAJA 1IWOA 1M1NA 4FDMA 1NQVA 3Q1LA 4C0JA 3CFYA 5B2FA 1G7TA 5L7WA 1SCBA 4XM0A 3AVQA 1E9AA 1NATA 3K9LA 1N2GA 2IE8A 1B93A 1ZNQO 5BVHB 1YXMA 2OC9A 3DCJA 4Q3OA 1IIRA 5INTA 1W4LA 3G89A 3NEJA 2XV1A 4DDVA 1G2QA 1KK2A 5BN1A 3OIWA 2O14A 3OX1A 4OAPA 4FBLA 2PMWB 1VHQA 3FYHA 4QU9A 2AG1A 1ETUA 1JHVA 2YYZA 1RXEA 3T9CA 1B74A 5B4UA 4MWZA 1IFXA 5ICFA 3O4HA 3ZDEA 1QAMA 2Q6LA 3D3WA 1DB3A 4R1OA 3RYTC 2W42A 4C3ZA 1QYCA 1W4BA 3NWBA 2BEJA 2V6IA 4ASUA 1EJBA 1V2HE 2P91A 3FHOA 3OWOA 4QREA 2DULA 3BICA 3OESA 1AQUA 1OFVA 3PWKA 1ZQ1A 3AC0A 4MJLA 3U16A 1LX6A 3K92A 1Z35A 2ZIZA 3L82B 3BWYA 4I8DA 2HBZA 3AB3A 4MR9A 4NX2A 3OJEA 4Q48A 3LBFA 1BKYA 4RL6A 3RBVA 3SICE 4EPYA 5A06A 1R0XA 4AL4A 1VPEA 1A8SA 1UM9A 4H0NA 3RU7A 2BI4A 2V6JA 1ZMTA 1A4UA 4BWVA 1NBHA 3SX4A 3PL1A 1XTKA 2ZYVX 1J20A 4MKFA 5I9MA 1JEYA 1BEZA 5K3SA 2WAXA 3N2KB 3AVPA 1GJRA 3NORA 2FRDA 3TVYA 1QU3A 1BOFA 2Q1UA 2VATA 3E18A 4HYQA 4D56A 1E9EA 5A3RA 5LJIA 2PQMA 2QD4A 4B2YA 1DC8A 2B0JA 3T1TA 4HMOA 5E4YA 5I4IA 2PSSA 2ZT7A 1OA0A 1QVRA 1FDWA 4OHOA 3M0EA 4QEDA 1X1QA 2CEAA 1BGVA 4WZBB 2GEJA 4Z9AA 2BFEA 3E9QA 5DXAA 1A98A 2MIIA 3GDHA 4URZR 3PXUA 4KXMA 1W5FA 5EESA 5AKXA 3QXJA 4J3JA 3RSFA 4DE5A 3LT4A 4E5NA 1F1BA 2QYOA 1KH2A 2LIVA 4LZLA 2D5AA 3TX2A 5FOUA 4BO4A 4GFDA 3LCVB 1ACMA 2ZUBA 2DWOA 2BJVA 1ZRSA 1G63A 3HCPA 1GYPA 1PNQA 2WVAA 1QK4A 3WADA 4KKXB 5ICGA 1OI4A 1B7GO 2AQIA 2J3QA 4ZANA 2NO1A 4YQZA 3U5TA 1GILA 2J5QA 4IPTA 4XVUA 3WGYA 2XZTA 2X23A 3JVUA 1TTTA 3A9VA 2RB4A 1AGRA 5BVGB 1JSLA 1NQ5A 1L3CA 4ZEWA 3B9RA 5AKKA 4IMJB 1QHYA 3WGLA 1KIMA 4CIWA 4EX7A 3KM0A 4KRYA 5HIAA 3DB2A 3HB5X 1H05A 1Q21A 3BIXA 1GPWB 2YXDA 3HVKA 4KBFA 2J46A 3SYMA 4BFVA 3AJ9A 1E3WA 4BMPB 1SOMA 3DL7A 4Z4CA 2BFNA 4YLGA 4EW1A 1TOAA 4KN8A 2HXSA 2WLTA 1WPXA 3HDJA 3A3OA 2J9XB 1KDOA 4TXNA 2JFFA 1II8A 1RAEA 4HXFB 5EVJA 5I45A 3W3AH 2HJRA 3QMMA 1ZNXA 1MU0A 1LQTA 4LWQA 3UB4A 1EVZA 5CFPA 1KBQA 3T06B 2ID9A 1GAEO 3U4IA 3UK1A 2CVFA 1XEFA 4LGMA 3EASA 3ZV4A 3OEWA 4HGRA 1RPNA 4FFBB 4MVJM 3V00A 3A4YA 2V7GA 5L8VA 2GEFA 3C98A 1UH5A 4HDMB 3EEYA 3BBLA 3P0IA 4FYWA 1J22A 3T99A 1IN5A 2OHJA 1R0RE 1V8OA 9ATCA 4AM8A 3UKDA 5BUCA 1NDUA 5BR4A 4OOEA 3WOVA 3OZWA 2GTHA 1MV8A 2B3DA 1Z7GA 2WVGA 1X80A 2E82A 3HEMA 3WYNA 5FO1A 4OFBA 3U7IA 5IKPA 4EG4A 4RQUA 3I01A 4QZVA 5TE9A 2IYVA 2JH3A 2AZDA 2Y0CA 4HNAB 4KXLA 1C1DB 1G5PA 2EZ4A 3KT6A 4NENA 5CPBA 3HXOA 1REQA 3JAKB 3OY7A 5LB2A 2FKNA 2WUGA 3NV7A 1YV9A 4W4TA 4DCUA 1R9JA 1SBTA 4UBJA 2ZBPA 1TYBE 2BOVA 5I4KA 5D6OA 1Q0UA 3K0HA 4Q5IA 2MMGA 1E1RA 3AGPA 3AJRA 2QM3A 4NZYA 2V4ZA 2CDRA 2ZR0A 2QPTA 2H2AA 2B1QA 2JLBA 5H80A 3ZWKA 3NVAA 4MGYR 1ONPA 5DTEA 5JQGB 1AHHA 3LC0A 3HUUA 4ZD6A 4Z2YA 3ZX4A 4LIPD 1FZQA 5FI1B 1J2YA 1F8YA 2JJQA 3LC7O 4BKQA 1YJ8A 4A36A 3LT0A 3UJ6A 2VHWA 1G0OA 2ZQ5A 2Z9DA 4EVQA 5KSWB 2YXLA 3GOHA 1XI2A 3Q8MA 3FOBA 5A7GA 2P3OA 4RH0A 1GV0A 3JD1A 3DVRX 1EXWA 2NLOA 3P26A 4TTVA 4LXUA 1ZGGA 1WCXA 1L5QA 2PY6A 3OIFA 3OAAD 1EK2A 3WK7A 3NHKA 5B6IA 5FR2A 4B8WA 3E7DA 5HIMA 3EEFA 2DBZA 1VIDA 3N8KA 3ZWWA 2XUIA 3TNLA 5CA0B 3TCXB 1HEUA 1RXUA 2XDWA 3NHZA 5H70A 3W5HA 3PPXA 4FYKA 2VZ9A 1UMDA 4LWOA 1FE8A 1KARA 5AOCA 4AJIA 3JASB 4FB5A 1Y1TA 2HNKA 2POQX 3HFJA 1UPTA 2EBWA 5CLHA 2Z2KA 4CLRA 3VKUA 1KY3A 3M6WA 3BGOS 3GFQA 4C4XA 3R8XA 1X9IA 1N0IA 3QP9A 5T7BA 3DVAA 1B8PA 1LBIA 2XODA 2J0UA 1DZ3A 4MGEA 1DC4A 2NXCA 2VAXA 4WEQA 2VPTA 1S8NA 1ZN7A 1BW9B 2C84A 5CD9A 2VPIA 3EF1A 3A8TA 4XVHA 1MOPA 3L5OA 1Q2XA 3NIFB 4EI2A 4BP8A 1G4HA 3TW0A 4EI7A 2BJHA 4OJQA 2HFKA 2ZE5A 2I4IA 4GYYA 3W6PA 2ZW9A 4WGFA 4DIKA 2ZM5A 2OV2A 1Q77A 1OH7A 4PZPA 4RXUA 4QDTA 4URXR 3ICQB 1OXVA 2GI4A 2FA9A 2XB8A 1X3SA 3WDSA 3G5AA 2QTWB 5L40A 2WQZA 4TV9F 3QU5A 4YDHB 4G8BA 3BJRA 5I7RA 2HO4A 4F04A 1F2TA 3DOHA 2XB4A 2ZUDA 5I7FA 3X1YA 4E3WA 1Y7IA 2IGBA 4PLZA 2H2GA 2JLAA 4R8RA 3T61A 3O1IC 2LCQA 2A5JA 3OQPA 1KDPA 1S2NA 3LKVA 3LTNC 4PC3A 1ATZA 5DLEA 2MHCA 4NI5A 3IPYA 1WSDA 1A9XA 2RHMA 4DBZA 3DL0A 4KUHA 1XTZA 4LF7B 2FPIB 3UEOA 2OPBA 2QNRA 2WRZA 3DBOB 4ALKA 3B1XA 1XQVA 1D6MA 4NESA 5TGZA 4E13A 2Q2NA 3KCNA 4PLYA 3TNDA 1ILWA 1ZAYA 5CDGA 4M9RA 4RD6A 4R8MA 4D3ZA 3M33A 1TUGA 3O92A 4BO5A 4PCUA 5L3RA 3B6KA 4B45A 4I9HA 5EE3A 2GEUA 5I6DA 2O3TA 1KFCB 4L07A 1VXOA 3HN6A 3FVTA 2QYTA 3UTCA 3QIAA 4BQRA 1ZKMA 5D3ZA 3RFUA 4YRBA 5JO0A 2CFIA 2XZPA 1QRDA 2I3BA 3LDFA 4G5FA 2OXTA 1ES9A 3GEHA 1V8PA 3QF4A 3MJFA 4P4LA 3T3MB 1S2MA 2VCHA 5LP6B 3EIEA 3WGUA 1F4VA 2OXEA 2A9VA 2JBWA 4HLUC 4XX0B 4DKXA 2APJA 1PV1A 1TU0A 2EJTA 4M8IA 1CW2B 3CX7A 2WA2A 2IXEA 2QQ5A 4XWGA 5C3MA 3T3PB 5JLJA 2PWBA 5GP1A 2DHCA 4BLTA 3WZ2A 7REQB 2XCIA 2DC1A 2EZTA 2OK8A 1RTTA 1THZA 4KE6A 4ZOAA 4GYJA 4IJVA 4JJKA 4YMSA 1Y6RA 3GAFA 2GPAA 3C6QA 3SJBA 1YK0A 3LLVA 3N9IA 4IP0A 5TRTA 4LOHA 2A9PA 3TSWA 4ZJZA 2X8JA 3M2PA 5AI5A 1Q0HA 1DXHA 1JHQA 4LNAA 2JGIA 2WTNA 1GNRA 1J06A 1EGQA 1ICIA 1TZBA 5TPWB 5LQUA 2H11A 2FWJA 1N2CE 5CFMA 3H1TA 2GRUA 2EJBA 5DBGA 3M5CA 2ZSBA 1Z2EA 4L02A 5DTIA 1A95A 5HOQA 1UODA 4ZEOA 1WB9A 3R20A 4D3FA 1R66A 4RDIA 4F1KA 2BCJQ 5JFOA 1IATA 1RRMA 1SUDA 3NKVA 5HGXA 2Q7DA 1W76A 4B3CA 2ZI7A 1NJ5A 3JQQA 1C3EA 3OJ0A 3ZR4B 4NH4A 2R0QC 1YJQA 2FQQA 3PQ6A 4EUNA 1Z29A 4ND2A 4EKGA 1M74A 2CWWA 2NU8B 4OFXA 3TVTA 4MRVA 5JASA 1E1KA 4RK5A 4N0EA 3ASYA 4F4IA 4JBGA 4ECAA 3GRRA 5FEUA 2IY9A 2VQ6A 4EA7A 3STVA 4BVFA 3LZDA 3QI2A 3MHPA 2LUOA 3BXHA 1X7DA 3CBGA 3WQBA 4UTPA 5LQRA 5E6RA 3E6AA 2PM8A 2A9KA 2XVMA 3A4NA 4RMJA 4UM9B 2BM0A 1DI0A 3QBDA 2GAFA 4B84A 1GEEA 2QMEA 1JQLB 2IUYA 2R00A 2GXAA 4MW0A 3E53A 3RWOA 4EMUA 4K9LA 5DBFA 4EKNB 3L05A 4JDPA 4WWHA 2UUOA 1H9BA 3V8PA 2BFFA 5EJ4A 2FMIA 3AUYA 3H87A 4MW1A 1I3MA 2ZUUA 3IOMA 1Z6XA 3ZWYA 2OSVA 4W6ZA 1SBYA 3MCAA 3MF4A 3DUFA 1CR1A 3I2YX 1NPDA 2BGWA 1NFQA 2XAAA 1EUCA 2V6GA 2IUSA 3LGAA 3EVDA 5FYDA 2EG9A 4NEQA 1PVOA 4XFDA 3WK8A 4HPJB 2AXQA 4MOWA 3CV3A 1U4NA 1SZPA 4IWYA 2FP4B 2MR5A 2Q1YA 3IE0A 3IDOA 4JOBA 4F6RB 3KX2A 2JHCA 4BN5A 2GTIA 4Y30A 3AF1A 3QUCA 2CLEB 3PENA 1TQ8A 5KOHA 1Y9JA 2BMWA 3HKCA 3LGXA 5DCUA 3DNMA 3I2GA 2O0HA 4ZI2A 1RQPA 2W6PA 1QLWA 4H3KB 1RC8A 3VNSA 3DZIA 2VSYA 3IIJA 4S12A 4TTTS 2QRKA 2J6IA 3PZRA 3R7WB 1MD9A 4UCFA 4DUYB 1FSZA 4X3CA 3TK1A 5JD5A 3ZQ6A 5T3UA 5C8VA 2C7PA 1Y5IA 1BTOA 2KQUA 2COKA 4LMPA 5BOVA 3E70C 2GN2A 3W79A 4BMDA 2RGXA 4I14A 1XE3A 3H4VA 3JRXA 4Z4HA 3DJFA 4H77A 8GPBA 5KZMB 1MAUA 3LJKA 4L0DA 3UGJA 4I50F 4ARSA 4C7JA 4EW3A 3BA6A 4B3HA 4G0VA 3PEUA 4FS3A 4MQMA 2XRZA 2IXAA 4CMJA 1I7DA 4XWYA 5G3ZA 3HADA 4FCVA 1S2OA 4JZYA 4LWPA 1L4KA 3C48A 3N2GA 3NBQA 3IKTA 3L1JA 5EXSA 2EKBA 3CLSD 3EHDA 2VDJA 2YZNA 5LB4A 3H97A 3OO1A 3QXGA 5KJFA 4MEAA 1RXIA 3RYFA 4P4GA 1PQPA 1U8UA 1U94A 5BW8A 5JJKA 1U8FO 4WBNF 2AG5A 3GZTB 1BJRE 3ZKWA 3PLRA 4Y2JA 2W6ZA 5J5AA 2GF9A 1ZMBA 1T5LA 2Q50A 1JH8A 3B8EA 4IWNA 5TVGA 3DWIA 4V1CI 3PEWA 1R37A 3K2BA 3SKVA 4NMWA 1IQPA 1Z7BA 2W83A 3BAZA 4DR2B 3TSAA 3A9WA 1H2FA 1XTSA 3R4CA 4ZDKA 5FR1A 4C2BA 1IAVA 1TJ5A 4GE3A 3A1NA 5BSGA 3KPWA 3OOEA 2VJAA 4OMUA 3UOGA 4X1IA 3LC2O 1L5NA 1LQUA 3NTOA 3RT1A 4HDOB 4ZCRA 3L6OO 2GEKA 2LD4A 3D3WB 4OA5A 4LVOA 4Q93A 2AXEA 1TJ4A 1NT2A 3HKEA 5K3BA 4R7ZA 4F4DA 4OBWA 5JC1A 5B3KA 5LNK6 3GL9A 2WWFA 1G60A 2OFOA 3BXEA 2XNDD 5FLEX 3O0DA 2YJ5A 1NI5A 1YI8A 3CKMA 4MR9B 3SIRA 4A1OA 2Y1OA 2YVAA 3CX6A 3IUEA 3C6BA 3K31A 3LY9A 4LSZA 5AI8A 4LZAA 5EJ2A 3V4ZA 5BSEA 3P5SA 5K2MA 3PFHA 4WLUA 2DTXA 5IDXA 1UM9B 4V2IA 2O8FA 1E3DA 3REGA 5JCOC 1S96A 2YXBA 3AUJB 2Z2JA 4LRUA 4F7DA 5KJ1A 4RS4A 3CM0A 1GGHA 3UJ3X 1JEYB 1L9KA 3VZSA 2A35A 1G5HA 4OTZA 5IFKA 1PYGA 1CG6A 2HR1A 3UUWA 2C04A 4FP9A 5TT1A 3I9V6 2FGKA 1VDMA 1DVRA 3OJOA 1DBPA 1KY2A 1XZNA 4AJNA 4ZOQI 2IV2X 1P0FA 1SURA 4BNXA 3VFDA 1KC1A 1H8EA 3REOA 5K8LA 2YHAA 3KTFA 4PG4A 2O5EA 3CUYA 1ZD8A 3I9MA 2JLVA 2QUZA 4UBIA 2BFEB 3RF6A 3URMA 6NULA 3P27A 4RCZA 1NF8A 1ZH0A 1E0JA 3FPGA 3WWZA 2Z3ZA 1MQ8B 4N3BA 4E1AA 3UJBA 3E0XA 4YYEA 1IPFA 2X9QA 4X8MA 2ZSUA 3RT7A 2V0CA 3AKEA 2M9MA 4PVDA 4WOJA 4CEJA 3P4YA 2PA0A 1W52X 3BAFA 3KPVA 1FFDA 3OF3A 1XEXA 1RBMA 1U3CA 2FN8A 1Q1QA 3O8DA 1Y4DE 4I6EA 5EQTA 5SZJA 1XP8A 4HN4B 1U1IA 1W36D 2GNPA 1XF9A 1X19A 1MB2A 5C4GB 3TB4A 5IABA 1PG5A 2E89A 4QU5A 4ZVRA 5FV7A 1IYZA 1LJUA 4JU8A 4NJMA 3SD7A 5LLDA 4LFBB 3UV3A 2HYIC 1GLVA 1WCV1 3F49S 2OLJA 1JTEA 2WICA 4X41A 1WP4A 4V0QA 3ZQKA 2M6RA 4B3FX 2O8DB 1NRIA 1WQ1R 4O8ZA 4CW7A 2A78A 1F0KA 1OPRA 3KLNA 3THRA 4EGQA 2IHUA 5FUQA 4ALMA 3FNFA 3IP9A 4YREA 1DKPA 5ADUS 3PC4A 1DTEA 1PWZA 1R3DA 3GEEA 3FWNA 3GZ4A 2I91A 3ZQUA 1II8B 4W5OA 2DQYA 2P40A 3LFHA 4E31A 1P2BA 3G0GA 2OM6A 4FMPA 3RUFA 1TD1A 3Q8KA 1W29A 3WL7A 2FFAA 4BNTA 4ZHQA 4WK0B 1P5HA 2CE2X 5F23A 4HRXA 5KTNA 1P9OA 3DEIA 1BRTA 4X6YA 3OLCX 1U28A 1F2DA 2WFLB 2WI8A 2YV2A 2B5OA 2R4UA 4V0LA 2CSUA 3HC7A 4X54A 4AD8A 5DT2A 3TMAA 4MP3A 1BXZA 1PX2A 1Q12A 1R6XA 2OCYC 3D6FA 3NDIA 3O74A 3Q7EA 4JVOA 3TX6A 4QOIA 4BFUA 4MVJF 5CT8A 1QTNA 1X80B 2HMYB 2ZUCA 4KO2S 1IMJA 5E7QA 2QV0A 2QPOA 4PRZA 1REQB 5DN9A 3ETGA 3PDIA 4MPJA 3TOSA 5EKDA 2D2XA 3T1VA 5CTJA 5B3LA 5BWMA 1JKIA 3VPCA 1O5IA 3HXMA 4KQIA 5DYTA 1F9AA 3S81A 4O1MA 4V0KA 3RVNA 3FN4A 1PHPA 1PJSA 3DTVD 3DC2A 5H3CA 2X1MA 3ANXA 3OT5A 5A6SA 2XIQA 3AU8A 1QO7A 3QLJA 4P86A 5HW0A 2VHEA 4JLOA 4AP5A 1ENOA 1AQIA 2PKQP 4DM4A 4PANA 4XLTA 1Q91A 3H84A 5FLKA 1V6AA 4DCOA 3H9QA 5JZ9A 4UZSA 2XCSB 1GTSA 3L6EA 2WWRA 4LPSA 1AXGA 1Z0IA 5F1PA 1EGAA 1FUYB 1N7HA 4D4GA 2H1SA 3FVVA 3G6KA 4X0EA 4OQ4A 5K03A 4PM4A 1NM5C 1WG8A 4E32A 1ZS9A 3LOQA 4PZCA 3KHKA 3W5JA 1B73A 2G40A 3EUFA 3P0JA 2ZAYA 1K9SA 3R44A 4ND7A 1D5CA 1JLRA 1NAIA 3EISA 5FWXB 4FYYA 4LV8B 4G0UA 1L5LA 3D81A 1IDN1 3BSSA 1PN3A 1VL5A 5D5PA 1QHGA 3VBEA 3ZS8A 2IUUA 2YIDA 1U0FA 2R96A 2WWGA 3I52A 3SYNA 2HSJA 3EEIA 3GDOA 2Q8NA 2ID7A 4GUAA 3R9KA 4B4DA 2YC2C 3CVUA 1UMDB 3A9TA 2WF5A 2G72A 2REQA 3DGEC 1CS0A 4TS9A 4UXJA 3OZDA 1JZQA 4D7AA 2OXFA 2Z95A 2AC7A 4HNVA 3OZUA 1A88A 4IFEA 1WCWA 4L4XA 4OHKA 4ALLA 4CLRB 1W4RA 2OO5C 5HF5A 3ZDRA 1BU8A 2CWDA 2DH5A 1ORTA 1TLLA 4OI1A 3ZN2A 4DCMA 5GADl 1T2DA 1GUAA 3OTOB 1TT7A 3DVAB 2JLRA 1UWKA 821PA 5IKMA 1PT9A 4OH1A 4Z9BA 1I9CA 4WOBA 2AMYA 2PLWA 1DADA 3NWPA 4RLFA 4JUCA 3AI7A 2B4QA 2OZPA 3FCCA 1CIPA 3QVGA 5DV9A 3RAPR 4U2KA 1WSAA 4G3XA 5E9JA 1JIXA 3AM1A 1UXKA 1E9BA 3NCHA 2FQYA 5F76A 1MAVA 4EO9A 1BN7A 4J2TA 4UAVA 5H4HA 4FZJA 1HOTA 2W6CX 2P2DA 1QYXA 1DKNA 1L5SA 2J6BA 2VJQA 1KZGB 3RK4A 3S8MA 1BDJA 3ZW9A 1A72A 4C3OB 4PNEA 3U17A 2VNHA 4MV8A 3B1YA 2TS1A 3HXKA 3P8ZA 4ZCPA 3SC6A 1M6HA 4JHLA 4NXNB 2A1IA 1Z73A 1AQYA 2C7QA 1F2TB 2WG1A 2ZULA 1TQ2A 4QO7A 2ZGVA 1B0ZA 2IHKA 1ZG3A 3BWCA 3MK31 1LSUA 3O8NA 4HWOA 5HQJA 4II7A 4EG6A 4NE2A 4JJZA 4TTPA 1GAQA 4GLBA 4TLDA 2XB9A 2CXSA 4DLYA 1PS9A 3C3EA 3KWJA 2VIIA 1UPAA 3ASZA 4D98A 4AMUA 1A9XB 1U5BA 5DNVA 2OHFA 4GXQA 1KO7A 3A26A 5MN5A 2AF4C 1JJFA 2J3KA 2D13A 2Y4NA 4YXWA 3QPBA 3RROA 3SYLA 3VR1A 2O57A 2YW9A 4DV6B 4OQLA 3GPLA 3K1YA 2WUVA 3KJZA 4ALIA 5ICCA 1GPJA 1SCKA 4X97A 3S68A 4XGRA 4W1QA 2Z6VA 3TM4A 3IHTA 1P3DA 2QPAA 4G09A 5H83A 3TTWA 2BW0A 2DOKA 3OICA 3LTEA 1GR0A 2G0TA 4GMDA 5IBRA 1K6MA 4BMNA 1MT3A 4B85A 3AM5A 3KV1A 4B48A 1N1GA 2ZIGA 2CY0A 3FM9A 3LXRA 4MCIA 3KE8A 4QTUB 4Z0TA 1T2CA 1QP8A 2C97A 3OX4A 1I51A 2EP7A 4DDKA 1ZHFA 1BJKA 5KC8A 4OUKX 4UEKA 3KR2A 2W2VA 4FONA 4X6UA 4DARA 2B1GA 2OO7A 4ZKEA 5ALVA 2IVZA 2YJNA 1HE1C 3C45A 3VA7A 1LLFA 3QVOA 4Q00A 1VMKA 5FQOA 2ZM6B 5LZ7A 2ZYSA 3HJAA 4JBLA 1IVSA 3JXEA 3HYSA 2AOXA 2JLSA 4BQFA 4YI5A 3OEEA 4NYMR 1CUYA 1V41E 2ZXFA 3R5FA 1KI2A 4FYXA 4MUAA 4KIUA 4W6QA 5AKZA 3WK4A 5JDIA 3OKCA 3O8OA 3T0GA 4AK9A 4JSYA 5CG2A 3IMGA 3CNBA 1ORIA 1YD7A 4NYMQ 3OZTA 2X8JB 1FSSA 3VTZA 3QYPA 4HVTA 2EW1A 2C03A 2INGX 2X7XA 4ONEA 4EA8A 3R6LA 3VGPA 3WRVA 2WZQA 2DG2A 4KI7A 2JCBA 3VKWA 3QNUA 3TIIA 2POCA 2UAGA 3KC2A 3PD0A 1DINA 4WNCA 4YMVA 4DV2B 4J07A 1Y6FA 4CMEA 1RKVA 2CNKA 3ESAA 1QYVA 3GFTA 3MUFA 3H8WA 2WPDA 3U7RA 4OI2A 1NUAA 1YZNA 3E9YA 5AK6A 2WYHA 2PXXA 2I65A 2XJ4A 3BRSA 1NY6A 2RG7A 4QSHA 4C05A 1LS1A 2PO7A 3MBIA 4Y3UA 4TRMA 1E1DA 3U4CA 5DMXA 3NHAA 2JA2A 2YOFA 4C7BA 2FI1A 3WLHA 4PRLA 4G5QA 1KDRA 3VSCA 1WMFA 2H7XA 4CE6A 1DIBA 2W4IA 4IXMA 4JJAA 4DSOA 4NHOA 3WYFA 1FXWF 2XGOA 1H6CA 3F96A 5EP4A 5BV1A 5E6RB 1QH1A 1XZAA 1YMQA 3DMHA 4NRDA 2BKAA 3A0RB 1M6EX 3EPJA 4Y2RA 3HJHA 3HP7A 4S1NA 1SPXA 1WU8A 4RVDA 5DTQA 5AI4A 3QOXA 3OY2A 5SICE 3HYCA 3A3KA 3ZNPA 4KLZA 2KSQA 4HAIA 3U4HA 4X71A 5CNKA 4MMXB 2BFFB 4L76A 1RZRD 1G8PA 2PRYA 1FS4A 2A6PA 2C8JA 2WG2A 5T64A 1KO5A 3ZWVA 3UJCA 1AKTA 4ADSG 1WDMA 2B1RA 3DUFB 2FFQA 2RC6A 3IODA 4PYMA 1EUCB 1EE1A 4OYLA 4Q9IA 2XD4A 3ENWA 3TFQA 1A2BA 2WTBA 2R8OA 5JCPA 2AA3A 2VNAA 4CCYA 1TPZA 1DEXA 4MS4A 1CSEE 1SRRA 3R23A 1RDFA 2IYAA 5HHTA 1VSTA 3IXQA 1PE0A 1OZFA 3HCFA 1AUVA 3E3OA 1NSYA 4J9UE 4UFNA 1H6DA 3KEQA 3GJRA 5C3UA 3V1UA 1DLJA 2ZR9A 3G2JA 3RYIA 3U09A 3LPLA 2FSPA 3IRVA 5D86A 2X2PA 1DC6A 2DRIA 2IUFA 1Q11A 1B16A 1EVEA 1RWWA 5LBIA 1N75A 4YJ2B 5JBIA 1ZNYA 2PBRA 2QY9A 1ZWLA 1O03A 4AUMA 4TSFA 4F5EA 1EFUA 1M2HA 1UC4B 1X8KA 2E4ZA 3CX8A 3E3LA 3T38A 5JZSA 3Q7IA 2WTAA 3LS2A 2GA9A 1RBZA 4IO1A 4Q7QA 2OORC 1I9GA 2B5WA 4G9GA 4I1IA 2AX3A 2DQKA 3BWBA 1SD2A 3AEZA 3AZOA 3CLRC 2A92A 2DJIA 4MEJA 3WP1B 2ACEA 4XPIA 2YJ4A 4V0ME 4FKZA 1J7KA 5JYBA 3QFRA 1JKJA 3N2GB 4J03A 1WKVA 2OCBA 2YIVX 4GG1A 2WNHA 4G4SO 1N5JA 4NU6A 2C5SA 2CVZA 3EOAI 3K9BA 1FTYA 4WXMA 5GONA 2P2LA 4QDKA 3RYFB 1GKYA 1RAFA 1ST2A 2A88A 2QRNA 2FMXA 2ADMA 1YASA 1G9TA 2QOEA 3BH7A 3VR6D 1VFNA 4LQDA 5ES3A 3AHHA 5A4IS 2XNHA 1GN8A 3PFKA 3U0VA 1JFRA 3IV7A 4RK1A 3S2ZA 4F12A 4G65A 2V65A 2RI1A 1A82A 1Q92A 3QVKA 2YXEA 4PAMA 2AVDA 3BK7A 3NMUF 1YKSA 1A4XA 1BMFA 3K0BA 2H48A 3U4QA 4G5HA 2SKEA 3BL5A 3DLBA 1VE5A 1XBTA 1Z0UA 2QUBA 3MUEA 4IHQA 4MIKA 1O4WA 2H4JA 3HUTA 4G4SP 1FU7A 1X1CA 2CNOA 3HKEB 4D9MA 2BYTA 1OCEA 1P6UA 2HKIA 1DRWA 2XRYA 4XR9A 1PT6A 1JAHA 3GT4A 4TUYA 1UWLA 3FRJA 1GRQA 2GJKA 1GV1A 2AUNA 3K6RA 2RH8A 4OBEA 4P34A 4PZDA 3UXEA 1Z6TA 4Q7MB 1TUBA 1NP6A 4EHLA 4YJ3F 4F92B 4UHJA 3BWVA 3UATA 3CHYA 2P41A 2Y0EA 3DEZA 2IZ1A 3HRKA 5TQ0A 2W8ZA 3FTDA 3GRKA 2REBA 4TSKA 2DUMA 3VZQA 2QTVA 2Q6OA 3K8ZA 4JP1A 3ED1A 1H94A 4P5DA 3GJ0A 4NL4H 4YRAA 4IHKA 4PTLA 4TKMA 4DBLE 2IP1A 2OSBA 2JCVA 2PGXA 1ICEA 3HMQA 4XB2A 1O6ZA 1GGJA 4U6SA 2H4FA 3F5MA 4Q3DA 1IU9A 5GQSA 1BA2A 3C3BA 2B6NA 1UANA 5HK8A 1OKKA 4JWTA 4W5HA 1A8PA 4R3NA 1X87A 2R1UA 1V5IA 2BE9A 2EHDA 1PGJA 2H9IA 4INPA 3K0CC 2VP6A 3OOHA 2WJ4A 4M1TA 4X84A 3LX6A 3V6MA 5L4NA 2AEEA 2L0XA 1LQ2A 3OZIA 4XA8A 4YCJA 4UBOA 1YGPA 4JLDA 4BRWA 4F3KA 1GTRA 3WJ1A 3ROGA 4HT3B 1C41A 2HEGA 4MAMA 3CN7A 1WXIA 3OTIA 4FGSA 4X7PA 4CEJB 2Q2QA 1XEXB 2R4QA 4V02A 1MABA 4BVGA 3PLNA 3G5UA 4D4HA 1RZ3A 2P3SA 4DT1A 3HJTA 3W90A 4CL0A 2GDJA 4DA8A 1AMNA 1ABFA 5C53B 2CLKB 3O93A 4W8HA 7GPBA 1LPNA 1U3FA 3B6ZA 2JFUA 1XDDA 1HNWB 2PKXA 1EB8A 1HDCA 2ZJ3A 1R9NA 4AX8A 2AZTA 4MRNA 4PPFA 4EJFA 3A6ZA 1DQRA 2AXNA 5I7AA 1JEDA 1O6CA 2YWRA 3AL3A 5BMVA 1PS8A 3DV0B 1VJ1A 5LWQA 5DCYA 2BLNA 4BO2A 3A14A 1Y9AA 5TJ9A 4AJOA 1GL7A 4BO1A