3KYEA

Crystal structure of roadblock/lc7 domain from streptomyces avermitilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
VSDLDWLMSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHMAALASGLYSLGRSAGIRFGDGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEMAMLVKSVRPYLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roadblock/LC7 domain, Robl_LC7
publication title Crystal Structure of Roadblock/LC7 Domain from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3kyeA00
1D1JA 1VETA 2ZL1A 3T1QB 3MSHA 3CHWP 4FTXA 2B95A 3T1XA 3NECA 2PAVP 1Z09A 2V8FA 4QWOA 3MS6A 5EVEA 3L9KA 4D60A 3CPTA 3UB5P 3T12B 3LGOA 3L7HA 1AWIA 2V8CA 4X1MA 1SKOB 2PRFA 1Y4OA 2BTFP 1FIKA 1SZVA 2E8JA 5FEFA 1PFLA 3U4LP 1YPRA 5EM0A 2JKGA 1CJFA 3NULA 1HLUP 1VEUB 1A0KA 2ACGA 3T1RA 1VEUA 1ACFA 1CQAA 5EM1A 1F2KA 3D9YA 1SKOA 2VK3A 2PBDP 3LEQA 5EV0A 4FUWA 2JKFA 2ZL1B 1K0KA 1FILA 1PNEA 1J3WA 5FEGA 3DAVA 4X1LA 3KYEA 1G5UA 3T1SA 3CPTB 1CF0A 1PRQA 1VETB 5FDSA 4X25A 2HZ5A 4ESPA
chains in the Genus database with same CATH superfamily
2EX6A 3EGXC 2IA2A 3IS2A 1ESIA 1KE0A 1LSVA 3ZDJA 5E2HA 3O86A 3VV4A 1HVBA 4OOLA 1LI9A 1CI8A 4S2LA 5EOEA 3HJKA 1LSXA 4KG2A 1H3QA 3W4PA 5A93A 3DTKA 3HLFA 4GZBA 4LV0A 3HUMA 2UV0E 3T12B 4D2OA 2HDRA 3LGOA 3L7HA 2JKRM 2XRNA 4LENA 1W63Q 1SZVA 3M2JA 5E2FA 4MBHA 1SDEA 4R4RA 3A3DA 2NUPC 2D01A 4ZJ2A 5HPIA 3H7WA 1ES2A 4Y13A 3IH8A 3NULA 3IH9A 1TS0A 4Y0UA 5DVAA 1VEUA 2Z2LB 4MN7A 2L1MA 1YLZA 4DRTA 5EM1A 1SKOA 2PBDP 2P04A 3LR3A 1XFQA 5EV0A 2GJ3A 2W1RA 2Y2LA 5J4EA 3HLDA 2Y2NA 1NLYA 3OCLA 3T4QA 4EXOA 4EEUA 5TFQA 4N9KA 3K3DA 3TJZC 3S7NA 4X1LA 4HJ3A 1NZUA 3HCYA 1G5UA 3ZG9B 2EFXA 5I94A 5J8XA 3T1SA 5HAIA 3OPRA 1FOFA 3PTEA 5F83A 2PHYA 3A0RA 3W2ZA 2EX8A 2R9XA 4I5SA 3CJMA 3BFEA 1NWZA 2I72A 4P6ZM 4JXVA 2NUTC 1OT6A 2Y4AA 2I9VA 3LEZA 4CJNA 1DY6A 4RA7A 2DMWA 2W3HA 1H8YA 3ITAA 3TW8A 1DJAA 2XK1A 3W8KA 2RL3A 2OLVA 3SS3A 3JVVA 1JNUA 2GZAA 3Q7VB 3W4QA 1O07A 3CITA 3BQ8A 4BL3A 4H6JB 4S2PA 2XD5A 2R78A 4X1MA 3UO9A 3F1NB 4E3MA 4HJ6A 3VOZA 5KZHA 3LY4A 4FCFA 1L0EA 2WGWA 3I7JA 3LCEA 2XDMA 1PFLA 3U4LP 3AGDA 3QP1A 3IX4A 3KYZA 4CQHA 1Y54A 4JXSA 4I3AA 1P9WA 4FH4A 3UE1A 1GSXA 3PR6A 1HLUP 1ONHA 2PT7A 1BZAA 4EU0A 2K7SA 3CWFA 3MXQA 3BEBA 2HDQA 4PPRA 3WWXA 4NXBA 3MFXA 1K55C 1TF1A 2IWCA 1W8QA 3F1PA 4ZBEA 1TEMA 3ZCZA 1IYPA 1QMEA 3DBAA 3WS1A 4N1XA 2J9PA 1N9OA 2OWJA 1E25A 3A0VA 3N4IA 4Q0IA 3GDIA 1OJ5A 3A3EA 1VETA 1YSQA 1YQSA 3MSHA 3P01A 3CHWP 1PWGA 3QP8A 1FQGA 3IWOA 3D4FA 1KGGA 1LHYA 1DRMA 4N92A 3BQAA 3MMHA 5J3WA 3A0SA 2YKHA 3NOUC 3KX0X 3S1YA 4G3KA 4MEZA 2H5SA 2W1TB 3LUQA 1O7EA 4XT2B 4GNUA 2QMIA 2D02A 4OP5A 1LL5A 1NZOA 2V8CA 5F6AA 4IVKA 5M1AA 4QHCA 3ISGA 3OPLA 4NXFA 4KZ7A 4EW7A 1K6RA 4B93A 3N6IA 2O9AA 1K54C 4DJ3A 1S4RA 4ZJ1A 5FA7A 4BBVA 5CTNA 2Q9MA 3C7UA 4G3WA 3LR5A 5FSRA 2ZC6B 4R38A 1KE3A 4ARZA 2XLNA 5EVIB 2ZOIA 3CI6A 4X56A 3DW0A 2JHEA 3IHBA 3FKWA 3UPPA 2J80A 1FCMA 2QWSA 3Q7ZA 1H8MA 3CUEC 3UB9A 5FEGA 4BQMA 4LLOB 4O0PA 5EE8A 2O9CA 4S2IA 2H10A 2WKPA 4OOYA 4HIAA 1H8ZA 3DAVA 4BBTA 4PM7A 3IXBA 2CC1A 3P98A 3G32A 2CMNA 1CF0A 5F82A 5BOHA 1G28A 2JKTI 2WK0A 1F5MA 3HJIA 2VGLS 3IXGA 1E3UA 3T1QB 4PHTA 1PYYA 3VSLA 1UWNX 5HX9A 3S7OA 2PAVP 2EX2A 1SHVA 3PBQA 3MKFA 2GDNA 4L9GA 2UWXA 3F1OB 2B5RA 3AGFA 5HAPA 3A3IA 5GL9A 3UB5P 3O88A 4QD4A 1OTAA 4I39A 4UA7A 4ID4A 3HLGA 4OONA 3DWZA 4DE1A 3UPNA 2XA7S 4ME4A 5M18A 5HL1A 4P87A 4CLCB 4LFUA 3MQQA 1IELA 4AFIA 2OV5A 1OTDA 3IF6B 5FAOA 2OAP1 1JWPA 2K2NA 4R3BA 4WM9A 4WELA 3T4OA 4KZ8A 3EOIA 3BFFA 3D3OA 3EWKA 2WGVA 4DXCA 3C4PA 2P74A 4UAAA 3IQAA 3R7WA 3ZGAB 1NRFA 1ZKJA 4Q0JA 3GSGA 1XA7A 4E6XA 4PM8A 3NCKA 2J3TC 5DF8A 2KLIA 4BWIA 1ESUA 3K3CA 3BLMA 3SS5A 2ZL1A 5CGXA 2W0NA 3HLWA 4LPZA 1YMXA 3LYXA 4FTXA 4PM9A 3WRZA 1SKFA 2V1AA 1PI5A 4RQ9A 2VKSA 3WS2A 1VB6A 1W63M 3B47A 3CZDA 3CPTA 4S2OA 2HV1A 3MQOA 4JGQA 4LV3A 4YNRA 4FOFA 3S7PA 4BD1A 3UB6A 3MR0A 4GW9A 5DTSA 3A3FA 3JYIA 4PM6A 3JVUA 4QJGA 4U0TA 1K57C 4WL9A 5EM0A 4JF6A 4GD8A 3UB8A 4YOFA 3HVFA 3NDEA 5EVIC 1BSGA 3KSHA 4R70A 4DF6A 2Y2HA 4IUKA 2ZJ9A 2QZ6A 3CG5A 1GCEA 4HH3A 4HH2A 4RX2A 4CLCE 1WA9A 3UNWA 3PBSA 2V1ZA 1EW0A 5F1GA 1LSWA 2W3DA 1G6AA 1FR6A 3BJNA 4BENA 1FR1A 4OQ0A 4ZJ3A 4U3TA 3VE3A 2EXBA 4IBXA 4JXWA 3C5AA 4PMAA 2JCHA 2BG1A 3VOLA 2HGVA 5HSQA 4BJPA 3H82B 3NHQA 2VV7A 5AQAA 1QMFA 2WAEA 4Y3IA 1KOUA 4U0XA 3BLSA 4LV2A 2OLUA 3BECA 5DFXA 5HL6A 1BTLA 3LR0A 4IVIA 3RXXA 3O87A 1PI4A 2VV6A 4D60A 1G6OA 2BLSA 1OTIA 5F68A 4JPMA 5IT5A 4GHIB 4CLCC 4EWFA 5GHZA 3SW1A 2W27A 3IWIA 5G4ZA 4Y0OA 4UEYA 1LT0A 3OLOA 3IF6C 4K08A 5JYOA 4R4SA 4ZTKA 4I3IA 1I5QA 3O3VA 2L0WA 3SS4A 1W5DA 3QNBA 4GCZA 3T4TA 1GHPA 5CGWA 5AQ7A 1M6KA 2P9VB 3A3JA 4KZ5A 1T1AA 1GSWA 1OMEA 5AVEA 2V2FF 3GVBA 3IS2B 2Y2IA 1CI9A 2FFYA 3NY4A 3V39A 3HREA 4JXGA 3PAEA 1PWDA 4HESA 4FD8A 4DE3A 2QHKA 3N8LA 3QNCA 4EETB 5MC7A 4OVDA 2JBFA 3VMAA 4HP4A 4X25A 2Y91A 4N9LA 1RGYA 2K31A 2ZQ9A 1K25A 1XP4A 5TBMB 2ZM0A 5CHJA 4QY5A 2PD8A 3BY9A 4HI4A 3OC2A 3H7WB 1V9ZA 2Y2GA 3LIDA 2PYRA 1PW8A 1YT4A 1S67L 5HD5A 5KSCA 1KE4A 3HUNA 3Q7VA 4WZ5A 4A5RA 3QP2A 5FQJA 4DMZA 4ETZA 1SKOB 3KSIA 4GDBA 1TS7A 2PRFA 1XGJA 2WUQA 4KUKA 3F1NA 4Y0TA 3G35A 3S22A 2J3WA 4L9FA 1K56A 5FI2A 2ZOHA 3C7VA 4KQDA 4UA9A 3E2LA 3QP6A 1DJCA 3EQUA 3MBZA 3QP4A 2RCXA 4GDNA 2WKIA 3PHYA 4RYEA 3SOIA 2ZQ7A 3UDFA 2FZ0A 3UN7A 2JKTM 2PBYA 2ZMVA 3E4OA 3VP3A 3TG9A 1CK3A 2V0UA 3T4JA 3HLEA 5I5LA 4EBPA 1XJ3A 1G68A 1L0FA 3SH7A 4OH0A 3TOIA 3E4QA 4L0LA 4S2KA 1I2SA 4Z1WA 4P6BA 4Q0HA 5KSHA 4PKYA 2X01A 3TSGA 1PW1A 3G4PA 1PRQA 4BLMA 4Y17A 2Y2OA 3PXPA 1HTZA 5J7EA 2A49A 1OTEA 3GECA 3KYQA 1H0MA 2OSUA 4NG2A 2X71A 1L0DA 4NXGA 4C3QA 3G2ZA 3HBRA 3FV7A 2ZLYA 3HLCA 4KENB 3G31A 4P0MA 4R3AA 2W1TA 4JF4A 4B9OA 3CAXA 2KOIA 2QJ5A 1I2WA 1K4FA 3C2WA 4Y15A 3G30A 4EEPA 4OP8A 5FAPA 1S1ZA 3EEHA 4EQIA 3UE3A 1P97A 4UA6A 2JKRI 2HP5A 1MPLA 1BLHA 3ZVWA 4KZBA 4FH2A 1FCNA 4I38A 1MC0A 4NEED 2XEPA 5KMWA 5CEDA 4I3JA 5IHVA 2Q9NA 5HARA 1WYBA 3D72A 1ZTUA 5HAQA 4HHDA 5EVIA 5EOOA 1E4DA 5DF7A 3ICYA 1K0KA 1OJGA 3LIEA 3KSFA 4KQOA 1ES5A 3N8RA 3VSKA 1AXBA 3B42A 1V9YA 4OPRA 3AGEA 3UE6A 2OOLA 3V50A 1JWVA 3NC8A 3BW6A 5F69A 1IKIA 1YLPA 3LI8A 4KQQA 1XJ4A 2V0WA 3QP5A 3ZG5A 2VJWA 3UY6A 3MZFA 4MBFA 1S4SA 5FI6A 5DTTA 1LL8A 5CEBA 5HFOA 4BD0A 4DKIA 1MWTA 1TDLA 2PU2A 1YLTA 5EVID 4M4XA 3MXSA 5U47A 1IYSA 1WE4A 3RTYA 4EUZA 1Z09A 2V8FA 1NRJA 1MWUA 1N4OA 1PIOA 1SCWA 2M7VA 4E3LA 4B4XA 3F1OA 3R4KA 2VLGA 1ZG6A 1GA0A 4KZ9A 4MBKA 4KZ6A 4Y7PA 5G4YA 1VM1A 2XD1A 4S2NC 4GB7A 1VQQA 2ZM2A 4HBUA 1MBLA 2Y2JA 2BASA 4LRXC 1GHIA 2JKGA 2WAFA 4E3OA 3PAGA 1Q2QA 3IF5A 3UMEA 1TVFA 3DWKA 1OTBA 3SZTA 4F3LA 5HPFA 1KVLA 1A0KA 2Y2PA 3T1RA 4OOMA 3ZQ5A 1FSWA 3LEQA 1E3UD 1NY0A 3WS0A 3ZVTA 3G6OA 4WLAA 4WYYA 4PKYG 1XA1A 3E4PA 4GKUA 1PNEA 4HQAA 1WYCA 3EGDC 3E2KA 3T50A 4S2JA 4JBFA 1H5XA 2O9BA 4GS9A 1JWZA 3M6HA 1NJ4A 2AVXA 5GLDA 1S66L 4GJ4A 5FQ9A 2PU4A 4DDSA 1GA9A 5FDSA 5KIZA 2HZ5A 1XXMA 1XJ2A 5FQQA 4IJGA 2DCFA 4WZ4A 2HJ9C 4JF5A 2Y2MA 1DP8A 4X69A 3IXHA 4QB8A 4IEDA 3GR2A 5IU1A 2R9WA 1BLCA 2B02A 4WF0A 4ETXA 4JGOA 2DRWA 3OOVA 1AWIA 4NETA 1GSVA 5TR7A 1EI5A 2QKPA 4R3JA 3PBRA 2YKFA 3FPWA 2E8JA 3BM6A 2IWBA 2H0YA 5TGFA 1OT9A 1MY8A 1XKZA 1IYQA 4IHQA 1CJFA 3JPUA 3NJAA 2EA9A 1S1YA 3WRTA 2QYBA 2Y55A 2GX5A 2HF6A 5EUAA 4QY6A 1ACFA 1MKIA 2XFTA 4DN0A 3LO7A 1FCOA 5CHUA 4MDZA 2ZL1B 3LICA 2ZQAA 3KO6A 2JC7A 1T18A 4RX3A 4K91A 5AQ9A 1Z6FA 3M6BA 1LLBA 2WKQA 1N9BA 4P6ZS 3T4SA 2Z6CA 4OKPA 1KGFA 3CPTB 4OQHA 2KDKA 4YFMA 1T1CA 5CGSA 2WYXA 4ESPA 1RP5A 2G7UA 3MXRA 1K55A 1HD8A 5HDCA 2EWWA 2WZXA 3CLOA 4IUHA 1PZOA 1YSPA 4S2MA 5JYPA 1EWZA 2ZMAA 4OPYA 3FZCA 5FATA 3BFGA 4II7A 1GHMA 3RH8B 1XJ6A 3QHYA 3ZG7B 1ZC2A 5HW3A 3VP2A 5HZHA 5FL3A 1X0OA 1Y4OA 1JTGA 4E3IA 4N1HA 1JTDA 4IBRA 2XF3A 2ZM8A 2EFUA 1CEGA 3UE0A 3G34A 2PD7A 1UWPX 1KGEA 5L8MA 2ZC3B 5HWVA 2MJ6A 1DP9A 2EX9A 1U60A 2LB5A 2QJ7A 5CECA 2Z6DA 5TJJA 3C30A 2Y59A 1ALQA 2H28A 1F2KA 3PYPA 1IEMA 5DF9A 2PDRA 2A24B 3OPHA 3PBOA 5D3OA 5DKLA 2C5WB 3E0YA 3ZNTA 1BLSA 3LI9A 1TS6A 1JVJA 3PBNA 3RJUA 5DJUA 4B4ZA 3VFFA 4E3NA 1K54A 5FASA 3OZHA 3ULFA 1N9NA 1FSYA 4UQIM 1W8YA 4NKPA 3P7NA 3IWQA 4MLLA 2EXAA 4DJ2A 1PWCA 3IHAA 1CEFA 5C5KA 3BRMA 1F98A 3CUEA 2HP6A 4X6TA 5TBMA 2ZC4B 1TD5A 3W4OA 4WEJA 2ZD8A 3HUOA 2G2WA 5L07A 3UDXA 1DJBA 4JKTA 4LRYC 5HDDA 4MCWA 4GLQA 2O0YA 2OAQ1 2XGNA 4XXRA 1MKMA 5CERA 1UGUA 4HEFA 1YPRA 5EPHA 4S2NA 4O7DA 1YLYA 1VEUB 4NXEA 4H6JA 4YWZA 5A90A 4KZAA 4KZ4A 3ZG0A 1L3LA 5FDHA 3GQZA 1CQAA 2HP9A 3LFVA 2ZQ8A 2G2UA 4QPRA 2DNSA 3E98A 3MKEA 3HLBA 2HPBA 1ODVA 4PAUA 4F94A 4E6WA 3U2AA 2V9AA 2KX6A 5HDSA 2PR6A 2PR5A 4EESA 2M1CA 4L9EA 3UPOA 2XH9A 4O01A 1IKGA 4GN2A 1J9MA 3FG8A 1NXYA 4K0XA 4OLDA 2L4RA 2HDSA 4YINA 1SDNA 2Y2QA 4LCLA 2PYPA 2WKRA 4DXBA 4WMCA 4QU3A 1NLZA 3NI9A 3FYZA 1P0ZA 3V3RA 2V1BA 2EWVA 3T1XA 5CRFA 1IOUA 3Q1FA 4Y5FA 1K56D 1DP6A 1XFNA 4ZAMA 2X02A 4KQRA 3OBFA 2J7VA 3HL9A 3RXWA 2VZWA 4CPKA 4UHUA 4OPQA 2XROA 5FI7A 2HJEA 1XX2A 1IFQA 3WS4A 1T1BA 3LIAA 3O5YA 3MZEA 4MN5A 2WGWB 2BTFP 3OCNA 1FIKA 1IYOA 2ZMFA 4JGRA 3VFHA 4WMCD 2W3EA 1L2SA 3IBJA 4XUZA 1T19A 1XPBA 1P9RA 5G18A 2HDUA 2J3TD 4XT2A 3UB7A 5EFWA 5E2GA 2XFSA 3CMZA 4R6LA 3D9YA 3F1PB 3FWLA 4X68A 3V5MA 3LIBA 2VEAA 1YAXA 4OLGA 4ZDXA 1Y28A 2A3UA 1K57A 3SH8A 3V67A 2WZZA 4X55A 4E04A 1ES3A 3MJQA 4LV1A 3V3SA 5AVFA 4C75A 1BUEA 1ZHHB 3MFDA 2W3GA 4R0QA 1YLWA 1BULA 1VETB 5AJGA 1D1JA 1XGIA 4PM5A 3C38A 3G2YA 1N9LA 1BLPA 5FQKA 3TE8A 2B95A 4EUVA 1L0GA 2JN7A 3ITBA 1LL9A 1HZOA 4QWOA 3T4KA 2VV8A 3PBTA 2GNXA 3P09A 3UMDA 3L9KA 5AQBA 4BL2A 3IBRA 4HBTA 4EV4A 5EECA 2INWA 5CXWA 3T4LA 5FAQA 1K6SA 5E43A 3K2NA 4MN6A 2XSSA 1KDSA 1PZPA 1S0WA 2FFFB 1RGZA 3MF0A 2E8IA 4Y2FA 3GV9A 1F9IA 2XR0A 5LBRA 4XUXA 5FEFA 3MQ0A 1M40A 5L09A 2WKEA 4ARZB 4P85A 3KSGA 2IWDA 3NBLA 4Q8IA 1S6RA 2M7UA 1YKDA 4WBGA 2ZC7A 3FKVA 1KDWA 2VK3A 2WKHA 5CX7A 1ES4A 2JKFA 4CLCA 5GHXA 3BFDA 2VA0A 4HJ4A 5K5BA 3GMWA 3DTIA 3ZHHA 4LRZE 3ZG8B 4WN5A 3IF6A 1W79A 3N7WA 3KYEA 3Q81A 1MWSA 4NK3A 1KVMA 4C6YA 4WZ5C 2Z2MB 1ZG4A 4LCMA 3TRCA 1BYWA 3LIFA 5A8BA 5DTKA 2W3FA 4JLFA 4HP9A 4MMNA 3GTCA 2ZC5B 3Q07A 2OWHA 1NYMA 3EEAA 1D7EA 3EQVA 1Q2PA 4CLCD 3MZDA 4GOGA 4WUJA 3B33A 4WEKA 4BMWA 4R1GA 1ONGA 3UDIA 1EROA 3VP0A 5FQMA 4F3LB 1ERQA 1C3BA 3WS5A 4JGPA 4DE2A 3FPVA 3NOPC 3B3XA 2J9OA 5E2EA 2C6WB 4E3KA 5DKKA 5EVLA 4DDYA 1YM1A 4HOIA 4M3KA 3RFBA 1BT5A 5GLCA 5GLAA 1MXOA 2ZQCA 4RVAA 3ZFZA 4UQIS 4OPZA 4O8GA 2H0TA 3IXDA 4GS9B 5HWWA 4BBUA 3VP1A 5IS1A 1MZUA 2Y8HA 3R7WB 3LR4A 2JE5A 4FUWA 2LB9A 5L10A 1FILA 1NYYA 3NOTC 3S4XA 3SH9A 5DJTA 4E3JA 2A2LA 4HY8A 1LI0A 5A92A 4MNRA 5FQIA 3H9WA 4R23A 2VX8A 4HNBA 3C4OA 2ZQDA 5CHMA 4K0WA 4OQGA 3IT9A 1STZA 2O99A 5HD3A 3BY8A 4LGWA 2WGIA 5F1FA 4EBLA 3NECA 3BFCA 3MS6A 5EVEA 1VHMA 2P08A 1K38A 4GD6A 2FH5A 4FSFA 4OQIA 4DE0A 3ZYTA 3FC7A 3GRJA 4KG5A 5M19A 3H82A 5A91A 4EERA 2VGLM 2Y79A 4G3VA 3IX3A 5DFYA 4Z9QA 3Q82A 4ZRRA 4X53A 3BWLA 5L2FA 2WADA 3M2KA 3N8SA 1K4EA 1ERMA 4EQ1A 4KUOA 4EBNA 2P7JA 3ZNYA 3OPPA 1OPXA 3NIAA 1W7FA 1YLJA 2ACGA 4KZ3A 4B88A 3VP4A 3C8CA 2Q0OA 2J8YA 3NDGA 4GHIA 5GHYA 3DTEA 2VGJA 2V20A 5GLBA 5HWTA 1RCJA 2Y2KA 1MWRA 5F5YA 2A24A 2ZBBA 3VE4A 2XA7M 3VOYA 3DTMA 1J3WA 4H8RA 2VGKA 1D06A 2XQZA 3BYDA 3S7QA 1TS8A 2B18A 5CTMA 2P9VA 1YMSA 1TDGA 3LY3A 3IX8A 4KG6A 2QPNA
chains in the Genus database with same CATH topology
1D1JA 1VETA 2ZL1A 3T1QB 3MSHA 3CHWP 4FTXA 2B95A 3T1XA 3NECA 2PAVP 1Z09A 2V8FA 4QWOA 3MS6A 5EVEA 3L9KA 4D60A 3CPTA 3UB5P 3T12B 3LGOA 3L7HA 1AWIA 2V8CA 4X1MA 1SKOB 2PRFA 1Y4OA 2BTFP 1FIKA 1SZVA 2E8JA 5FEFA 1PFLA 3U4LP 1YPRA 5EM0A 2JKGA 1CJFA 3NULA 1HLUP 1VEUB 1A0KA 2ACGA 3T1RA 1VEUA 1ACFA 1CQAA 5EM1A 1F2KA 3D9YA 1SKOA 2VK3A 2PBDP 3LEQA 5EV0A 4FUWA 2JKFA 2ZL1B 1K0KA 1FILA 1PNEA 1J3WA 5FEGA 3DAVA 4X1LA 3KYEA 1G5UA 3T1SA 3CPTB 1CF0A 1PRQA 1VETB 5FDSA 4X25A 2HZ5A 4ESPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1J A;  1VET A;  2ZL1 A;  3T1Q B;  3MSH A;  3CHW P;  4FTX A;  2B95 A;  3T1X A;  3NEC A;  2PAV P;  1Z09 A;  2V8F A;  4QWO A;  3MS6 A;  5EVE A;  3L9K A;  4D60 A;  3CPT A;  3UB5 P;  3T12 B;  3LGO A;  3L7H A;  1AWI A;  2V8C A;  4X1M A;  1SKO B;  2PRF A;  1Y4O A;  2BTF P;  1FIK A;  1SZV A;  2E8J A;  5FEF A;  1PFL A;  3U4L P;  1YPR A;  5EM0 A;  2JKG A;  1CJF A;  3NUL A;  1HLU P;  1VEU B;  1A0K A;  2ACG A;  3T1R A;  1VEU A;  1ACF A;  1CQA A;  5EM1 A;  1F2K A;  3D9Y A;  1SKO A;  2VK3 A;  2PBD P;  3LEQ A;  5EV0 A;  4FUW A;  2JKF A;  2ZL1 B;  1K0K A;  1FIL A;  1PNE A;  1J3W A;  5FEG A;  3DAV A;  4X1L A;  3KYE A;  1G5U A;  3T1S A;  3CPT B;  1CF0 A;  1PRQ A;  1VET B;  5FDS A;  4X25 A;  2HZ5 A;  4ESP A; 
#chains in the Genus database with same CATH topology
 2EX6 A;  3EGX C;  2IA2 A;  3IS2 A;  1ESI A;  1KE0 A;  1LSV A;  3ZDJ A;  5E2H A;  3O86 A;  3VV4 A;  1HVB A;  4OOL A;  1LI9 A;  1CI8 A;  4S2L A;  5EOE A;  3HJK A;  1LSX A;  4KG2 A;  1H3Q A;  3W4P A;  5A93 A;  3DTK A;  3HLF A;  4GZB A;  4LV0 A;  3HUM A;  2UV0 E;  3T12 B;  4D2O A;  2HDR A;  3LGO A;  3L7H A;  2JKR M;  2XRN A;  4LEN A;  1W63 Q;  1SZV A;  3M2J A;  5E2F A;  4MBH A;  1SDE A;  4R4R A;  3A3D A;  2NUP C;  2D01 A;  4ZJ2 A;  5HPI A;  3H7W A;  1ES2 A;  4Y13 A;  3IH8 A;  3NUL A;  3IH9 A;  1TS0 A;  4Y0U A;  5DVA A;  1VEU A;  2Z2L B;  4MN7 A;  2L1M A;  1YLZ A;  4DRT A;  5EM1 A;  1SKO A;  2PBD P;  2P04 A;  3LR3 A;  1XFQ A;  5EV0 A;  2GJ3 A;  2W1R A;  2Y2L A;  5J4E A;  3HLD A;  2Y2N A;  1NLY A;  3OCL A;  3T4Q A;  4EXO A;  4EEU A;  5TFQ A;  4N9K A;  3K3D A;  3TJZ C;  3S7N A;  4X1L A;  4HJ3 A;  1NZU A;  3HCY A;  1G5U A;  3ZG9 B;  2EFX A;  5I94 A;  5J8X A;  3T1S A;  5HAI A;  3OPR A;  1FOF A;  3PTE A;  5F83 A;  2PHY A;  3A0R A;  3W2Z A;  2EX8 A;  2R9X A;  4I5S A;  3CJM A;  3BFE A;  1NWZ A;  2I72 A;  4P6Z M;  4JXV A;  2NUT C;  1OT6 A;  2Y4A A;  2I9V A;  3LEZ A;  4CJN A;  1DY6 A;  4RA7 A;  2DMW A;  2W3H A;  1H8Y A;  3ITA A;  3TW8 A;  1DJA A;  2XK1 A;  3W8K A;  2RL3 A;  2OLV A;  3SS3 A;  3JVV A;  1JNU A;  2GZA A;  3Q7V B;  3W4Q A;  1O07 A;  3CIT A;  3BQ8 A;  4BL3 A;  4H6J B;  4S2P A;  2XD5 A;  2R78 A;  4X1M A;  3UO9 A;  3F1N B;  4E3M A;  4HJ6 A;  3VOZ A;  5KZH A;  3LY4 A;  4FCF A;  1L0E A;  2WGW A;  3I7J A;  3LCE A;  2XDM A;  1PFL A;  3U4L P;  3AGD A;  3QP1 A;  3IX4 A;  3KYZ A;  4CQH A;  1Y54 A;  4JXS A;  4I3A A;  1P9W A;  4FH4 A;  3UE1 A;  1GSX A;  3PR6 A;  1HLU P;  1ONH A;  2PT7 A;  1BZA A;  4EU0 A;  2K7S A;  3CWF A;  3MXQ A;  3BEB A;  2HDQ A;  4PPR A;  3WWX A;  4NXB A;  3MFX A;  1K55 C;  1TF1 A;  2IWC A;  1W8Q A;  3F1P A;  4ZBE A;  1TEM A;  3ZCZ A;  1IYP A;  1QME A;  3DBA A;  3WS1 A;  4N1X A;  2J9P A;  1N9O A;  2OWJ A;  1E25 A;  3A0V A;  3N4I A;  4Q0I A;  3GDI A;  1OJ5 A;  3A3E A;  1VET A;  1YSQ A;  1YQS A;  3MSH A;  3P01 A;  3CHW P;  1PWG A;  3QP8 A;  1FQG A;  3IWO A;  3D4F A;  1KGG A;  1LHY A;  1DRM A;  4N92 A;  3BQA A;  3MMH A;  5J3W A;  3A0S A;  2YKH A;  3NOU C;  3KX0 X;  3S1Y A;  4G3K A;  4MEZ A;  2H5S A;  2W1T B;  3LUQ A;  1O7E A;  4XT2 B;  4GNU A;  2QMI A;  2D02 A;  4OP5 A;  1LL5 A;  1NZO A;  2V8C A;  5F6A A;  4IVK A;  5M1A A;  4QHC A;  3ISG A;  3OPL A;  4NXF A;  4KZ7 A;  4EW7 A;  1K6R A;  4B93 A;  3N6I A;  2O9A A;  1K54 C;  4DJ3 A;  1S4R A;  4ZJ1 A;  5FA7 A;  4BBV A;  5CTN A;  2Q9M A;  3C7U A;  4G3W A;  3LR5 A;  5FSR A;  2ZC6 B;  4R38 A;  1KE3 A;  4ARZ A;  2XLN A;  5EVI B;  2ZOI A;  3CI6 A;  4X56 A;  3DW0 A;  2JHE A;  3IHB A;  3FKW A;  3UPP A;  2J80 A;  1FCM A;  2QWS A;  3Q7Z A;  1H8M A;  3CUE C;  3UB9 A;  5FEG A;  4BQM A;  4LLO B;  4O0P A;  5EE8 A;  2O9C A;  4S2I A;  2H10 A;  2WKP A;  4OOY A;  4HIA A;  1H8Z A;  3DAV A;  4BBT A;  4PM7 A;  3IXB A;  2CC1 A;  3P98 A;  3G32 A;  2CMN A;  1CF0 A;  5F82 A;  5BOH A;  1G28 A;  2JKT I;  2WK0 A;  1F5M A;  3HJI A;  2VGL S;  3IXG A;  1E3U A;  3T1Q B;  4PHT A;  1PYY A;  3VSL A;  1UWN X;  5HX9 A;  3S7O A;  2PAV P;  2EX2 A;  1SHV A;  3PBQ A;  3MKF A;  2GDN A;  4L9G A;  2UWX A;  3F1O B;  2B5R A;  3AGF A;  5HAP A;  3A3I A;  5GL9 A;  3UB5 P;  3O88 A;  4QD4 A;  1OTA A;  4I39 A;  4UA7 A;  4ID4 A;  3HLG A;  4OON A;  3DWZ A;  4DE1 A;  3UPN A;  2XA7 S;  4ME4 A;  5M18 A;  5HL1 A;  4P87 A;  4CLC B;  4LFU A;  3MQQ A;  1IEL A;  4AFI A;  2OV5 A;  1OTD A;  3IF6 B;  5FAO A;  2OAP 1;  1JWP A;  2K2N A;  4R3B A;  4WM9 A;  4WEL A;  3T4O A;  4KZ8 A;  3EOI A;  3BFF A;  3D3O A;  3EWK A;  2WGV A;  4DXC A;  3C4P A;  2P74 A;  4UAA A;  3IQA A;  3R7W A;  3ZGA B;  1NRF A;  1ZKJ A;  4Q0J A;  3GSG A;  1XA7 A;  4E6X A;  4PM8 A;  3NCK A;  2J3T C;  5DF8 A;  2KLI A;  4BWI A;  1ESU A;  3K3C A;  3BLM A;  3SS5 A;  2ZL1 A;  5CGX A;  2W0N A;  3HLW A;  4LPZ A;  1YMX A;  3LYX A;  4FTX A;  4PM9 A;  3WRZ A;  1SKF A;  2V1A A;  1PI5 A;  4RQ9 A;  2VKS A;  3WS2 A;  1VB6 A;  1W63 M;  3B47 A;  3CZD A;  3CPT A;  4S2O A;  2HV1 A;  3MQO A;  4JGQ A;  4LV3 A;  4YNR A;  4FOF A;  3S7P A;  4BD1 A;  3UB6 A;  3MR0 A;  4GW9 A;  5DTS A;  3A3F A;  3JYI A;  4PM6 A;  3JVU A;  4QJG A;  4U0T A;  1K57 C;  4WL9 A;  5EM0 A;  4JF6 A;  4GD8 A;  3UB8 A;  4YOF A;  3HVF A;  3NDE A;  5EVI C;  1BSG A;  3KSH A;  4R70 A;  4DF6 A;  2Y2H A;  4IUK A;  2ZJ9 A;  2QZ6 A;  3CG5 A;  1GCE A;  4HH3 A;  4HH2 A;  4RX2 A;  4CLC E;  1WA9 A;  3UNW A;  3PBS A;  2V1Z A;  1EW0 A;  5F1G A;  1LSW A;  2W3D A;  1G6A A;  1FR6 A;  3BJN A;  4BEN A;  1FR1 A;  4OQ0 A;  4ZJ3 A;  4U3T A;  3VE3 A;  2EXB A;  4IBX A;  4JXW A;  3C5A A;  4PMA A;  2JCH A;  2BG1 A;  3VOL A;  2HGV A;  5HSQ A;  4BJP A;  3H82 B;  3NHQ A;  2VV7 A;  5AQA A;  1QMF A;  2WAE A;  4Y3I A;  1KOU A;  4U0X A;  3BLS A;  4LV2 A;  2OLU A;  3BEC A;  5DFX A;  5HL6 A;  1BTL A;  3LR0 A;  4IVI A;  3RXX A;  3O87 A;  1PI4 A;  2VV6 A;  4D60 A;  1G6O A;  2BLS A;  1OTI A;  5F68 A;  4JPM A;  5IT5 A;  4GHI B;  4CLC C;  4EWF A;  5GHZ A;  3SW1 A;  2W27 A;  3IWI A;  5G4Z A;  4Y0O A;  4UEY A;  1LT0 A;  3OLO A;  3IF6 C;  4K08 A;  5JYO A;  4R4S A;  4ZTK A;  4I3I A;  1I5Q A;  3O3V A;  2L0W A;  3SS4 A;  1W5D A;  3QNB A;  4GCZ A;  3T4T A;  1GHP A;  5CGW A;  5AQ7 A;  1M6K A;  2P9V B;  3A3J A;  4KZ5 A;  1T1A A;  1GSW A;  1OME A;  5AVE A;  2V2F F;  3GVB A;  3IS2 B;  2Y2I A;  1CI9 A;  2FFY A;  3NY4 A;  3V39 A;  3HRE A;  4JXG A;  3PAE A;  1PWD A;  4HES A;  4FD8 A;  4DE3 A;  2QHK A;  3N8L A;  3QNC A;  4EET B;  5MC7 A;  4OVD A;  2JBF A;  3VMA A;  4HP4 A;  4X25 A;  2Y91 A;  4N9L A;  1RGY A;  2K31 A;  2ZQ9 A;  1K25 A;  1XP4 A;  5TBM B;  2ZM0 A;  5CHJ A;  4QY5 A;  2PD8 A;  3BY9 A;  4HI4 A;  3OC2 A;  3H7W B;  1V9Z A;  2Y2G A;  3LID A;  2PYR A;  1PW8 A;  1YT4 A;  1S67 L;  5HD5 A;  5KSC A;  1KE4 A;  3HUN A;  3Q7V A;  4WZ5 A;  4A5R A;  3QP2 A;  5FQJ A;  4DMZ A;  4ETZ A;  1SKO B;  3KSI A;  4GDB A;  1TS7 A;  2PRF A;  1XGJ A;  2WUQ A;  4KUK A;  3F1N A;  4Y0T A;  3G35 A;  3S22 A;  2J3W A;  4L9F A;  1K56 A;  5FI2 A;  2ZOH A;  3C7V A;  4KQD A;  4UA9 A;  3E2L A;  3QP6 A;  1DJC A;  3EQU A;  3MBZ A;  3QP4 A;  2RCX A;  4GDN A;  2WKI A;  3PHY A;  4RYE A;  3SOI A;  2ZQ7 A;  3UDF A;  2FZ0 A;  3UN7 A;  2JKT M;  2PBY A;  2ZMV A;  3E4O A;  3VP3 A;  3TG9 A;  1CK3 A;  2V0U A;  3T4J A;  3HLE A;  5I5L A;  4EBP A;  1XJ3 A;  1G68 A;  1L0F A;  3SH7 A;  4OH0 A;  3TOI A;  3E4Q A;  4L0L A;  4S2K A;  1I2S A;  4Z1W A;  4P6B A;  4Q0H A;  5KSH A;  4PKY A;  2X01 A;  3TSG A;  1PW1 A;  3G4P A;  1PRQ A;  4BLM A;  4Y17 A;  2Y2O A;  3PXP A;  1HTZ A;  5J7E A;  2A49 A;  1OTE A;  3GEC A;  3KYQ A;  1H0M A;  2OSU A;  4NG2 A;  2X71 A;  1L0D A;  4NXG A;  4C3Q A;  3G2Z A;  3HBR A;  3FV7 A;  2ZLY A;  3HLC A;  4KEN B;  3G31 A;  4P0M A;  4R3A A;  2W1T A;  4JF4 A;  4B9O A;  3CAX A;  2KOI A;  2QJ5 A;  1I2W A;  1K4F A;  3C2W A;  4Y15 A;  3G30 A;  4EEP A;  4OP8 A;  5FAP A;  1S1Z A;  3EEH A;  4EQI A;  3UE3 A;  1P97 A;  4UA6 A;  2JKR I;  2HP5 A;  1MPL A;  1BLH A;  3ZVW A;  4KZB A;  4FH2 A;  1FCN A;  4I38 A;  1MC0 A;  4NEE D;  2XEP A;  5KMW A;  5CED A;  4I3J A;  5IHV A;  2Q9N A;  5HAR A;  1WYB A;  3D72 A;  1ZTU A;  5HAQ A;  4HHD A;  5EVI A;  5EOO A;  1E4D A;  5DF7 A;  3ICY A;  1K0K A;  1OJG A;  3LIE A;  3KSF A;  4KQO A;  1ES5 A;  3N8R A;  3VSK A;  1AXB A;  3B42 A;  1V9Y A;  4OPR A;  3AGE A;  3UE6 A;  2OOL A;  3V50 A;  1JWV A;  3NC8 A;  3BW6 A;  5F69 A;  1IKI A;  1YLP A;  3LI8 A;  4KQQ A;  1XJ4 A;  2V0W A;  3QP5 A;  3ZG5 A;  2VJW A;  3UY6 A;  3MZF A;  4MBF A;  1S4S A;  5FI6 A;  5DTT A;  1LL8 A;  5CEB A;  5HFO A;  4BD0 A;  4DKI A;  1MWT A;  1TDL A;  2PU2 A;  1YLT A;  5EVI D;  4M4X A;  3MXS A;  5U47 A;  1IYS A;  1WE4 A;  3RTY A;  4EUZ A;  1Z09 A;  2V8F A;  1NRJ A;  1MWU A;  1N4O A;  1PIO A;  1SCW A;  2M7V A;  4E3L A;  4B4X A;  3F1O A;  3R4K A;  2VLG A;  1ZG6 A;  1GA0 A;  4KZ9 A;  4MBK A;  4KZ6 A;  4Y7P A;  5G4Y A;  1VM1 A;  2XD1 A;  4S2N C;  4GB7 A;  1VQQ A;  2ZM2 A;  4HBU A;  1MBL A;  2Y2J A;  2BAS A;  4LRX C;  1GHI A;  2JKG A;  2WAF A;  4E3O A;  3PAG A;  1Q2Q A;  3IF5 A;  3UME A;  1TVF A;  3DWK A;  1OTB A;  3SZT A;  4F3L A;  5HPF A;  1KVL A;  1A0K A;  2Y2P A;  3T1R A;  4OOM A;  3ZQ5 A;  1FSW A;  3LEQ A;  1E3U D;  1NY0 A;  3WS0 A;  3ZVT A;  3G6O A;  4WLA A;  4WYY A;  4PKY G;  1XA1 A;  3E4P A;  4GKU A;  1PNE A;  4HQA A;  1WYC A;  3EGD C;  3E2K A;  3T50 A;  4S2J A;  4JBF A;  1H5X A;  2O9B A;  4GS9 A;  1JWZ A;  3M6H A;  1NJ4 A;  2AVX A;  5GLD A;  1S66 L;  4GJ4 A;  5FQ9 A;  2PU4 A;  4DDS A;  1GA9 A;  5FDS A;  5KIZ A;  2HZ5 A;  1XXM A;  1XJ2 A;  5FQQ A;  4IJG A;  2DCF A;  4WZ4 A;  2HJ9 C;  4JF5 A;  2Y2M A;  1DP8 A;  4X69 A;  3IXH A;  4QB8 A;  4IED A;  3GR2 A;  5IU1 A;  2R9W A;  1BLC A;  2B02 A;  4WF0 A;  4ETX A;  4JGO A;  2DRW A;  3OOV A;  1AWI A;  4NET A;  1GSV A;  5TR7 A;  1EI5 A;  2QKP A;  4R3J A;  3PBR A;  2YKF A;  3FPW A;  2E8J A;  3BM6 A;  2IWB A;  2H0Y A;  5TGF A;  1OT9 A;  1MY8 A;  1XKZ A;  1IYQ A;  4IHQ A;  1CJF A;  3JPU A;  3NJA A;  2EA9 A;  1S1Y A;  3WRT A;  2QYB A;  2Y55 A;  2GX5 A;  2HF6 A;  5EUA A;  4QY6 A;  1ACF A;  1MKI A;  2XFT A;  4DN0 A;  3LO7 A;  1FCO A;  5CHU A;  4MDZ A;  2ZL1 B;  3LIC A;  2ZQA A;  3KO6 A;  2JC7 A;  1T18 A;  4RX3 A;  4K91 A;  5AQ9 A;  1Z6F A;  3M6B A;  1LLB A;  2WKQ A;  1N9B A;  4P6Z S;  3T4S A;  2Z6C A;  4OKP A;  1KGF A;  3CPT B;  4OQH A;  2KDK A;  4YFM A;  1T1C A;  5CGS A;  2WYX A;  4ESP A;  1RP5 A;  2G7U A;  3MXR A;  1K55 A;  1HD8 A;  5HDC A;  2EWW A;  2WZX A;  3CLO A;  4IUH A;  1PZO A;  1YSP A;  4S2M A;  5JYP A;  1EWZ A;  2ZMA A;  4OPY A;  3FZC A;  5FAT A;  3BFG A;  4II7 A;  1GHM A;  3RH8 B;  1XJ6 A;  3QHY A;  3ZG7 B;  1ZC2 A;  5HW3 A;  3VP2 A;  5HZH A;  5FL3 A;  1X0O A;  1Y4O A;  1JTG A;  4E3I A;  4N1H A;  1JTD A;  4IBR A;  2XF3 A;  2ZM8 A;  2EFU A;  1CEG A;  3UE0 A;  3G34 A;  2PD7 A;  1UWP X;  1KGE A;  5L8M A;  2ZC3 B;  5HWV A;  2MJ6 A;  1DP9 A;  2EX9 A;  1U60 A;  2LB5 A;  2QJ7 A;  5CEC A;  2Z6D A;  5TJJ A;  3C30 A;  2Y59 A;  1ALQ A;  2H28 A;  1F2K A;  3PYP A;  1IEM A;  5DF9 A;  2PDR A;  2A24 B;  3OPH A;  3PBO A;  5D3O A;  5DKL A;  2C5W B;  3E0Y A;  3ZNT A;  1BLS A;  3LI9 A;  1TS6 A;  1JVJ A;  3PBN A;  3RJU A;  5DJU A;  4B4Z A;  3VFF A;  4E3N A;  1K54 A;  5FAS A;  3OZH A;  3ULF A;  1N9N A;  1FSY A;  4UQI M;  1W8Y A;  4NKP A;  3P7N A;  3IWQ A;  4MLL A;  2EXA A;  4DJ2 A;  1PWC A;  3IHA A;  1CEF A;  5C5K A;  3BRM A;  1F98 A;  3CUE A;  2HP6 A;  4X6T A;  5TBM A;  2ZC4 B;  1TD5 A;  3W4O A;  4WEJ A;  2ZD8 A;  3HUO A;  2G2W A;  5L07 A;  3UDX A;  1DJB A;  4JKT A;  4LRY C;  5HDD A;  4MCW A;  4GLQ A;  2O0Y A;  2OAQ 1;  2XGN A;  4XXR A;  1MKM A;  5CER A;  1UGU A;  4HEF A;  1YPR A;  5EPH A;  4S2N A;  4O7D A;  1YLY A;  1VEU B;  4NXE A;  4H6J A;  4YWZ A;  5A90 A;  4KZA A;  4KZ4 A;  3ZG0 A;  1L3L A;  5FDH A;  3GQZ A;  1CQA A;  2HP9 A;  3LFV A;  2ZQ8 A;  2G2U A;  4QPR A;  2DNS A;  3E98 A;  3MKE A;  3HLB A;  2HPB A;  1ODV A;  4PAU A;  4F94 A;  4E6W A;  3U2A A;  2V9A A;  2KX6 A;  5HDS A;  2PR6 A;  2PR5 A;  4EES A;  2M1C A;  4L9E A;  3UPO A;  2XH9 A;  4O01 A;  1IKG A;  4GN2 A;  1J9M A;  3FG8 A;  1NXY A;  4K0X A;  4OLD A;  2L4R A;  2HDS A;  4YIN A;  1SDN A;  2Y2Q A;  4LCL A;  2PYP A;  2WKR A;  4DXB A;  4WMC A;  4QU3 A;  1NLZ A;  3NI9 A;  3FYZ A;  1P0Z A;  3V3R A;  2V1B A;  2EWV A;  3T1X A;  5CRF A;  1IOU A;  3Q1F A;  4Y5F A;  1K56 D;  1DP6 A;  1XFN A;  4ZAM A;  2X02 A;  4KQR A;  3OBF A;  2J7V A;  3HL9 A;  3RXW A;  2VZW A;  4CPK A;  4UHU A;  4OPQ A;  2XRO A;  5FI7 A;  2HJE A;  1XX2 A;  1IFQ A;  3WS4 A;  1T1B A;  3LIA A;  3O5Y A;  3MZE A;  4MN5 A;  2WGW B;  2BTF P;  3OCN A;  1FIK A;  1IYO A;  2ZMF A;  4JGR A;  3VFH A;  4WMC D;  2W3E A;  1L2S A;  3IBJ A;  4XUZ A;  1T19 A;  1XPB A;  1P9R A;  5G18 A;  2HDU A;  2J3T D;  4XT2 A;  3UB7 A;  5EFW A;  5E2G A;  2XFS A;  3CMZ A;  4R6L A;  3D9Y A;  3F1P B;  3FWL A;  4X68 A;  3V5M A;  3LIB A;  2VEA A;  1YAX A;  4OLG A;  4ZDX A;  1Y28 A;  2A3U A;  1K57 A;  3SH8 A;  3V67 A;  2WZZ A;  4X55 A;  4E04 A;  1ES3 A;  3MJQ A;  4LV1 A;  3V3S A;  5AVF A;  4C75 A;  1BUE A;  1ZHH B;  3MFD A;  2W3G A;  4R0Q A;  1YLW A;  1BUL A;  1VET B;  5AJG A;  1D1J A;  1XGI A;  4PM5 A;  3C38 A;  3G2Y A;  1N9L A;  1BLP A;  5FQK A;  3TE8 A;  2B95 A;  4EUV A;  1L0G A;  2JN7 A;  3ITB A;  1LL9 A;  1HZO A;  4QWO A;  3T4K A;  2VV8 A;  3PBT A;  2GNX A;  3P09 A;  3UMD A;  3L9K A;  5AQB A;  4BL2 A;  3IBR A;  4HBT A;  4EV4 A;  5EEC A;  2INW A;  5CXW A;  3T4L A;  5FAQ A;  1K6S A;  5E43 A;  3K2N A;  4MN6 A;  2XSS A;  1KDS A;  1PZP A;  1S0W A;  2FFF B;  1RGZ A;  3MF0 A;  2E8I A;  4Y2F A;  3GV9 A;  1F9I A;  2XR0 A;  5LBR A;  4XUX A;  5FEF A;  3MQ0 A;  1M40 A;  5L09 A;  2WKE A;  4ARZ B;  4P85 A;  3KSG A;  2IWD A;  3NBL A;  4Q8I A;  1S6R A;  2M7U A;  1YKD A;  4WBG A;  2ZC7 A;  3FKV A;  1KDW A;  2VK3 A;  2WKH A;  5CX7 A;  1ES4 A;  2JKF A;  4CLC A;  5GHX A;  3BFD A;  2VA0 A;  4HJ4 A;  5K5B A;  3GMW A;  3DTI A;  3ZHH A;  4LRZ E;  3ZG8 B;  4WN5 A;  3IF6 A;  1W79 A;  3N7W A;  3KYE A;  3Q81 A;  1MWS A;  4NK3 A;  1KVM A;  4C6Y A;  4WZ5 C;  2Z2M B;  1ZG4 A;  4LCM A;  3TRC A;  1BYW A;  3LIF A;  5A8B A;  5DTK A;  2W3F A;  4JLF A;  4HP9 A;  4MMN A;  3GTC A;  2ZC5 B;  3Q07 A;  2OWH A;  1NYM A;  3EEA A;  1D7E A;  3EQV A;  1Q2P A;  4CLC D;  3MZD A;  4GOG A;  4WUJ A;  3B33 A;  4WEK A;  4BMW A;  4R1G A;  1ONG A;  3UDI A;  1ERO A;  3VP0 A;  5FQM A;  4F3L B;  1ERQ A;  1C3B A;  3WS5 A;  4JGP A;  4DE2 A;  3FPV A;  3NOP C;  3B3X A;  2J9O A;  5E2E A;  2C6W B;  4E3K A;  5DKK A;  5EVL A;  4DDY A;  1YM1 A;  4HOI A;  4M3K A;  3RFB A;  1BT5 A;  5GLC A;  5GLA A;  1MXO A;  2ZQC A;  4RVA A;  3ZFZ A;  4UQI S;  4OPZ A;  4O8G A;  2H0T A;  3IXD A;  4GS9 B;  5HWW A;  4BBU A;  3VP1 A;  5IS1 A;  1MZU A;  2Y8H A;  3R7W B;  3LR4 A;  2JE5 A;  4FUW A;  2LB9 A;  5L10 A;  1FIL A;  1NYY A;  3NOT C;  3S4X A;  3SH9 A;  5DJT A;  4E3J A;  2A2L A;  4HY8 A;  1LI0 A;  5A92 A;  4MNR A;  5FQI A;  3H9W A;  4R23 A;  2VX8 A;  4HNB A;  3C4O A;  2ZQD A;  5CHM A;  4K0W A;  4OQG A;  3IT9 A;  1STZ A;  2O99 A;  5HD3 A;  3BY8 A;  4LGW A;  2WGI A;  5F1F A;  4EBL A;  3NEC A;  3BFC A;  3MS6 A;  5EVE A;  1VHM A;  2P08 A;  1K38 A;  4GD6 A;  2FH5 A;  4FSF A;  4OQI A;  4DE0 A;  3ZYT A;  3FC7 A;  3GRJ A;  4KG5 A;  5M19 A;  3H82 A;  5A91 A;  4EER A;  2VGL M;  2Y79 A;  4G3V A;  3IX3 A;  5DFY A;  4Z9Q A;  3Q82 A;  4ZRR A;  4X53 A;  3BWL A;  5L2F A;  2WAD A;  3M2K A;  3N8S A;  1K4E A;  1ERM A;  4EQ1 A;  4KUO A;  4EBN A;  2P7J A;  3ZNY A;  3OPP A;  1OPX A;  3NIA A;  1W7F A;  1YLJ A;  2ACG A;  4KZ3 A;  4B88 A;  3VP4 A;  3C8C A;  2Q0O A;  2J8Y A;  3NDG A;  4GHI A;  5GHY A;  3DTE A;  2VGJ A;  2V20 A;  5GLB A;  5HWT A;  1RCJ A;  2Y2K A;  1MWR A;  5F5Y A;  2A24 A;  2ZBB A;  3VE4 A;  2XA7 M;  3VOY A;  3DTM A;  1J3W A;  4H8R A;  2VGK A;  1D06 A;  2XQZ A;  3BYD A;  3S7Q A;  1TS8 A;  2B18 A;  5CTM A;  2P9V A;  1YMS A;  1TDG A;  3LY3 A;  3IX8 A;  4KG6 A;  2QPN A; 
#chains in the Genus database with same CATH homology
 1D1J A;  1VET A;  2ZL1 A;  3T1Q B;  3MSH A;  3CHW P;  4FTX A;  2B95 A;  3T1X A;  3NEC A;  2PAV P;  1Z09 A;  2V8F A;  4QWO A;  3MS6 A;  5EVE A;  3L9K A;  4D60 A;  3CPT A;  3UB5 P;  3T12 B;  3LGO A;  3L7H A;  1AWI A;  2V8C A;  4X1M A;  1SKO B;  2PRF A;  1Y4O A;  2BTF P;  1FIK A;  1SZV A;  2E8J A;  5FEF A;  1PFL A;  3U4L P;  1YPR A;  5EM0 A;  2JKG A;  1CJF A;  3NUL A;  1HLU P;  1VEU B;  1A0K A;  2ACG A;  3T1R A;  1VEU A;  1ACF A;  1CQA A;  5EM1 A;  1F2K A;  3D9Y A;  1SKO A;  2VK3 A;  2PBD P;  3LEQ A;  5EV0 A;  4FUW A;  2JKF A;  2ZL1 B;  1K0K A;  1FIL A;  1PNE A;  1J3W A;  5FEG A;  3DAV A;  4X1L A;  3KYE A;  1G5U A;  3T1S A;  3CPT B;  1CF0 A;  1PRQ A;  1VET B;  5FDS A;  4X25 A;  2HZ5 A;  4ESP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...