3KYEA

Crystal structure of roadblock/lc7 domain from streptomyces avermitilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
VSDLDWLMSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHMAALASGLYSLGRSAGIRFGDGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEMAMLVKSVRPYLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Roadblock/LC7 Domain from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
molecule keywords Roadblock/LC7 domain, Robl_LC7
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3kyeA00
3CPTA 5EM1A 1FIKA 3T1RA 3T1SA 3U4LP 1CF0A 3T1QB 2ZL1A 3LGOA 1CQAA 1PRQA 2V8FA 3T12B 1VETA 1VEUA 2VK3A 3L7HA 3LEQA 1J3WA 1CJFA 1YPRA 1ACFA 1SZVA 2BTFP 1Y4OA 2ACGA 2HZ5A 3D9YA 1PNEA 2E8JA 3CHWP 4QWOA 1SKOB 1A0KA 1VETB 1Z09A 3L9KA 1G5UA 2PAVP 4D60A 4X25A 5EM0A 1HLUP 3NULA 1SKOA 3CPTB 4X1LA 1FILA 1AWIA 4FTXA 4FUWA 5EV0A 3UB5P 2JKGA 2B95A 1PFLA 5EVEA 4ESPA 5FEFA 5FEGA 1K0KA 3MS6A 2V8CA 3T1XA 1D1JA 2JKFA 3MSHA 3KYEA 5FDSA 1F2KA 3DAVA 4X1MA 1VEUB 3NECA 2PBDP 2ZL1B 2PRFA
chains in the Genus database with same CATH superfamily
3S7PA 4RA7A 1L0FA 4O01A 2PR5A 5L07A 4IUKA 4ETZA 1OJ5A 3C7VA 3PXPA 4HY8A 3E4PA 2Y4AA 2JN7A 5DJUA 4F94A 1VEUB 3OBFA 4HH2A 4WMCD 5KSCA 3GSGA 3ZG5A 3IF6B 4Z1WA 3CG5A 3R7WB 3LCEA 1SCWA 2P08A 1TDLA 1YLTA 4QJGA 2M1CA 3UE3A 4Q8IA 5TJJA 2GX5A 3FZCA 4BENA 2Q0OA 2WKPA 4MCWA 4R6LA 1YLWA 2PRFA 1MKMA 4XXRA 3S22A 2PYPA 2A3UA 1NZUA 4H8RA 1LSWA 3DTIA 4L0LA 4S2MA 4LV0A 4ZBEA 2H5SA 1D1JA 1S1ZA 1Z6FA 1STZA 5HD3A 5K5BA 3IH9A 4QB8A 2WUQA 4D2OA 3D3OA 3UMDA 1K55A 4S2NC 3C30A 4JGPA 1ERQA 4P0MA 3T4KA 1TF1A 1C3BA 1K57C 5G4ZA 4R4SA 5FQKA 2BASA 1G6AA 2PU4A 4KQOA 3LGOA 3N4IA 4HNBA 2JCHA 1YLZA 2KX6A 5A8BA 4GN2A 3VE3A 4S2NA 4EBLA 3HUOA 4B4XA 1WE4A 3Q82A 1PI4A 4X68A 1YSQA 1KGFA 3UPPA 4JXWA 3KO6A 2OSUA 3HLEA 2VGLS 1MPLA 1D7EA 1JTDA 3C2WA 1LHYA 1E25A 4PKYG 4L9EA 4KQQA 4HIAA 1KGEA 2OV5A 2XRNA 4PMAA 5HX9A 1YT4A 1F2KA 2VLGA 5CGWA 3ZCZA 3HCYA 1XX2A 3CPTA 5L8MA 2ZM0A 5DF9A 2H0TA 5FDHA 1FOFA 1HD8A 1G5UA 3HUNA 4GKUA 4KG5A 4KQRA 5FEGA 4XT2A 3VFFA 4S2OA 2M7UA 1RP5A 1VM1A 2Z2LB 4IBRA 4O8GA 2Z6DA 5CERA 1VETA 3BECA 3MR0A 3OLOA 5GHYA 1FR1A 3AGDA 2G2UA 3CUEC 4NEED 3KYQA 3NDEA 2A49A 2I72A 2RCXA 2W3EA 1GSXA 3IXHA 3UO9A 3NHQA 4PAUA 3QP2A 1FCMA 3LFVA 3OPPA 3VSKA 2OLUA 1TS7A 4MMNA 2HZ5A 2BTFP 3CAXA 4QWOA 3E2KA 4P6ZS 3WS2A 4X56A 1XXMA 1SKOA 1KOUA 2H0YA 2W0NA 3O87A 4X1MA 3EOIA 4DXBA 1CI9A 1K56D 2ZL1A 5EVIB 1PZPA 1VEUA 3CUEA 2ZD8A 4K91A 3R4KA 4RX3A 4OPYA 3N8LA 3DTMA 4KZ5A 4FH2A 1AWIA 3K2NA 1DP9A 2Y2NA 1S66L 1NJ4A 1K56A 1KGGA 3MKFA 3Q1FA 2VK3A 3LY3A 4Y0UA 5HL6A 1V9YA 1XJ3A 1ERMA 5FAOA 4FTXA 1PI5A 1NRFA 3DBAA 5E2FA 3IS2A 3T4TA 4WZ5C 3ZNTA 2PBDP 1MWUA 1PRQA 2HP6A 1ACFA 2WKQA 1ES2A 3HREA 1W63Q 4U0XA 2Y2MA 3F1PB 2ZC5B 1GA0A 5TGFA 5DVAA 4CLCB 2Y79A 3IH8A 4EWFA 5FQMA 4A5RA 3V3RA 3O3VA 2X01A 1LL9A 3EWKA 5J7EA 3NOUC 4KZ4A 2MJ6A 3HJIA 4U3TA 4GNUA 2INWA 4EBNA 2LB9A 3E4QA 3IX4A 5FASA 3ZG8B 2QKPA 3BM6A 2W27A 1VQQA 1EWZA 3IBRA 1P9WA 4OQHA 3UE0A 2Q9MA 2ZL1B 3WWXA 5EM1A 2JKTM 3IHAA 4GCZA 2A24B 3VP4A 4CJNA 4IUHA 3NC8A 5EPHA 1W5DA 1GHMA 4H6JB 4UQIS 3PAGA 2V8CA 3V50A 2NUTC 2BG1A 2IWDA 3T4OA 3B3XA 3T4LA 4U0TA 3NIAA 4R3JA 2XA7M 3V67A 4YWZA 3PBNA 3VMAA 2WK0A 1DRMA 2HDQA 1N9NA 3BWLA 4WELA 4B9OA 3ZG9B 2EX6A 3S1YA 3OCNA 1MKIA 1YLJA 5FI6A 3HJKA 1BULA 4LCMA 4B4ZA 2ZMAA 3NJAA 3PBQA 3IQAA 3DTKA 4RYEA 2HGVA 2DNSA 4NKPA 5EVIA 4ETXA 4X25A 5DF8A 3MQ0A 3NBLA 5DKLA 5DTKA 4RVAA 5EVID 1P0ZA 3W4OA 3LI8A 2PT7A 1YPRA 3MXQA 3KSFA 1IYOA 3CJMA 4WL9A 5AQAA 1ONHA 5DJTA 3NY4A 2R9WA 3LI9A 1BTLA 2XH9A 3TSGA 3DW0A 4R70A 3IT9A 2V0WA 3OPLA 5FI7A 2K2NA 1DJCA 1YAXA 3T1QB 3E4OA 4R1GA 4GLQA 3UDIA 4I39A 2O9CA 1Q2PA 1YQSA 1NXYA 3WS5A 1H8MA 4JBFA 4N1HA 3PHYA 5HD5A 3FV7A 4Y2FA 5F6AA 3C4OA 1LSVA 1ES4A 3GR2A 4UHUA 2WKIA 1ESUA 3MXRA 3L9KA 2P9VA 1S67L 2OOLA 3M6HA 4UAAA 1CEGA 4X55A 1PFLA 2J3WA 2ZC3B 4OQGA 4DJ3A 3IXBA 1MWRA 3UNWA 3WS0A 4DE3A 4WYYA 3DWKA 4DF6A 2HDUA 3TRCA 3OCLA 4DE0A 3ISGA 4GZBA 2EFXA 2JKRI 4DE2A 5EOEA 3AGEA 3T1RA 5FATA 2JBFA 4BLMA 5EE8A 1J3WA 4I38A 3ZVTA 3IWIA 3HL9A 2PU2A 1WA9A 3NI9A 4JXSA 4BBUA 2EX8A 3W4PA 3VOZA 3IX8A 4MBFA 3MFDA 4E3MA 1H5XA 2A2LA 4WN5A 3CWFA 1LI9A 4E3KA 3WS1A 5A91A 4JF4A 1S4RA 2YKHA 4DDYA 5F69A 3S7OA 5HAIA 2PD7A 2W3GA 4E04A 4DE1A 1JNUA 3LIBA 1SDNA 3KYZA 3FKWA 4HJ4A 3A3EA 2EWWA 3PBOA 1XJ4A 2Y2JA 2PD8A 3T4SA 5HWVA 3MKEA 1WYBA 2VX8A 3N8RA 2ZQCA 2EX2A 5E2EA 1G28A 4OOYA 3Q7VB 4MBKA 4EBPA 1MWTA 5FQJA 1WYCA 3EEHA 4KG2A 2W3HA 4Y15A 1XFQA 4HOIA 1KVLA 4EQ1A 2BLSA 3LO7A 1ZTUA 2W1RA 3T4JA 1L0GA 4HBUA 3P98A 1SKFA 4GS9B 2E8IA 4C3QA 4E3OA 3NECA 4NG2A 4PM7A 4N92A 3T12B 1V9ZA 2DMWA 3QP4A 1SZVA 4Y5FA 2O9AA 3E0YA 3UB6A 1OJGA 5D3OA 5DTTA 3IHBA 2HV1A 3DWZA 4FD8A 5FQQA 4I3AA 2OWHA 1H3QA 1IFQA 1DY6A 3UPNA 3I7JA 5IT5A 4NXGA 5DFYA 5EUAA 1OTAA 4ZJ3A 3B42A 4ZAMA 2PYRA 3VE4A 2WKRA 3O86A 4MDZA 4OP5A 4DKIA 3M2KA 1FSYA 4EEUA 1OMEA 1T18A 2Y2HA 4WMCA 2L1MA 2X02A 4WZ4A 1K38A 3GMWA 2XR0A 1UWNX 2ZLYA 5FL3A 3LUQA 5EECA 3C38A 1RGYA 4C6YA 1LT0A 2V9AA 5CRFA 2L0WA 3BFEA 4S2KA 4WEKA 5CEDA 4KENB 3HLFA 4II7A 5CHMA 1OTBA 3NCKA 3BQ8A 1W8YA 3MFXA 2ZM8A 3A3JA 4I3IA 3ZGAB 1NZOA 1K6SA 5HDCA 4PPRA 4P6BA 2Y2LA 4DXCA 1TD5A 3MSHA 1O7EA 3HLDA 3M2JA 2YKFA 3JVUA 4QPRA 5J4EA 3E2LA 3QNCA 3BFFA 5L09A 4ZJ2A 3KSGA 5FAQA 2W1TB 4ARZA 4E3NA 4R3BA 1S1YA 3P7NA 3ULFA 2HP9A 4WEJA 1ES5A 1W79A 3MS6A 4WZ5A 2XSSA 3CITA 4S2IA 2XD5A 3ITAA 1BLHA 4S2LA 1K4FA 1PW1A 1S0WA 3CHWP 2W3DA 1SKOB 1A0KA 2FFFB 1OT9A 2PAVP 1VHMA 4NXBA 1K57A 3LYXA 1FQGA 4MLLA 4R0QA 2G7UA 2XGNA 2IWBA 5HDSA 4Y17A 1S4SA 5F5YA 2D02A 3N8SA 3UB8A 4KG6A 5F1GA 1E4DA 2ZC6B 5HWWA 4OLDA 2EFUA 2H10A 1E3UD 4GHIB 4CLCD 2XQZA 2B5RA 3LIEA 4HI4A 4QD4A 5F1FA 2VA0A 3SZTA 5HAPA 2Q9NA 4JPMA 1PWGA 4M3KA 1Q2QA 3IWQA 1JWPA 4JF6A 4GB7A 3FPVA 4HP4A 3B33A 3UB9A 1XP4A 1I5QA 2PHYA 5EFWA 2Y2OA 5AQ9A 3OZHA 4UQIM 2J80A 4KZ7A 4HBTA 4JXGA 4EETB 4NK3A 1K25A 3ZHHA 3H82B 3ITBA 1XJ6A 1YMXA 4PM5A 3IF5A 4R38A 3OOVA 1PZOA 1MWSA 3FKVA 4X69A 2ZOHA 1PIOA 4Y0TA 3MZEA 4K0WA 5EVLA 5HPFA 5KMWA 5FEFA 3BLMA 5KIZA 2ZQ9A 1JWZA 2QZ6A 3SH7A 4EV4A 2L4RA 3GDIA 2J8YA 4EEPA 4FH4A 1F98A 5FA7A 1DP8A 1NRJA 1IELA 1KDSA 2J9PA 1L0DA 2XDMA 3VSLA 4NETA 3RXWA 2P74A 4PM8A 1DJBA 4ME4A 2JKRM 3G34A 4NXEA 2PR6A 2WZZA 1D06A 2R78A 2WGWA 2ZC4B 4FSFA 2FFYA 4EQIA 3NOTC 3LEQA 2VGLM 2XD1A 5MC7A 3A3IA 4LRZE 3G31A 2EWVA 4DDSA 4LV2A 4WF0A 2WZXA 3NULA 3V5MA 3SS4A 5CTMA 3CMZA 1G6OA 5AJGA 1BSGA 2CMNA 3LR3A 5GHZA 3DTEA 1T1BA 3RTYA 2V8FA 3MMHA 4LV3A 2JHEA 3QP5A 3UDXA 1TS6A 4Y7PA 2XFTA 4JGRA 3BLSA 2EXBA 4QY5A 3KSHA 1MBLA 1QMFA 2OWJA 1DP6A 4ZJ1A 3EGDC 5EVIC 3JVVA 1GSVA 1RGZA 1I2WA 5JYOA 3SW1A 4JF5A 4AFIA 3UE1A 1NLZA 1EI5A 2QYBA 4MNRA 5CHUA 5E43A 3IF6A 5IS1A 2V1AA 3OPHA 5CTNA 4LV1A 5HDDA 5FI2A 2WGWB 3M6BA 1K54C 4QU3A 3BFCA 5M19A 2UWXA 3HLCA 1KE4A 3TOIA 1FR6A 3AGFA 3SOIA 1VETB 2ZQAA 1YLYA 1OPXA 3FG8A 1JVJA 2Y2IA 4BBVA 2B95A 3LR0A 2HJ9C 2Y2KA 4MN6A 5FDSA 5GLDA 2WGIA 3JPUA 5F83A 2GNXA 4FOFA 3UMEA 1VB6A 2QPNA 4HJ3A 2K7SA 3ICYA 3L7HA 3HLGA 4OOMA 4KZAA 3H82A 3WRZA 4MN5A 1CEFA 3GRJA 1K55C 2GJ3A 4BMWA 2K31A 4YINA 3MZDA 2GZAA 2OAP1 5GLCA 1N9OA 3F1NB 3SH8A 1BUEA 4E3JA 5HWTA 4LENA 5AVEA 4WM9A 3TE8A 1OT6A 2Y2QA 2C5WB 2VGJA 4GW9A 4P6ZM 1ZKJA 1N4OA 3EEAA 1QMEA 3ZYTA 3U2AA 2NUPC 1T1CA 1N9LA 3P09A 3C4PA 1LSXA 1MY8A 1NWZA 4YNRA 1KE0A 4OOLA 4HH3A 5G4YA 3RJUA 5EVEA 3MXSA 2WGVA 4ZDXA 5A90A 3RFBA 4E6XA 2Z6CA 1K4EA 4OQIA 2WKEA 3G2YA 3BFGA 1TVFA 1BLSA 2ACGA 1ZG4A 4UA7A 5A92A 1XGJA 4KZBA 1L0EA 4HESA 2DCFA 1GHIA 5U47A 3LY4A 1E3UA 2V1ZA 4CLCA 3IXDA 4Y0OA 3U4LP 1IOUA 1Y4OA 3Q7ZA 2XROA 3MJQA 4LRYC 1ZG6A 3RXXA 2R9XA 4BWIA 2VV7A 4OVDA 1LI0A 4Q0JA 1PWDA 3QP8A 4IJGA 4LRXC 2J3TD 3NDGA 5E2GA 1FCOA 1M40A 4GD8A 4B93A 1W63M 2O0YA 4QY6A 3LICA 3EQUA 1GA9A 3DAVA 3A0VA 3T4QA 2QMIA 4R23A 1T19A 2XFSA 4F3LA 3PBTA 3IXGA 5M18A 3D4FA 2HJEA 3TW8A 2H28A 4P85A 1KVMA 3PAEA 4OP8A 4DMZA 4IVKA 4DN0A 2UV0E 5AVFA 4KZ8A 2AVXA 1PYYA 4IEDA 2EA9A 4JGOA 3UN7A 3F1PA 2KDKA 2XK1A 3HUMA 1H0MA 3D9YA 2OAQ1 2Y59A 4L9FA 3G2ZA 1YKDA 2B02A 5KSHA 2ZM2A 4HJ6A 4BD0A 5DKKA 4GOGA 1KDWA 4ZRRA 3IS2B 3KSIA 3BQAA 2VJWA 3P01A 4LGWA 3RH8B 3BRMA 4PKYA 3EGXC 2ZOIA 3C5AA 1XJ2A 5GHXA 3G32A 1BLCA 3QP6A 2Z2MB 4JXVA 4G3WA 4R3AA 1T1AA 3LR5A 1IKIA 2KLIA 3A0SA 3S7NA 4DJ2A 2HDSA 3UPOA 1JWVA 4EERA 2FZ0A 1K54A 5TFQA 3MQOA 3PBSA 3T1SA 2QWSA 4XT2B 3ZNYA 1UGUA 4OH0A 3ZG0A 1Z09A 4D60A 4YFMA 2Y2PA 3NOPC 1MZUA 5IHVA 4EUZA 3VP3A 3PYPA 1M6KA 1SHVA 4HQAA 4OLGA 1MC0A 1HTZA 4X53A 5AQBA 1JTGA 2VGKA 2X71A 3OPRA 4CQHA 4GDBA 4UA6A 3W2ZA 5BOHA 4RQ9A 4X1LA 3O88A 3UB5P 1OTEA 2JKGA 1ZHHB 4IHQA 5F68A 5TR7A 1CK3A 3N6IA 3BY9A 4H6JA 1CF0A 5M1AA 1H8YA 5G18A 3ZQ5A 2E8JA 3BYDA 5HW3A 4P87A 1FILA 1OTDA 4FUWA 2QJ5A 3UY6A 3G35A 5DF7A 2Y2GA 3Q07A 1XFNA 1CI8A 3V39A 2VKSA 4BL3A 2J9OA 3ZG7B 2V2FF 2QHKA 3O5YA 5CGXA 1IKGA 5E2HA 3PR6A 4KUKA 1O07A 5EV0A 3OC2A 3G4PA 2ZJ9A 3T1XA 3IF6C 1ALQA 2JKFA 4GD6A 5C5KA 2ZC7A 4CLCE 5GLBA 2JKTI 4G3VA 3VP0A 1CQAA 2J7VA 5I94A 2C6WB 4PHTA 2RL3A 3HLWA 1GHPA 1HZOA 3GQZA 3GV9A 2XF3A 1NYMA 3A3DA 4I3JA 4DRTA 3BW6A 5GL9A 1ODVA 3FWLA 5TBMA 4KQDA 1AXBA 2IA2A 3G30A 2Y91A 3C8CA 1XGIA 4EXOA 3ZFZA 1RCJA 4ZTKA 4CPKA 1XA1A 3K3DA 5DFXA 5GLAA 2ZMFA 4OONA 4IVIA 2XA7S 1GSWA 4KZ3A 4MN7A 4LPZA 4K08A 3T50A 4O0PA 2PDRA 3SS3A 1EW0A 4I5SA 2V1BA 1TS0A 1UWPX 4WUJA 5FSRA 3EQVA 3GECA 3IWOA 4FCFA 4KZ9A 5I5LA 3SS5A 2VEAA 3WRTA 5F82A 4X6TA 3FYZA 4EW7A 5HZHA 3CPTB 2QJ7A 1KE3A 1K6RA 1SDEA 3CI6A 3S4XA 2WAFA 1ONGA 5HPIA 4GJ4A 1HVBA 3D72A 2J3TC 2V0UA 5L2FA 4KUOA 3ZVWA 5IU1A 5J8XA 2CC1A 3LIAA 1U60A 1NLYA 2GDNA 3VV4A 1PW8A 3H7WB 1J9MA 4EESA 4ID4A 2VV8A 2P9VB 5CXWA 1FCNA 5L10A 1MXOA 3IX3A 3H9WA 3JYIA 1TEMA 2WYXA 3B47A 3LIDA 1BZAA 4UEYA 4LCLA 2XLNA 3Q81A 3ZDJA 4MEZA 3F1OA 4GDNA 1P97A 1LL8A 1PWCA 3VOYA 3FPWA 2M7VA 4MBHA 5TBMB 5LBRA 5CEBA 5AQ7A 3W4QA 4JGQA 4WBGA 3UDFA 3UE6A 4HEFA 4Z9QA 4Y13A 4L9GA 2ZQDA 3MQQA 2G2WA 4EUVA 3Q7VA 4BJPA 4G3KA 4LFUA 1YSPA 5HFOA 5KZHA 1LL5A 3MZFA 2PBYA 1NYYA 3A3FA 3LR4A 3FC7A 2P7JA 4YOFA 3LEZA 1IYSA 3PTEA 4LLOB 5FAPA 4OPZA 1BYWA 1TS8A 5A93A 1FSWA 5EOOA 3H7WA 4S2JA 3S7QA 2OLVA 1YMSA 4O7DA 1Y28A 4PM6A 4F3LB 3BEBA 1XA7A 1H8ZA 3TJZC 2JC7A 4HP9A 2O99A 5J3WA 3TG9A 1FIKA 5HAQA 1EROA 2ZQ8A 1YLPA 2JE5A 2FH5A 1BLPA 4E3IA 5HSQA 1YM1A 4GHIA 4OQ0A 4XUXA 1XKZA 2VV6A 1K0KA 3BFDA 4OPQA 3VFHA 4N9LA 4C75A 1G68A 1IYQA 3LIFA 4Q0HA 2D01A 4N1XA 3HVFA 4BD1A 2IWCA 3QP1A 4E3LA 2WAEA 4BQMA 4GS9A 3A0RA 1PNEA 1P9RA 4B88A 5JYPA 3GTCA 3G6OA 5EM0A 4BL2A 2WADA 3CLOA 4NXFA 5CX7A 2XEPA 3MBZA 2O9BA 4E6WA 1Y54A 3QNBA 2HP5A 4WLAA 1I2SA 2VZWA 2DRWA 1W7FA 5CGSA 1CJFA 2Y8HA 2W3FA 4PM9A 3E98A 4JKTA 2ZBBA 4K0XA 2HPBA 4XUZA 2KOIA 1L2SA 3UB7A 3K3CA 4Y3IA 4UA9A 3WS4A 4JLFA 3BJNA 1TDGA 1F5MA 1X0OA 2HF6A 4HHDA 1W8QA 1ES3A 2ZMVA 3N7WA 2Y55A 1ESIA 3R7WA 2EX9A 2EXAA 4CLCC 2V20A 1N9BA 3GVBA 1F9IA 1OTIA 1XPBA 3C7UA 4RX2A 5HL1A 2WKHA 5DTSA 2B18A 1L3LA 4R4RA 4BBTA 4OPRA 3W8KA 1NY0A 4EU0A 5CHJA 2HDRA 4Q0IA 3VP2A 1DJAA 3F1NA 1IYPA 1S6RA 3KX0X 5HARA 4ESPA 4N9KA 3V3SA 3VOLA 3PBRA 1LLBA 3IBJA 1IEMA 3VP1A 3KYEA 2I9VA 4M4XA 1BT5A 1ZC2A 4S2PA 5CECA 3HLBA 3MF0A 4QHCA 5FQIA 3SH9A 4IBXA 5FQ9A 1HLUP 4KZ6A 4OKPA 3F1OB 2P04A 2ZQ7A 3CZDA 1GCEA 2W1TA 4ARZB 3QHYA 2A24A 2LB5A 3BY8A 3HBRA
chains in the Genus database with same CATH topology
3CPTA 5EM1A 1FIKA 3T1RA 3T1SA 3U4LP 1CF0A 3T1QB 2ZL1A 3LGOA 1CQAA 1PRQA 2V8FA 3T12B 1VETA 1VEUA 2VK3A 3L7HA 3LEQA 1J3WA 1CJFA 1YPRA 1ACFA 1SZVA 2BTFP 1Y4OA 2ACGA 2HZ5A 3D9YA 1PNEA 2E8JA 3CHWP 4QWOA 1SKOB 1A0KA 1VETB 1Z09A 3L9KA 1G5UA 2PAVP 4D60A 4X25A 5EM0A 1HLUP 3NULA 1SKOA 3CPTB 4X1LA 1FILA 1AWIA 4FTXA 4FUWA 5EV0A 3UB5P 2JKGA 2B95A 1PFLA 5EVEA 4ESPA 5FEFA 5FEGA 1K0KA 3MS6A 2V8CA 3T1XA 1D1JA 2JKFA 3MSHA 3KYEA 5FDSA 1F2KA 3DAVA 4X1MA 1VEUB 3NECA 2PBDP 2ZL1B 2PRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPT A;  5EM1 A;  1FIK A;  3T1R A;  3T1S A;  3U4L P;  1CF0 A;  3T1Q B;  2ZL1 A;  3LGO A;  1CQA A;  1PRQ A;  2V8F A;  3T12 B;  1VET A;  1VEU A;  2VK3 A;  3L7H A;  3LEQ A;  1J3W A;  1CJF A;  1YPR A;  1ACF A;  1SZV A;  2BTF P;  1Y4O A;  2ACG A;  2HZ5 A;  3D9Y A;  1PNE A;  2E8J A;  3CHW P;  4QWO A;  1SKO B;  1A0K A;  1VET B;  1Z09 A;  3L9K A;  1G5U A;  2PAV P;  4D60 A;  4X25 A;  5EM0 A;  1HLU P;  3NUL A;  1SKO A;  3CPT B;  4X1L A;  1FIL A;  1AWI A;  4FTX A;  4FUW A;  5EV0 A;  3UB5 P;  2JKG A;  2B95 A;  1PFL A;  5EVE A;  4ESP A;  5FEF A;  5FEG A;  1K0K A;  3MS6 A;  2V8C A;  3T1X A;  1D1J A;  2JKF A;  3MSH A;  3KYE A;  5FDS A;  1F2K A;  3DAV A;  4X1M A;  1VEU B;  3NEC A;  2PBD P;  2ZL1 B;  2PRF A; 
#chains in the Genus database with same CATH topology
 3S7P A;  4RA7 A;  1L0F A;  4O01 A;  2PR5 A;  5L07 A;  4IUK A;  4ETZ A;  1OJ5 A;  3C7V A;  3PXP A;  4HY8 A;  3E4P A;  2Y4A A;  2JN7 A;  5DJU A;  4F94 A;  1VEU B;  3OBF A;  4HH2 A;  4WMC D;  5KSC A;  3GSG A;  3ZG5 A;  3IF6 B;  4Z1W A;  3CG5 A;  3R7W B;  3LCE A;  1SCW A;  2P08 A;  1TDL A;  1YLT A;  4QJG A;  2M1C A;  3UE3 A;  4Q8I A;  5TJJ A;  2GX5 A;  3FZC A;  4BEN A;  2Q0O A;  2WKP A;  4MCW A;  4R6L A;  1YLW A;  2PRF A;  1MKM A;  4XXR A;  3S22 A;  2PYP A;  2A3U A;  1NZU A;  4H8R A;  1LSW A;  3DTI A;  4L0L A;  4S2M A;  4LV0 A;  4ZBE A;  2H5S A;  1D1J A;  1S1Z A;  1Z6F A;  1STZ A;  5HD3 A;  5K5B A;  3IH9 A;  4QB8 A;  2WUQ A;  4D2O A;  3D3O A;  3UMD A;  1K55 A;  4S2N C;  3C30 A;  4JGP A;  1ERQ A;  4P0M A;  3T4K A;  1TF1 A;  1C3B A;  1K57 C;  5G4Z A;  4R4S A;  5FQK A;  2BAS A;  1G6A A;  2PU4 A;  4KQO A;  3LGO A;  3N4I A;  4HNB A;  2JCH A;  1YLZ A;  2KX6 A;  5A8B A;  4GN2 A;  3VE3 A;  4S2N A;  4EBL A;  3HUO A;  4B4X A;  1WE4 A;  3Q82 A;  1PI4 A;  4X68 A;  1YSQ A;  1KGF A;  3UPP A;  4JXW A;  3KO6 A;  2OSU A;  3HLE A;  2VGL S;  1MPL A;  1D7E A;  1JTD A;  3C2W A;  1LHY A;  1E25 A;  4PKY G;  4L9E A;  4KQQ A;  4HIA A;  1KGE A;  2OV5 A;  2XRN A;  4PMA A;  5HX9 A;  1YT4 A;  1F2K A;  2VLG A;  5CGW A;  3ZCZ A;  3HCY A;  1XX2 A;  3CPT A;  5L8M A;  2ZM0 A;  5DF9 A;  2H0T A;  5FDH A;  1FOF A;  1HD8 A;  1G5U A;  3HUN A;  4GKU A;  4KG5 A;  4KQR A;  5FEG A;  4XT2 A;  3VFF A;  4S2O A;  2M7U A;  1RP5 A;  1VM1 A;  2Z2L B;  4IBR A;  4O8G A;  2Z6D A;  5CER A;  1VET A;  3BEC A;  3MR0 A;  3OLO A;  5GHY A;  1FR1 A;  3AGD A;  2G2U A;  3CUE C;  4NEE D;  3KYQ A;  3NDE A;  2A49 A;  2I72 A;  2RCX A;  2W3E A;  1GSX A;  3IXH A;  3UO9 A;  3NHQ A;  4PAU A;  3QP2 A;  1FCM A;  3LFV A;  3OPP A;  3VSK A;  2OLU A;  1TS7 A;  4MMN A;  2HZ5 A;  2BTF P;  3CAX A;  4QWO A;  3E2K A;  4P6Z S;  3WS2 A;  4X56 A;  1XXM A;  1SKO A;  1KOU A;  2H0Y A;  2W0N A;  3O87 A;  4X1M A;  3EOI A;  4DXB A;  1CI9 A;  1K56 D;  2ZL1 A;  5EVI B;  1PZP A;  1VEU A;  3CUE A;  2ZD8 A;  4K91 A;  3R4K A;  4RX3 A;  4OPY A;  3N8L A;  3DTM A;  4KZ5 A;  4FH2 A;  1AWI A;  3K2N A;  1DP9 A;  2Y2N A;  1S66 L;  1NJ4 A;  1K56 A;  1KGG A;  3MKF A;  3Q1F A;  2VK3 A;  3LY3 A;  4Y0U A;  5HL6 A;  1V9Y A;  1XJ3 A;  1ERM A;  5FAO A;  4FTX A;  1PI5 A;  1NRF A;  3DBA A;  5E2F A;  3IS2 A;  3T4T A;  4WZ5 C;  3ZNT A;  2PBD P;  1MWU A;  1PRQ A;  2HP6 A;  1ACF A;  2WKQ A;  1ES2 A;  3HRE A;  1W63 Q;  4U0X A;  2Y2M A;  3F1P B;  2ZC5 B;  1GA0 A;  5TGF A;  5DVA A;  4CLC B;  2Y79 A;  3IH8 A;  4EWF A;  5FQM A;  4A5R A;  3V3R A;  3O3V A;  2X01 A;  1LL9 A;  3EWK A;  5J7E A;  3NOU C;  4KZ4 A;  2MJ6 A;  3HJI A;  4U3T A;  4GNU A;  2INW A;  4EBN A;  2LB9 A;  3E4Q A;  3IX4 A;  5FAS A;  3ZG8 B;  2QKP A;  3BM6 A;  2W27 A;  1VQQ A;  1EWZ A;  3IBR A;  1P9W A;  4OQH A;  3UE0 A;  2Q9M A;  2ZL1 B;  3WWX A;  5EM1 A;  2JKT M;  3IHA A;  4GCZ A;  2A24 B;  3VP4 A;  4CJN A;  4IUH A;  3NC8 A;  5EPH A;  1W5D A;  1GHM A;  4H6J B;  4UQI S;  3PAG A;  2V8C A;  3V50 A;  2NUT C;  2BG1 A;  2IWD A;  3T4O A;  3B3X A;  3T4L A;  4U0T A;  3NIA A;  4R3J A;  2XA7 M;  3V67 A;  4YWZ A;  3PBN A;  3VMA A;  2WK0 A;  1DRM A;  2HDQ A;  1N9N A;  3BWL A;  4WEL A;  4B9O A;  3ZG9 B;  2EX6 A;  3S1Y A;  3OCN A;  1MKI A;  1YLJ A;  5FI6 A;  3HJK A;  1BUL A;  4LCM A;  4B4Z A;  2ZMA A;  3NJA A;  3PBQ A;  3IQA A;  3DTK A;  4RYE A;  2HGV A;  2DNS A;  4NKP A;  5EVI A;  4ETX A;  4X25 A;  5DF8 A;  3MQ0 A;  3NBL A;  5DKL A;  5DTK A;  4RVA A;  5EVI D;  1P0Z A;  3W4O A;  3LI8 A;  2PT7 A;  1YPR A;  3MXQ A;  3KSF A;  1IYO A;  3CJM A;  4WL9 A;  5AQA A;  1ONH A;  5DJT A;  3NY4 A;  2R9W A;  3LI9 A;  1BTL A;  2XH9 A;  3TSG A;  3DW0 A;  4R70 A;  3IT9 A;  2V0W A;  3OPL A;  5FI7 A;  2K2N A;  1DJC A;  1YAX A;  3T1Q B;  3E4O A;  4R1G A;  4GLQ A;  3UDI A;  4I39 A;  2O9C A;  1Q2P A;  1YQS A;  1NXY A;  3WS5 A;  1H8M A;  4JBF A;  4N1H A;  3PHY A;  5HD5 A;  3FV7 A;  4Y2F A;  5F6A A;  3C4O A;  1LSV A;  1ES4 A;  3GR2 A;  4UHU A;  2WKI A;  1ESU A;  3MXR A;  3L9K A;  2P9V A;  1S67 L;  2OOL A;  3M6H A;  4UAA A;  1CEG A;  4X55 A;  1PFL A;  2J3W A;  2ZC3 B;  4OQG A;  4DJ3 A;  3IXB A;  1MWR A;  3UNW A;  3WS0 A;  4DE3 A;  4WYY A;  3DWK A;  4DF6 A;  2HDU A;  3TRC A;  3OCL A;  4DE0 A;  3ISG A;  4GZB A;  2EFX A;  2JKR I;  4DE2 A;  5EOE A;  3AGE A;  3T1R A;  5FAT A;  2JBF A;  4BLM A;  5EE8 A;  1J3W A;  4I38 A;  3ZVT A;  3IWI A;  3HL9 A;  2PU2 A;  1WA9 A;  3NI9 A;  4JXS A;  4BBU A;  2EX8 A;  3W4P A;  3VOZ A;  3IX8 A;  4MBF A;  3MFD A;  4E3M A;  1H5X A;  2A2L A;  4WN5 A;  3CWF A;  1LI9 A;  4E3K A;  3WS1 A;  5A91 A;  4JF4 A;  1S4R A;  2YKH A;  4DDY A;  5F69 A;  3S7O A;  5HAI A;  2PD7 A;  2W3G A;  4E04 A;  4DE1 A;  1JNU A;  3LIB A;  1SDN A;  3KYZ A;  3FKW A;  4HJ4 A;  3A3E A;  2EWW A;  3PBO A;  1XJ4 A;  2Y2J A;  2PD8 A;  3T4S A;  5HWV A;  3MKE A;  1WYB A;  2VX8 A;  3N8R A;  2ZQC A;  2EX2 A;  5E2E A;  1G28 A;  4OOY A;  3Q7V B;  4MBK A;  4EBP A;  1MWT A;  5FQJ A;  1WYC A;  3EEH A;  4KG2 A;  2W3H A;  4Y15 A;  1XFQ A;  4HOI A;  1KVL A;  4EQ1 A;  2BLS A;  3LO7 A;  1ZTU A;  2W1R A;  3T4J A;  1L0G A;  4HBU A;  3P98 A;  1SKF A;  4GS9 B;  2E8I A;  4C3Q A;  4E3O A;  3NEC A;  4NG2 A;  4PM7 A;  4N92 A;  3T12 B;  1V9Z A;  2DMW A;  3QP4 A;  1SZV A;  4Y5F A;  2O9A A;  3E0Y A;  3UB6 A;  1OJG A;  5D3O A;  5DTT A;  3IHB A;  2HV1 A;  3DWZ A;  4FD8 A;  5FQQ A;  4I3A A;  2OWH A;  1H3Q A;  1IFQ A;  1DY6 A;  3UPN A;  3I7J A;  5IT5 A;  4NXG A;  5DFY A;  5EUA A;  1OTA A;  4ZJ3 A;  3B42 A;  4ZAM A;  2PYR A;  3VE4 A;  2WKR A;  3O86 A;  4MDZ A;  4OP5 A;  4DKI A;  3M2K A;  1FSY A;  4EEU A;  1OME A;  1T18 A;  2Y2H A;  4WMC A;  2L1M A;  2X02 A;  4WZ4 A;  1K38 A;  3GMW A;  2XR0 A;  1UWN X;  2ZLY A;  5FL3 A;  3LUQ A;  5EEC A;  3C38 A;  1RGY A;  4C6Y A;  1LT0 A;  2V9A A;  5CRF A;  2L0W A;  3BFE A;  4S2K A;  4WEK A;  5CED A;  4KEN B;  3HLF A;  4II7 A;  5CHM A;  1OTB A;  3NCK A;  3BQ8 A;  1W8Y A;  3MFX A;  2ZM8 A;  3A3J A;  4I3I A;  3ZGA B;  1NZO A;  1K6S A;  5HDC A;  4PPR A;  4P6B A;  2Y2L A;  4DXC A;  1TD5 A;  3MSH A;  1O7E A;  3HLD A;  3M2J A;  2YKF A;  3JVU A;  4QPR A;  5J4E A;  3E2L A;  3QNC A;  3BFF A;  5L09 A;  4ZJ2 A;  3KSG A;  5FAQ A;  2W1T B;  4ARZ A;  4E3N A;  4R3B A;  1S1Y A;  3P7N A;  3ULF A;  2HP9 A;  4WEJ A;  1ES5 A;  1W79 A;  3MS6 A;  4WZ5 A;  2XSS A;  3CIT A;  4S2I A;  2XD5 A;  3ITA A;  1BLH A;  4S2L A;  1K4F A;  1PW1 A;  1S0W A;  3CHW P;  2W3D A;  1SKO B;  1A0K A;  2FFF B;  1OT9 A;  2PAV P;  1VHM A;  4NXB A;  1K57 A;  3LYX A;  1FQG A;  4MLL A;  4R0Q A;  2G7U A;  2XGN A;  2IWB A;  5HDS A;  4Y17 A;  1S4S A;  5F5Y A;  2D02 A;  3N8S A;  3UB8 A;  4KG6 A;  5F1G A;  1E4D A;  2ZC6 B;  5HWW A;  4OLD A;  2EFU A;  2H10 A;  1E3U D;  4GHI B;  4CLC D;  2XQZ A;  2B5R A;  3LIE A;  4HI4 A;  4QD4 A;  5F1F A;  2VA0 A;  3SZT A;  5HAP A;  2Q9N A;  4JPM A;  1PWG A;  4M3K A;  1Q2Q A;  3IWQ A;  1JWP A;  4JF6 A;  4GB7 A;  3FPV A;  4HP4 A;  3B33 A;  3UB9 A;  1XP4 A;  1I5Q A;  2PHY A;  5EFW A;  2Y2O A;  5AQ9 A;  3OZH A;  4UQI M;  2J80 A;  4KZ7 A;  4HBT A;  4JXG A;  4EET B;  4NK3 A;  1K25 A;  3ZHH A;  3H82 B;  3ITB A;  1XJ6 A;  1YMX A;  4PM5 A;  3IF5 A;  4R38 A;  3OOV A;  1PZO A;  1MWS A;  3FKV A;  4X69 A;  2ZOH A;  1PIO A;  4Y0T A;  3MZE A;  4K0W A;  5EVL A;  5HPF A;  5KMW A;  5FEF A;  3BLM A;  5KIZ A;  2ZQ9 A;  1JWZ A;  2QZ6 A;  3SH7 A;  4EV4 A;  2L4R A;  3GDI A;  2J8Y A;  4EEP A;  4FH4 A;  1F98 A;  5FA7 A;  1DP8 A;  1NRJ A;  1IEL A;  1KDS A;  2J9P A;  1L0D A;  2XDM A;  3VSL A;  4NET A;  3RXW A;  2P74 A;  4PM8 A;  1DJB A;  4ME4 A;  2JKR M;  3G34 A;  4NXE A;  2PR6 A;  2WZZ A;  1D06 A;  2R78 A;  2WGW A;  2ZC4 B;  4FSF A;  2FFY A;  4EQI A;  3NOT C;  3LEQ A;  2VGL M;  2XD1 A;  5MC7 A;  3A3I A;  4LRZ E;  3G31 A;  2EWV A;  4DDS A;  4LV2 A;  4WF0 A;  2WZX A;  3NUL A;  3V5M A;  3SS4 A;  5CTM A;  3CMZ A;  1G6O A;  5AJG A;  1BSG A;  2CMN A;  3LR3 A;  5GHZ A;  3DTE A;  1T1B A;  3RTY A;  2V8F A;  3MMH A;  4LV3 A;  2JHE A;  3QP5 A;  3UDX A;  1TS6 A;  4Y7P A;  2XFT A;  4JGR A;  3BLS A;  2EXB A;  4QY5 A;  3KSH A;  1MBL A;  1QMF A;  2OWJ A;  1DP6 A;  4ZJ1 A;  3EGD C;  5EVI C;  3JVV A;  1GSV A;  1RGZ A;  1I2W A;  5JYO A;  3SW1 A;  4JF5 A;  4AFI A;  3UE1 A;  1NLZ A;  1EI5 A;  2QYB A;  4MNR A;  5CHU A;  5E43 A;  3IF6 A;  5IS1 A;  2V1A A;  3OPH A;  5CTN A;  4LV1 A;  5HDD A;  5FI2 A;  2WGW B;  3M6B A;  1K54 C;  4QU3 A;  3BFC A;  5M19 A;  2UWX A;  3HLC A;  1KE4 A;  3TOI A;  1FR6 A;  3AGF A;  3SOI A;  1VET B;  2ZQA A;  1YLY A;  1OPX A;  3FG8 A;  1JVJ A;  2Y2I A;  4BBV A;  2B95 A;  3LR0 A;  2HJ9 C;  2Y2K A;  4MN6 A;  5FDS A;  5GLD A;  2WGI A;  3JPU A;  5F83 A;  2GNX A;  4FOF A;  3UME A;  1VB6 A;  2QPN A;  4HJ3 A;  2K7S A;  3ICY A;  3L7H A;  3HLG A;  4OOM A;  4KZA A;  3H82 A;  3WRZ A;  4MN5 A;  1CEF A;  3GRJ A;  1K55 C;  2GJ3 A;  4BMW A;  2K31 A;  4YIN A;  3MZD A;  2GZA A;  2OAP 1;  5GLC A;  1N9O A;  3F1N B;  3SH8 A;  1BUE A;  4E3J A;  5HWT A;  4LEN A;  5AVE A;  4WM9 A;  3TE8 A;  1OT6 A;  2Y2Q A;  2C5W B;  2VGJ A;  4GW9 A;  4P6Z M;  1ZKJ A;  1N4O A;  3EEA A;  1QME A;  3ZYT A;  3U2A A;  2NUP C;  1T1C A;  1N9L A;  3P09 A;  3C4P A;  1LSX A;  1MY8 A;  1NWZ A;  4YNR A;  1KE0 A;  4OOL A;  4HH3 A;  5G4Y A;  3RJU A;  5EVE A;  3MXS A;  2WGV A;  4ZDX A;  5A90 A;  3RFB A;  4E6X A;  2Z6C A;  1K4E A;  4OQI A;  2WKE A;  3G2Y A;  3BFG A;  1TVF A;  1BLS A;  2ACG A;  1ZG4 A;  4UA7 A;  5A92 A;  1XGJ A;  4KZB A;  1L0E A;  4HES A;  2DCF A;  1GHI A;  5U47 A;  3LY4 A;  1E3U A;  2V1Z A;  4CLC A;  3IXD A;  4Y0O A;  3U4L P;  1IOU A;  1Y4O A;  3Q7Z A;  2XRO A;  3MJQ A;  4LRY C;  1ZG6 A;  3RXX A;  2R9X A;  4BWI A;  2VV7 A;  4OVD A;  1LI0 A;  4Q0J A;  1PWD A;  3QP8 A;  4IJG A;  4LRX C;  2J3T D;  3NDG A;  5E2G A;  1FCO A;  1M40 A;  4GD8 A;  4B93 A;  1W63 M;  2O0Y A;  4QY6 A;  3LIC A;  3EQU A;  1GA9 A;  3DAV A;  3A0V A;  3T4Q A;  2QMI A;  4R23 A;  1T19 A;  2XFS A;  4F3L A;  3PBT A;  3IXG A;  5M18 A;  3D4F A;  2HJE A;  3TW8 A;  2H28 A;  4P85 A;  1KVM A;  3PAE A;  4OP8 A;  4DMZ A;  4IVK A;  4DN0 A;  2UV0 E;  5AVF A;  4KZ8 A;  2AVX A;  1PYY A;  4IED A;  2EA9 A;  4JGO A;  3UN7 A;  3F1P A;  2KDK A;  2XK1 A;  3HUM A;  1H0M A;  3D9Y A;  2OAQ 1;  2Y59 A;  4L9F A;  3G2Z A;  1YKD A;  2B02 A;  5KSH A;  2ZM2 A;  4HJ6 A;  4BD0 A;  5DKK A;  4GOG A;  1KDW A;  4ZRR A;  3IS2 B;  3KSI A;  3BQA A;  2VJW A;  3P01 A;  4LGW A;  3RH8 B;  3BRM A;  4PKY A;  3EGX C;  2ZOI A;  3C5A A;  1XJ2 A;  5GHX A;  3G32 A;  1BLC A;  3QP6 A;  2Z2M B;  4JXV A;  4G3W A;  4R3A A;  1T1A A;  3LR5 A;  1IKI A;  2KLI A;  3A0S A;  3S7N A;  4DJ2 A;  2HDS A;  3UPO A;  1JWV A;  4EER A;  2FZ0 A;  1K54 A;  5TFQ A;  3MQO A;  3PBS A;  3T1S A;  2QWS A;  4XT2 B;  3ZNY A;  1UGU A;  4OH0 A;  3ZG0 A;  1Z09 A;  4D60 A;  4YFM A;  2Y2P A;  3NOP C;  1MZU A;  5IHV A;  4EUZ A;  3VP3 A;  3PYP A;  1M6K A;  1SHV A;  4HQA A;  4OLG A;  1MC0 A;  1HTZ A;  4X53 A;  5AQB A;  1JTG A;  2VGK A;  2X71 A;  3OPR A;  4CQH A;  4GDB A;  4UA6 A;  3W2Z A;  5BOH A;  4RQ9 A;  4X1L A;  3O88 A;  3UB5 P;  1OTE A;  2JKG A;  1ZHH B;  4IHQ A;  5F68 A;  5TR7 A;  1CK3 A;  3N6I A;  3BY9 A;  4H6J A;  1CF0 A;  5M1A A;  1H8Y A;  5G18 A;  3ZQ5 A;  2E8J A;  3BYD A;  5HW3 A;  4P87 A;  1FIL A;  1OTD A;  4FUW A;  2QJ5 A;  3UY6 A;  3G35 A;  5DF7 A;  2Y2G A;  3Q07 A;  1XFN A;  1CI8 A;  3V39 A;  2VKS A;  4BL3 A;  2J9O A;  3ZG7 B;  2V2F F;  2QHK A;  3O5Y A;  5CGX A;  1IKG A;  5E2H A;  3PR6 A;  4KUK A;  1O07 A;  5EV0 A;  3OC2 A;  3G4P A;  2ZJ9 A;  3T1X A;  3IF6 C;  1ALQ A;  2JKF A;  4GD6 A;  5C5K A;  2ZC7 A;  4CLC E;  5GLB A;  2JKT I;  4G3V A;  3VP0 A;  1CQA A;  2J7V A;  5I94 A;  2C6W B;  4PHT A;  2RL3 A;  3HLW A;  1GHP A;  1HZO A;  3GQZ A;  3GV9 A;  2XF3 A;  1NYM A;  3A3D A;  4I3J A;  4DRT A;  3BW6 A;  5GL9 A;  1ODV A;  3FWL A;  5TBM A;  4KQD A;  1AXB A;  2IA2 A;  3G30 A;  2Y91 A;  3C8C A;  1XGI A;  4EXO A;  3ZFZ A;  1RCJ A;  4ZTK A;  4CPK A;  1XA1 A;  3K3D A;  5DFX A;  5GLA A;  2ZMF A;  4OON A;  4IVI A;  2XA7 S;  1GSW A;  4KZ3 A;  4MN7 A;  4LPZ A;  4K08 A;  3T50 A;  4O0P A;  2PDR A;  3SS3 A;  1EW0 A;  4I5S A;  2V1B A;  1TS0 A;  1UWP X;  4WUJ A;  5FSR A;  3EQV A;  3GEC A;  3IWO A;  4FCF A;  4KZ9 A;  5I5L A;  3SS5 A;  2VEA A;  3WRT A;  5F82 A;  4X6T A;  3FYZ A;  4EW7 A;  5HZH A;  3CPT B;  2QJ7 A;  1KE3 A;  1K6R A;  1SDE A;  3CI6 A;  3S4X A;  2WAF A;  1ONG A;  5HPI A;  4GJ4 A;  1HVB A;  3D72 A;  2J3T C;  2V0U A;  5L2F A;  4KUO A;  3ZVW A;  5IU1 A;  5J8X A;  2CC1 A;  3LIA A;  1U60 A;  1NLY A;  2GDN A;  3VV4 A;  1PW8 A;  3H7W B;  1J9M A;  4EES A;  4ID4 A;  2VV8 A;  2P9V B;  5CXW A;  1FCN A;  5L10 A;  1MXO A;  3IX3 A;  3H9W A;  3JYI A;  1TEM A;  2WYX A;  3B47 A;  3LID A;  1BZA A;  4UEY A;  4LCL A;  2XLN A;  3Q81 A;  3ZDJ A;  4MEZ A;  3F1O A;  4GDN A;  1P97 A;  1LL8 A;  1PWC A;  3VOY A;  3FPW A;  2M7V A;  4MBH A;  5TBM B;  5LBR A;  5CEB A;  5AQ7 A;  3W4Q A;  4JGQ A;  4WBG A;  3UDF A;  3UE6 A;  4HEF A;  4Z9Q A;  4Y13 A;  4L9G A;  2ZQD A;  3MQQ A;  2G2W A;  4EUV A;  3Q7V A;  4BJP A;  4G3K A;  4LFU A;  1YSP A;  5HFO A;  5KZH A;  1LL5 A;  3MZF A;  2PBY A;  1NYY A;  3A3F A;  3LR4 A;  3FC7 A;  2P7J A;  4YOF A;  3LEZ A;  1IYS A;  3PTE A;  4LLO B;  5FAP A;  4OPZ A;  1BYW A;  1TS8 A;  5A93 A;  1FSW A;  5EOO A;  3H7W A;  4S2J A;  3S7Q A;  2OLV A;  1YMS A;  4O7D A;  1Y28 A;  4PM6 A;  4F3L B;  3BEB A;  1XA7 A;  1H8Z A;  3TJZ C;  2JC7 A;  4HP9 A;  2O99 A;  5J3W A;  3TG9 A;  1FIK A;  5HAQ A;  1ERO A;  2ZQ8 A;  1YLP A;  2JE5 A;  2FH5 A;  1BLP A;  4E3I A;  5HSQ A;  1YM1 A;  4GHI A;  4OQ0 A;  4XUX A;  1XKZ A;  2VV6 A;  1K0K A;  3BFD A;  4OPQ A;  3VFH A;  4N9L A;  4C75 A;  1G68 A;  1IYQ A;  3LIF A;  4Q0H A;  2D01 A;  4N1X A;  3HVF A;  4BD1 A;  2IWC A;  3QP1 A;  4E3L A;  2WAE A;  4BQM A;  4GS9 A;  3A0R A;  1PNE A;  1P9R A;  4B88 A;  5JYP A;  3GTC A;  3G6O A;  5EM0 A;  4BL2 A;  2WAD A;  3CLO A;  4NXF A;  5CX7 A;  2XEP A;  3MBZ A;  2O9B A;  4E6W A;  1Y54 A;  3QNB A;  2HP5 A;  4WLA A;  1I2S A;  2VZW A;  2DRW A;  1W7F A;  5CGS A;  1CJF A;  2Y8H A;  2W3F A;  4PM9 A;  3E98 A;  4JKT A;  2ZBB A;  4K0X A;  2HPB A;  4XUZ A;  2KOI A;  1L2S A;  3UB7 A;  3K3C A;  4Y3I A;  4UA9 A;  3WS4 A;  4JLF A;  3BJN A;  1TDG A;  1F5M A;  1X0O A;  2HF6 A;  4HHD A;  1W8Q A;  1ES3 A;  2ZMV A;  3N7W A;  2Y55 A;  1ESI A;  3R7W A;  2EX9 A;  2EXA A;  4CLC C;  2V20 A;  1N9B A;  3GVB A;  1F9I A;  1OTI A;  1XPB A;  3C7U A;  4RX2 A;  5HL1 A;  2WKH A;  5DTS A;  2B18 A;  1L3L A;  4R4R A;  4BBT A;  4OPR A;  3W8K A;  1NY0 A;  4EU0 A;  5CHJ A;  2HDR A;  4Q0I A;  3VP2 A;  1DJA A;  3F1N A;  1IYP A;  1S6R A;  3KX0 X;  5HAR A;  4ESP A;  4N9K A;  3V3S A;  3VOL A;  3PBR A;  1LLB A;  3IBJ A;  1IEM A;  3VP1 A;  3KYE A;  2I9V A;  4M4X A;  1BT5 A;  1ZC2 A;  4S2P A;  5CEC A;  3HLB A;  3MF0 A;  4QHC A;  5FQI A;  3SH9 A;  4IBX A;  5FQ9 A;  1HLU P;  4KZ6 A;  4OKP A;  3F1O B;  2P04 A;  2ZQ7 A;  3CZD A;  1GCE A;  2W1T A;  4ARZ B;  3QHY A;  2A24 A;  2LB5 A;  3BY8 A;  3HBR A; 
#chains in the Genus database with same CATH homology
 3CPT A;  5EM1 A;  1FIK A;  3T1R A;  3T1S A;  3U4L P;  1CF0 A;  3T1Q B;  2ZL1 A;  3LGO A;  1CQA A;  1PRQ A;  2V8F A;  3T12 B;  1VET A;  1VEU A;  2VK3 A;  3L7H A;  3LEQ A;  1J3W A;  1CJF A;  1YPR A;  1ACF A;  1SZV A;  2BTF P;  1Y4O A;  2ACG A;  2HZ5 A;  3D9Y A;  1PNE A;  2E8J A;  3CHW P;  4QWO A;  1SKO B;  1A0K A;  1VET B;  1Z09 A;  3L9K A;  1G5U A;  2PAV P;  4D60 A;  4X25 A;  5EM0 A;  1HLU P;  3NUL A;  1SKO A;  3CPT B;  4X1L A;  1FIL A;  1AWI A;  4FTX A;  4FUW A;  5EV0 A;  3UB5 P;  2JKG A;  2B95 A;  1PFL A;  5EVE A;  4ESP A;  5FEF A;  5FEG A;  1K0K A;  3MS6 A;  2V8C A;  3T1X A;  1D1J A;  2JKF A;  3MSH A;  3KYE A;  5FDS A;  1F2K A;  3DAV A;  4X1M A;  1VEU B;  3NEC A;  2PBD P;  2ZL1 B;  2PRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...