3KYEA

Crystal structure of roadblock/lc7 domain from streptomyces avermitilis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
120
structure length
120
Chain Sequence
VSDLDWLMSGLVQRVPHTTSAVLLSCDGLVKSVHGLDPDSADHMAALASGLYSLGRSAGIRFGDGGDVRQVVVELDSTLLFVSTAGSGTCLAVLAGREADAAVLGYEMAMLVKSVRPYLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Roadblock/LC7 domain, Robl_LC7
publication title Crystal Structure of Roadblock/LC7 Domain from Streptomyces avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Structural genomics, unknown function
total genus 31
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03259 Robl_LC7 Roadblock/LC7 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.30 Alpha Beta 2-Layer Sandwich Beta-Lactamase Dynein light chain 2a, cytoplasmic 3kyeA00
1ACFA 3T1QB 1FILA 2JKFA 2E8JA 5EM0A 3L9KA 3MSHA 3NULA 3D9YA 3NECA 4D60A 1CF0A 3KYEA 1Y4OA 1PFLA 2V8FA 1SKOA 3UB5P 4QWOA 1VETB 5FEGA 1HLUP 3MS6A 4FUWA 5EM1A 3CPTA 3LEQA 1PNEA 5FDSA 3T1RA 4X25A 3T1XA 1CJFA 1SKOB 3T1SA 1FIKA 2HZ5A 2PBDP 2B95A 3CPTB 4X1LA 3U4LP 1VEUA 3DAVA 1D1JA 3CHWP 1YPRA 1A0KA 1Z09A 5EV0A 3T12B 1K0KA 1G5UA 2ZL1A 5EVEA 1AWIA 1VEUB 4FTXA 2BTFP 4X1MA 2V8CA 1CQAA 1SZVA 3LGOA 2ACGA 3L7HA 2ZL1B 5FEFA 1F2KA 2VK3A 1J3WA 2PAVP 2JKGA 1PRQA 4ESPA 2PRFA 1VETA
chains in the Genus database with same CATH superfamily
2WKRA 4Q0IA 3G4PA 2G7UA 3Q7ZA 5CTNA 5CTMA 3C4PA 1BLSA 2OV5A 4NXGA 2LB9A 2VV7A 4RQ9A 4UQIM 4U0TA 1PW8A 1N9LA 3UE0A 5GHXA 5A90A 4BBVA 3ZNYA 2VGLS 2XA7S 5G4YA 4DE0A 2Z2LB 1MC0A 4EU0A 2XR0A 1FR6A 2EFUA 1LSXA 1NJ4A 4OLDA 4ZJ3A 3IWIA 3CJMA 4EBPA 3IT9A 5KZHA 4HH3A 1MWSA 2VV6A 2ZMVA 4HJ6A 3RFBA 4H6JA 1SKFA 5EM1A 3HLEA 1XGJA 4I38A 1GSXA 4P6ZM 1LL9A 1DY6A 3E4PA 5HDCA 4BD0A 1O07A 1FIKA 2OSUA 4S2OA 2VGLM 5HPIA 3E4QA 4QU3A 1TEMA 4DRTA 5HX9A 4MEZA 5HSQA 2NUPC 1ODVA 3G31A 1YT4A 3DBAA 2H0YA 4Y17A 1W63M 2ZL1A 1WA9A 3H7WA 4FD8A 2BTFP 3C2WA 2HP5A 4EBLA 4UEYA 2VX8A 1LLBA 3K3CA 2EXBA 3VP2A 3H82A 2PHYA 3CAXA 2V0WA 1LL5A 1J3WA 2PAVP 3K3DA 1KGGA 1TDLA 1GSVA 1VHMA 4PPRA 5TJJA 4R3BA 4RYEA 4R23A 2RL3A 4IBXA 1P9RA 4K91A 1FSWA 2WK0A 5EPHA 5FQQA 4OLGA 1L0GA 4JGRA 4NXEA 4HH2A 2ZQ8A 3EGDC 1IKIA 2P04A 2QMIA 4N9LA 1IELA 4ETZA 3N7WA 2WGIA 4PHTA 3LFVA 3A0SA 3WS4A 4O7DA 4ETXA 4PAUA 2WGWB 5HFOA 2ZJ9A 2O9CA 4D2OA 1XPBA 4JXVA 2BG1A 1PWDA 1PI5A 1SKOA 1MWUA 2J8YA 1Z6FA 3LIEA 3MS6A 5CGWA 5M1AA 2E8IA 3JVVA 3CUEA 2DRWA 1KE4A 3B42A 5F1FA 4GS9B 1PW1A 3KYQA 3P01A 4EWFA 2EX2A 2ZM0A 4KZ3A 1Y28A 3MQQA 3F1PA 3HJIA 2L1MA 3HVFA 2A24B 3EOIA 2Y2LA 3LI8A 5KMWA 3N8SA 2MJ6A 2JC7A 3SZTA 3SS3A 5IHVA 4GDNA 1WYBA 3GTCA 1JWVA 1SDEA 3BWLA 1ZG6A 2R9WA 4O8GA 3Q07A 2QKPA 2O9BA 4OP5A 4WN5A 4E6WA 4UAAA 3UPOA 2W3HA 4H8RA 3VV4A 5EM0A 2A49A 5CERA 2W3DA 5AQ9A 2WADA 3BECA 4EERA 3LIDA 2V20A 3QP8A 4DXBA 3R4KA 4Y13A 4L9FA 2J7VA 3R7WB 2EX6A 4YWZA 1CF0A 5DTTA 3FYZA 2KX6A 2YKFA 1TS7A 2XDMA 2K31A 3IXGA 3PAGA 3LYXA 1BZAA 5M19A 1YLPA 4ZDXA 4E3OA 5F83A 1W8YA 3UDFA 4FUWA 5FAQA 4B9OA 5HDDA 2QJ7A 3IQAA 4IVKA 4DJ2A 4GZBA 5DTKA 4KZ5A 4ARZB 2K2NA 4PKYA 2X02A 3KYZA 3DWKA 2FH5A 4F3LA 3V3RA 4DE3A 3CHWP 2HJEA 2PYPA 1A0KA 2Y2HA 5I5LA 1BLCA 1JTDA 4WF0A 1NY0A 1K25A 1TS8A 4FTXA 1UWNX 3MJQA 4KUOA 1V9ZA 4OKPA 5HDSA 5TFQA 4ZBEA 4E3MA 4LFUA 4WZ5A 3KX0X 2M1CA 4OOLA 2DNSA 2Y2PA 2VK3A 3ZG5A 3CMZA 4UA7A 4PM9A 4LV2A 1XP4A 5MC7A 3DW0A 2WKIA 4PM8A 4WZ5C 2I72A 2Y2JA 3B3XA 4B4XA 3HUNA 3F1NB 4M3KA 4Y7PA 1K4EA 2AVXA 1PWCA 1MWRA 2WKPA 4G3KA 1W79A 4HP9A 3LR0A 3U2AA 2JN7A 4MNRA 4E6XA 4F94A 3A3EA 1VETB 5FEGA 3UB7A 3F1OB 3TW8A 4GHIB 3OBFA 2QJ5A 1KGFA 2XROA 2R9XA 3FWLA 4JPMA 3CWFA 4NXBA 3BM6A 4P87A 3ISGA 1MY8A 3GR2A 3DTMA 4OOYA 5EV0A 4X56A 3UDIA 1S67L 1G5UA 1S4SA 2PR6A 5HWTA 4JXGA 2DMWA 4OQIA 4HJ3A 4KZ4A 4CLCB 4LV3A 4Y3IA 3VOLA 3ZHHA 4LCLA 2XLNA 5F68A 4UA6A 2A3UA 1IEMA 4XT2B 5GLAA 5FEFA 1YLJA 1I5QA 1XFQA 5L10A 5G18A 5DF8A 3T1QB 3IF5A 2B18A 4X55A 3V39A 4LRXC 1EW0A 1YAXA 4EUZA 4RX2A 1XA7A 4IUKA 4Y0UA 3FZCA 5DJTA 3MFDA 3W4PA 3MZDA 4E3NA 2RCXA 4WYYA 1K57A 2KLIA 5J4EA 2Y2OA 1HD8A 3P09A 1HVBA 4K0XA 3IXHA 1OTIA 4JF6A 4YOFA 4ID4A 3EGXC 4NK3A 4BL2A 1CI8A 2DCFA 4E3JA 1DJCA 1K57C 1PZOA 1YM1A 1E3UA 5E2EA 3EQUA 4MN6A 1GA9A 5HAPA 3LIBA 3UE1A 5EOEA 4R3JA 2Q9NA 4HQAA 4ZJ2A 2HP9A 3IBRA 2HZ5A 2PBDP 1K56D 1L0FA 3PBOA 5J3WA 2A2LA 4XUZA 4EV4A 4HIAA 1BT5A 4JLFA 3HLDA 4WM9A 3S7PA 3W4QA 4Q8IA 5DVAA 1OPXA 1NZUA 1ZTUA 1DJAA 3OPPA 5GHZA 1LT0A 1ES4A 1CQAA 4NETA 1OTDA 3PBQA 3A3IA 4QPRA 4E3LA 1OTBA 3FPVA 4WLAA 5CHUA 3PR6A 4E04A 3BFDA 4BWIA 3FPWA 1H0MA 2WYXA 3A3JA 4ZRRA 1EROA 5EVIA 4I3AA 1ACFA 1S6RA 4UQIS 1KE3A 2V1AA 5FAPA 5C5KA 3JPUA 3NDEA 5IT5A 4HNBA 3HLFA 4DE2A 5E2FA 3NC8A 3NULA 1UGUA 3D9YA 5EVIC 2CC1A 3FG8A 3S4XA 3GDIA 5IS1A 2ZC6B 3GECA 3B47A 5JYPA 5F1GA 3OCLA 4ZAMA 1ERQA 2IA2A 2W1TB 1ESIA 3GRJA 1DP8A 1KDSA 4XUXA 1T18A 1KOUA 2G2UA 1M6KA 4ZTKA 4P6ZS 2Z6DA 3B33A 2Y79A 2XRNA 3WS0A 3C4OA 1Q2PA 3IH8A 1CEFA 2W3EA 5FAOA 4DJ3A 4CPKA 3Q82A 3VE4A 4KUKA 3Q7VB 5FATA 1D1JA 3N6IA 5A8BA 1G6AA 5A91A 5KIZA 3ZVTA 2IWCA 2EXAA 4C3QA 1BTLA 5AVEA 3QP1A 4GD8A 4BD1A 4L9GA 1D7EA 2XSSA 4PMAA 4N1HA 4WMCA 4X1MA 4E3KA 1F9IA 3G34A 1EI5A 2WGWA 3V5MA 3RJUA 1BSGA 2JKGA 5CEDA 1RGZA 3LEZA 3EWKA 3T4KA 4LV0A 2EFXA 3ITAA 1FILA 2XH9A 1MKIA 2BASA 2NUTC 3NCKA 4N1XA 1FOFA 4HBTA 2C5WB 1QMEA 4OOMA 4GS9A 5FL3A 5DKKA 5K5BA 2IWDA 3HLWA 4MBHA 1P9WA 1HZOA 2Y2MA 2UWXA 3EQVA 2ZQDA 4QHCA 4EESA 4JF4A 1KE0A 3BFFA 2PR5A 3KSHA 4GN2A 2WAFA 5J7EA 3OLOA 1OT6A 2ZM2A 3G32A 2XD5A 4WL9A 1AXBA 4GOGA 2W3FA 3KSIA 4L9EA 2L0WA 3W2ZA 3OCNA 1P97A 2W3GA 1TF1A 5JYOA 3UE6A 1QMFA 3NY4A 5HZHA 4LPZA 3MKFA 3MBZA 1JWPA 3G30A 2OOLA 4H6JB 2WGVA 2J3TD 1VM1A 1XJ2A 3FKVA 4B93A 1ZHHB 1IOUA 3BFEA 4KG2A 3T12B 3SS5A 5HL1A 3IWOA 2PU4A 4B4ZA 3HBRA 3MXRA 3R7WA 1YMSA 1F98A 3QP6A 2OWJA 3ITBA 4HOIA 1RP5A 3ZGAB 2GZAA 1ES5A 3L7HA 2ZL1B 1ES3A 4P85A 5CGXA 4LENA 1IFQA 2Z2MB 4HBUA 3PAEA 3CUEC 3V50A 4MBFA 1K55A 2JKTM 5EFWA 4XXRA 3ICYA 2WKEA 2KOIA 3LR3A 5L8MA 5CX7A 1TDGA 4DDYA 5A92A 5HL6A 3IXBA 1CI9A 3I7JA 5E43A 4ARZA 1IYSA 1K55C 4OQHA 5TBMB 3RTYA 4KZ7A 4JXSA 3T50A 1D06A 1XXMA 5HAQA 2BLSA 5HD3A 3T4LA 2ZC4B 1Y4OA 1IYPA 1K6SA 1GHIA 4LRYC 3P7NA 4DE1A 4QY6A 1S1ZA 2ZQCA 4I39A 1RGYA 3Q1FA 4JGQA 3A0RA 4OPZA 1W5DA 2XF3A 1G68A 1OTAA 2XFTA 1SKOB 4LGWA 5EUAA 1M40A 3PHYA 2HDUA 4O01A 2ZOIA 4IHQA 3DAVA 2Z6CA 4OQGA 3EEHA 3BJNA 1T1AA 3F1NA 1K0KA 4DKIA 3VP1A 3LIFA 3ZG7B 4BQMA 2V1ZA 3M6BA 4BBUA 2XGNA 2ZMFA 3ZG9B 4JGOA 4JGPA 4FOFA 3GQZA 5DKLA 4BMWA 2P9VA 3CZDA 2FFFB 4DF6A 2D02A 3PTEA 3W8KA 2JKTI 3P98A 4S2KA 3VFHA 4HP4A 2VV8A 3O86A 3WRZA 3T4SA 1FQGA 1VETA 2JKRM 4DMZA 4BL3A 1K6RA 4KG5A 4R4RA 3UB9A 3ULFA 2FZ0A 2IWBA 4BBTA 5E2HA 4KG6A 3BQAA 3NBLA 2VKSA 3NDGA 2M7UA 3SOIA 1OMEA 3NIAA 1JWZA 3GMWA 1XGIA 3UB8A 5FQJA 5GLDA 3O87A 2PYRA 2V9AA 1YLWA 4LV1A 4RX3A 1ZKJA 3IF6A 5EVLA 3CPTA 2W1RA 4XT2A 4Q0JA 2GNXA 1GA0A 3BLMA 1L2SA 1CJFA 3CI6A 3ZQ5A 2O0YA 4OVDA 2HF6A 4A5RA 1P0ZA 1UWPX 4X1LA 3E2KA 4KZBA 2L4RA 3IF6C 3NOPC 4MBKA 1YPRA 1W7FA 4IJGA 3G2YA 3IX3A 2VA0A 2Y4AA 4CLCD 3DTIA 2OAQ1 3UDXA 3GVBA 4F3LB 4EEPA 4OQ0A 1YQSA 1PZPA 2Q9MA 5DFYA 4OH0A 2ACGA 1N9OA 2INWA 5HW3A 4K0WA 2GX5A 3OPRA 1NRJA 3NI9A 2KDKA 4DDSA 3IX8A 2JKRI 4C6YA 3AGEA 3Q81A 1K38A 3LCEA 4WEKA 4Y0OA 1NWZA 1KGEA 3LR5A 1H8MA 2E8JA 4IVIA 2VEAA 1S0WA 4QJGA 2ZC5B 3SH9A 5CRFA 3VP4A 2JE5A 3MSHA 2ZM8A 1T1CA 1NYYA 3WS5A 3NECA 2O99A 3BRMA 4QD4A 1MXOA 4FH4A 5FI7A 1SDNA 4I5SA 3N8RA 5FDHA 5TGFA 3SW1A 1F5MA 1PYYA 1DP6A 1DP9A 1TVFA 4OPQA 5AQBA 1K56A 1H8YA 2QZ6A 3TSGA 2R78A 5DF7A 2J80A 4GB7A 2HPBA 1ONGA 2ZLYA 4Y2FA 3T4QA 5FSRA 2VJWA 3NJAA 1YLZA 2ZQAA 1VEUA 4GKUA 3PBNA 5L07A 2VZWA 3C5AA 4HHDA 1BULA 1ONHA 4MMNA 4U3TA 3QP2A 2HDRA 3KO6A 3VP0A 3A3DA 4OP8A 4KZ6A 1OT9A 4Y5FA 4KQOA 3LGOA 3G6OA 2P74A 4AFIA 2W1TA 4R4SA 3T4JA 1Y54A 1GSWA 1SHVA 3LUQA 2XD1A 2O9AA 2P08A 2K7SA 2PD7A 2HV1A 5TR7A 1VQQA 1OJGA 3C7VA 2EWWA 3O3VA 3MZEA 4KQDA 2QPNA 3KSFA 4HJ4A 1E25A 1XX2A 3T4TA 1BUEA 1YSQA 2XEPA 4PKYG 3WS2A 2W27A 4N9KA 3BY8A 4EQ1A 3WWXA 5BOHA 2V0UA 3LR4A 3V3SA 2ZOHA 3CITA 2H0TA 4CQHA 1X0OA 3ZYTA 2FFYA 4KQQA 3ZNTA 4LRZE 3M2KA 2QHKA 1MKMA 2EA9A 5F82A 2Y2QA 3LIAA 1PNEA 3ZDJA 3E98A 1BLPA 3C8CA 4X25A 3IHAA 3HL9A 1NZOA 3PYPA 2EWVA 1FCOA 1PIOA 3TG9A 4X53A 5GL9A 3VE3A 4EXOA 2B95A 2HJ9C 2OLVA 3NOTC 1I2WA 1H8ZA 1L3LA 4ME4A 4LLOB 3TRCA 1NXYA 1U60A 1JVJA 4KZ9A 4CJNA 1NRFA 4Y15A 3MFXA 2Y59A 3HREA 5HPFA 1RCJA 4YNRA 4R38A 1YLTA 3HUMA 4S2NA 3ZFZA 4CLCE 2OAP1 1XJ4A 2G2WA 5EVID 3UN7A 5CEBA 2PT7A 3VSLA 5FI6A 3UO9A 3MF0A 1IKGA 4ESPA 4LCMA 2J3WA 4S2IA 4S2NC 3OC2A 3HCYA 2EX8A 4Z9QA 4HI4A 4WEJA 4C75A 3VOYA 2ZQ7A 1JTGA 2VLGA 3C7UA 5D3OA 5EVIB 2GDNA 1LI9A 4II7A 3IS2B 3S1YA 4JBFA 3HJKA 4JXWA 3UY6A 5HAIA 2EX9A 3MKEA 3EEAA 1MZUA 4K08A 3OPHA 4R0QA 3PXPA 4S2PA 4M4XA 4UHUA 1PFLA 2XA7M 3FV7A 3S7QA 4S2MA 4QWOA 5CGSA 3BFGA 4GDBA 2HDQA 3PBTA 3QNCA 3E2LA 3DWZA 3AGDA 3HLBA 3IWQA 5FDSA 3OZHA 4EQIA 1IYOA 1N9BA 5E2GA 4EETB 1OJ5A 2A24A 2B5RA 5CECA 3BLSA 1KVMA 5FA7A 2PU2A 1TS0A 5F69A 1YMXA 3LI9A 4WMCD 2HP6A 2J3TC 5A93A 2M7VA 2ZQ9A 3BYDA 5FASA 5TBMA 2QWSA 1K4FA 3LY3A 2JHEA 3KSGA 2I9VA 5DF9A 5KSHA 2WAEA 5F5YA 5G4ZA 3UMEA 4EUVA 4N92A 1S1YA 5HWVA 4X69A 5HD5A 2J9PA 2JKFA 3ZCZA 3SS4A 3ZG8B 3UNWA 2V2FF 3C38A 1BLHA 1STZA 2P7JA 3H7WB 1G6OA 3OOVA 1N9NA 1WE4A 3CG5A 3H9WA 2Y2KA 3JVUA 4KZ8A 3H82B 3IHBA 4G3VA 3AGFA 3ZG0A 4PM7A 4NG2A 1H5XA 4L0LA 3BW6A 2XQZA 4GNUA 1VB6A 4Q0HA 1J9MA 4I3IA 3T1RA 4OPRA 2GJ3A 3T1XA 3RXXA 2WZXA 1XKZA 4NEED 4ZJ1A 3A0VA 1BYWA 2H5SA 5FQKA 2H10A 3BFCA 4KZAA 2OLUA 1SCWA 4IBRA 1Z09A 4GLQA 4RA7A 5I94A 3D4FA 4YFMA 5EVEA 3LO7A 5CHMA 5CHJA 3DTKA 4KQRA 3WS1A 3RH8B 2V8CA 5DTSA 4DN0A 1SZVA 2WZZA 3PBRA 2ZBBA 4MCWA 1FR1A 5L2FA 1FCNA 3FKWA 3SH8A 1FCMA 5AQAA 1S66L 1MBLA 2JBFA 3TE8A 3V67A 1ZG4A 3QNBA 3F1PB 1IYQA 4GJ4A 3A3FA 2H28A 4JF5A 3MQ0A 3E0YA 1K54A 2JCHA 3C30A 3BY9A 2PDRA 1ES2A 4PM6A 4BENA 4PM5A 3LICA 1H3QA 4JKTA 4HEFA 3G35A 5EOOA 3F1OA 1K54C 3D3OA 4GHIA 3QP4A 5AJGA 5EE8A 3UPNA 5AVFA 1CEGA 3UB5P 1DRMA 4GD6A 1XA1A 2UV0E 4E3IA 3MXQA 4NKPA 4FSFA 2HDSA 4WZ4A 4EBNA 3GSGA 1ERMA 5AQ7A 5DFXA 4UA9A 4X6TA 1E4DA 2PBYA 4G3WA 4S2LA 3U4LP 1GHPA 4CLCA 3JYIA 4KENB 1ESUA 2VGJA 5J8XA 3QHYA 4WUJA 2Y8HA 4MN7A 4R3AA 1AWIA 1W8QA 4BLMA 3VMAA 1C3BA 4MLLA 4CLCC 2PD8A 1PI4A 3IX4A 3S7NA 2WKHA 3TOIA 3O88A 5FI2A 2X01A 1TS6A 2Q0OA 5FQIA 3SH7A 2WKQA 1PRQA 3S7OA 3RXWA 3UE3A 4HY8A 2D01A 4X68A 2P9VB 1PWGA 3VOZA 5DJUA 3W4OA 3N4IA 1L0DA 4DXCA 1GHMA 2ZC7A 1YSPA 1MWTA 2ZD8A 2VGKA 1NYMA 4D60A 2LB5A 4IEDA 4R1GA 3MMHA 3VP3A 4U0XA 2ZC3B 3T4OA 1FSYA 4R70A 4OONA 3MZFA 1LI0A 1KVLA 3TJZC 3WRTA 1HLUP 3G2ZA 3LEQA 3M6HA 5EECA 2J9OA 3MR0A 2CMNA 4Z1WA 5M18A 5GHYA 1YLYA 3GV9A 4GW9A 1N4OA 4I3JA 3T1SA 2X71A 1XJ3A 4R6LA 4FCFA 4YINA 3IF6B 4EEUA 4QY5A 3IXDA 3CPTB 5HWWA 3HUOA 2C6WB 3QP5A 1ALQA 2Y2GA 4IUHA 5U47A 3MQOA 2XFSA 3N8LA 4RVAA 3PBSA 3VSKA 1O7EA 4MDZA 2Y91A 2W0NA 1ZC2A 1MPLA 1W63Q 3CLOA 1YKDA 3NOUC 4P0MA 1OTEA 5LBRA 4B88A 1Q2QA 3LY4A 1V9YA 5GLBA 1EWZA 1JNUA 3E4OA 2PRFA 4BJPA 4MN5A 5F6AA 1DJBA 4WBGA 4FH2A 1G28A 3BQ8A 3L9KA 4GCZA 5CXWA 1HTZA 1LSVA 1LHYA 5IU1A 5GLCA 3KYEA 1LL8A 3M2JA 1TD5A 4HESA 1LSWA 4OPYA 3DTEA 5HARA 1NLZA 2V8FA 3BEBA 3IBJA 1GCEA 3HLCA 2B02A 3UPPA 2OWHA 1L0EA 3Q7VA 1NLYA 3MXSA 2HGVA 4S2JA 4Y0TA 3OPLA 5L09A 3D72A 2Y2NA 1KDWA 1T19A 1E3UD 3O5YA 1I2SA 3IH9A 2Y55A 3FC7A 1S4RA 2QYBA 3K2NA 4EW7A 1XFNA 1T1BA 4NXFA 2WUQA 4QB8A 5FQMA 5FQ9A 1VEUB 2Y2IA 2V1BA 3IS2A 4O0PA 3HLGA 3UB6A 2YKHA 2XK1A 1XJ6A 1F2KA 3S22A 2ZMAA 5KSCA 3VFFA 3UMDA 3ZVWA 4P6BA 1CK3A 4WELA 3NHQA 1WYCA
chains in the Genus database with same CATH topology
1ACFA 3T1QB 1FILA 2JKFA 2E8JA 5EM0A 3L9KA 3MSHA 3NULA 3D9YA 3NECA 4D60A 1CF0A 3KYEA 1Y4OA 1PFLA 2V8FA 1SKOA 3UB5P 4QWOA 1VETB 5FEGA 1HLUP 3MS6A 4FUWA 5EM1A 3CPTA 3LEQA 1PNEA 5FDSA 3T1RA 4X25A 3T1XA 1CJFA 1SKOB 3T1SA 1FIKA 2HZ5A 2PBDP 2B95A 3CPTB 4X1LA 3U4LP 1VEUA 3DAVA 1D1JA 3CHWP 1YPRA 1A0KA 1Z09A 5EV0A 3T12B 1K0KA 1G5UA 2ZL1A 5EVEA 1AWIA 1VEUB 4FTXA 2BTFP 4X1MA 2V8CA 1CQAA 1SZVA 3LGOA 2ACGA 3L7HA 2ZL1B 5FEFA 1F2KA 2VK3A 1J3WA 2PAVP 2JKGA 1PRQA 4ESPA 2PRFA 1VETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ACF A;  3T1Q B;  1FIL A;  2JKF A;  2E8J A;  5EM0 A;  3L9K A;  3MSH A;  3NUL A;  3D9Y A;  3NEC A;  4D60 A;  1CF0 A;  3KYE A;  1Y4O A;  1PFL A;  2V8F A;  1SKO A;  3UB5 P;  4QWO A;  1VET B;  5FEG A;  1HLU P;  3MS6 A;  4FUW A;  5EM1 A;  3CPT A;  3LEQ A;  1PNE A;  5FDS A;  3T1R A;  4X25 A;  3T1X A;  1CJF A;  1SKO B;  3T1S A;  1FIK A;  2HZ5 A;  2PBD P;  2B95 A;  3CPT B;  4X1L A;  3U4L P;  1VEU A;  3DAV A;  1D1J A;  3CHW P;  1YPR A;  1A0K A;  1Z09 A;  5EV0 A;  3T12 B;  1K0K A;  1G5U A;  2ZL1 A;  5EVE A;  1AWI A;  1VEU B;  4FTX A;  2BTF P;  4X1M A;  2V8C A;  1CQA A;  1SZV A;  3LGO A;  2ACG A;  3L7H A;  2ZL1 B;  5FEF A;  1F2K A;  2VK3 A;  1J3W A;  2PAV P;  2JKG A;  1PRQ A;  4ESP A;  2PRF A;  1VET A; 
#chains in the Genus database with same CATH topology
 2WKR A;  4Q0I A;  3G4P A;  2G7U A;  3Q7Z A;  5CTN A;  5CTM A;  3C4P A;  1BLS A;  2OV5 A;  4NXG A;  2LB9 A;  2VV7 A;  4RQ9 A;  4UQI M;  4U0T A;  1PW8 A;  1N9L A;  3UE0 A;  5GHX A;  5A90 A;  4BBV A;  3ZNY A;  2VGL S;  2XA7 S;  5G4Y A;  4DE0 A;  2Z2L B;  1MC0 A;  4EU0 A;  2XR0 A;  1FR6 A;  2EFU A;  1LSX A;  1NJ4 A;  4OLD A;  4ZJ3 A;  3IWI A;  3CJM A;  4EBP A;  3IT9 A;  5KZH A;  4HH3 A;  1MWS A;  2VV6 A;  2ZMV A;  4HJ6 A;  3RFB A;  4H6J A;  1SKF A;  5EM1 A;  3HLE A;  1XGJ A;  4I38 A;  1GSX A;  4P6Z M;  1LL9 A;  1DY6 A;  3E4P A;  5HDC A;  4BD0 A;  1O07 A;  1FIK A;  2OSU A;  4S2O A;  2VGL M;  5HPI A;  3E4Q A;  4QU3 A;  1TEM A;  4DRT A;  5HX9 A;  4MEZ A;  5HSQ A;  2NUP C;  1ODV A;  3G31 A;  1YT4 A;  3DBA A;  2H0Y A;  4Y17 A;  1W63 M;  2ZL1 A;  1WA9 A;  3H7W A;  4FD8 A;  2BTF P;  3C2W A;  2HP5 A;  4EBL A;  4UEY A;  2VX8 A;  1LLB A;  3K3C A;  2EXB A;  3VP2 A;  3H82 A;  2PHY A;  3CAX A;  2V0W A;  1LL5 A;  1J3W A;  2PAV P;  3K3D A;  1KGG A;  1TDL A;  1GSV A;  1VHM A;  4PPR A;  5TJJ A;  4R3B A;  4RYE A;  4R23 A;  2RL3 A;  4IBX A;  1P9R A;  4K91 A;  1FSW A;  2WK0 A;  5EPH A;  5FQQ A;  4OLG A;  1L0G A;  4JGR A;  4NXE A;  4HH2 A;  2ZQ8 A;  3EGD C;  1IKI A;  2P04 A;  2QMI A;  4N9L A;  1IEL A;  4ETZ A;  3N7W A;  2WGI A;  4PHT A;  3LFV A;  3A0S A;  3WS4 A;  4O7D A;  4ETX A;  4PAU A;  2WGW B;  5HFO A;  2ZJ9 A;  2O9C A;  4D2O A;  1XPB A;  4JXV A;  2BG1 A;  1PWD A;  1PI5 A;  1SKO A;  1MWU A;  2J8Y A;  1Z6F A;  3LIE A;  3MS6 A;  5CGW A;  5M1A A;  2E8I A;  3JVV A;  3CUE A;  2DRW A;  1KE4 A;  3B42 A;  5F1F A;  4GS9 B;  1PW1 A;  3KYQ A;  3P01 A;  4EWF A;  2EX2 A;  2ZM0 A;  4KZ3 A;  1Y28 A;  3MQQ A;  3F1P A;  3HJI A;  2L1M A;  3HVF A;  2A24 B;  3EOI A;  2Y2L A;  3LI8 A;  5KMW A;  3N8S A;  2MJ6 A;  2JC7 A;  3SZT A;  3SS3 A;  5IHV A;  4GDN A;  1WYB A;  3GTC A;  1JWV A;  1SDE A;  3BWL A;  1ZG6 A;  2R9W A;  4O8G A;  3Q07 A;  2QKP A;  2O9B A;  4OP5 A;  4WN5 A;  4E6W A;  4UAA A;  3UPO A;  2W3H A;  4H8R A;  3VV4 A;  5EM0 A;  2A49 A;  5CER A;  2W3D A;  5AQ9 A;  2WAD A;  3BEC A;  4EER A;  3LID A;  2V20 A;  3QP8 A;  4DXB A;  3R4K A;  4Y13 A;  4L9F A;  2J7V A;  3R7W B;  2EX6 A;  4YWZ A;  1CF0 A;  5DTT A;  3FYZ A;  2KX6 A;  2YKF A;  1TS7 A;  2XDM A;  2K31 A;  3IXG A;  3PAG A;  3LYX A;  1BZA A;  5M19 A;  1YLP A;  4ZDX A;  4E3O A;  5F83 A;  1W8Y A;  3UDF A;  4FUW A;  5FAQ A;  4B9O A;  5HDD A;  2QJ7 A;  3IQA A;  4IVK A;  4DJ2 A;  4GZB A;  5DTK A;  4KZ5 A;  4ARZ B;  2K2N A;  4PKY A;  2X02 A;  3KYZ A;  3DWK A;  2FH5 A;  4F3L A;  3V3R A;  4DE3 A;  3CHW P;  2HJE A;  2PYP A;  1A0K A;  2Y2H A;  5I5L A;  1BLC A;  1JTD A;  4WF0 A;  1NY0 A;  1K25 A;  1TS8 A;  4FTX A;  1UWN X;  3MJQ A;  4KUO A;  1V9Z A;  4OKP A;  5HDS A;  5TFQ A;  4ZBE A;  4E3M A;  4LFU A;  4WZ5 A;  3KX0 X;  2M1C A;  4OOL A;  2DNS A;  2Y2P A;  2VK3 A;  3ZG5 A;  3CMZ A;  4UA7 A;  4PM9 A;  4LV2 A;  1XP4 A;  5MC7 A;  3DW0 A;  2WKI A;  4PM8 A;  4WZ5 C;  2I72 A;  2Y2J A;  3B3X A;  4B4X A;  3HUN A;  3F1N B;  4M3K A;  4Y7P A;  1K4E A;  2AVX A;  1PWC A;  1MWR A;  2WKP A;  4G3K A;  1W79 A;  4HP9 A;  3LR0 A;  3U2A A;  2JN7 A;  4MNR A;  4E6X A;  4F94 A;  3A3E A;  1VET B;  5FEG A;  3UB7 A;  3F1O B;  3TW8 A;  4GHI B;  3OBF A;  2QJ5 A;  1KGF A;  2XRO A;  2R9X A;  3FWL A;  4JPM A;  3CWF A;  4NXB A;  3BM6 A;  4P87 A;  3ISG A;  1MY8 A;  3GR2 A;  3DTM A;  4OOY A;  5EV0 A;  4X56 A;  3UDI A;  1S67 L;  1G5U A;  1S4S A;  2PR6 A;  5HWT A;  4JXG A;  2DMW A;  4OQI A;  4HJ3 A;  4KZ4 A;  4CLC B;  4LV3 A;  4Y3I A;  3VOL A;  3ZHH A;  4LCL A;  2XLN A;  5F68 A;  4UA6 A;  2A3U A;  1IEM A;  4XT2 B;  5GLA A;  5FEF A;  1YLJ A;  1I5Q A;  1XFQ A;  5L10 A;  5G18 A;  5DF8 A;  3T1Q B;  3IF5 A;  2B18 A;  4X55 A;  3V39 A;  4LRX C;  1EW0 A;  1YAX A;  4EUZ A;  4RX2 A;  1XA7 A;  4IUK A;  4Y0U A;  3FZC A;  5DJT A;  3MFD A;  3W4P A;  3MZD A;  4E3N A;  2RCX A;  4WYY A;  1K57 A;  2KLI A;  5J4E A;  2Y2O A;  1HD8 A;  3P09 A;  1HVB A;  4K0X A;  3IXH A;  1OTI A;  4JF6 A;  4YOF A;  4ID4 A;  3EGX C;  4NK3 A;  4BL2 A;  1CI8 A;  2DCF A;  4E3J A;  1DJC A;  1K57 C;  1PZO A;  1YM1 A;  1E3U A;  5E2E A;  3EQU A;  4MN6 A;  1GA9 A;  5HAP A;  3LIB A;  3UE1 A;  5EOE A;  4R3J A;  2Q9N A;  4HQA A;  4ZJ2 A;  2HP9 A;  3IBR A;  2HZ5 A;  2PBD P;  1K56 D;  1L0F A;  3PBO A;  5J3W A;  2A2L A;  4XUZ A;  4EV4 A;  4HIA A;  1BT5 A;  4JLF A;  3HLD A;  4WM9 A;  3S7P A;  3W4Q A;  4Q8I A;  5DVA A;  1OPX A;  1NZU A;  1ZTU A;  1DJA A;  3OPP A;  5GHZ A;  1LT0 A;  1ES4 A;  1CQA A;  4NET A;  1OTD A;  3PBQ A;  3A3I A;  4QPR A;  4E3L A;  1OTB A;  3FPV A;  4WLA A;  5CHU A;  3PR6 A;  4E04 A;  3BFD A;  4BWI A;  3FPW A;  1H0M A;  2WYX A;  3A3J A;  4ZRR A;  1ERO A;  5EVI A;  4I3A A;  1ACF A;  1S6R A;  4UQI S;  1KE3 A;  2V1A A;  5FAP A;  5C5K A;  3JPU A;  3NDE A;  5IT5 A;  4HNB A;  3HLF A;  4DE2 A;  5E2F A;  3NC8 A;  3NUL A;  1UGU A;  3D9Y A;  5EVI C;  2CC1 A;  3FG8 A;  3S4X A;  3GDI A;  5IS1 A;  2ZC6 B;  3GEC A;  3B47 A;  5JYP A;  5F1G A;  3OCL A;  4ZAM A;  1ERQ A;  2IA2 A;  2W1T B;  1ESI A;  3GRJ A;  1DP8 A;  1KDS A;  4XUX A;  1T18 A;  1KOU A;  2G2U A;  1M6K A;  4ZTK A;  4P6Z S;  2Z6D A;  3B33 A;  2Y79 A;  2XRN A;  3WS0 A;  3C4O A;  1Q2P A;  3IH8 A;  1CEF A;  2W3E A;  5FAO A;  4DJ3 A;  4CPK A;  3Q82 A;  3VE4 A;  4KUK A;  3Q7V B;  5FAT A;  1D1J A;  3N6I A;  5A8B A;  1G6A A;  5A91 A;  5KIZ A;  3ZVT A;  2IWC A;  2EXA A;  4C3Q A;  1BTL A;  5AVE A;  3QP1 A;  4GD8 A;  4BD1 A;  4L9G A;  1D7E A;  2XSS A;  4PMA A;  4N1H A;  4WMC A;  4X1M A;  4E3K A;  1F9I A;  3G34 A;  1EI5 A;  2WGW A;  3V5M A;  3RJU A;  1BSG A;  2JKG A;  5CED A;  1RGZ A;  3LEZ A;  3EWK A;  3T4K A;  4LV0 A;  2EFX A;  3ITA A;  1FIL A;  2XH9 A;  1MKI A;  2BAS A;  2NUT C;  3NCK A;  4N1X A;  1FOF A;  4HBT A;  2C5W B;  1QME A;  4OOM A;  4GS9 A;  5FL3 A;  5DKK A;  5K5B A;  2IWD A;  3HLW A;  4MBH A;  1P9W A;  1HZO A;  2Y2M A;  2UWX A;  3EQV A;  2ZQD A;  4QHC A;  4EES A;  4JF4 A;  1KE0 A;  3BFF A;  2PR5 A;  3KSH A;  4GN2 A;  2WAF A;  5J7E A;  3OLO A;  1OT6 A;  2ZM2 A;  3G32 A;  2XD5 A;  4WL9 A;  1AXB A;  4GOG A;  2W3F A;  3KSI A;  4L9E A;  2L0W A;  3W2Z A;  3OCN A;  1P97 A;  2W3G A;  1TF1 A;  5JYO A;  3UE6 A;  1QMF A;  3NY4 A;  5HZH A;  4LPZ A;  3MKF A;  3MBZ A;  1JWP A;  3G30 A;  2OOL A;  4H6J B;  2WGV A;  2J3T D;  1VM1 A;  1XJ2 A;  3FKV A;  4B93 A;  1ZHH B;  1IOU A;  3BFE A;  4KG2 A;  3T12 B;  3SS5 A;  5HL1 A;  3IWO A;  2PU4 A;  4B4Z A;  3HBR A;  3MXR A;  3R7W A;  1YMS A;  1F98 A;  3QP6 A;  2OWJ A;  3ITB A;  4HOI A;  1RP5 A;  3ZGA B;  2GZA A;  1ES5 A;  3L7H A;  2ZL1 B;  1ES3 A;  4P85 A;  5CGX A;  4LEN A;  1IFQ A;  2Z2M B;  4HBU A;  3PAE A;  3CUE C;  3V50 A;  4MBF A;  1K55 A;  2JKT M;  5EFW A;  4XXR A;  3ICY A;  2WKE A;  2KOI A;  3LR3 A;  5L8M A;  5CX7 A;  1TDG A;  4DDY A;  5A92 A;  5HL6 A;  3IXB A;  1CI9 A;  3I7J A;  5E43 A;  4ARZ A;  1IYS A;  1K55 C;  4OQH A;  5TBM B;  3RTY A;  4KZ7 A;  4JXS A;  3T50 A;  1D06 A;  1XXM A;  5HAQ A;  2BLS A;  5HD3 A;  3T4L A;  2ZC4 B;  1Y4O A;  1IYP A;  1K6S A;  1GHI A;  4LRY C;  3P7N A;  4DE1 A;  4QY6 A;  1S1Z A;  2ZQC A;  4I39 A;  1RGY A;  3Q1F A;  4JGQ A;  3A0R A;  4OPZ A;  1W5D A;  2XF3 A;  1G68 A;  1OTA A;  2XFT A;  1SKO B;  4LGW A;  5EUA A;  1M40 A;  3PHY A;  2HDU A;  4O01 A;  2ZOI A;  4IHQ A;  3DAV A;  2Z6C A;  4OQG A;  3EEH A;  3BJN A;  1T1A A;  3F1N A;  1K0K A;  4DKI A;  3VP1 A;  3LIF A;  3ZG7 B;  4BQM A;  2V1Z A;  3M6B A;  4BBU A;  2XGN A;  2ZMF A;  3ZG9 B;  4JGO A;  4JGP A;  4FOF A;  3GQZ A;  5DKL A;  4BMW A;  2P9V A;  3CZD A;  2FFF B;  4DF6 A;  2D02 A;  3PTE A;  3W8K A;  2JKT I;  3P98 A;  4S2K A;  3VFH A;  4HP4 A;  2VV8 A;  3O86 A;  3WRZ A;  3T4S A;  1FQG A;  1VET A;  2JKR M;  4DMZ A;  4BL3 A;  1K6R A;  4KG5 A;  4R4R A;  3UB9 A;  3ULF A;  2FZ0 A;  2IWB A;  4BBT A;  5E2H A;  4KG6 A;  3BQA A;  3NBL A;  2VKS A;  3NDG A;  2M7U A;  3SOI A;  1OME A;  3NIA A;  1JWZ A;  3GMW A;  1XGI A;  3UB8 A;  5FQJ A;  5GLD A;  3O87 A;  2PYR A;  2V9A A;  1YLW A;  4LV1 A;  4RX3 A;  1ZKJ A;  3IF6 A;  5EVL A;  3CPT A;  2W1R A;  4XT2 A;  4Q0J A;  2GNX A;  1GA0 A;  3BLM A;  1L2S A;  1CJF A;  3CI6 A;  3ZQ5 A;  2O0Y A;  4OVD A;  2HF6 A;  4A5R A;  1P0Z A;  1UWP X;  4X1L A;  3E2K A;  4KZB A;  2L4R A;  3IF6 C;  3NOP C;  4MBK A;  1YPR A;  1W7F A;  4IJG A;  3G2Y A;  3IX3 A;  2VA0 A;  2Y4A A;  4CLC D;  3DTI A;  2OAQ 1;  3UDX A;  3GVB A;  4F3L B;  4EEP A;  4OQ0 A;  1YQS A;  1PZP A;  2Q9M A;  5DFY A;  4OH0 A;  2ACG A;  1N9O A;  2INW A;  5HW3 A;  4K0W A;  2GX5 A;  3OPR A;  1NRJ A;  3NI9 A;  2KDK A;  4DDS A;  3IX8 A;  2JKR I;  4C6Y A;  3AGE A;  3Q81 A;  1K38 A;  3LCE A;  4WEK A;  4Y0O A;  1NWZ A;  1KGE A;  3LR5 A;  1H8M A;  2E8J A;  4IVI A;  2VEA A;  1S0W A;  4QJG A;  2ZC5 B;  3SH9 A;  5CRF A;  3VP4 A;  2JE5 A;  3MSH A;  2ZM8 A;  1T1C A;  1NYY A;  3WS5 A;  3NEC A;  2O99 A;  3BRM A;  4QD4 A;  1MXO A;  4FH4 A;  5FI7 A;  1SDN A;  4I5S A;  3N8R A;  5FDH A;  5TGF A;  3SW1 A;  1F5M A;  1PYY A;  1DP6 A;  1DP9 A;  1TVF A;  4OPQ A;  5AQB A;  1K56 A;  1H8Y A;  2QZ6 A;  3TSG A;  2R78 A;  5DF7 A;  2J80 A;  4GB7 A;  2HPB A;  1ONG A;  2ZLY A;  4Y2F A;  3T4Q A;  5FSR A;  2VJW A;  3NJA A;  1YLZ A;  2ZQA A;  1VEU A;  4GKU A;  3PBN A;  5L07 A;  2VZW A;  3C5A A;  4HHD A;  1BUL A;  1ONH A;  4MMN A;  4U3T A;  3QP2 A;  2HDR A;  3KO6 A;  3VP0 A;  3A3D A;  4OP8 A;  4KZ6 A;  1OT9 A;  4Y5F A;  4KQO A;  3LGO A;  3G6O A;  2P74 A;  4AFI A;  2W1T A;  4R4S A;  3T4J A;  1Y54 A;  1GSW A;  1SHV A;  3LUQ A;  2XD1 A;  2O9A A;  2P08 A;  2K7S A;  2PD7 A;  2HV1 A;  5TR7 A;  1VQQ A;  1OJG A;  3C7V A;  2EWW A;  3O3V A;  3MZE A;  4KQD A;  2QPN A;  3KSF A;  4HJ4 A;  1E25 A;  1XX2 A;  3T4T A;  1BUE A;  1YSQ A;  2XEP A;  4PKY G;  3WS2 A;  2W27 A;  4N9K A;  3BY8 A;  4EQ1 A;  3WWX A;  5BOH A;  2V0U A;  3LR4 A;  3V3S A;  2ZOH A;  3CIT A;  2H0T A;  4CQH A;  1X0O A;  3ZYT A;  2FFY A;  4KQQ A;  3ZNT A;  4LRZ E;  3M2K A;  2QHK A;  1MKM A;  2EA9 A;  5F82 A;  2Y2Q A;  3LIA A;  1PNE A;  3ZDJ A;  3E98 A;  1BLP A;  3C8C A;  4X25 A;  3IHA A;  3HL9 A;  1NZO A;  3PYP A;  2EWV A;  1FCO A;  1PIO A;  3TG9 A;  4X53 A;  5GL9 A;  3VE3 A;  4EXO A;  2B95 A;  2HJ9 C;  2OLV A;  3NOT C;  1I2W A;  1H8Z A;  1L3L A;  4ME4 A;  4LLO B;  3TRC A;  1NXY A;  1U60 A;  1JVJ A;  4KZ9 A;  4CJN A;  1NRF A;  4Y15 A;  3MFX A;  2Y59 A;  3HRE A;  5HPF A;  1RCJ A;  4YNR A;  4R38 A;  1YLT A;  3HUM A;  4S2N A;  3ZFZ A;  4CLC E;  2OAP 1;  1XJ4 A;  2G2W A;  5EVI D;  3UN7 A;  5CEB A;  2PT7 A;  3VSL A;  5FI6 A;  3UO9 A;  3MF0 A;  1IKG A;  4ESP A;  4LCM A;  2J3W A;  4S2I A;  4S2N C;  3OC2 A;  3HCY A;  2EX8 A;  4Z9Q A;  4HI4 A;  4WEJ A;  4C75 A;  3VOY A;  2ZQ7 A;  1JTG A;  2VLG A;  3C7U A;  5D3O A;  5EVI B;  2GDN A;  1LI9 A;  4II7 A;  3IS2 B;  3S1Y A;  4JBF A;  3HJK A;  4JXW A;  3UY6 A;  5HAI A;  2EX9 A;  3MKE A;  3EEA A;  1MZU A;  4K08 A;  3OPH A;  4R0Q A;  3PXP A;  4S2P A;  4M4X A;  4UHU A;  1PFL A;  2XA7 M;  3FV7 A;  3S7Q A;  4S2M A;  4QWO A;  5CGS A;  3BFG A;  4GDB A;  2HDQ A;  3PBT A;  3QNC A;  3E2L A;  3DWZ A;  3AGD A;  3HLB A;  3IWQ A;  5FDS A;  3OZH A;  4EQI A;  1IYO A;  1N9B A;  5E2G A;  4EET B;  1OJ5 A;  2A24 A;  2B5R A;  5CEC A;  3BLS A;  1KVM A;  5FA7 A;  2PU2 A;  1TS0 A;  5F69 A;  1YMX A;  3LI9 A;  4WMC D;  2HP6 A;  2J3T C;  5A93 A;  2M7V A;  2ZQ9 A;  3BYD A;  5FAS A;  5TBM A;  2QWS A;  1K4F A;  3LY3 A;  2JHE A;  3KSG A;  2I9V A;  5DF9 A;  5KSH A;  2WAE A;  5F5Y A;  5G4Z A;  3UME A;  4EUV A;  4N92 A;  1S1Y A;  5HWV A;  4X69 A;  5HD5 A;  2J9P A;  2JKF A;  3ZCZ A;  3SS4 A;  3ZG8 B;  3UNW A;  2V2F F;  3C38 A;  1BLH A;  1STZ A;  2P7J A;  3H7W B;  1G6O A;  3OOV A;  1N9N A;  1WE4 A;  3CG5 A;  3H9W A;  2Y2K A;  3JVU A;  4KZ8 A;  3H82 B;  3IHB A;  4G3V A;  3AGF A;  3ZG0 A;  4PM7 A;  4NG2 A;  1H5X A;  4L0L A;  3BW6 A;  2XQZ A;  4GNU A;  1VB6 A;  4Q0H A;  1J9M A;  4I3I A;  3T1R A;  4OPR A;  2GJ3 A;  3T1X A;  3RXX A;  2WZX A;  1XKZ A;  4NEE D;  4ZJ1 A;  3A0V A;  1BYW A;  2H5S A;  5FQK A;  2H10 A;  3BFC A;  4KZA A;  2OLU A;  1SCW A;  4IBR A;  1Z09 A;  4GLQ A;  4RA7 A;  5I94 A;  3D4F A;  4YFM A;  5EVE A;  3LO7 A;  5CHM A;  5CHJ A;  3DTK A;  4KQR A;  3WS1 A;  3RH8 B;  2V8C A;  5DTS A;  4DN0 A;  1SZV A;  2WZZ A;  3PBR A;  2ZBB A;  4MCW A;  1FR1 A;  5L2F A;  1FCN A;  3FKW A;  3SH8 A;  1FCM A;  5AQA A;  1S66 L;  1MBL A;  2JBF A;  3TE8 A;  3V67 A;  1ZG4 A;  3QNB A;  3F1P B;  1IYQ A;  4GJ4 A;  3A3F A;  2H28 A;  4JF5 A;  3MQ0 A;  3E0Y A;  1K54 A;  2JCH A;  3C30 A;  3BY9 A;  2PDR A;  1ES2 A;  4PM6 A;  4BEN A;  4PM5 A;  3LIC A;  1H3Q A;  4JKT A;  4HEF A;  3G35 A;  5EOO A;  3F1O A;  1K54 C;  3D3O A;  4GHI A;  3QP4 A;  5AJG A;  5EE8 A;  3UPN A;  5AVF A;  1CEG A;  3UB5 P;  1DRM A;  4GD6 A;  1XA1 A;  2UV0 E;  4E3I A;  3MXQ A;  4NKP A;  4FSF A;  2HDS A;  4WZ4 A;  4EBN A;  3GSG A;  1ERM A;  5AQ7 A;  5DFX A;  4UA9 A;  4X6T A;  1E4D A;  2PBY A;  4G3W A;  4S2L A;  3U4L P;  1GHP A;  4CLC A;  3JYI A;  4KEN B;  1ESU A;  2VGJ A;  5J8X A;  3QHY A;  4WUJ A;  2Y8H A;  4MN7 A;  4R3A A;  1AWI A;  1W8Q A;  4BLM A;  3VMA A;  1C3B A;  4MLL A;  4CLC C;  2PD8 A;  1PI4 A;  3IX4 A;  3S7N A;  2WKH A;  3TOI A;  3O88 A;  5FI2 A;  2X01 A;  1TS6 A;  2Q0O A;  5FQI A;  3SH7 A;  2WKQ A;  1PRQ A;  3S7O A;  3RXW A;  3UE3 A;  4HY8 A;  2D01 A;  4X68 A;  2P9V B;  1PWG A;  3VOZ A;  5DJU A;  3W4O A;  3N4I A;  1L0D A;  4DXC A;  1GHM A;  2ZC7 A;  1YSP A;  1MWT A;  2ZD8 A;  2VGK A;  1NYM A;  4D60 A;  2LB5 A;  4IED A;  4R1G A;  3MMH A;  3VP3 A;  4U0X A;  2ZC3 B;  3T4O A;  1FSY A;  4R70 A;  4OON A;  3MZF A;  1LI0 A;  1KVL A;  3TJZ C;  3WRT A;  1HLU P;  3G2Z A;  3LEQ A;  3M6H A;  5EEC A;  2J9O A;  3MR0 A;  2CMN A;  4Z1W A;  5M18 A;  5GHY A;  1YLY A;  3GV9 A;  4GW9 A;  1N4O A;  4I3J A;  3T1S A;  2X71 A;  1XJ3 A;  4R6L A;  4FCF A;  4YIN A;  3IF6 B;  4EEU A;  4QY5 A;  3IXD A;  3CPT B;  5HWW A;  3HUO A;  2C6W B;  3QP5 A;  1ALQ A;  2Y2G A;  4IUH A;  5U47 A;  3MQO A;  2XFS A;  3N8L A;  4RVA A;  3PBS A;  3VSK A;  1O7E A;  4MDZ A;  2Y91 A;  2W0N A;  1ZC2 A;  1MPL A;  1W63 Q;  3CLO A;  1YKD A;  3NOU C;  4P0M A;  1OTE A;  5LBR A;  4B88 A;  1Q2Q A;  3LY4 A;  1V9Y A;  5GLB A;  1EWZ A;  1JNU A;  3E4O A;  2PRF A;  4BJP A;  4MN5 A;  5F6A A;  1DJB A;  4WBG A;  4FH2 A;  1G28 A;  3BQ8 A;  3L9K A;  4GCZ A;  5CXW A;  1HTZ A;  1LSV A;  1LHY A;  5IU1 A;  5GLC A;  3KYE A;  1LL8 A;  3M2J A;  1TD5 A;  4HES A;  1LSW A;  4OPY A;  3DTE A;  5HAR A;  1NLZ A;  2V8F A;  3BEB A;  3IBJ A;  1GCE A;  3HLC A;  2B02 A;  3UPP A;  2OWH A;  1L0E A;  3Q7V A;  1NLY A;  3MXS A;  2HGV A;  4S2J A;  4Y0T A;  3OPL A;  5L09 A;  3D72 A;  2Y2N A;  1KDW A;  1T19 A;  1E3U D;  3O5Y A;  1I2S A;  3IH9 A;  2Y55 A;  3FC7 A;  1S4R A;  2QYB A;  3K2N A;  4EW7 A;  1XFN A;  1T1B A;  4NXF A;  2WUQ A;  4QB8 A;  5FQM A;  5FQ9 A;  1VEU B;  2Y2I A;  2V1B A;  3IS2 A;  4O0P A;  3HLG A;  3UB6 A;  2YKH A;  2XK1 A;  1XJ6 A;  1F2K A;  3S22 A;  2ZMA A;  5KSC A;  3VFF A;  3UMD A;  3ZVW A;  4P6B A;  1CK3 A;  4WEL A;  3NHQ A;  1WYC A; 
#chains in the Genus database with same CATH homology
 1ACF A;  3T1Q B;  1FIL A;  2JKF A;  2E8J A;  5EM0 A;  3L9K A;  3MSH A;  3NUL A;  3D9Y A;  3NEC A;  4D60 A;  1CF0 A;  3KYE A;  1Y4O A;  1PFL A;  2V8F A;  1SKO A;  3UB5 P;  4QWO A;  1VET B;  5FEG A;  1HLU P;  3MS6 A;  4FUW A;  5EM1 A;  3CPT A;  3LEQ A;  1PNE A;  5FDS A;  3T1R A;  4X25 A;  3T1X A;  1CJF A;  1SKO B;  3T1S A;  1FIK A;  2HZ5 A;  2PBD P;  2B95 A;  3CPT B;  4X1L A;  3U4L P;  1VEU A;  3DAV A;  1D1J A;  3CHW P;  1YPR A;  1A0K A;  1Z09 A;  5EV0 A;  3T12 B;  1K0K A;  1G5U A;  2ZL1 A;  5EVE A;  1AWI A;  1VEU B;  4FTX A;  2BTF P;  4X1M A;  2V8C A;  1CQA A;  1SZV A;  3LGO A;  2ACG A;  3L7H A;  2ZL1 B;  5FEF A;  1F2K A;  2VK3 A;  1J3W A;  2PAV P;  2JKG A;  1PRQ A;  4ESP A;  2PRF A;  1VET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...