3KYGA

Crystal structure of vca0042 (l135r) complexed with c-di-gmp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
b'SKTVSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQRRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein VCA0042
publication title Structure of PP4397 Reveals the Molecular Basis for Different c-di-GMP Binding Modes by Pilz Domain Proteins.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 39
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 3kygA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3kygA02
3KYFA 5BNCA 4XHYA 3U34A 3FGEA 1WLIA 3VY5A 4RT1A 3RH7A 2ARZA 4RT0A 4HMUA 3SWJA 2RDEA 3BA3A 1W3PA 2HQ9A 2NR4A 2HQ7A 2OU5A 3A20A 3PFTA 5KEDA 5EJZA 1RZ0A 1T9MA 1W3OA 2RE7A 3DSGA 4P00A 5CHEC 3ZOHA 4YWNA 1YLNA 1WGBA 3CNRA 3ZODA 3B5MA 3R5WA 1WV4A 4XJ2A 3F7EA 3ZOGA 1G78A 4P02A 2R0XA 3R5RA 2D38A 4ZKYA 2ECUA 1VL7A 2HTDA 2I51A 3U0IA 4I86A 2IMLA 1YWUA 3K86A 2A2JA 2OL5A 3K87A 3ZOEA 5EJ1A 4XRNA 2ECRA 3R5YA 3A6RA 2E83A 2QEAA 3NFWA 1G79A 3A6QA 3VY2A 2X1JA 3AMFA 1G76A 3CP3A 4QVBA 2ASFA 1I0SA 3KYGA 4IRAA 2D5MA 3R5ZA 3ZOFA 1EJEA 5ESCA 3H96A 1WLKA 1W9AA 1JNWA 3DNHA 4HMTA 4HMVA 4HMSA 1I0RA 3BPKA 2GJGA 2L74A 2D36A 3CB0A 3FKHA 3R5LA 4Z85A 5KGOA 1W3QA 2AQ6A 3DB0A 3R5PA 5EIYA 1W3RA 3ZOCA 3VYAA 2X1KA 1XXOA 1YOAA 2HHZA 4N7RC 1Y30A 4HG6A 4R82A 2FURA 4HX6A 3TGVA 2VPAA 2ED4A 4YBNA 2FG9A 1CI0A 1RZ1A 1XHNA 1RFEA 2Q9KA 3GASA 2PTFA 1NRGA 4F07A 5KECA 4F48B 4HMWA 2R6VA 2QCKA 1G77A 2HTIA 3U5WA 3BNKA 3K88A 1TY9A 5JABA 1USCA 3HY8A 2D37A 3EC6A 5EJLA 3HMZA 3E4VA 5CHOA 2I02A 4Y9IA 1DNLA 3AWHA 2IG6A 4HMXA 3U35A 4L82A 3DMBA 4FOUC 2IABA 1AXJA 2FHQA 1USFA 3IN6A 1FLMA
chains in the Genus database with same CATH superfamily
2H2ZA 4F55A 1DFPA 3KYFA 5BNCA 4AOQA 3DA9B 1C2KA 3SNEA 1HAHH 2GMTB 3GISB 4VGCC 1S83A 2BDGA 3C1KA 1PQ8A 1EAIA 3A20A 5E0HA 5EW1H 2WPDD 2Z6BD 1XVOA 1C5OH 3TK9A 3SYJA 1BRBE 1FAKH 2ZDVH 2QXIA 4P00A 2GTBA 5LGOA 5T6DA 1J15A 1W11U 1BJVA 1A61H 3HK6B 1GJDB 4B71A 5ETXA 2XC5A 4I86A 4NG9H 2QF0A 2HNTF 4AC9A 8GCHF 5EU8A 4JZEH 3NCLA 2Z9LA 5FHTA 2E83A 2HNTC 2P3FH 2QEAA 1ZHRA 1O3DA 2XC4A 3OY6U 3ZZDA 1GCTB 3GCHB 4XBCA 3R5ZA 1THSH 1FAXA 2ZQ1A 1C4V2 2K8IA 3QTVH 7ESTE 2ZO3H 1S85A 3RXQA 2UUJB 1QB1A 2Z3EA 5GCHG 4X1SU 2ZP0H 3U9AH 4Y6DA 1EASA 2G5NA 4IMQA 2CV3A 1Z1IA 2HALA 3RM0H 1QB9A 1L1NA 2BLVA 3SJOA 4YOJA 3FFGA 3P8NA 5J4SA 1O3OA 1YOAA 1IQLA 5I46H 4HI3A 3RXUA 4R82A 2FXRA 1H1BA 1N6XA 5HIYA 5T1VA 4K5ZA 4OGXA 1XHNA 2Q9KA 1QL7A 2P95A 3PO1B 1HPGA 3O8DA 1SSXA 1MKWK 2XBYA 3MU8A 1O3EA 1QFKH 3VB6A 1BMLA 2XCFA 3ZIAD 1MTSA 2SGFE 2WPKS 3PMBB 1USCA 2F9OA 2CHAB 3VB3A 3TNTA 4YLQH 1GPZA 3ATIA 2AH4X 3HMZA 4X2VA 1VGCB 4X6PA 1E38B 1LHGH 2KAIB 4L82A 3HPTB 4IS5A 3HK3B 2BD9A 2FM2A 2DE8A 3U34A 1EKBB 2C90B 4BXWA 1IQEA 3JZ2B 4OM9A 3EE0B 4ZKSU 3ZVGA 1LCYA 4O3TA 1QR3E 1UVTH 1V2WT 3PV2A 3D23A 4IN1A 1O2ZA 1MTUA 1FXYA 2HQ9A 3ZZCA 2PSXA 3PFTA 3ATKA 3OEED 4H6SB 1HAGE 4RN6A 2WZQA 4AFQA 1UTNA 1SQOA 2B0FA 2BDIA 1C5YB 2HPQH 2JETB 1TRMA 1KXBA 1W0JD 2THFB 2BB4A 2KR7A 3SJ9A 4B6EA 1DWDH 4UFDH 5FBIA 2R0XA 1A46H 1O2YA 3U8RH 1J14A 1RFNA 4NSYA 6ESTA 1GJAB 1ELVA 2JIZD 1UHBB 2EQNA 4UFGH 2VH0A 3CS7A 3K87A 2VWLA 3LIWA 1BTUA 5EJ1A 2ECRA 2PKAB 5PTPA 2AFQB 2YOLA 4Y8XA 3V13A 1W0KD 1OP2A 4FUJA 1SI5H 3ZZ9A 1G79A 1WUNH 1ESBA 1HAZB 2ASUB 2OLGA 1NBME 3MU5A 4Z0KA 2D5MA 2YMSD 4TPYA 1K1IA 2OQUA 1V2ST 2BLWA 1C2DA 4U2WA 3E90B 4H6TA 1NZQH 3TLOA 1K0HA 1HCGA 4FVBA 3SU6A 1AB9C 2GJGA 2AGEX 2G00A 3CB0A 3FKHA 3BIUH 4MNVA 5KGOA 1NRSH 2QYIA 1IQIA 1EJAA 1T31A 1O2SA 6CHAC 5F6MA 2QY0B 1OS8A 1EFRD 2LPRA 1GJBB 2SGEE 1O2XA 2WPHS 3SU3A 1GI2A 1O2QA 1DY8A 3E0PB 2Z3CA 1AWFH 3FKSD 3GASA 2J92A 2SGDE 1FUJA 3ATMA 2ZHEH 2P3TB 1C1OA 1O5FH 1C2EA 3A8DA 2H5CA 4OS5A 5HYOA 1IQGA 2F9BH 1AKSB 1YLCA 1A5HA 3RXJA 1SQRA 1TPPA 3MNCA 1HAOH 2ZA5A 1YF4A 1HB0B 2STBE 3DD2H 4DURA 2J94A 1Z8IB 1LVOA 1GHWH 5SGAE 3A81A 4BAKB 2FHQA 1RXPA 3IN6A 1IAUA 1ZMNA 5GXPA 1A1RA 4CR5A 3RXHA 4HKHA 2HVXA 2EI8A 4A5TS 8ESTE 2K1QA 4RT1A 3RMOH 2GVFA 4ISHH 3DSPA 2G52A 4MTBA 1CSOE 1JWTA 1M9UA 1OOKB 1ZSLA 1TPAE 3T29A 1TFXA 2PWXA 4OS6A 3BTTE 3RXOA 3Q76A 1BZXE 1GBEA 1V2KT 1WGBA 3SUEA 1T4VH 1DWEH 1K1MA 1WV4A 1F2SE 1C5TA 1GHBF 1SB1H 1W10U 2FTLE 1WOFA 1AVGH 1SKYE 1QJ6B 1Z8GA 1CA0B 2VIQA 3DFJA 3ZOEA 3NUMA 1AE8H 4H42U 2I6SA 5C5NA 1V2MT 3EA7A 3U28C 4NIVA 4JZDH 4ZXXH 1TOCB 4Y0YE 2BZ6H 2WPIS 1VR1H 2VIPA 1QURH 2Y82A 3NRLA 3RU4T 3SGBE 3E6PH 1O2UA 1MU6B 2OUAA 4DIHH 1GL1A 4THNH 2H1UA 3GY6A 2BDAA 2K0QA 1W2KH 3U8OH 1OYQA 1WLKA 2B9LA 3BTWE 1JNWA 1ESTA 3AW1A 1G3EA 1ELGA 1K21H 2ULLA 4MLFB 1YPLH 2L74A 1SLXB 1SLWB 1Q2WA 2FESH 2VGCB 3DB0A 1NC6A 4ZAEA 7LPRA 3L3TA 1YC0A 3FOAA 4CHAC 1HJ8A 1DANH 1Y5UT 1AY6H 3BTFE 4GPGA 4E7NA 1GHAF 3LGYA 4NA7A 3DUXH 3M3VA 1EPTB 3KQ5A 3PLPA 1TB6H 2GDDA 1ZMLA 2M5TA 5BRRE 2R6VA 3P92A 2A2XH 2FLRH 2CGAA 3O8CA 2FTMA 1G77A 6GCHG 1ZPBA 1B0FA 3BG4B 1IQFA 2C8XB 4WH6A 1QL9A 3QO6A 2IPQX 2GZ9A 3A8BA 2YNBA 2OCVB 1O33A 4E7RG 3M7TA 3NZIA 2IG6A 1GGDB 1GI4A 2BD8A 4TWYA 2IABA 3UFAA 4CRFA 5GJ4B 1NFXA 4FUHA 1D6WA 3FGEA 2FI5E 3A7YA 4DG4A 1MKXH 4KP0A 2QF5A 1HDTH 4FUEA 5ABWA 1P04A 2P8OB 3F0OA 1BHXF 1TONA 4ABBA 2ANWA 3LGWA 1KMHB 3PLKA 4BAMB 4FU9A 3S9CA 5G4BA 4U30A 1GMHF 2IJD1 3F68H 2A7JA 1G3DA 4Y8ZA 4U01A 1AGJA 1XKAC 1O38A 2VIOA 2B7DH 1PFXC 1VJ9U 2Q1JA 3SV8A 2BD5A 1AO5A 4GVUA 3ZODA 1C5PA 4SGBE 1EOJA 3FO8D 3BV9B 5I25A 3EE7A 3MWIU 1O3NA 2A4RA 1KXAA 4JCNA 1K2I1 2L1TA 1O2LA 4WJG2 1YGCH 4X6MA 4E05H 4XBDA 5EW2H 1O3HA 3SHCH 1ARBA 2J98A 3ZZ6A 3GCNA 3SJ8A 3UTUH 1F7ZA 4JZ1A 5DP7A 3MU0A 3VXFH 2ZIQH 3NPSA 3QN7A 1C1QA 1WQSA 5EQSA 3RXAA 3GS9A 2CF8H 5ESBA 4QVBA 5JYIA 2G4UA 3F9HA 1EJEA 1COWD 1LKBA 2BX3A 2A0QB 1DXPA 1UMAH 1C2FA 2WYGA 1E37B 1GBAA 1MQ6A 1O3KA 1PJPA 1MABB 3SI3H 4I32A 1O3FA 4NGAH 1O3BA 4I31A 1RGQA 5DN6D 3B23B 1UCYH 1QIXB 2GCTC 2BHGA 4A1TA 2ALPA 1LHCH 1TNHA 2X1KA 1P57B 4JYVH 1JXPA 4I8LA 1J9CH 4X1NU 4ZKOU 4A1XA 3M3TA 3QZQA 2G8TA 1TPSA 1KLJH 5JB8S 3H7TA 4YT6H 1XUKA 5JBTA 4XBBA 1O2OA 1CHOF 1UK2A 2EC9H 2GD4B 2ODPA 3U5WA 1TY9A 1MBQA 1WAYB 1HUTH 2BM2A 2FLBH 2VIDA 2A2QH 1X7AC 3T26A 1XUIA 3A7TA 1G2MA 1YLDA 3EC6A 2WSSD 5C17A 2ZFSA 4X1QU 3PV5A 1T8OA 3U35A 2KZ4A 3LC5A 3PWCA 2XNDD 4F4OC 1GMDF 3ZVAA 4I7YH 2M2AA 1NROH 3E0NB 1IQNA 3HE1A 4AGJA 2H6MA 4JZFH 3PRDA 1H8HD 1Y3UA 1C5RA 1GBJA 4ISIH 4OGYA 4RT0A 1BCUH 1ETTH 1HAIH 1D3PB 1YPJH 2YNAA 4TYDA 1V2PT 1TLDA 3H7OA 1QBNA 2W3IA 2TGPZ 1C1WH 1BQYA 4UDWH 5JBAS 2TRMA 3B5MA 3MNSA 4BTIB 5HXFA 1GBFA 2ZC9H 1BT7A 1MKXK 3FP6E 1C5NH 2I51A 1G9IE 1FY4A 5DP9A 2AHME 3SUGA 2C93B 2JH5D 3SQEE 1YPGH 1SBWA 1GI8B 1E36B 1DY9A 1ZPCA 2FDAA 1ZR0A 3LPRA 1TPOA 1VZQH 1GBMA 2D8WA 1EXFA 1Z1JA 3AMFA 3OFND 3ZZ3A 1HIAB 2V3MA 1ELAA 2BY7X 5CHAB 1HAVA 1TIOA 5FXLA 5ESCA 3GY4A 2GKVE 3E8LA 4YM9A 4HMSA 3BTKE 1KY9A 1GHXH 1DICA 2A5IA 3MYWA 1UVSH 1W3QA 2FWWA 2GT7A 3P8FA 1YPEH 1CGHA 5T6GA 1GMCG 3V7TA 4ISNA 1O3PB 4VGCB 1NN6A 4N7RC 3RC6A 1EQ9A 2BYAX 4A7IB 2FURA 3TGVA 3Q3YA 4ZCNA 4I8KA 3SZEA 2BDHA 1CBWC 1ZHPA 1OWKA 4AN7A 4AFSA 1F5RA 1FDPA 1TNIA 4CBOA 1QA7A 5KECA 1W13U 1MZDA 3F9EA 1MKWH 4Q7ZA 2W5EA 4XOJA 4WMEA 1GHZA 3TU7H 3D49H 3P95A 3BNKA 1C5ZB 3U98H 1IHTH 3RXVA 1XM1A 1O3CA 2PTCE 1LHEH 1HAPH 1AHTH 4Y10E 2A31A 4GLYA 3M36A 1GI9B 2I02A 4Y9IA 1T7CA 2BY8X 1SGDE 1THRH 1TRNA 1Z71A 2LP6A 3IITA 1RTFB 1MTVA 3BIVH 3N7DA 4NWLA 1BMAA 1O3AA 1YPHE 1WYKA 2FOBA 2ZWLH 5JBCS 1XUFA 2GT8A 2WHXA 5AFZH 3W94A 4AYVB 2HOBA 1NU9A 1K1JA 4HMUA 2BOKA 2FS8A 2VWNA 1P09A 3UOUA 4R0IA 3S7HB 2AIQA 2A5KA 5L2YH 2BQ6B 5EJZA 2DUCA 5EPNA 3SZNA 2PKSC 4MPXA 1ELFA 4YT7H 5JBBS 3HATH 4LZ4B 1JIMA 5L30H 4B6FA 4YXWD 1G78A 3R5RA 5HMAA 3QZRA 4AG2A 3OEHD 2NU4E 5E8EH 4GCHF 1V6DA 3ATLA 1A0HB 1ELDE 4X1RU 1QJ1B 5L2ZH 3A7XA 2IPHA 2FS9A 2BOHB 4UFFH 4WF8A 1C2MA 3R5YA 2P3UB 1Y3XA 5E2OA 4ISOA 1QL8A 1LDTT 1O35A 1F0RA 4IBLH 1HFDA 3MFJA 1ZLRA 3O8BA 3M5LA 4WMDA 2AYWA 4CREA 1JIRA 1GL0E 2KCAA 4X2YA 5TCCA 2PSYA 3F3BA 4X2XA 4UHVA 4B2BA 3RXMA 1ACBE 4LXBH 1HNEE 4WY3A 3T5FH 1TAWA 2BTCE 1W9AA 3MO3A 1KLIH 4ZUHA 3RUOA 3L33A 3UQOA 1TNJA 4HTCH 5DG6A 2QXGA 5DP8A 1NRNH 1GBCA 1Q31A 5C3NA 4BOHA 4DW2U 1KXEA 1ELEE 1Y30A 3K2UA 1TOMH 1KDQB 2FG9A 2BXTH 1O36A 1DOJA 3BEIB 1RZ1A 1MTNB 5FBEA 3N7OA 2XW9A 4NSVA 1V2NT 4JK5A 4WXIA 1L4DA 4I8HA 1UTKA 1C5MD 1SFQB 4R8TB 1ZMJA 2QCKA 3MNXA 1SMFE 4Y11E 1KXFA 3IG6B 4IW4E 1Z6JH 5K0HA 2CF9H 1GBHA 5TJXA 3D62A 4TT3D 3ZZAA 2BD3A 4MDSA 1UTPA 1EP6A 5L6NH 2ANKH 2BDYA 1O2PA 3OE7D 1IQHA 3N7EA 1O2KA 5C1UA 2ZCKP 3CP7A 5FAHA 1GI7B 2VIWA 1DS2E 2BMGB 1T8LA 3SNDA 1G30B 3MHWU 2NU0E 4M9FA 1FY8E 1TWXB 1P01A 2FOHA 1A0JA 3SBKA 1SGTA 5FPYA 3TK5A 3VGCC 2W6ID 1P2NA 3GY2A 1N8OB 1HAYB 3ZZ5A 1L4ZA 1H9HE 1UTQA 2JJ1D 1BBRK 1ZGVA 4Y76A 1IQJA 1XUGA 3KCGH 4YWNA 1DITH 2WV5A 5C1XA 1VKYA 2EA3A 3I77A 4Y79A 5LPRA 1QQUA 3SO3A 3SU4A 1GBDA 3M35A 5E0JA 2ZDAH 1UTJA 3ESTA 4FUBA 1O2RA 1ZTLA 1WXRA 2QXHA 2VJ1A 1O5AB 1T8MA 3WWFA 2Y7XA 1QHRB 1TX8A 1PQ5A 4INLA 3DT0H 2AEIH 2O8UA 1FPCH 1BDAA 3M7UA 4I33A 3U8TH 2SGQE 2XNIA 5HIZA 1GI6A 7GCHF 1NFYA 3CP3A 1FZZA 1I0SA 1TGCA 3F2FA 2B5TB 3RXFA 3F6UH 1BUIA 4XFQA 3GICB 1O2NA 3MH6A 5AHGH 1V2UT 1W0YH 2P94A 3K6ZA 4MPWA 4ZXYH 3ZYEA 3H96A 1ID5H 3QUMP 1G2LA 2HWLB 3MH7A 3BPKA 3EA8A 1WV7H 2ZU2A 4MPUA 1GCTC 4TY6A 5A8YA 1O5CB 5DP4A 3RP2A 2Z9JA 4ABEA 1S84A 4E06H 1NM6A 5T6FA 1GBIA 4YOIA 2XC0A 1TNGA 3PMHB 1EAXA 2OTVA 1D9IA 1OP8A 4D8NA 1O5GH 1JMOH 2VPAA 4O03A 1AI8H 1CA8B 2XOKD 2XTTB 3ENSB 2FOMB 2RCEA 2ZHQH 3KGPA 3OU0A 2ZTXA 1FX0B 2OK5A 3SGAE 5EQRA 3S0NA 4NZLA 5DKMA 3KF2A 1ANBA 3SV2H 4DGJA 3LKWA 4K1SA 2ZU5A 3EQ0H 1LKAA 2BD4A 3SU2A 1WTHD 4NA9H 3SGQE 1SGQE 5GIBA 2YMSB 3K88A 1GG6B 4K69A 2H9HA 2XBVA 5A2MH 3FZZA 1A5GH 5FPSA 2BQWB 3M61U 3P17H 1HJAB 4YOGA 1QB6A 3SOSA 1BBRE 1Z8JB 1Z8RA 4GUXA 1TBZH 4YO9A 5DGJA 3RMMH 3TJOA 1ZZZA 2XYAA 1USFA 1K1LA 5A09A 4DOQA 2OBOA 1GDUA 1C2JA 4YESB 1PYTC 1UK3A 3MOCA 4WVPE 3AASA 4JZIA 1EAWA 4A92A 1OX1A 2Q6GA 2FO9A 3MU4A 5DK1A 1FV9A 1GHBG 2FYRA 2ODYB 2PR3A 1SOTA 5FX5A 3T62A 1UHBA 4KELA 3E16B 3VXEH 3P8OA 1C1RA 1A2CH 1SR5C 4ZKRU 4MTKA 1O32A 2BQ7B 2WV9A 2PKAA 2FEQH 3SV9A 2XBXA 4CHAB 5FCKA 3ZOGA 5TCAA 2O8MA 3V3MA 2IJOB 3Q3XA 3GDVA 4X2WA 1VL7A 3U0IA 2ZTZA 3TH3H 1FI8A 3K86A 3MU1A 2XXLA 3EDXB 1XX9A 4X8UH 1QRWA 3RXRA 3LJJA 3OTPA 4NWKA 2JETC 1CHGA 4X1PU 2WUCA 3A6RA 1TA2A 4HFPB 5A8ZA 3KNXA 1P2MA 2J5UA 4ZMAH 1SC8U 1F0TA 1A7SA 4HGCA 1O5BB 1FN6A 3A83A 1UJ1A 1ARCA 1JRSA 1DUEA 4CRCA 2BXUH 2ZFTA 3ZZBA 4AORA 4NIXA 3FAOA 1UVOA 4ISLA 1WU1A 1S6HA 2RA0A 2ZU4A 3UQVA 1O3LA 2TIOA 1GHAG 1SGRE 4DVAU 1O39A 3SJKA 3A88A 1CGJE 4KTSA 1W3RA 1ANCA 1C2IA 1CVWH 1LMWB 2V7QD 1B7XB 1K1PA 5EPYA 1F5LA 3LH3A 3RXBA 1KXCA 3OTJE 1AKSA 3NWUA 3FANA 1BHXB 2CMYA 2O8TA 4ZHAA 1ZSJA 2FOEA 3RMLH 2QV1A 1F5KU 2OQ5A 5DP5A 5ESTE 5C1YA 2AGGX 1K1OA 3GYLB 2ZHWH 3PLBA 2F9NA 4CRDA 4A1VA 1C5QA 2FYQA 2VWMA 2V0BA 4JYUH 3T25A 3A85A 4TSFD 2BY6X 1GI0A 3ZVDA 1SGFA 1SGYE 2FMJA 1FLEE 3TNSA 1E79D 1ZSKA 3SU5A 1C1PA 2DE9A 2EY4C 4BTTB 2Y7ZA 1P2OA 8KME2 5LPFA 1O2VA 2R0KA 4Q7XA 1LO6A 3PMJA 4ZHMU 1GMHG 1ETSH 3UNSA 5A8XA 1XXDA 1O2HA 3RH7A 1DE7H 1ANDA 3MMGA 1UK4A 4K1TA 2KCPA 1YYY1 4DT7B 1N6YA 1OWHA 2B8OH 1PPBH 4I8GA 1HYLA 2ZG0H 1TQ0B 3DSGA 3DSOA 5GWZA 2XWAA 5CHEC 1YLNA 2XRCA 2BD7A 3CNRA 1TGNA 2ZU3A 2VB0A 2ZDKA 4ACAA 7KMEH 3ZVEA 4XJ2A 2ZGCA 3F7EA 4P02A 5A0AE 3T27A 1S0QA 5HKKD 1GDQA 1WDIA 1GBLA 3MH4A 3NXPA 2IMLA 1DWCH 1P0SH 1YWUA 3ZYDA 4AFZA 2A2JA 5AF9H 1AVWA 4GSOA 2WV4A 3SW2B 3ZZ7A 2P5ZX 4INHA 2ANYA 4D7FA 3TJNA 1EZUC 3RXKA 2R3UA 1NU7B 3GYMA 1O30A 3NKKA 3A6QA 1VITH 2VIVA 2X1JA 2ALVA 1G76A 1C1SA 3GY3A 3HKJB 3STJA 2K4QA 1AQ7A 1OP0A 1MQ5A 1CA0C 1LHFH 2PHBA 2UWLA 1FMGA 1TBRH 1RS0A 2SNWA 3A86A 1NPMA 2C8WB 4M7GA 1V2RT 1NESE 4CH2B 3TPIZ 3UAIC 4CH8B 1FN8A 5C67A 4ABAA 1I0RA 3WWBA 4IC6A 1EPTA 1C5SA 2D2DA 4I8JA 2QF4A 1DX5M 3A7ZA 5AFYH 1O2WA 2ZFFH 3LU9B 3R5PA 1S6LA 5EIYA 2ZEBA 3UY9A 2OINA 1QQ4A 3IWMA 1XXOA 1GJ6A 2HHZA 2RFKC 1P12E 4HG6A 4Q4LA 4DT4A 2H9EH 1O2TA 1CHOG 3TIUA 1CQQA 1AVXA 2Z3DA 2PTFA 3S9BA 1P06A 1LQEA 1DSTA 1U6QA 2VGCC 5IDKA 5IK2D 2OC0A 4HMWA 3E91A 1BMNH 1AIXH 3MI4A 2RDLA 1C4U2 2R2WU 2GP9B 5AVDA 4U32A 1FNIA 2V6NA 4CR9A 1GMDG 2Q6FA 5JABA 3V4HA 1HXFH 1EPTC 3UIRA 1BIOA 3KQBA 4Q7YA 3F1SB 3E4VA 1W12U 1P9SA 5CHBA 5IYTA 2VH6A 1NY22 1SLVB 2P16A 1O2GH 1FLMA 2UWOA 1RIWB 2VWOA 1O2JA 3SORA 3U1JB 3LGIA 1GBKA 1AFEH 1ZOMA 3KHVA 2OBQA 1QJ7B 4OS1A 3SWJA 1BA8B 3A80A 4H4FA 4ESTE 1W3PA 2XCNA 3QWCH 1LPKB 3NK8A 1TNLA 3UR9A 1TBQH 2BLQA 4D7GA 2ZGXH 1GHYH 4GHQA 2RE7A 3QDZB 1UVPA 3KQDA 3SNBA 1SOZA 2P8OC 1YCPM 1L0ZA 1YBWA 1P05A 1SG8B 1GDNA 4OS4A 2GCHF 1L1JA 1CBWB 9LPRA 1DWBH 1TE0A 9ESTA 1O3JA 3SN8A 1WSSH 2Q6DA 1P11E 3MO6A 1W3CA 2R9PA 2VVCA 4UONA 1S5SA 1UW7A 1BTZA 2ZHDA 1O2IA 1TMUH 1G3BA 3S9AA 1WBGB 4IRAA 1GJ5H 3KYGA 2TGTA 4K60A 4O9VA 1A5IA 1QZ8A 2Z7FE 1YPMH 3DFLA 2FODA 3GCTF 3ODFA 4HMTA 4HMVA 4YTAA 1GHVH 3R5LA 3KL6A 2F3CE 1XXFA 2P59A 4LOYH 2VVVA 2G4TA 1S81A 2Y5GA 2OC8A 3ZVCA 4UFEH 4ACBA 1HV7A 4B75A 1WTGH 2RA3A 1DT2A 4HX6A 1YPHC 1EP5A 3PWBA 3AK5A 2PGQB 3RXEA 2NWNA 1P3EA 2ZDLA 1P2QA 2OC7A 2BDCA 1MCTA 1NRGA 3SV7A 2HVYB 2LELA 1T8NA 2BVRH 4KTUA 3PROA 1VITF 4W64A 4FUDA 2ZDMA 1ZPZA 4MNYA 3MH5A 1EB2A 1NFWA 2WUBA 4K8YA 3LH1A 2QAAA 4Y0ZE 5DP6A 5J4QA 5F03A 1C5UA 1SHYA 1FONA 2FX4A 1AE5A 1BITA 3ZV8A 5DSFA 1HLTH 2ZQ2A 4FVDA 5CHOA 3M5OA 3HKIB 2ZFPH 4BXSA 2PUQH 1C1TA 2GZ7A 1NFUA 2GZ8A 2ZKSA 1QBVH 1V2JT 4NCYA 1AUTC 1P03A 1ELCA 4ABDA 4XHYA 3LGUA 1D3DB 1WLIA 1RTLA 1AZ8A 1NRPH 1OSSA 3F2HA 1BTYA 3P6ZB 3H5CB 3RM2H 3UWIA 1A0LA 4DIIH 2HGTH 3ZZ4A 3PB1E 1AUJA 1TABE 1TQ7B 1ZJDA 2UUFB 1K9OE 1F92A 2Y5HA 1T9MA 1BRUP 1THPB 2FIRH 3RXGA 2ODQA 4GCHG 1BBRH 1Y3WA 1TMTH 1C4Y2 3UB0A 1S6FA 3V12A 4IGDA 3RXPA 1YY3A 1EZXC 1H9IE 1J16A 1BMFD 3ATWA 4GHTA 2PTNA 2QC2A 1YKTA 5EXMA 3URCA 5C0TA 2HTDA 1KTTB 2FP7B 2G81E 3HGPA 1FJSA 1YM0A 4XRNA 3UPEA 1D6RA 3AVZA 3UR6A 1NT1A 3PMAB 3U69H 5F8TA 3Q3KA 1PPCE 1BTPA 1OWIA 5GNDA 2AERH 2W7UA 1HRTH 5EQQA 1PPHE 1BTXA 1P8VC 3UNRA 2NU3E 1KIGH 1TMBH 2F91A 3TH2H 1TNKA 1SQTA 1H8IH 2H5DA 2Z9IA 1UTOA 3QK1A 1DXWA 2AGIX 1AMHA 2A1DB 5CE1A 3VYAA 1W7XH 3MQKC 3RXTA 2CXVA 3E3TA 1KXDA 3SNCA 5C5OA 1C5WB 4AB8A 1ESAA 5EOKA 2J97A 1A3EH 1EAUA 3WW7A 4F48B 4KGAA 1GVLA 4IN2A 1FQ3A 1XUJA 2Z9GA 1GCDA 2BVXH 3R3GB 3PM3A 1GJ7B 1T32A 3CENA 1FIWA 4Q63A 1DUAA 1F0SA 2WYJA 3A8CA 4IC5A 4WXVA 3BTGE 1DNLA 1LVYA 4FOUC 4Y71A 1ABIH 1AXJA 1AFQC 2J9NA 3ELAH 1QA0A 2ZTYA 2J2UA 4CBNA 1K1NA 1NRQH 2KFWA 1SGNE 4TV4A 4BTUB 3T2NA 4FU8A 4FUIA 1K28D 1SL3A 3GDUA 2ZGBH 2NR4A 2HQ7A 1DM4B 1UCYE 1QRXA 1G36A 3FZDA 4IMZA 1ZTJA 1QBOA 1GJCB 4Y7AA 3RC5A 1NTPA 4J2YB 1RZ0A 2G5VA 4NFEA 2OP9A 4NA8A 2Z94A 2BDBA 4NIYA 3I29A 1AZZA 3ZOHA 4F49A 1EB1H 5HM2A 1XKBC 3R5WA 2HLDD 7GCHG 1S82A 1LTOA 2ZPRA 4B76A 2CJIA 1L1GA 4ABJA 4CRBA 1O0DH 4WWYA 4XD7D 3NFWA 1AB9B 4HZHA 4AGKA 3VY2A 2R0LA 1BB0B 5E0GA 3K9XB 1ETRH 6CHAB 1C1NA 3BTME 2TPIZ 2ZGJA 4MPVA 1PYTD 2GMTC 4ZHLU 2JKHA 4FETA 4UE7H 3B8JA 2XWBI 4Z1MD 1KDQA 4DCDA 1QRZA 4INKA 1AWHB 2J34A 1FY5A 4MNXA 2W26A 2G51A 3RXIA 3HGNA 2CN0H 1P10A 3Q77A 1ABJH 5GCHF 3M5NA 1V3XA 1EJMA 2D1JA 3SUDA 2EI7A 3QLPH 2F83A 1BTWA 4OS7A 2HNTE 2VINA 5HM9A 1G37A 4FUGA 2C3SA 2C8YB 1YP9A 2QF3A 2V3OH 4JMYA 1BOQA 1C1MA 2C4FH 4AZ2B 1A4WH 1EX3A 1SHHB 4J1YA 2UUYA 4YZUA 1IQMA 4B73A 4WMFA 3A89A 5GPIB 3SU0A 3GCHC 1MTNC 3ZV9A 1O37A 4DJZB 3TJVA 6LPRA 4B74A 4ZH8A 5EJLA 3RLWH 2JH6D 3GY7A 4AYYB 1EATA 2KCYA 4MNWA 4RKOB 3GDSA 1BMMH 3AAUA 1MH0A 4AX9H 3A82A 1V2VT 3OSYA 2TBSA 1UTMA 1DDJA 4OS2A 2KAIA 2RDEA 2BLOA 2PUXB 2OD3B 2OU5A 3H09A 1QTFA 4Q80A 2SFAA 4X8VH 1MAXA 1MBMA 3P8GA 4AB9A 4X8TH 5C0UA 3PO1C 5E2PA 1JBUH 1XUHA 4NZQA 3TH4H 4X0WU 3RXCA 1MAYA 1YCPH 4ABIA 3EGKH 1KLTA 2SNVA 2ZU1A 1TX7A 1OWEA 1N8OC 2D38A 4D9QA 2ECUA 2W7SA 3A7WA 2CHAC 1W0ZU 1MMJN 1CGIE 1GI3A 4X6NA 4Q2KA 3TGKE 1RD3B 3B9FH 1VGCC 3M5MA 4ASUD 1OHHD 3VFEA 2A4QA 2GX4A 1Q3XA 2AS9A 4K3JA 2F9PA 4B2CA 2ASFA 1DSUA 2WINI 3M7QA 3S69A 3STIA 1GI1A 1H4WA 3OX7U 4ABFA 3KIDU 1GJ4H 3LGVA 1GI5A 1ZYOA 3FN8A 1Y3VA 1NRRH 1P3CA 3VB7A 3DNHA 5JB9S 3Q00A 4D9RA 2ESTE 3W1EA 1E0FD 2ZCHP 1O5EH 3QX5H 1VJAU 3PYHA 1H8DH 1DPOA 1C9TA 3TVJB 2OXSA 2SGPE 2PGBB 2JH0D 3DHKH 2F4LA 4YBNA 1P2IA 3LGTA 1TGTA 1CI0A 2EI6A 2A4GA 3URDA 1LVBA 1HBTH 2QGRA 1P2KA 3DCLA 3OAAD 1E35B 3A7VA 3LONA 1F0UA 2A7HA 1V2LT 1MTWA 2F43B 1DLKB 2Y80A 2QN5T 1W7GH 2TGAA 3SQHE 1EZSC 3PTBA 4K8BA 1HJ9A 2ZDNA 2RG3A 3MTYA 1D3QB 4ASHA 4TPIZ 4K1EA 4FUFA 3BG8A 4MG3A 1DVAH 1UTLM 1HAXB 3DMBA 5C2ZA 2WPLS 2GUJA 2YMSC 2R3YA 3I78A 1SGFG 5DP3A 2NU2E 3QTOH 2HPPH 2ZHFH 1AD8H 1JRTA 1GG6C 3F9FA 4Y8YA 3UREA 2VVUA 3JZ1B 1H8ED 2AMQA 1YPKH 1HJAC 1VCPA 3BA3A 3KQEA 4RSPA 1L2EA 2AIPA 1B5GH 3SI4H 1KYNA 3VB4A 1O5DH 2FI4E 3EAJA 1W3OA 2QE7D 3F9GA 3A87A 3QGJA 1MCVA 1V2TT 3VPKA 2JDID 2A45B 1C2HA 1C1VH 4CRGA 1Y8TA 3LJOA 3FVFB 2P93A 5EGMA 1XMNB 2CK3D 2OL5A 2FOFA 2PW8H 5HGGA 3VEQB 4BAHB 4BNRA 1Z6EA 2FOCA 3MO9A 2A7CA 5FCRA 2QA9E 1C2LA 1TALA 2GCTB 5CDFE 1BTHH 2C8ZB 2J98B 4KTCA 1YCPK 1TA6A 1SQAA 3E1XB 1W14U 1Z7KA 3BTQE 4BAOB 4A6LA 1WQVH 2ZGHA 1BRAA 2QCYA 1OWJA 1ANEA 2Y6TA 3TITA 4Z85A 1CE5A 5DPAA 2WPJS 2OC1A 4ABGA 1W8BH 3UWJH 1ZRBA 4BAQB 3BTEE 3ZOCA 4MQAA 3GY8A 3TGJE 1O3MA 1ELBA 3SHAH 1LVMA 1FY3A 1EJNA 5EXLA 2LNCA 3RU4D 1SVPA 2F9UA 1PPFE 2Z9KA 4X8SH 4XDEA 5DJ7A 5B6OA 2TGDA 4RI0A 1MUEB 3ZVBA 1K22H 2UUKB 2ZNKH 2A32A 1GBBA 4B2AA 1EOLA 3GOVB 1TGBA 3F0PA 1TGSZ 1GWAA 1T4UH 4JYTA 1OWDA 5H4IB 1UO6A 1ZTKA 2GDEH 2STAE 1LPGB 4AFUA 1ZHMA 2WPMS 2L6OA 6GCHF 1TRYA 1VCWA 2O9QA 1CO7E 2ZF0H 1CT2E 3OY5U 4BANB 4TWWA 1SFIA 1J8AA 5F8XA 2EEKA 3KQCA 5K7RA 2G55A 2BVSH 2ILNA 2GV6A 2JJ2D 1QNJA 3SV6A 4KKDA 1RJXB 2PLXA 4Y7BA 2ARZA 2Y81A 2ANMH 5BPEA 5EXNA 5KEDA 1FPHH 1MU8B 2UWPA 2ZPSA 3C27B 4MVNA 2GCHG 3BTDE 1GJ9B 3D65E 1WCZA 3BSQA 3ITIA 1O3GA 1BJUA 1O3IA 2VU8E 5B6LA 3CS0A 3BEUA 2HRVA 1QGFA 3RXDA 4ABHA 1ZRKA 4Z6AH 3UOPA 1HXEH 1UVUH 3BG4C 1OKXA 1QY6A 2QIQA 1INCA 1Y59T 1V2OT 3FP7E 4AG1A 1IHSH 2R2MB 3MNBA 3GY5A 1GBTA 2FOAA 5LH8A 3KN2A 1MZAA 1J17T 1GGDC 1C5LH 1PPZA 3A8AA 4X6OA 3GCTG 1OPHB 1VCQA 1JOUB 1TYNA 5FX6A 3GCOA 3ZOFA 3UNQA 4FUCA 3VG8A 3TGIE 1IOEA 3SUFA 3W95A 1Y3YA 1O2MA 1IQKA 8LPRA 2KCOA 3RMNH 2W6JD 2AMDA 3K65B 2D36A 1ELTA 2AQ6A 1HAVB 1OXGA 2IOTA 1CT0E 3RXLA 2J4IA 5EG4A 2FZZA 4NFFA 3ODDA 1VITG 1C2GA 2PFEA 2ED4A 3L6PA 1H9LB 3N99A 1LPZB 5C20A 1EZQA 3G01A 3LOXA 5F8ZA 3K6YA 1P02A 3UUZA 4O3UA 2PV9B 1SGEE 2PP6A 4QT8C 4XE4A 1GJ8B 3LDXH 1LHDH 2A5AA 3PRBA 1Y5BT 2HTIA 2O8WA 1LQDB 2V3HH 1Y5AT 2W3KA 1SGIB 1PQ7A 2ZCLP 2FOGA 1O31A 1G3CA 3RDZA 2FPZA 1ZGIA 3WY8A 2XBWA 3BEFB 2ZPQA 1P2JA 1DLEA 3PTNA 3EYDA 1BRCE 4LK4A 2BY9X 3U1IB 1C5VA 1XVMA 2PKSB 1PQAA 1AU8A 4XSKU 2VNTA 3VY5A 2J38A 3BTHE 1RRKA 3O8RA 2IN2A 2J95A 1NS3A 1AN1E 3A84A 2ZECA 3PV4A 1QCPA 3ZZ8A 1RIWC 1PPGE 4WH8A 1C1UH 2HLCA 5JPMH 1EUFA 5FPTA 3LC3A 2GGVB 1RTKA 4FXGH 1NO9H 5JDUB 3EAAA 3P70B 5EODA 3TK6A 4ZKYA 4JK6A 1MD7A 4CRAA 2BZAA 3AAVA 3RU4E 3M37A 3R0FA 3F2GA 3SJIA 1SGPE 3QGNB 1SLUB 3RLYH 1CU1A 4GAWA 2V35A 3SNAA 1SPJA 2NU1E 5A0CA 1E34B 1ORFA 1C9PA 3RC4A 1G32B 3V0XA 3RXSA 1O34A 4SGAE 4D76A 3SU1A 2VBCA 2SGAA 5GDSH 2ZI2H 1PPEE 3BN9A 2A4OA 4PROA 5DO4H 1GVKB 4ZROA 2Y5FA 4LZ1H 1N1LA 5FL7D 3TJUA 1V2QT 1FIZA 4FU7A 1HIAA 5A0BA 2BX4A 4RKJB 5F53A 4ZKNU 1AFQB 1TX6A 1UCYK 2I6QA 5C94A 2GV7A 1D3TB 3S7KB 1Y12A 4TY7A 2ZFRH 2O8LA 3OYPA 1E1RD 1ZJKA 4UD9H 1KSNA 2F9VA 2BY5X 1S0RA 2QXJA 1RFEA 2D26C 3VB5A 1D4PB 1GMCF 1CT4E 3EA9A 2FX6A 1E1QD 2AMPA 4F07A 4B1TA 1P9UA 4UEHH 1SGCA 5T3HA 3LT3A 2H9TH 2ZFQH 4YLUA 1KTSB 2KX4A 3T28A 1HGTH 1NBMD 2BD2A 5LPEA 1FY1A 3KEEA 4O97A 3BF6H 2KM0A 3AW0A 3HY8A 5CHAC 1OYTH 2D37A 1C5XB 3VGCB 1B0EA 4NIWA 3AWHA 3FP8E 4HMXA 3M3SA 2FI3E 3ZVFA 2ZZUH 8GCHG 1A3BH 1GVZA 4DY7B 5CMXH 1MD8A 4K2YA
chains in the Genus database with same CATH topology
3KYFA 5BNCA 4XHYA 3U34A 3FGEA 1WLIA 3VY5A 4RT1A 3RH7A 2ARZA 4RT0A 4HMUA 3SWJA 2RDEA 3BA3A 1W3PA 2HQ9A 2NR4A 2HQ7A 2OU5A 3A20A 3PFTA 5KEDA 5EJZA 1RZ0A 1T9MA 1W3OA 2RE7A 3DSGA 4P00A 5CHEC 3ZOHA 4YWNA 1YLNA 1WGBA 3CNRA 3ZODA 3B5MA 3R5WA 1WV4A 4XJ2A 3F7EA 3ZOGA 1G78A 4P02A 2R0XA 3R5RA 2D38A 4ZKYA 2ECUA 1VL7A 2HTDA 2I51A 3U0IA 4I86A 2IMLA 1YWUA 3K86A 2A2JA 2OL5A 3K87A 3ZOEA 5EJ1A 4XRNA 2ECRA 3R5YA 3A6RA 2E83A 2QEAA 3NFWA 1G79A 3A6QA 3VY2A 2X1JA 3AMFA 1G76A 3CP3A 4QVBA 2ASFA 1I0SA 3KYGA 4IRAA 2D5MA 3R5ZA 3ZOFA 1EJEA 5ESCA 3H96A 1WLKA 1W9AA 1JNWA 3DNHA 4HMTA 4HMVA 4HMSA 1I0RA 3BPKA 2GJGA 2L74A 2D36A 3CB0A 3FKHA 3R5LA 4Z85A 5KGOA 1W3QA 2AQ6A 3DB0A 3R5PA 5EIYA 1W3RA 3ZOCA 3VYAA 2X1KA 1XXOA 1YOAA 2HHZA 4N7RC 1Y30A 4HG6A 4R82A 2FURA 4HX6A 3TGVA 2VPAA 2ED4A 4YBNA 2FG9A 1CI0A 1RZ1A 1XHNA 1RFEA 2Q9KA 3GASA 2PTFA 1NRGA 4F07A 5KECA 4F48B 4HMWA 2R6VA 2QCKA 1G77A 2HTIA 3U5WA 3BNKA 3K88A 1TY9A 5JABA 1USCA 3HY8A 2D37A 3EC6A 5EJLA 3HMZA 3E4VA 5CHOA 2I02A 4Y9IA 1DNLA 3AWHA 2IG6A 4HMXA 3U35A 4L82A 3DMBA 4FOUC 2IABA 1AXJA 2FHQA 1USFA 3IN6A 1FLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYF A;  5BNC A;  4XHY A;  3U34 A;  3FGE A;  1WLI A;  3VY5 A;  4RT1 A;  3RH7 A;  2ARZ A;  4RT0 A;  4HMU A;  3SWJ A;  2RDE A;  3BA3 A;  1W3P A;  2HQ9 A;  2NR4 A;  2HQ7 A;  2OU5 A;  3A20 A;  3PFT A;  5KED A;  5EJZ A;  1RZ0 A;  1T9M A;  1W3O A;  2RE7 A;  3DSG A;  4P00 A;  5CHE C;  3ZOH A;  4YWN A;  1YLN A;  1WGB A;  3CNR A;  3ZOD A;  3B5M A;  3R5W A;  1WV4 A;  4XJ2 A;  3F7E A;  3ZOG A;  1G78 A;  4P02 A;  2R0X A;  3R5R A;  2D38 A;  4ZKY A;  2ECU A;  1VL7 A;  2HTD A;  2I51 A;  3U0I A;  4I86 A;  2IML A;  1YWU A;  3K86 A;  2A2J A;  2OL5 A;  3K87 A;  3ZOE A;  5EJ1 A;  4XRN A;  2ECR A;  3R5Y A;  3A6R A;  2E83 A;  2QEA A;  3NFW A;  1G79 A;  3A6Q A;  3VY2 A;  2X1J A;  3AMF A;  1G76 A;  3CP3 A;  4QVB A;  2ASF A;  1I0S A;  3KYG A;  4IRA A;  2D5M A;  3R5Z A;  3ZOF A;  1EJE A;  5ESC A;  3H96 A;  1WLK A;  1W9A A;  1JNW A;  3DNH A;  4HMT A;  4HMV A;  4HMS A;  1I0R A;  3BPK A;  2GJG A;  2L74 A;  2D36 A;  3CB0 A;  3FKH A;  3R5L A;  4Z85 A;  5KGO A;  1W3Q A;  2AQ6 A;  3DB0 A;  3R5P A;  5EIY A;  1W3R A;  3ZOC A;  3VYA A;  2X1K A;  1XXO A;  1YOA A;  2HHZ A;  4N7R C;  1Y30 A;  4HG6 A;  4R82 A;  2FUR A;  4HX6 A;  3TGV A;  2VPA A;  2ED4 A;  4YBN A;  2FG9 A;  1CI0 A;  1RZ1 A;  1XHN A;  1RFE A;  2Q9K A;  3GAS A;  2PTF A;  1NRG A;  4F07 A;  5KEC A;  4F48 B;  4HMW A;  2R6V A;  2QCK A;  1G77 A;  2HTI A;  3U5W A;  3BNK A;  3K88 A;  1TY9 A;  5JAB A;  1USC A;  3HY8 A;  2D37 A;  3EC6 A;  5EJL A;  3HMZ A;  3E4V A;  5CHO A;  2I02 A;  4Y9I A;  1DNL A;  3AWH A;  2IG6 A;  4HMX A;  3U35 A;  4L82 A;  3DMB A;  4FOU C;  2IAB A;  1AXJ A;  2FHQ A;  1USF A;  3IN6 A;  1FLM A; 
#chains in the Genus database with same CATH topology
 2H2Z A;  4F55 A;  1DFP A;  3KYF A;  5BNC A;  4AOQ A;  3DA9 B;  1C2K A;  3SNE A;  1HAH H;  2GMT B;  3GIS B;  4VGC C;  1S83 A;  2BDG A;  3C1K A;  1PQ8 A;  1EAI A;  3A20 A;  5E0H A;  5EW1 H;  2WPD D;  2Z6B D;  1XVO A;  1C5O H;  3TK9 A;  3SYJ A;  1BRB E;  1FAK H;  2ZDV H;  2QXI A;  4P00 A;  2GTB A;  5LGO A;  5T6D A;  1J15 A;  1W11 U;  1BJV A;  1A61 H;  3HK6 B;  1GJD B;  4B71 A;  5ETX A;  2XC5 A;  4I86 A;  4NG9 H;  2QF0 A;  2HNT F;  4AC9 A;  8GCH F;  5EU8 A;  4JZE H;  3NCL A;  2Z9L A;  5FHT A;  2E83 A;  2HNT C;  2P3F H;  2QEA A;  1ZHR A;  1O3D A;  2XC4 A;  3OY6 U;  3ZZD A;  1GCT B;  3GCH B;  4XBC A;  3R5Z A;  1THS H;  1FAX A;  2ZQ1 A;  1C4V 2;  2K8I A;  3QTV H;  7EST E;  2ZO3 H;  1S85 A;  3RXQ A;  2UUJ B;  1QB1 A;  2Z3E A;  5GCH G;  4X1S U;  2ZP0 H;  3U9A H;  4Y6D A;  1EAS A;  2G5N A;  4IMQ A;  2CV3 A;  1Z1I A;  2HAL A;  3RM0 H;  1QB9 A;  1L1N A;  2BLV A;  3SJO A;  4YOJ A;  3FFG A;  3P8N A;  5J4S A;  1O3O A;  1YOA A;  1IQL A;  5I46 H;  4HI3 A;  3RXU A;  4R82 A;  2FXR A;  1H1B A;  1N6X A;  5HIY A;  5T1V A;  4K5Z A;  4OGX A;  1XHN A;  2Q9K A;  1QL7 A;  2P95 A;  3PO1 B;  1HPG A;  3O8D A;  1SSX A;  1MKW K;  2XBY A;  3MU8 A;  1O3E A;  1QFK H;  3VB6 A;  1BML A;  2XCF A;  3ZIA D;  1MTS A;  2SGF E;  2WPK S;  3PMB B;  1USC A;  2F9O A;  2CHA B;  3VB3 A;  3TNT A;  4YLQ H;  1GPZ A;  3ATI A;  2AH4 X;  3HMZ A;  4X2V A;  1VGC B;  4X6P A;  1E38 B;  1LHG H;  2KAI B;  4L82 A;  3HPT B;  4IS5 A;  3HK3 B;  2BD9 A;  2FM2 A;  2DE8 A;  3U34 A;  1EKB B;  2C90 B;  4BXW A;  1IQE A;  3JZ2 B;  4OM9 A;  3EE0 B;  4ZKS U;  3ZVG A;  1LCY A;  4O3T A;  1QR3 E;  1UVT H;  1V2W T;  3PV2 A;  3D23 A;  4IN1 A;  1O2Z A;  1MTU A;  1FXY A;  2HQ9 A;  3ZZC A;  2PSX A;  3PFT A;  3ATK A;  3OEE D;  4H6S B;  1HAG E;  4RN6 A;  2WZQ A;  4AFQ A;  1UTN A;  1SQO A;  2B0F A;  2BDI A;  1C5Y B;  2HPQ H;  2JET B;  1TRM A;  1KXB A;  1W0J D;  2THF B;  2BB4 A;  2KR7 A;  3SJ9 A;  4B6E A;  1DWD H;  4UFD H;  5FBI A;  2R0X A;  1A46 H;  1O2Y A;  3U8R H;  1J14 A;  1RFN A;  4NSY A;  6EST A;  1GJA B;  1ELV A;  2JIZ D;  1UHB B;  2EQN A;  4UFG H;  2VH0 A;  3CS7 A;  3K87 A;  2VWL A;  3LIW A;  1BTU A;  5EJ1 A;  2ECR A;  2PKA B;  5PTP A;  2AFQ B;  2YOL A;  4Y8X A;  3V13 A;  1W0K D;  1OP2 A;  4FUJ A;  1SI5 H;  3ZZ9 A;  1G79 A;  1WUN H;  1ESB A;  1HAZ B;  2ASU B;  2OLG A;  1NBM E;  3MU5 A;  4Z0K A;  2D5M A;  2YMS D;  4TPY A;  1K1I A;  2OQU A;  1V2S T;  2BLW A;  1C2D A;  4U2W A;  3E90 B;  4H6T A;  1NZQ H;  3TLO A;  1K0H A;  1HCG A;  4FVB A;  3SU6 A;  1AB9 C;  2GJG A;  2AGE X;  2G00 A;  3CB0 A;  3FKH A;  3BIU H;  4MNV A;  5KGO A;  1NRS H;  2QYI A;  1IQI A;  1EJA A;  1T31 A;  1O2S A;  6CHA C;  5F6M A;  2QY0 B;  1OS8 A;  1EFR D;  2LPR A;  1GJB B;  2SGE E;  1O2X A;  2WPH S;  3SU3 A;  1GI2 A;  1O2Q A;  1DY8 A;  3E0P B;  2Z3C A;  1AWF H;  3FKS D;  3GAS A;  2J92 A;  2SGD E;  1FUJ A;  3ATM A;  2ZHE H;  2P3T B;  1C1O A;  1O5F H;  1C2E A;  3A8D A;  2H5C A;  4OS5 A;  5HYO A;  1IQG A;  2F9B H;  1AKS B;  1YLC A;  1A5H A;  3RXJ A;  1SQR A;  1TPP A;  3MNC A;  1HAO H;  2ZA5 A;  1YF4 A;  1HB0 B;  2STB E;  3DD2 H;  4DUR A;  2J94 A;  1Z8I B;  1LVO A;  1GHW H;  5SGA E;  3A81 A;  4BAK B;  2FHQ A;  1RXP A;  3IN6 A;  1IAU A;  1ZMN A;  5GXP A;  1A1R A;  4CR5 A;  3RXH A;  4HKH A;  2HVX A;  2EI8 A;  4A5T S;  8EST E;  2K1Q A;  4RT1 A;  3RMO H;  2GVF A;  4ISH H;  3DSP A;  2G52 A;  4MTB A;  1CSO E;  1JWT A;  1M9U A;  1OOK B;  1ZSL A;  1TPA E;  3T29 A;  1TFX A;  2PWX A;  4OS6 A;  3BTT E;  3RXO A;  3Q76 A;  1BZX E;  1GBE A;  1V2K T;  1WGB A;  3SUE A;  1T4V H;  1DWE H;  1K1M A;  1WV4 A;  1F2S E;  1C5T A;  1GHB F;  1SB1 H;  1W10 U;  2FTL E;  1WOF A;  1AVG H;  1SKY E;  1QJ6 B;  1Z8G A;  1CA0 B;  2VIQ A;  3DFJ A;  3ZOE A;  3NUM A;  1AE8 H;  4H42 U;  2I6S A;  5C5N A;  1V2M T;  3EA7 A;  3U28 C;  4NIV A;  4JZD H;  4ZXX H;  1TOC B;  4Y0Y E;  2BZ6 H;  2WPI S;  1VR1 H;  2VIP A;  1QUR H;  2Y82 A;  3NRL A;  3RU4 T;  3SGB E;  3E6P H;  1O2U A;  1MU6 B;  2OUA A;  4DIH H;  1GL1 A;  4THN H;  2H1U A;  3GY6 A;  2BDA A;  2K0Q A;  1W2K H;  3U8O H;  1OYQ A;  1WLK A;  2B9L A;  3BTW E;  1JNW A;  1EST A;  3AW1 A;  1G3E A;  1ELG A;  1K21 H;  2ULL A;  4MLF B;  1YPL H;  2L74 A;  1SLX B;  1SLW B;  1Q2W A;  2FES H;  2VGC B;  3DB0 A;  1NC6 A;  4ZAE A;  7LPR A;  3L3T A;  1YC0 A;  3FOA A;  4CHA C;  1HJ8 A;  1DAN H;  1Y5U T;  1AY6 H;  3BTF E;  4GPG A;  4E7N A;  1GHA F;  3LGY A;  4NA7 A;  3DUX H;  3M3V A;  1EPT B;  3KQ5 A;  3PLP A;  1TB6 H;  2GDD A;  1ZML A;  2M5T A;  5BRR E;  2R6V A;  3P92 A;  2A2X H;  2FLR H;  2CGA A;  3O8C A;  2FTM A;  1G77 A;  6GCH G;  1ZPB A;  1B0F A;  3BG4 B;  1IQF A;  2C8X B;  4WH6 A;  1QL9 A;  3QO6 A;  2IPQ X;  2GZ9 A;  3A8B A;  2YNB A;  2OCV B;  1O33 A;  4E7R G;  3M7T A;  3NZI A;  2IG6 A;  1GGD B;  1GI4 A;  2BD8 A;  4TWY A;  2IAB A;  3UFA A;  4CRF A;  5GJ4 B;  1NFX A;  4FUH A;  1D6W A;  3FGE A;  2FI5 E;  3A7Y A;  4DG4 A;  1MKX H;  4KP0 A;  2QF5 A;  1HDT H;  4FUE A;  5ABW A;  1P04 A;  2P8O B;  3F0O A;  1BHX F;  1TON A;  4ABB A;  2ANW A;  3LGW A;  1KMH B;  3PLK A;  4BAM B;  4FU9 A;  3S9C A;  5G4B A;  4U30 A;  1GMH F;  2IJD 1;  3F68 H;  2A7J A;  1G3D A;  4Y8Z A;  4U01 A;  1AGJ A;  1XKA C;  1O38 A;  2VIO A;  2B7D H;  1PFX C;  1VJ9 U;  2Q1J A;  3SV8 A;  2BD5 A;  1AO5 A;  4GVU A;  3ZOD A;  1C5P A;  4SGB E;  1EOJ A;  3FO8 D;  3BV9 B;  5I25 A;  3EE7 A;  3MWI U;  1O3N A;  2A4R A;  1KXA A;  4JCN A;  1K2I 1;  2L1T A;  1O2L A;  4WJG 2;  1YGC H;  4X6M A;  4E05 H;  4XBD A;  5EW2 H;  1O3H A;  3SHC H;  1ARB A;  2J98 A;  3ZZ6 A;  3GCN A;  3SJ8 A;  3UTU H;  1F7Z A;  4JZ1 A;  5DP7 A;  3MU0 A;  3VXF H;  2ZIQ H;  3NPS A;  3QN7 A;  1C1Q A;  1WQS A;  5EQS A;  3RXA A;  3GS9 A;  2CF8 H;  5ESB A;  4QVB A;  5JYI A;  2G4U A;  3F9H A;  1EJE A;  1COW D;  1LKB A;  2BX3 A;  2A0Q B;  1DXP A;  1UMA H;  1C2F A;  2WYG A;  1E37 B;  1GBA A;  1MQ6 A;  1O3K A;  1PJP A;  1MAB B;  3SI3 H;  4I32 A;  1O3F A;  4NGA H;  1O3B A;  4I31 A;  1RGQ A;  5DN6 D;  3B23 B;  1UCY H;  1QIX B;  2GCT C;  2BHG A;  4A1T A;  2ALP A;  1LHC H;  1TNH A;  2X1K A;  1P57 B;  4JYV H;  1JXP A;  4I8L A;  1J9C H;  4X1N U;  4ZKO U;  4A1X A;  3M3T A;  3QZQ A;  2G8T A;  1TPS A;  1KLJ H;  5JB8 S;  3H7T A;  4YT6 H;  1XUK A;  5JBT A;  4XBB A;  1O2O A;  1CHO F;  1UK2 A;  2EC9 H;  2GD4 B;  2ODP A;  3U5W A;  1TY9 A;  1MBQ A;  1WAY B;  1HUT H;  2BM2 A;  2FLB H;  2VID A;  2A2Q H;  1X7A C;  3T26 A;  1XUI A;  3A7T A;  1G2M A;  1YLD A;  3EC6 A;  2WSS D;  5C17 A;  2ZFS A;  4X1Q U;  3PV5 A;  1T8O A;  3U35 A;  2KZ4 A;  3LC5 A;  3PWC A;  2XND D;  4F4O C;  1GMD F;  3ZVA A;  4I7Y H;  2M2A A;  1NRO H;  3E0N B;  1IQN A;  3HE1 A;  4AGJ A;  2H6M A;  4JZF H;  3PRD A;  1H8H D;  1Y3U A;  1C5R A;  1GBJ A;  4ISI H;  4OGY A;  4RT0 A;  1BCU H;  1ETT H;  1HAI H;  1D3P B;  1YPJ H;  2YNA A;  4TYD A;  1V2P T;  1TLD A;  3H7O A;  1QBN A;  2W3I A;  2TGP Z;  1C1W H;  1BQY A;  4UDW H;  5JBA S;  2TRM A;  3B5M A;  3MNS A;  4BTI B;  5HXF A;  1GBF A;  2ZC9 H;  1BT7 A;  1MKX K;  3FP6 E;  1C5N H;  2I51 A;  1G9I E;  1FY4 A;  5DP9 A;  2AHM E;  3SUG A;  2C93 B;  2JH5 D;  3SQE E;  1YPG H;  1SBW A;  1GI8 B;  1E36 B;  1DY9 A;  1ZPC A;  2FDA A;  1ZR0 A;  3LPR A;  1TPO A;  1VZQ H;  1GBM A;  2D8W A;  1EXF A;  1Z1J A;  3AMF A;  3OFN D;  3ZZ3 A;  1HIA B;  2V3M A;  1ELA A;  2BY7 X;  5CHA B;  1HAV A;  1TIO A;  5FXL A;  5ESC A;  3GY4 A;  2GKV E;  3E8L A;  4YM9 A;  4HMS A;  3BTK E;  1KY9 A;  1GHX H;  1DIC A;  2A5I A;  3MYW A;  1UVS H;  1W3Q A;  2FWW A;  2GT7 A;  3P8F A;  1YPE H;  1CGH A;  5T6G A;  1GMC G;  3V7T A;  4ISN A;  1O3P B;  4VGC B;  1NN6 A;  4N7R C;  3RC6 A;  1EQ9 A;  2BYA X;  4A7I B;  2FUR A;  3TGV A;  3Q3Y A;  4ZCN A;  4I8K A;  3SZE A;  2BDH A;  1CBW C;  1ZHP A;  1OWK A;  4AN7 A;  4AFS A;  1F5R A;  1FDP A;  1TNI A;  4CBO A;  1QA7 A;  5KEC A;  1W13 U;  1MZD A;  3F9E A;  1MKW H;  4Q7Z A;  2W5E A;  4XOJ A;  4WME A;  1GHZ A;  3TU7 H;  3D49 H;  3P95 A;  3BNK A;  1C5Z B;  3U98 H;  1IHT H;  3RXV A;  1XM1 A;  1O3C A;  2PTC E;  1LHE H;  1HAP H;  1AHT H;  4Y10 E;  2A31 A;  4GLY A;  3M36 A;  1GI9 B;  2I02 A;  4Y9I A;  1T7C A;  2BY8 X;  1SGD E;  1THR H;  1TRN A;  1Z71 A;  2LP6 A;  3IIT A;  1RTF B;  1MTV A;  3BIV H;  3N7D A;  4NWL A;  1BMA A;  1O3A A;  1YPH E;  1WYK A;  2FOB A;  2ZWL H;  5JBC S;  1XUF A;  2GT8 A;  2WHX A;  5AFZ H;  3W94 A;  4AYV B;  2HOB A;  1NU9 A;  1K1J A;  4HMU A;  2BOK A;  2FS8 A;  2VWN A;  1P09 A;  3UOU A;  4R0I A;  3S7H B;  2AIQ A;  2A5K A;  5L2Y H;  2BQ6 B;  5EJZ A;  2DUC A;  5EPN A;  3SZN A;  2PKS C;  4MPX A;  1ELF A;  4YT7 H;  5JBB S;  3HAT H;  4LZ4 B;  1JIM A;  5L30 H;  4B6F A;  4YXW D;  1G78 A;  3R5R A;  5HMA A;  3QZR A;  4AG2 A;  3OEH D;  2NU4 E;  5E8E H;  4GCH F;  1V6D A;  3ATL A;  1A0H B;  1ELD E;  4X1R U;  1QJ1 B;  5L2Z H;  3A7X A;  2IPH A;  2FS9 A;  2BOH B;  4UFF H;  4WF8 A;  1C2M A;  3R5Y A;  2P3U B;  1Y3X A;  5E2O A;  4ISO A;  1QL8 A;  1LDT T;  1O35 A;  1F0R A;  4IBL H;  1HFD A;  3MFJ A;  1ZLR A;  3O8B A;  3M5L A;  4WMD A;  2AYW A;  4CRE A;  1JIR A;  1GL0 E;  2KCA A;  4X2Y A;  5TCC A;  2PSY A;  3F3B A;  4X2X A;  4UHV A;  4B2B A;  3RXM A;  1ACB E;  4LXB H;  1HNE E;  4WY3 A;  3T5F H;  1TAW A;  2BTC E;  1W9A A;  3MO3 A;  1KLI H;  4ZUH A;  3RUO A;  3L33 A;  3UQO A;  1TNJ A;  4HTC H;  5DG6 A;  2QXG A;  5DP8 A;  1NRN H;  1GBC A;  1Q31 A;  5C3N A;  4BOH A;  4DW2 U;  1KXE A;  1ELE E;  1Y30 A;  3K2U A;  1TOM H;  1KDQ B;  2FG9 A;  2BXT H;  1O36 A;  1DOJ A;  3BEI B;  1RZ1 A;  1MTN B;  5FBE A;  3N7O A;  2XW9 A;  4NSV A;  1V2N T;  4JK5 A;  4WXI A;  1L4D A;  4I8H A;  1UTK A;  1C5M D;  1SFQ B;  4R8T B;  1ZMJ A;  2QCK A;  3MNX A;  1SMF E;  4Y11 E;  1KXF A;  3IG6 B;  4IW4 E;  1Z6J H;  5K0H A;  2CF9 H;  1GBH A;  5TJX A;  3D62 A;  4TT3 D;  3ZZA A;  2BD3 A;  4MDS A;  1UTP A;  1EP6 A;  5L6N H;  2ANK H;  2BDY A;  1O2P A;  3OE7 D;  1IQH A;  3N7E A;  1O2K A;  5C1U A;  2ZCK P;  3CP7 A;  5FAH A;  1GI7 B;  2VIW A;  1DS2 E;  2BMG B;  1T8L A;  3SND A;  1G30 B;  3MHW U;  2NU0 E;  4M9F A;  1FY8 E;  1TWX B;  1P01 A;  2FOH A;  1A0J A;  3SBK A;  1SGT A;  5FPY A;  3TK5 A;  3VGC C;  2W6I D;  1P2N A;  3GY2 A;  1N8O B;  1HAY B;  3ZZ5 A;  1L4Z A;  1H9H E;  1UTQ A;  2JJ1 D;  1BBR K;  1ZGV A;  4Y76 A;  1IQJ A;  1XUG A;  3KCG H;  4YWN A;  1DIT H;  2WV5 A;  5C1X A;  1VKY A;  2EA3 A;  3I77 A;  4Y79 A;  5LPR A;  1QQU A;  3SO3 A;  3SU4 A;  1GBD A;  3M35 A;  5E0J A;  2ZDA H;  1UTJ A;  3EST A;  4FUB A;  1O2R A;  1ZTL A;  1WXR A;  2QXH A;  2VJ1 A;  1O5A B;  1T8M A;  3WWF A;  2Y7X A;  1QHR B;  1TX8 A;  1PQ5 A;  4INL A;  3DT0 H;  2AEI H;  2O8U A;  1FPC H;  1BDA A;  3M7U A;  4I33 A;  3U8T H;  2SGQ E;  2XNI A;  5HIZ A;  1GI6 A;  7GCH F;  1NFY A;  3CP3 A;  1FZZ A;  1I0S A;  1TGC A;  3F2F A;  2B5T B;  3RXF A;  3F6U H;  1BUI A;  4XFQ A;  3GIC B;  1O2N A;  3MH6 A;  5AHG H;  1V2U T;  1W0Y H;  2P94 A;  3K6Z A;  4MPW A;  4ZXY H;  3ZYE A;  3H96 A;  1ID5 H;  3QUM P;  1G2L A;  2HWL B;  3MH7 A;  3BPK A;  3EA8 A;  1WV7 H;  2ZU2 A;  4MPU A;  1GCT C;  4TY6 A;  5A8Y A;  1O5C B;  5DP4 A;  3RP2 A;  2Z9J A;  4ABE A;  1S84 A;  4E06 H;  1NM6 A;  5T6F A;  1GBI A;  4YOI A;  2XC0 A;  1TNG A;  3PMH B;  1EAX A;  2OTV A;  1D9I A;  1OP8 A;  4D8N A;  1O5G H;  1JMO H;  2VPA A;  4O03 A;  1AI8 H;  1CA8 B;  2XOK D;  2XTT B;  3ENS B;  2FOM B;  2RCE A;  2ZHQ H;  3KGP A;  3OU0 A;  2ZTX A;  1FX0 B;  2OK5 A;  3SGA E;  5EQR A;  3S0N A;  4NZL A;  5DKM A;  3KF2 A;  1ANB A;  3SV2 H;  4DGJ A;  3LKW A;  4K1S A;  2ZU5 A;  3EQ0 H;  1LKA A;  2BD4 A;  3SU2 A;  1WTH D;  4NA9 H;  3SGQ E;  1SGQ E;  5GIB A;  2YMS B;  3K88 A;  1GG6 B;  4K69 A;  2H9H A;  2XBV A;  5A2M H;  3FZZ A;  1A5G H;  5FPS A;  2BQW B;  3M61 U;  3P17 H;  1HJA B;  4YOG A;  1QB6 A;  3SOS A;  1BBR E;  1Z8J B;  1Z8R A;  4GUX A;  1TBZ H;  4YO9 A;  5DGJ A;  3RMM H;  3TJO A;  1ZZZ A;  2XYA A;  1USF A;  1K1L A;  5A09 A;  4DOQ A;  2OBO A;  1GDU A;  1C2J A;  4YES B;  1PYT C;  1UK3 A;  3MOC A;  4WVP E;  3AAS A;  4JZI A;  1EAW A;  4A92 A;  1OX1 A;  2Q6G A;  2FO9 A;  3MU4 A;  5DK1 A;  1FV9 A;  1GHB G;  2FYR A;  2ODY B;  2PR3 A;  1SOT A;  5FX5 A;  3T62 A;  1UHB A;  4KEL A;  3E16 B;  3VXE H;  3P8O A;  1C1R A;  1A2C H;  1SR5 C;  4ZKR U;  4MTK A;  1O32 A;  2BQ7 B;  2WV9 A;  2PKA A;  2FEQ H;  3SV9 A;  2XBX A;  4CHA B;  5FCK A;  3ZOG A;  5TCA A;  2O8M A;  3V3M A;  2IJO B;  3Q3X A;  3GDV A;  4X2W A;  1VL7 A;  3U0I A;  2ZTZ A;  3TH3 H;  1FI8 A;  3K86 A;  3MU1 A;  2XXL A;  3EDX B;  1XX9 A;  4X8U H;  1QRW A;  3RXR A;  3LJJ A;  3OTP A;  4NWK A;  2JET C;  1CHG A;  4X1P U;  2WUC A;  3A6R A;  1TA2 A;  4HFP B;  5A8Z A;  3KNX A;  1P2M A;  2J5U A;  4ZMA H;  1SC8 U;  1F0T A;  1A7S A;  4HGC A;  1O5B B;  1FN6 A;  3A83 A;  1UJ1 A;  1ARC A;  1JRS A;  1DUE A;  4CRC A;  2BXU H;  2ZFT A;  3ZZB A;  4AOR A;  4NIX A;  3FAO A;  1UVO A;  4ISL A;  1WU1 A;  1S6H A;  2RA0 A;  2ZU4 A;  3UQV A;  1O3L A;  2TIO A;  1GHA G;  1SGR E;  4DVA U;  1O39 A;  3SJK A;  3A88 A;  1CGJ E;  4KTS A;  1W3R A;  1ANC A;  1C2I A;  1CVW H;  1LMW B;  2V7Q D;  1B7X B;  1K1P A;  5EPY A;  1F5L A;  3LH3 A;  3RXB A;  1KXC A;  3OTJ E;  1AKS A;  3NWU A;  3FAN A;  1BHX B;  2CMY A;  2O8T A;  4ZHA A;  1ZSJ A;  2FOE A;  3RML H;  2QV1 A;  1F5K U;  2OQ5 A;  5DP5 A;  5EST E;  5C1Y A;  2AGG X;  1K1O A;  3GYL B;  2ZHW H;  3PLB A;  2F9N A;  4CRD A;  4A1V A;  1C5Q A;  2FYQ A;  2VWM A;  2V0B A;  4JYU H;  3T25 A;  3A85 A;  4TSF D;  2BY6 X;  1GI0 A;  3ZVD A;  1SGF A;  1SGY E;  2FMJ A;  1FLE E;  3TNS A;  1E79 D;  1ZSK A;  3SU5 A;  1C1P A;  2DE9 A;  2EY4 C;  4BTT B;  2Y7Z A;  1P2O A;  8KME 2;  5LPF A;  1O2V A;  2R0K A;  4Q7X A;  1LO6 A;  3PMJ A;  4ZHM U;  1GMH G;  1ETS H;  3UNS A;  5A8X A;  1XXD A;  1O2H A;  3RH7 A;  1DE7 H;  1AND A;  3MMG A;  1UK4 A;  4K1T A;  2KCP A;  1YYY 1;  4DT7 B;  1N6Y A;  1OWH A;  2B8O H;  1PPB H;  4I8G A;  1HYL A;  2ZG0 H;  1TQ0 B;  3DSG A;  3DSO A;  5GWZ A;  2XWA A;  5CHE C;  1YLN A;  2XRC A;  2BD7 A;  3CNR A;  1TGN A;  2ZU3 A;  2VB0 A;  2ZDK A;  4ACA A;  7KME H;  3ZVE A;  4XJ2 A;  2ZGC A;  3F7E A;  4P02 A;  5A0A E;  3T27 A;  1S0Q A;  5HKK D;  1GDQ A;  1WDI A;  1GBL A;  3MH4 A;  3NXP A;  2IML A;  1DWC H;  1P0S H;  1YWU A;  3ZYD A;  4AFZ A;  2A2J A;  5AF9 H;  1AVW A;  4GSO A;  2WV4 A;  3SW2 B;  3ZZ7 A;  2P5Z X;  4INH A;  2ANY A;  4D7F A;  3TJN A;  1EZU C;  3RXK A;  2R3U A;  1NU7 B;  3GYM A;  1O30 A;  3NKK A;  3A6Q A;  1VIT H;  2VIV A;  2X1J A;  2ALV A;  1G76 A;  1C1S A;  3GY3 A;  3HKJ B;  3STJ A;  2K4Q A;  1AQ7 A;  1OP0 A;  1MQ5 A;  1CA0 C;  1LHF H;  2PHB A;  2UWL A;  1FMG A;  1TBR H;  1RS0 A;  2SNW A;  3A86 A;  1NPM A;  2C8W B;  4M7G A;  1V2R T;  1NES E;  4CH2 B;  3TPI Z;  3UAI C;  4CH8 B;  1FN8 A;  5C67 A;  4ABA A;  1I0R A;  3WWB A;  4IC6 A;  1EPT A;  1C5S A;  2D2D A;  4I8J A;  2QF4 A;  1DX5 M;  3A7Z A;  5AFY H;  1O2W A;  2ZFF H;  3LU9 B;  3R5P A;  1S6L A;  5EIY A;  2ZEB A;  3UY9 A;  2OIN A;  1QQ4 A;  3IWM A;  1XXO A;  1GJ6 A;  2HHZ A;  2RFK C;  1P12 E;  4HG6 A;  4Q4L A;  4DT4 A;  2H9E H;  1O2T A;  1CHO G;  3TIU A;  1CQQ A;  1AVX A;  2Z3D A;  2PTF A;  3S9B A;  1P06 A;  1LQE A;  1DST A;  1U6Q A;  2VGC C;  5IDK A;  5IK2 D;  2OC0 A;  4HMW A;  3E91 A;  1BMN H;  1AIX H;  3MI4 A;  2RDL A;  1C4U 2;  2R2W U;  2GP9 B;  5AVD A;  4U32 A;  1FNI A;  2V6N A;  4CR9 A;  1GMD G;  2Q6F A;  5JAB A;  3V4H A;  1HXF H;  1EPT C;  3UIR A;  1BIO A;  3KQB A;  4Q7Y A;  3F1S B;  3E4V A;  1W12 U;  1P9S A;  5CHB A;  5IYT A;  2VH6 A;  1NY2 2;  1SLV B;  2P16 A;  1O2G H;  1FLM A;  2UWO A;  1RIW B;  2VWO A;  1O2J A;  3SOR A;  3U1J B;  3LGI A;  1GBK A;  1AFE H;  1ZOM A;  3KHV A;  2OBQ A;  1QJ7 B;  4OS1 A;  3SWJ A;  1BA8 B;  3A80 A;  4H4F A;  4EST E;  1W3P A;  2XCN A;  3QWC H;  1LPK B;  3NK8 A;  1TNL A;  3UR9 A;  1TBQ H;  2BLQ A;  4D7G A;  2ZGX H;  1GHY H;  4GHQ A;  2RE7 A;  3QDZ B;  1UVP A;  3KQD A;  3SNB A;  1SOZ A;  2P8O C;  1YCP M;  1L0Z A;  1YBW A;  1P05 A;  1SG8 B;  1GDN A;  4OS4 A;  2GCH F;  1L1J A;  1CBW B;  9LPR A;  1DWB H;  1TE0 A;  9EST A;  1O3J A;  3SN8 A;  1WSS H;  2Q6D A;  1P11 E;  3MO6 A;  1W3C A;  2R9P A;  2VVC A;  4UON A;  1S5S A;  1UW7 A;  1BTZ A;  2ZHD A;  1O2I A;  1TMU H;  1G3B A;  3S9A A;  1WBG B;  4IRA A;  1GJ5 H;  3KYG A;  2TGT A;  4K60 A;  4O9V A;  1A5I A;  1QZ8 A;  2Z7F E;  1YPM H;  3DFL A;  2FOD A;  3GCT F;  3ODF A;  4HMT A;  4HMV A;  4YTA A;  1GHV H;  3R5L A;  3KL6 A;  2F3C E;  1XXF A;  2P59 A;  4LOY H;  2VVV A;  2G4T A;  1S81 A;  2Y5G A;  2OC8 A;  3ZVC A;  4UFE H;  4ACB A;  1HV7 A;  4B75 A;  1WTG H;  2RA3 A;  1DT2 A;  4HX6 A;  1YPH C;  1EP5 A;  3PWB A;  3AK5 A;  2PGQ B;  3RXE A;  2NWN A;  1P3E A;  2ZDL A;  1P2Q A;  2OC7 A;  2BDC A;  1MCT A;  1NRG A;  3SV7 A;  2HVY B;  2LEL A;  1T8N A;  2BVR H;  4KTU A;  3PRO A;  1VIT F;  4W64 A;  4FUD A;  2ZDM A;  1ZPZ A;  4MNY A;  3MH5 A;  1EB2 A;  1NFW A;  2WUB A;  4K8Y A;  3LH1 A;  2QAA A;  4Y0Z E;  5DP6 A;  5J4Q A;  5F03 A;  1C5U A;  1SHY A;  1FON A;  2FX4 A;  1AE5 A;  1BIT A;  3ZV8 A;  5DSF A;  1HLT H;  2ZQ2 A;  4FVD A;  5CHO A;  3M5O A;  3HKI B;  2ZFP H;  4BXS A;  2PUQ H;  1C1T A;  2GZ7 A;  1NFU A;  2GZ8 A;  2ZKS A;  1QBV H;  1V2J T;  4NCY A;  1AUT C;  1P03 A;  1ELC A;  4ABD A;  4XHY A;  3LGU A;  1D3D B;  1WLI A;  1RTL A;  1AZ8 A;  1NRP H;  1OSS A;  3F2H A;  1BTY A;  3P6Z B;  3H5C B;  3RM2 H;  3UWI A;  1A0L A;  4DII H;  2HGT H;  3ZZ4 A;  3PB1 E;  1AUJ A;  1TAB E;  1TQ7 B;  1ZJD A;  2UUF B;  1K9O E;  1F92 A;  2Y5H A;  1T9M A;  1BRU P;  1THP B;  2FIR H;  3RXG A;  2ODQ A;  4GCH G;  1BBR H;  1Y3W A;  1TMT H;  1C4Y 2;  3UB0 A;  1S6F A;  3V12 A;  4IGD A;  3RXP A;  1YY3 A;  1EZX C;  1H9I E;  1J16 A;  1BMF D;  3ATW A;  4GHT A;  2PTN A;  2QC2 A;  1YKT A;  5EXM A;  3URC A;  5C0T A;  2HTD A;  1KTT B;  2FP7 B;  2G81 E;  3HGP A;  1FJS A;  1YM0 A;  4XRN A;  3UPE A;  1D6R A;  3AVZ A;  3UR6 A;  1NT1 A;  3PMA B;  3U69 H;  5F8T A;  3Q3K A;  1PPC E;  1BTP A;  1OWI A;  5GND A;  2AER H;  2W7U A;  1HRT H;  5EQQ A;  1PPH E;  1BTX A;  1P8V C;  3UNR A;  2NU3 E;  1KIG H;  1TMB H;  2F91 A;  3TH2 H;  1TNK A;  1SQT A;  1H8I H;  2H5D A;  2Z9I A;  1UTO A;  3QK1 A;  1DXW A;  2AGI X;  1AMH A;  2A1D B;  5CE1 A;  3VYA A;  1W7X H;  3MQK C;  3RXT A;  2CXV A;  3E3T A;  1KXD A;  3SNC A;  5C5O A;  1C5W B;  4AB8 A;  1ESA A;  5EOK A;  2J97 A;  1A3E H;  1EAU A;  3WW7 A;  4F48 B;  4KGA A;  1GVL A;  4IN2 A;  1FQ3 A;  1XUJ A;  2Z9G A;  1GCD A;  2BVX H;  3R3G B;  3PM3 A;  1GJ7 B;  1T32 A;  3CEN A;  1FIW A;  4Q63 A;  1DUA A;  1F0S A;  2WYJ A;  3A8C A;  4IC5 A;  4WXV A;  3BTG E;  1DNL A;  1LVY A;  4FOU C;  4Y71 A;  1ABI H;  1AXJ A;  1AFQ C;  2J9N A;  3ELA H;  1QA0 A;  2ZTY A;  2J2U A;  4CBN A;  1K1N A;  1NRQ H;  2KFW A;  1SGN E;  4TV4 A;  4BTU B;  3T2N A;  4FU8 A;  4FUI A;  1K28 D;  1SL3 A;  3GDU A;  2ZGB H;  2NR4 A;  2HQ7 A;  1DM4 B;  1UCY E;  1QRX A;  1G36 A;  3FZD A;  4IMZ A;  1ZTJ A;  1QBO A;  1GJC B;  4Y7A A;  3RC5 A;  1NTP A;  4J2Y B;  1RZ0 A;  2G5V A;  4NFE A;  2OP9 A;  4NA8 A;  2Z94 A;  2BDB A;  4NIY A;  3I29 A;  1AZZ A;  3ZOH A;  4F49 A;  1EB1 H;  5HM2 A;  1XKB C;  3R5W A;  2HLD D;  7GCH G;  1S82 A;  1LTO A;  2ZPR A;  4B76 A;  2CJI A;  1L1G A;  4ABJ A;  4CRB A;  1O0D H;  4WWY A;  4XD7 D;  3NFW A;  1AB9 B;  4HZH A;  4AGK A;  3VY2 A;  2R0L A;  1BB0 B;  5E0G A;  3K9X B;  1ETR H;  6CHA B;  1C1N A;  3BTM E;  2TPI Z;  2ZGJ A;  4MPV A;  1PYT D;  2GMT C;  4ZHL U;  2JKH A;  4FET A;  4UE7 H;  3B8J A;  2XWB I;  4Z1M D;  1KDQ A;  4DCD A;  1QRZ A;  4INK A;  1AWH B;  2J34 A;  1FY5 A;  4MNX A;  2W26 A;  2G51 A;  3RXI A;  3HGN A;  2CN0 H;  1P10 A;  3Q77 A;  1ABJ H;  5GCH F;  3M5N A;  1V3X A;  1EJM A;  2D1J A;  3SUD A;  2EI7 A;  3QLP H;  2F83 A;  1BTW A;  4OS7 A;  2HNT E;  2VIN A;  5HM9 A;  1G37 A;  4FUG A;  2C3S A;  2C8Y B;  1YP9 A;  2QF3 A;  2V3O H;  4JMY A;  1BOQ A;  1C1M A;  2C4F H;  4AZ2 B;  1A4W H;  1EX3 A;  1SHH B;  4J1Y A;  2UUY A;  4YZU A;  1IQM A;  4B73 A;  4WMF A;  3A89 A;  5GPI B;  3SU0 A;  3GCH C;  1MTN C;  3ZV9 A;  1O37 A;  4DJZ B;  3TJV A;  6LPR A;  4B74 A;  4ZH8 A;  5EJL A;  3RLW H;  2JH6 D;  3GY7 A;  4AYY B;  1EAT A;  2KCY A;  4MNW A;  4RKO B;  3GDS A;  1BMM H;  3AAU A;  1MH0 A;  4AX9 H;  3A82 A;  1V2V T;  3OSY A;  2TBS A;  1UTM A;  1DDJ A;  4OS2 A;  2KAI A;  2RDE A;  2BLO A;  2PUX B;  2OD3 B;  2OU5 A;  3H09 A;  1QTF A;  4Q80 A;  2SFA A;  4X8V H;  1MAX A;  1MBM A;  3P8G A;  4AB9 A;  4X8T H;  5C0U A;  3PO1 C;  5E2P A;  1JBU H;  1XUH A;  4NZQ A;  3TH4 H;  4X0W U;  3RXC A;  1MAY A;  1YCP H;  4ABI A;  3EGK H;  1KLT A;  2SNV A;  2ZU1 A;  1TX7 A;  1OWE A;  1N8O C;  2D38 A;  4D9Q A;  2ECU A;  2W7S A;  3A7W A;  2CHA C;  1W0Z U;  1MMJ N;  1CGI E;  1GI3 A;  4X6N A;  4Q2K A;  3TGK E;  1RD3 B;  3B9F H;  1VGC C;  3M5M A;  4ASU D;  1OHH D;  3VFE A;  2A4Q A;  2GX4 A;  1Q3X A;  2AS9 A;  4K3J A;  2F9P A;  4B2C A;  2ASF A;  1DSU A;  2WIN I;  3M7Q A;  3S69 A;  3STI A;  1GI1 A;  1H4W A;  3OX7 U;  4ABF A;  3KID U;  1GJ4 H;  3LGV A;  1GI5 A;  1ZYO A;  3FN8 A;  1Y3V A;  1NRR H;  1P3C A;  3VB7 A;  3DNH A;  5JB9 S;  3Q00 A;  4D9R A;  2EST E;  3W1E A;  1E0F D;  2ZCH P;  1O5E H;  3QX5 H;  1VJA U;  3PYH A;  1H8D H;  1DPO A;  1C9T A;  3TVJ B;  2OXS A;  2SGP E;  2PGB B;  2JH0 D;  3DHK H;  2F4L A;  4YBN A;  1P2I A;  3LGT A;  1TGT A;  1CI0 A;  2EI6 A;  2A4G A;  3URD A;  1LVB A;  1HBT H;  2QGR A;  1P2K A;  3DCL A;  3OAA D;  1E35 B;  3A7V A;  3LON A;  1F0U A;  2A7H A;  1V2L T;  1MTW A;  2F43 B;  1DLK B;  2Y80 A;  2QN5 T;  1W7G H;  2TGA A;  3SQH E;  1EZS C;  3PTB A;  4K8B A;  1HJ9 A;  2ZDN A;  2RG3 A;  3MTY A;  1D3Q B;  4ASH A;  4TPI Z;  4K1E A;  4FUF A;  3BG8 A;  4MG3 A;  1DVA H;  1UTL M;  1HAX B;  3DMB A;  5C2Z A;  2WPL S;  2GUJ A;  2YMS C;  2R3Y A;  3I78 A;  1SGF G;  5DP3 A;  2NU2 E;  3QTO H;  2HPP H;  2ZHF H;  1AD8 H;  1JRT A;  1GG6 C;  3F9F A;  4Y8Y A;  3URE A;  2VVU A;  3JZ1 B;  1H8E D;  2AMQ A;  1YPK H;  1HJA C;  1VCP A;  3BA3 A;  3KQE A;  4RSP A;  1L2E A;  2AIP A;  1B5G H;  3SI4 H;  1KYN A;  3VB4 A;  1O5D H;  2FI4 E;  3EAJ A;  1W3O A;  2QE7 D;  3F9G A;  3A87 A;  3QGJ A;  1MCV A;  1V2T T;  3VPK A;  2JDI D;  2A45 B;  1C2H A;  1C1V H;  4CRG A;  1Y8T A;  3LJO A;  3FVF B;  2P93 A;  5EGM A;  1XMN B;  2CK3 D;  2OL5 A;  2FOF A;  2PW8 H;  5HGG A;  3VEQ B;  4BAH B;  4BNR A;  1Z6E A;  2FOC A;  3MO9 A;  2A7C A;  5FCR A;  2QA9 E;  1C2L A;  1TAL A;  2GCT B;  5CDF E;  1BTH H;  2C8Z B;  2J98 B;  4KTC A;  1YCP K;  1TA6 A;  1SQA A;  3E1X B;  1W14 U;  1Z7K A;  3BTQ E;  4BAO B;  4A6L A;  1WQV H;  2ZGH A;  1BRA A;  2QCY A;  1OWJ A;  1ANE A;  2Y6T A;  3TIT A;  4Z85 A;  1CE5 A;  5DPA A;  2WPJ S;  2OC1 A;  4ABG A;  1W8B H;  3UWJ H;  1ZRB A;  4BAQ B;  3BTE E;  3ZOC A;  4MQA A;  3GY8 A;  3TGJ E;  1O3M A;  1ELB A;  3SHA H;  1LVM A;  1FY3 A;  1EJN A;  5EXL A;  2LNC A;  3RU4 D;  1SVP A;  2F9U A;  1PPF E;  2Z9K A;  4X8S H;  4XDE A;  5DJ7 A;  5B6O A;  2TGD A;  4RI0 A;  1MUE B;  3ZVB A;  1K22 H;  2UUK B;  2ZNK H;  2A32 A;  1GBB A;  4B2A A;  1EOL A;  3GOV B;  1TGB A;  3F0P A;  1TGS Z;  1GWA A;  1T4U H;  4JYT A;  1OWD A;  5H4I B;  1UO6 A;  1ZTK A;  2GDE H;  2STA E;  1LPG B;  4AFU A;  1ZHM A;  2WPM S;  2L6O A;  6GCH F;  1TRY A;  1VCW A;  2O9Q A;  1CO7 E;  2ZF0 H;  1CT2 E;  3OY5 U;  4BAN B;  4TWW A;  1SFI A;  1J8A A;  5F8X A;  2EEK A;  3KQC A;  5K7R A;  2G55 A;  2BVS H;  2ILN A;  2GV6 A;  2JJ2 D;  1QNJ A;  3SV6 A;  4KKD A;  1RJX B;  2PLX A;  4Y7B A;  2ARZ A;  2Y81 A;  2ANM H;  5BPE A;  5EXN A;  5KED A;  1FPH H;  1MU8 B;  2UWP A;  2ZPS A;  3C27 B;  4MVN A;  2GCH G;  3BTD E;  1GJ9 B;  3D65 E;  1WCZ A;  3BSQ A;  3ITI A;  1O3G A;  1BJU A;  1O3I A;  2VU8 E;  5B6L A;  3CS0 A;  3BEU A;  2HRV A;  1QGF A;  3RXD A;  4ABH A;  1ZRK A;  4Z6A H;  3UOP A;  1HXE H;  1UVU H;  3BG4 C;  1OKX A;  1QY6 A;  2QIQ A;  1INC A;  1Y59 T;  1V2O T;  3FP7 E;  4AG1 A;  1IHS H;  2R2M B;  3MNB A;  3GY5 A;  1GBT A;  2FOA A;  5LH8 A;  3KN2 A;  1MZA A;  1J17 T;  1GGD C;  1C5L H;  1PPZ A;  3A8A A;  4X6O A;  3GCT G;  1OPH B;  1VCQ A;  1JOU B;  1TYN A;  5FX6 A;  3GCO A;  3ZOF A;  3UNQ A;  4FUC A;  3VG8 A;  3TGI E;  1IOE A;  3SUF A;  3W95 A;  1Y3Y A;  1O2M A;  1IQK A;  8LPR A;  2KCO A;  3RMN H;  2W6J D;  2AMD A;  3K65 B;  2D36 A;  1ELT A;  2AQ6 A;  1HAV B;  1OXG A;  2IOT A;  1CT0 E;  3RXL A;  2J4I A;  5EG4 A;  2FZZ A;  4NFF A;  3ODD A;  1VIT G;  1C2G A;  2PFE A;  2ED4 A;  3L6P A;  1H9L B;  3N99 A;  1LPZ B;  5C20 A;  1EZQ A;  3G01 A;  3LOX A;  5F8Z A;  3K6Y A;  1P02 A;  3UUZ A;  4O3U A;  2PV9 B;  1SGE E;  2PP6 A;  4QT8 C;  4XE4 A;  1GJ8 B;  3LDX H;  1LHD H;  2A5A A;  3PRB A;  1Y5B T;  2HTI A;  2O8W A;  1LQD B;  2V3H H;  1Y5A T;  2W3K A;  1SGI B;  1PQ7 A;  2ZCL P;  2FOG A;  1O31 A;  1G3C A;  3RDZ A;  2FPZ A;  1ZGI A;  3WY8 A;  2XBW A;  3BEF B;  2ZPQ A;  1P2J A;  1DLE A;  3PTN A;  3EYD A;  1BRC E;  4LK4 A;  2BY9 X;  3U1I B;  1C5V A;  1XVM A;  2PKS B;  1PQA A;  1AU8 A;  4XSK U;  2VNT A;  3VY5 A;  2J38 A;  3BTH E;  1RRK A;  3O8R A;  2IN2 A;  2J95 A;  1NS3 A;  1AN1 E;  3A84 A;  2ZEC A;  3PV4 A;  1QCP A;  3ZZ8 A;  1RIW C;  1PPG E;  4WH8 A;  1C1U H;  2HLC A;  5JPM H;  1EUF A;  5FPT A;  3LC3 A;  2GGV B;  1RTK A;  4FXG H;  1NO9 H;  5JDU B;  3EAA A;  3P70 B;  5EOD A;  3TK6 A;  4ZKY A;  4JK6 A;  1MD7 A;  4CRA A;  2BZA A;  3AAV A;  3RU4 E;  3M37 A;  3R0F A;  3F2G A;  3SJI A;  1SGP E;  3QGN B;  1SLU B;  3RLY H;  1CU1 A;  4GAW A;  2V35 A;  3SNA A;  1SPJ A;  2NU1 E;  5A0C A;  1E34 B;  1ORF A;  1C9P A;  3RC4 A;  1G32 B;  3V0X A;  3RXS A;  1O34 A;  4SGA E;  4D76 A;  3SU1 A;  2VBC A;  2SGA A;  5GDS H;  2ZI2 H;  1PPE E;  3BN9 A;  2A4O A;  4PRO A;  5DO4 H;  1GVK B;  4ZRO A;  2Y5F A;  4LZ1 H;  1N1L A;  5FL7 D;  3TJU A;  1V2Q T;  1FIZ A;  4FU7 A;  1HIA A;  5A0B A;  2BX4 A;  4RKJ B;  5F53 A;  4ZKN U;  1AFQ B;  1TX6 A;  1UCY K;  2I6Q A;  5C94 A;  2GV7 A;  1D3T B;  3S7K B;  1Y12 A;  4TY7 A;  2ZFR H;  2O8L A;  3OYP A;  1E1R D;  1ZJK A;  4UD9 H;  1KSN A;  2F9V A;  2BY5 X;  1S0R A;  2QXJ A;  1RFE A;  2D26 C;  3VB5 A;  1D4P B;  1GMC F;  1CT4 E;  3EA9 A;  2FX6 A;  1E1Q D;  2AMP A;  4F07 A;  4B1T A;  1P9U A;  4UEH H;  1SGC A;  5T3H A;  3LT3 A;  2H9T H;  2ZFQ H;  4YLU A;  1KTS B;  2KX4 A;  3T28 A;  1HGT H;  1NBM D;  2BD2 A;  5LPE A;  1FY1 A;  3KEE A;  4O97 A;  3BF6 H;  2KM0 A;  3AW0 A;  3HY8 A;  5CHA C;  1OYT H;  2D37 A;  1C5X B;  3VGC B;  1B0E A;  4NIW A;  3AWH A;  3FP8 E;  4HMX A;  3M3S A;  2FI3 E;  3ZVF A;  2ZZU H;  8GCH G;  1A3B H;  1GVZ A;  4DY7 B;  5CMX H;  1MD8 A;  4K2Y A; 
#chains in the Genus database with same CATH homology
 3KYF A;  5BNC A;  4XHY A;  3U34 A;  3FGE A;  1WLI A;  3VY5 A;  4RT1 A;  3RH7 A;  2ARZ A;  4RT0 A;  4HMU A;  3SWJ A;  2RDE A;  3BA3 A;  1W3P A;  2HQ9 A;  2NR4 A;  2HQ7 A;  2OU5 A;  3A20 A;  3PFT A;  5KED A;  5EJZ A;  1RZ0 A;  1T9M A;  1W3O A;  2RE7 A;  3DSG A;  4P00 A;  5CHE C;  3ZOH A;  4YWN A;  1YLN A;  1WGB A;  3CNR A;  3ZOD A;  3B5M A;  3R5W A;  1WV4 A;  4XJ2 A;  3F7E A;  3ZOG A;  1G78 A;  4P02 A;  2R0X A;  3R5R A;  2D38 A;  4ZKY A;  2ECU A;  1VL7 A;  2HTD A;  2I51 A;  3U0I A;  4I86 A;  2IML A;  1YWU A;  3K86 A;  2A2J A;  2OL5 A;  3K87 A;  3ZOE A;  5EJ1 A;  4XRN A;  2ECR A;  3R5Y A;  3A6R A;  2E83 A;  2QEA A;  3NFW A;  1G79 A;  3A6Q A;  3VY2 A;  2X1J A;  3AMF A;  1G76 A;  3CP3 A;  4QVB A;  2ASF A;  1I0S A;  3KYG A;  4IRA A;  2D5M A;  3R5Z A;  3ZOF A;  1EJE A;  5ESC A;  3H96 A;  1WLK A;  1W9A A;  1JNW A;  3DNH A;  4HMT A;  4HMV A;  4HMS A;  1I0R A;  3BPK A;  2GJG A;  2L74 A;  2D36 A;  3CB0 A;  3FKH A;  3R5L A;  4Z85 A;  5KGO A;  1W3Q A;  2AQ6 A;  3DB0 A;  3R5P A;  5EIY A;  1W3R A;  3ZOC A;  3VYA A;  2X1K A;  1XXO A;  1YOA A;  2HHZ A;  4N7R C;  1Y30 A;  4HG6 A;  4R82 A;  2FUR A;  4HX6 A;  3TGV A;  2VPA A;  2ED4 A;  4YBN A;  2FG9 A;  1CI0 A;  1RZ1 A;  1XHN A;  1RFE A;  2Q9K A;  3GAS A;  2PTF A;  1NRG A;  4F07 A;  5KEC A;  4F48 B;  4HMW A;  2R6V A;  2QCK A;  1G77 A;  2HTI A;  3U5W A;  3BNK A;  3K88 A;  1TY9 A;  5JAB A;  1USC A;  3HY8 A;  2D37 A;  3EC6 A;  5EJL A;  3HMZ A;  3E4V A;  5CHO A;  2I02 A;  4Y9I A;  1DNL A;  3AWH A;  2IG6 A;  4HMX A;  3U35 A;  4L82 A;  3DMB A;  4FOU C;  2IAB A;  1AXJ A;  2FHQ A;  1USF A;  3IN6 A;  1FLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...