3KYGA

Crystal structure of vca0042 (l135r) complexed with c-di-gmp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
SKTVSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQRRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein VCA0042
publication title Structure of PP4397 Reveals the Molecular Basis for Different c-di-GMP Binding Modes by Pilz Domain Proteins.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Unknown function
total genus 39
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 3kygA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3kygA02
1G76A 1T9MA 2R6VA 1XHNA 1W3PA 3ZOHA 2ECUA 1RZ1A 3HMZA 4HMSA 1I0RA 3ZOFA 3VYAA 4XJ2A 4F07A 2I51A 1CI0A 4P02A 3A6QA 2HTIA 2ED4A 5EJZA 3HY8A 2GJGA 1YLNA 1WLKA 4L82A 4HG6A 3KYFA 1WLIA 3E4VA 4HMWA 2HHZA 2Q9KA 3RH7A 3PFTA 3CB0A 3VY2A 3KYGA 3DB0A 2NR4A 2D37A 3DSGA 1FLMA 2AQ6A 5BNCA 4RT0A 2X1KA 1JNWA 5CHOA 3DMBA 1Y30A 3ZOGA 3EC6A 3ZODA 2VPAA 2X1JA 3U34A 5KGOA 4IRAA 3GASA 3A20A 2FG9A 2HQ9A 3BA3A 2PTFA 1RFEA 1WV4A 2FHQA 3ZOEA 3BPKA 2OL5A 3FGEA 5EJ1A 1DNLA 4YBNA 3U35A 3CNRA 4P00A 4HMUA 5JABA 1VL7A 2RE7A 3NFWA 1YWUA 2D5MA 4FOUC 4RT1A 1TY9A 4HMTA 4ZKYA 1XXOA 1YOAA 3K87A 4QVBA 2IG6A 3IN6A 3TGVA 2IABA 2L74A 2HQ7A 3CP3A 3R5WA 3F7EA 3SWJA 3DNHA 2ARZA 2QCKA 2OU5A 2D38A 1USFA 4Y9IA 1AXJA 2ASFA 1EJEA 1W3RA 4HX6A 1W3QA 1W9AA 4HMVA 3U0IA 1I0SA 2RDEA 3K86A 5KEDA 4HMXA 3U5WA 5EIYA 1G79A 4I86A 2I02A 3ZOCA 3AMFA 2E83A 3VY5A 3K88A 1G78A 1USCA 1W3OA 4F48B 2R0XA 2A2JA 1NRGA 3A6RA 5ESCA 2FURA 2D36A 4XHYA 2QEAA 3R5ZA 5EJLA 1RZ0A 4Z85A 2HTDA 3R5RA 4N7RC 1WGBA 4XRNA 3BNKA 3R5YA 3AWHA 3R5LA 4R82A 3B5MA 5CHEC 2ECRA 3FKHA 2IMLA 4YWNA 5KECA 3R5PA 1G77A 3H96A
chains in the Genus database with same CATH superfamily
3FP6E 4K3JA 2QCYA 3LKWA 1D4PB 1LKBA 1FAXA 3LGUA 1ZTJA 3N7OA 2KAIA 4F07A 2XCNA 1O2IA 5B6LA 2SGDE 2ZPRA 4UHVA 2WV4A 4GCHG 1O3HA 2D2DA 2OINA 2QXHA 2GCHG 4L82A 2VWOA 2CHAC 2OC1A 4FETA 1S82A 4CREA 2ZHWH 5C5NA 1C5QA 2XYAA 1ZHPA 1C5PA 4YTAA 1BA8B 1SR5C 4TY6A 2D37A 2UWLA 2BHGA 4JZFH 3H7TA 4E7NA 1CVWH 1BRAA 1GVKB 1TMTH 4CR9A 3SNEA 1Y3XA 3SUGA 2PGQB 2ZU2A 4ISLA 4FVDA 3ATWA 1A3BH 1E79D 4WVPE 1BBRE 1NRPH 3DFJA 4YM9A 3AVZA 3UWIA 1ELVA 1IHSH 3FANA 5BRRE 1JIRA 2QE7D 3OU0A 3DSOA 1Z1IA 1AFQC 2HNTF 1FQ3A 3R3GB 2PTFA 1XVOA 1RFEA 4Y8ZA 3MQKC 3A7TA 3MH5A 1AHTH 3SQHE 2ZHDA 4ZAEA 1G9IE 2BY6X 1GCDA 3ENSB 2BXUH 3HKIB 3NUMA 1GL1A 4QVBA 5LH8A 1C2EA 3U1IB 3S0NA 1KXAA 1TNLA 3MOCA 1O2TA 5DSFA 1C4V2 2W26A 3U98H 1EKBB 1KDQB 3EA9A 4UDWH 4KP0A 4FUCA 1YC0A 4Q7YA 5L30H 1O5EH 1MQ5A 1HXEH 1YCPM 2BDCA 5I46H 2TPIZ 1N1LA 3UFAA 1O2VA 4MQAA 2QA9E 1EFRD 1QB9A 5EQRA 4GHTA 1O36A 4MPVA 1SQRA 5KEDA 3A81A 4NFFA 2OQUA 1DICA 2SGPE 3GYLB 4Y76A 4NIYA 1QB1A 3ZZCA 1H9LB 3LOXA 3ATLA 4O97A 2D36A 1ANDA 1T4UH 1C1PA 4Z85A 5A09A 1FDPA 4E06H 2AFQB 1SHHB 1TWXB 1ID5H 2BZAA 1P03A 4OS4A 3ATMA 1ACBE 4YXWD 3Q3KA 1PPZA 1LPKB 2K4QA 1GHAF 3UTUH 2V3HH 1TA2A 1SLVB 1PQ7A 2B9LA 1ELTA 2P94A 2Z9JA 1UTPA 2YMSD 1BTHH 2IJD1 4GAWA 1YLNA 1TBRH 3P6ZB 1TX6A 1GBAA 1VJ9U 3PTNA 2NU2E 1P01A 5FX5A 2FOMB 3UNQA 2J92A 1LO6A 2PSXA 2Z9LA 1LTOA 3PRBA 3URCA 4BTUB 1SC8U 2ODQA 3EE0B 6CHAC 2F43B 3RP2A 2WYGA 3DUXH 4Y8YA 2ESTE 1C1MA 2BLWA 2GV7A 3OY6U 1DY9A 1NTPA 2H9EH 5FBEA 3EDXB 3TK5A 1F2SE 1LQDB 1G3CA 3FFGA 2JKHA 3P70B 3GCTF 3OAAD 1Y12A 1GDQA 1MH0A 2ZFRH 1GJ8B 1OS8A 1V2RT 1T8MA 3QTVH 2OL5A 3MU8A 1FLEE 2BOHB 1P9SA 1QR3E 4IMZA 1H9IE 5HKKD 4YBNA 1NM6A 4YLUA 1NRRH 1S0RA 2A1DB 1SI5H 3SBKA 2OCVB 2D5MA 4TY7A 2SGEE 2FODA 1TMUH 3UY9A 3V7TA 1DE7H 3RXLA 2AGGX 1O3FA 2OK5A 2WZQA 2ZCKP 3CP3A 2ZO3H 5A0BA 3LU9B 3SNCA 2PKSB 3UUZA 1DOJA 1D9IA 1GI4A 3QTOH 5IDKA 2KFWA 5A2MH 4ISNA 2OU5A 1UK4A 3PV2A 4OGXA 3ZVDA 1LVOA 1EAWA 3LGIA 1GBHA 3M7UA 2F83A 1VCQA 5DPAA 1CSOE 1MZDA 5F8ZA 8KME2 4FUDA 2VIVA 2YMSB 2SGAA 1Z6EA 3U8RH 2JH5D 3ZOCA 1JMOH 1TGTA 3A83A 2W7SA 1FPCH 1OP2A 1UK3A 3RC5A 3PMHB 1K1MA 5HXFA 3QGNB 1CGIE 1MTSA 2BY5X 1AWHB 3BNKA 1TOMH 1W0KD 7ESTE 2A4QA 1GDNA 4JZEH 1AVGH 1PPCE 3A7ZA 2GCTB 2AHME 1GI9B 1ETRH 1S83A 1O2SA 3H09A 2Q1JA 1BZXE 1CO7E 1LCYA 3BTQE 1QIXB 1TQ0B 1C2IA 3KHVA 5F8XA 3RXUA 1EB1H 3RXQA 3UQOA 1HUTH 1RTLA 4XSKU 3SJIA 3ZZ3A 4ABAA 2PKSC 4A1TA 1QL9A 3LGVA 1DVAH 2A2QH 2FPZA 3PFTA 2GZ7A 4AYVB 3SJ9A 2VWMA 3A88A 1Z7KA 4YO9A 1FN6A 2FOAA 4D9QA 3SU3A 5EQSA 4U32A 4AOQA 4A6LA 1UVOA 2J34A 3W94A 5ETXA 1AWFH 3RC4A 2ZNKH 1OXGA 5LPRA 1XKAC 5EU8A 3RDZA 2J98B 1GBTA 3BG4B 5KGOA 2GVFA 5L2ZH 1GMCF 3DCLA 6GCHG 1QGFA 4Q4LA 1EZXC 2WHXA 4ABEA 2GD4B 2PW8H 5CHAC 3ZYEA 3GY7A 1GJ4H 2VVCA 4CRDA 3RXRA 2CF8H 1KY9A 3KQBA 1THRH 1EXFA 2ZGBH 4IW4E 3BTKE 4JZIA 1HAIH 1TNHA 3P8NA 2F9VA 4ZKYA 2JH6D 1GJDB 2B7DH 2TBSA 2IABA 1TNKA 2QF3A 2BD2A 3QX5H 3RU4D 4AZ2B 4DT7B 3RXVA 2VGCB 1DANH 2STAE 1P2IA 4Y9IA 3A7YA 1BBRK 1GPZA 1HIAA 2GTBA 1KLIH 4I31A 1YLDA 2STBE 3RMMH 4WY3A 1H8IH 1QNJA 2RA3A 3SO3A 3KL6A 2V3MA 1V2MT 2GGVB 4B2CA 3BG4C 3MU4A 3GY4A 1TNJA 2ZFSA 3F6UH 3BEFB 2AGEX 1TYNA 5ESCA 2WSSD 3E0NB 2H9TH 3LJOA 4XHYA 3SYJA 1O3IA 3R5ZA 2H2ZA 1P8VC 1Y5AT 3VFEA 1V2WT 3N7DA 2XWBI 1CHGA 1Z71A 4AFZA 1A5GH 3W1EA 3R5LA 4R82A 2J5UA 2IMLA 1Y59T 1MCVA 1ZMJA 3BTDE 1WCZA 4TPYA 1L1JA 1TAWA 3RXSA 2HALA 1O37A 2BDAA 2KX4A 4CRAA 1C1WH 4ZHMU 2PFEA 4B6FA 1DDJA 2R3YA 3A6QA 1Q31A 1VKYA 3UR9A 2ZCLP 3ELAH 1ZPBA 5JBAS 2JDID 4CR5A 1GBLA 1O5AB 2AYWA 1E35B 2ZDAH 2AIPA 2M5TA 2OBQA 1CHOG 3MTYA 3V13A 3LONA 4ZMAH 1WXRA 4VGCC 3PWCA 1EZQA 3CB0A 2JETC 5C5OA 1K9OE 2TGTA 2FIRH 1O31A 1BBRH 4FUGA 2ZGXH 1O3MA 4B74A 1Z8RA 1O2YA 5EQQA 4BAQB 1D6RA 1FI8A 1XXFA 3EC6A 2FOHA 1QBNA 2ZFQH 1OWHA 1DFPA 5FPYA 2Q6DA 3IWMA 3VB5A 1P9UA 1MTWA 4XFQA 5JB9S 4GLYA 5A8XA 2A4RA 4D7GA 4GPGA 4H6SB 2R0LA 3RXMA 3TJNA 3PLPA 1V2VT 1C1QA 2BY7X 2RCEA 3RUOA 2BXTH 1RRKA 1ZSLA 1EB2A 1GCTB 1QCPA 4E05H 3SORA 1GBMA 4GHQA 4X2XA 2PTNA 2IJOB 1EAXA 3UOPA 3H5CB 2Y5GA 2KR7A 3EQ0H 2WPMS 3ZVGA 1SMFE 1BRUP 2W6ID 1E36B 1HAVB 1ZPZA 1TMBH 3QN7A 3ZZ8A 3F2FA 4X2VA 5E8EH 4IC5A 1W9AA 1ETTH 1P3CA 3FO8D 2Y7ZA 4Q63A 1O2ZA 2ZEBA 1NFXA 4X6MA 2BOKA 1AUJA 3AMFA 2C3SA 9LPRA 5C17A 4TWWA 4MPXA 1USCA 1MUEB 2GMTB 2I6QA 2FS8A 1C2DA 2ZDKA 3MH4A 1C4Y2 4FU7A 4MNXA 4J2YB 3LC3A 1OWDA 1G2MA 2BZ6H 1Y3UA 1P11E 3B5MA 2FI5E 1FXYA 1FONA 2PP6A 1K1LA 4X8TH 5GDSH 4I8HA 1T8OA 2R6VA 1J17T 1W3PA 1WAYB 7KMEH 1AO5A 1VR1H 1ZSJA 4HMSA 1C2JA 4Y0ZE 1GJBB 5I25A 1BTUA 1P09A 1HJ8A 1LQEA 1F0UA 2I51A 1UK2A 1CA0C 2J9NA 2M2AA 2QIQA 1GHXH 1C5OH 2I6SA 1WLKA 4CRGA 2G5VA 5DN6D 1C5LH 1FIWA 4TV4A 3GY5A 1IOEA 3ODFA 1ELBA 2A5IA 1SSXA 1V2ST 4BOHA 2QF4A 1W3CA 3L6PA 4LZ4B 1T7CA 3FZDA 5HYOA 1P06A 2GDEH 1ESTA 2FI4E 4JYTA 5HMAA 1GHAG 2BM2A 2ZHQH 4ASUD 7GCHF 1E34B 2P8OB 2XC0A 3RXJA 2R0KA 3N7EA 4INLA 4MNYA 4A1VA 1BOQA 7LPRA 5L2YH 5C0UA 3ZZDA 5EODA 4Y10E 3GDVA 3RXGA 3RXFA 2CJIA 2CMYA 2KCYA 5FAHA 1GJ6A 1GDUA 1EP5A 4K69A 1Q2WA 2V6NA 3GCHB 3MU1A 1NC6A 1Y3YA 2TGAA 3T29A 4AGJA 1AQ7A 3ODDA 3NRLA 1C9PA 1MD7A 1D3TB 1J15A 1ZPCA 2ZTZA 1EJAA 1O5FH 3PV4A 1GGDB 1PPEE 3PLBA 3PTBA 1E0FD 1LHDH 1O3BA 1TALA 1XUFA 1HAHH 1V6DA 1TGBA 1YOAA 2UWPA 3GCTG 1K1JA 1TA6A 1TPOA 2C93B 4X8SH 1WV7H 1PPHE 2XTTB 1TBZH 4UONA 5C1XA 1F5KU 4H42U 3T26A 3RMLH 1YP9A 2ARZA 2QN5T 2XCFA 4IGDA 4UFEH 2O8LA 3SNBA 4MPWA 2EI6A 2JJ1D 1WOFA 3Q3XA 3QZRA 4DG4A 4B76A 1P05A 1W3RA 3SN8A 4YOJA 3GYMA 2RDEA 3SU5A 2FX6A 1A46H 1GI7B 1KIGH 3ZZ6A 3KCGH 2O8TA 1AB9C 1AMHA 4IBLH 5JB8S 3M61U 3RXCA 1BDAA 1FN8A 2BQ6B 2AGIX 3KQCA 2ZWLH 3SU6A 2KZ4A 2CF9H 1NN6A 5A8YA 3VGCC 3F68H 1C2MA 5H4IB 2FTMA 2O9QA 3HATH 1GGDC 3HGPA 4JZDH 3SJKA 3HGNA 4ABIA 1T9MA 2A7HA 1W0YH 1S5SA 2ECUA 2TIOA 1EZSC 4D76A 4X6NA 3MO6A 2THFB 1QY6A 4P02A 5FPSA 2HTIA 3M5LA 2ZZUH 3DA9B 1HCGA 3BV9B 1CBWB 1EATA 4ABHA 3FZZA 2A4OA 3KYFA 3SJ8A 1O33A 1ELDE 3V3MA 3RH7A 4YESB 1ZOMA 3W95A 4NA8A 1C1SA 1ZGIA 1FLMA 5BNCA 3TJVA 4AG1A 1SQOA 1TPSA 2SFAA 1LPGB 4OS5A 3EAAA 5C94A 4AFQA 1GBBA 3A84A 1OPHB 1FJSA 1GJ7B 1ORFA 2ZDMA 1QB6A 3TLOA 1GMDF 4W64A 2ZTYA 5AVDA 4MNWA 4TPIZ 1BB0B 2VIPA 4JCNA 2FESH 4TWYA 1FUJA 1C1OA 1MBMA 1QQUA 5C0TA 1P2QA 1ELFA 3FN8A 5EGMA 1WDIA 3C1KA 1HAOH 2F3CE 3RU4T 2OD3B 2GZ9A 3K9XB 1YLCA 3FVFB 1WTGH 3MYWA 3U28C 2QYIA 1GBFA 1N6XA 2EY4C 3K87A 2KCAA 2P5ZX 1NRNH 1GHZA 3TGVA 2RFKC 2HWLB 3D23A 1WQVH 3SWJA 1GHBG 1P2NA 4NG9H 1SLUB 1O2NA 1AXJA 1VITF 2ZFPH 1W11U 1GMHF 1I0SA 3IG6B 2Z6BD 1COWD 2ZPSA 1V2OT 3DFLA 3ZVCA 3OEED 1KXDA 4ISIH 2ZCHP 2G5NA 4IN1A 1S6LA 1J9CH 2G8TA 3SU0A 4ESTE 3A8DA 2Y81A 3E8LA 1W3OA 4ZKSU 1RIWB 2HNTC 1G2LA 1RTKA 2EQNA 1DPOA 1B5GH 4MDSA 1EAIA 4MPUA 3WW7A 1SGPE 3AWHA 2C4FH 3RM0H 3H96A 1LPZB 2W5EA 1HBTH 2KM0A 2Z9GA 1Z8IB 3BEIB 4YLQH 1I0RA 2C8YB 4H4FA 1LHFH 1EJMA 1ZTKA 2HNTE 4AG2A 2OTVA 4I8GA 1O32A 2VH0A 1C2KA 1O2RA 3F9HA 3A8AA 3SQEE 3M5NA 1PYTC 3L3TA 1C2GA 1NESE 3D49H 4WWYA 1K1PA 3DT0H 1XUJA 1Y3WA 1LHGH 5J4SA 2PV9B 2Q9KA 1IQNA 2W7UA 2BVRH 1V2QT 4OM9A 1H4WA 5HIZA 8ESTE 2P95A 1QJ7B 4X8UH 2AQ6A 2J97A 3OE7D 3V4HA 4MLFB 4ZXXH 3EAJA 3ZZAA 5EG4A 2W3IA 1EQ9A 3AW0A 1A61H 1NBME 1V2LT 2QGRA 4X0WU 1HGTH 2PLXA 4LXBH 2V7QD 1FAKH 1UMAH 5EOKA 4GUXA 4O3UA 4DCDA 4HZHA 5FXLA 4Z6AH 3TU7H 5E0JA 2XW9A 1C9TA 2YNBA 3Q00A 2JH0D 3ZZ9A 1HRTH 2FM2A 4WMEA 4ZHLU 3E0PB 4P00A 1FPHH 3TGKE 1TRMA 2XXLA 1ZRKA 2FOBA 4XDEA 5CMXH 1P3EA 4RT1A 2D8WA 2ZDNA 1D6WA 2P3UB 4BAHB 2H1UA 2XBVA 2Q6FA 4WXVA 5DP3A 1MKXH 1GJAB 2SGQE 1QQ4A 3SU4A 1Y5BT 2K1QA 4B71A 4BTTB 2OLGA 3F7EA 3QWCH 1V2KT 1P0SH 4NSVA 1SOZA 1YPMH 2WYJA 3PO1B 2BD3A 1CQQA 2WPHS 3MMGA 3U69H 3UAIC 4Y79A 2FEQH 1SL3A 2BDHA 4DOQA 3RLWH 3LIWA 1O3LA 4HMXA 1HAXB 1O2OA 2GX4A 3A86A 2QF5A 3IITA 1C5MD 1QA0A 2HPPH 1G78A 1TGSZ 1RZ0A 4XBCA 1O3NA 1Q3XA 4OS1A 4X2YA 3Q76A 1GBKA 3ZVEA 1VCPA 1GI5A 1G3DA 1S6FA 2VIOA 1XHNA 2BQWB 1SBWA 5DP9A 4HTCH 3ZOFA 1ANEA 1YBWA 2H6MA 3LH3A 5HM9A 2G4UA 2O8UA 1IQFA 3F0PA 5T6GA 1O2PA 3SZEA 4U01A 4Y7BA 2FZZA 3SOSA 1B0FA 1O5GH 4J1YA 4R8TB 5K0HA 1WLIA 3QDZB 2XWAA 5JYIA 3PO1C 3Q77A 3DB0A 2FO9A 5DK1A 4QT8C 4B73A 3TJOA 1EJNA 1IQLA 1F5LA 4WMFA 5FL7D 3PLKA 3BF6H 1C4U2 3MNBA 2PKAB 2WV9A 2LP6A 2Y6TA 3V0XA 1AZ8A 1Z6JH 2AMQA 3T25A 2EI8A 1BTZA 3UPEA 1YCPK 1C5RA 1Z8GA 1OWKA 3UOUA 1TX7A 5E0GA 1SKYE 4X8VH 1C5SA 4FU9A 2ZI2H 5EW2H 5GWZA 3MFJA 1O3GA 5A0AE 1LMWB 2GT7A 1E38B 2P3TB 4CH2B 4HMUA 5GCHF 4YT7H 1GBIA 1CGJE 1QRZA 3A7VA 2YMSC 4UE7H 1GI8B 1GWAA 4HMTA 1XM1A 4Z1MD 3GICB 3K2UA 5FCRA 4AGKA 1GG6B 2ZHEH 4GCHF 1C5YB 2V3OH 5C1UA 2JIZD 2J94A 1C5XB 4DJZB 1MTUA 2GZ8A 1MAXA 2ZG0H 2A7JA 2FOCA 2L1TA 2P16A 1BJUA 1JBUH 4TYDA 1BMFD 1SGEE 1KTSB 1KDQA 4Y11E 2TRMA 1UW7A 2GCTC 1IQIA 2ZP0H 1W3QA 1SG8B 4BTIB 1YF4A 3U0IA 1BTXA 1RJXB 3SNAA 2QF0A 4ZKNU 1O2UA 5A8ZA 5TJXA 2HVYB 5F53A 3TNTA 2GP9B 5DGJA 3K88A 5GJ4B 1HV7A 4FUBA 2R0XA 1NRGA 1YCPH 3UQVA 2HGTH 3HK6B 2J4IA 4N7RC 1WGBA 2EEKA 4ZUHA 3TK9A 4DURA 2FI3E 1CT0E 1G77A 3O8CA 1GI1A 3VB3A 1BUIA 2H9HA 1IQHA 3A7WA 2ALVA 1C2FA 3CENA 1FZZA 1QRXA 4NGAH 4SGBE 1P2KA 1GVZA 1XKBC 1GG6C 3N99A 1ANBA 1W0ZU 2K0QA 2BD7A 3FP8E 5DP8A 4PROA 1GBCA 2XBWA 5AHGH 1NFYA 1OWEA 2GDDA 2CXVA 4LK4A 5FX6A 1OWJA 1RGQA 2VIDA 3KYGA 3SV9A 2AEIH 1ABIH 3K65B 2ZHFH 1BCUH 3RXDA 4DT4A 5JBCS 1RTFB 3SI4H 3VXEH 1FY5A 2JJ2D 2RDLA 2XNDD 2YOLA 4BANB 1JWTA 1V2JT 8GCHG 3D62A 1C5WB 1XUIA 3DSPA 3OSYA 2A45B 2Z3CA 3PMAB 1KXFA 1JXPA 2ZU3A 4MTBA 2UWOA 1W13U 2FTLE 3PM3A 3VG8A 3U34A 2BYAX 1RXPA 2BQ7B 1OYTH 3BIUH 2VGCC 1N8OB 3A87A 2ANKH 3T2NA 3ZV8A 4JYVH 2J2UA 1BT7A 2ZTXA 3RM2H 1CE5A 3Q3YA 4NZLA 1SVPA 2Z94A 1FX0B 2FS9A 5L6NH 2Y5HA 1AIXH 1XXDA 3EA7A 3PYHA 4U2WA 3RXEA 3FP7E 1SLXB 2GV6A 3E90B 3BIVH 4OS6A 3A89A 1AKSB 1AUTC 2WPKS 4ABBA 1JRTA 2B0FA 4WJG2 4K8YA 3P95A 2BVSH 1EPTB 1KLTA 1UHBB 3QO6A 3P17H 5ABWA 3SUDA 2F9BH 3I78A 1PQ5A 4FUIA 1MTNB 2QAAA 3SGAE 1Y8TA 1KSNA 3F9FA 4CRFA 3F9EA 4ACAA 3AAUA 1O2KA 4X6PA 3NWUA 2G00A 4Q80A 4NA9H 3BTFE 1FY3A 1GL0E 2IN2A 4WXIA 2A5KA 1WQSA 3ZVAA 1YGCH 4D9RA 9ESTA 3P8GA 1CA8B 3LDXH 3T27A 3TH3H 1THPB 2HTDA 1ETSH 1HLTH 3AK5A 1L1GA 4NIXA 1OP8A 1OHHD 4YT6H 4AB9A 1L1NA 1SGDE 3PROA 4FUHA 3R5PA 3LJJA 4HGCA 2GKVE 1CT4E 1BITA 3MO9A 4K1SA 4F4OC 2ZFFH 2QC2A 1QBOA 1VITH 2BLQA 4WMDA 2Z9IA 1HPGA 3UNSA 1A3EH 5EJZA 3SUEA 1KYNA 3LT3A 5AFZH 2P59A 1O3JA 4HMWA 2HHZA 2OQ5A 1O39A 6LPRA 1O2MA 2YNAA 1KXBA 1ZZZA 1NROH 3KF2A 2NU0E 4NA7A 3GDUA 2PGBB 4B2AA 1Y30A 1K21H 2QV1A 3ITIA 1GCTC 1SGYE 4MG3A 3RU4E 4I8KA 4RN6A 1CT2E 3MNCA 4H6TA 4HI3A 1X7AC 5DO4H 3GY8A 2BMGB 5DP5A 3TNSA 1UTMA 3SGBE 3A20A 2C8WB 4CBNA 4XBDA 3TH2H 3CS0A 4ABJA 4ZHAA 2J98A 2PSYA 2ZF0H 3GDSA 1P12E 2NU1E 1FY1A 1T32A 1DNLA 3T5FH 1EOJA 1Y5UT 1TOCB 4X1QU 3R0FA 3RLYH 1YWUA 3S7KB 1T4VH 1C1TA 1WTHD 5IYTA 1F7ZA 1GHWH 4NIVA 4MNVA 2ZKSA 2GMTC 2XRCA 2BD5A 2ZDVH 4X6OA 3SI3H 2OC0A 1F0SA 3R5WA 1W7XH 2BTCE 1TABE 1LVBA 2QCKA 2AH4X 2WPLS 3ZIAD 1J14A 4NSYA 5K7RA 1PQAA 2F9UA 2UUFB 2PUXB 3EGKH 2CGAA 1G37A 3AASA 2VBCA 5F6MA 4HMVA 4O9VA 3SUFA 1UVSH 3U5WA 2J95A 4ZROA 1XUHA 1SFQB 1A5HA 2QXIA 3F9GA 2BVXH 3NZIA 1HJ9A 1BMMH 3KQ5A 1BMNH 1PQ8A 1ELCA 2FOEA 4TT3D 1O3AA 1SHYA 2HVXA 4INHA 1TB6H 2FURA 2V0BA 2AMPA 2QEAA 5EJLA 4AB8A 1H9HE 6GCHF 3OY5U 5EXMA 3PV5A 2ECRA 5C3NA 1G3EA 2HLDD 1TPAE 2F9OA 1O2LA 1KTTB 1W14U 1DLKB 1W2KH 2P8OC 3V12A 3NXPA 3ZOHA 1GI0A 1V2TT 2ILNA 2Q6GA 1RFNA 1IQEA 2XNIA 1O34A 2R3UA 3OTJE 1G30B 4KGAA 2ZC9H 4UFDH 3WWFA 2FOGA 1A5IA 1ZGVA 3NKKA 3PRDA 1NU7B 1HAZB 1P2OA 1H8ED 1ESAA 3LPRA 1ZSKA 3GCHC 1AGJA 2VIWA 5DP6A 1FIZA 1BTWA 1SLWB 1GJ9B 3SZNA 3VY2A 3U1JB 2NR4A 4U30A 4IN2A 1BRBE 1YPLH 5BPEA 2X1KA 3TGIE 4I8LA 3EE7A 1AE8H 2ANYA 1CU1A 1MU6B 1ZYOA 2QXJA 5GIBA 1AVWA 1C5NH 1OWIA 1KLJH 1AN1E 1PFXC 4B75A 1JOUB 2ZFTA 2C8ZB 2VPAA 2ZGHA 1NS3A 1K1OA 2AERH 1Z1JA 2VWNA 3P92A 1TNIA 3OFND 2CHAB 3BA3A 2SNVA 3VB4A 5CDFE 1O5BB 3FKSD 4Y6DA 1DS2E 1EUFA 3F0OA 1ELGA 1UTJA 4K2YA 2C90B 4Y71A 3TH4H 2OBOA 3JZ2B 1C5TA 1XX9A 5T6DA 4ABGA 2Y7XA 1JIMA 4RI0A 1MQ6A 2GT8A 4HKHA 4RSPA 3TK6A 4I32A 2ZU4A 4Q7XA 4RKOB 3S9AA 2BLOA 4CBOA 1AFQB 3VXFH 3BG8A 3RXTA 4FXGH 1CHOF 1O3OA 1TLDA 1S85A 2OC7A 1USFA 3O8BA 3RMNH 4XE4A 1DM4B 8LPRA 2PR3A 5TCCA 4Y0YE 1H8HD 3A7XA 1MCTA 2VH6A 4XD7D 1TPPA 1HAVA 1K1NA 2ODYB 1UTOA 2VVUA 1TGCA 1IAUA 3LGWA 3MU5A 2A4GA 2E83A 2VIQA 1IQMA 1GMCG 3E91A 1CBWC 1TE0A 3TIUA 4ASHA 1BHXB 2SGFE 2BY8X 2FXRA 4XBBA 3UB0A 2H5CA 4K1TA 1LDTT 4ZH8A 1ELEE 1S6HA 3JZ1B 4OS2A 4A1XA 3UWJH 1H8DH 3PWBA 1XMNB 1MD8A 1DXPA 3O8RA 4HX6A 1P2MA 3U9AH 3B8JA 2G55A 1XUGA 1ZHRA 2FX4A 2G81E 3TITA 1G3BA 1KMHB 4DGJA 2ZQ2A 1FMGA 1NRQH 4INKA 2D1JA 1ZRBA 3ZZ7A 4WH6A 4BAMB 2ED4A 1DSUA 3RXKA 4LOYH 2BDGA 1LKAA 2FLRH 1IQKA 1GI3A 5JDUB 1BHXF 2XBYA 1BIOA 2IPHA 1T8LA 1JRSA 3VPKA 3RXOA 4AFSA 3KQDA 3MH6A 2FYQA 3NCLA 3BSQA 4KTCA 4FU8A 3SGQE 3M5OA 1YM0A 3DMBA 2ZU1A 3MU0A 1MKXK 5EPYA 4ISHH 5LPFA 2X1JA 3RXIA 4IRAA 3A8BA 1TRNA 3A85A 1WV4A 1DXWA 3ZOEA 1FY4A 1BTYA 2B5TB 1AD8H 3P8OA 4IMQA 4ZKOU 3QGJA 2FP7B 6CHAB 1UJ1A 4XOJA 2BDYA 3QLPH 2BD8A 3ZV9A 1QA7A 2VWLA 4FOUC 2A2XH 1TY9A 2WPIS 4DIHH 1ELAA 1FY8E 1EOLA 1NFWA 1O2GH 3BTEE 1OKXA 1RIWC 3UR6A 1J8AA 2FMJA 4IC6A 3MNXA 2NWNA 1HIAB 1HXFH 3GY2A 1D3QB 2ZQ1A 2A7CA 2D38A 1O2JA 2ASFA 3SNDA 1DLEA 5JBBS 1SGFA 3RXBA 4ZKRU 3HPTB 4ISOA 2Y5FA 2ANMH 2HRVA 3ZZ4A 3K86A 2ANWA 2KCOA 3SU1A 3I77A 4B1TA 3S9BA 2WPJS 4KTUA 1TBQH 3A6RA 5JBTA 3E1XB 1YPKH 2Y80A 1ZTLA 2R2MB 5EXLA 3SV8A 4Q7ZA 1TGNA 1Z8JB 4XRNA 5E0HA 1RS0A 3MH7A 1O3KA 1QL7A 3AAVA 3ZVFA 1DWBH 1KXCA 3HE1A 1YYY1 5FPTA 4B2BA 1GI2A 2CN0H 1RZ1A 4KKDA 4Q2KA 1MZAA 2UUKB 3ATKA 3KN2A 6ESTA 1OP0A 1O3CA 1EZUC 1DX5M 4NWKA 5G4BA 4ZXYH 3M7TA 4D8NA 3E16B 3HY8A 1THSH 3M3VA 1L2EA 1NZQH 5C20A 5T1VA 3E4VA 2O8MA 5ESBA 1O3DA 2ZU5A 1O2XA 1K0HA 3LGTA 3PMJA 2HPQH 4ZCNA 5EW1H 2OUAA 1DUEA 3M7QA 5ESTE 4WH8A 5CHOA 1C1RA 2XC4A 2BX4A 1UCYK 1UVTH 3FAOA 3ZYDA 2FOFA 3U8TH 1OYQA 4I7YH 1UTQA 1MMJN 3ZOGA 2VVVA 2WV5A 2KCPA 3F2HA 3GY6A 1L0ZA 2ASUB 1O2WA 2FWWA 4M7GA 2ZGCA 2FG9A 4IS5A 1MTVA 1O0DH 2V35A 5FHTA 2FHQA 1T8NA 3K6YA 2L6OA 1YPJH 4X1RU 3GCOA 3LH1A 1KXEA 2RG3A 1GHYH 2BY9X 2WPDD 1W8BH 2ZIQH 1VL7A 4K5ZA 2DE9A 3M3SA 1A0JA 5DG6A 2W6JD 1D3DB 4YZUA 2IG6A 1QZ8A 3NK8A 1NT1A 3PMBB 3SW2B 2L74A 5CHBA 2HQ7A 1HNEE 4F49A 3RXAA 5A0CA 1YPHC 2CV3A 4X1SU 3SV6A 2HLCA 3S7HB 3S69A 4AFUA 5CHAB 1P02A 1EJEA 7GCHG 1ZJDA 2EI7A 3T28A 1W10U 1QFKH 1IHTH 1UCYH 3DD2H 4DVAU 3KNXA 1E1RD 1YPHE 1WUNH 2WINI 4K8BA 2G4TA 1O30A 2EA3A 4A7IB 1SGNE 3KEEA 4FUFA 1DUAA 1TQ7B 2GCHF 1P57B 1C1NA 4BXSA 3R5YA 4JMYA 3STIA 4THNH 4YWNA 1G36A 1VGCB 5KECA 1B0EA 4RKJB 2A31A 2HOBA 1A7SA 3BTWE 2Z3DA 2VNTA 4ABFA 1IQJA 4O3TA 4X1PU 1DWCH 2IOTA 1WBGB 4XJ2A 1SGCA 1UVUH 4LZ1H 3PB1E 1CI0A 4Y8XA 5AFYH 2BB4A 3LC5A 2O8WA 4NCYA 5T3HA 1SGIB 3NPSA 1W0JD 1A0LA 1BTPA 1WSSH 2AIQA 3MWIU 3H7OA 2PWXA 4UD9H 1MBQA 4F55A 1ZMLA 4K1EA 4M9FA 3B23B 1FV9A 1LVYA 1QL8A 1GHBF 1O2QA 3OTPA 2ZGJA 4E7RG 3MO3A 5F8TA 5GXPA 1LHEH 1SFIA 1T31A 3BTHE 3GOVB 1L4DA 1GBDA 1PPBH 5HM2A 3SV7A 1BJVA 2BDBA 4HFPB 2LPRA 5LGOA 2AMDA 3GASA 4WF8A 3O8DA 1V2NT 1ZMNA 1LHCH 1VZQH 1ARCA 4UEHH 2FDAA 1NU9A 4ABDA 2A32A 1SGFG 2QY0B 2XBXA 4VGCB 4BXWA 1F0RA 1VGCC 1RD3B 2JETB 4DY7B 2B8OH 3EA8A 3G01A 2VJ1A 1TRYA 2P3FH 4X1NU 3VEQB 4AN7A 4MVNA 1HAYB 4FUEA 1OOKB 2G51A 1C2HA 3KIDU 1C5ZB 5DP4A 1EP6A 2AS9A 5AF9H 4TSFD 2R2WU 5C2ZA 4OS7A 4NFEA 2BD9A 1O5DH 2DUCA 2ZECA 4CHAB 2OXSA 1S0QA 1V3XA 1AU8A 1ABJH 1K22H 2C8XB 5GPIB 5IK2D 1AZZA 1NPMA 4CRCA 1DWDH 1P04A 4NWLA 4JZ1A 3UIRA 2I02A 3K6ZA 1TNGA 4KTSA 1S81A 1GMDG 1BMLA 2F91A 3ESTA 3ATIA 2ULLA 2K8IA 1O2HA 2FYRA 4AORA 3R5RA 3CS7A 3KGPA 3TPIZ 1K2I1 3A82A 5B6OA 1GBEA 1HFDA 3MNSA 2ZPQA 4A92A 3OYPA 1WU1A 1EAUA 5EPNA 2CK3D 3GS9A 1SGTA 2G52A 4AYYB 1QRWA 4DW2U 1N6YA 1VJAU 3VYAA 3BTME 4YOIA 2GJGA 1K28D 2TGDA 4HG6A 1IQGA 1DWEH 3BTTE 3SV2H 5GNDA 4CHAC 1HAPH 1PJPA 1H1BA 1N8OC 5E2OA 1DSTA 3WWBA 1VITG 1A4WH 1B7XB 3DSGA 4NIWA 5E2PA 3VB7A 1GMHG 2KAIB 2PHBA 3M35A 4UFFH 4B6EA 2PTCE 3BEUA 3HK3B 1DT2A 4CH8B 1GI6A 1UTNA 5DP7A 3SHAH 3WY8A 3SJOA 1ZHMA 4OGYA 2PUQH 4GSOA 1C2LA 1CA0B 5TCAA 3ZODA 1EX3A 3F2GA 1YPGH 1SPJA 1SQAA 1E37B 1TIOA 4Z0KA 3F1SB 4I8JA 1V2PT 3ZZBA 1ZR0A 2WUBA 2PKAA 1EPTC 1P2JA 3M36A 4NZQA 3S9CA 2HQ9A 1NRSH 3M37A 3RMOH 3BPKA 1A1RA 3F3BA 2BX3A 1EASA 3FGEA 1SGQE 5EJ1A 1MTNC 3URDA 3U35A 3CNRA 1W7GH 3U8OH 1C1VH 1FNIA 5JABA 2R9PA 4SGAE 2RE7A 1BMAA 1SGRE 3RXHA 3NFWA 1E1QD 2ZDLA 5HIYA 1UVPA 2J38A 3FOAA 1XXOA 2F9NA 1W12U 3IN6A 2FLBH 2D26C 1F92A 4A5TS 4FUJA 1HYLA 1HAGE 1C5UA 1HJAB 2XOKD 3A80A 3EYDA 3DNHA 5F03A 3M3TA 3L33A 3T62A 3TJUA 5C67A 2VU8E 2ALPA 1O35A 2DE8A 2NU4E 4CRBA 4R0IA 3SHCH 3BTGE 1PPGE 5LPEA 1P10A 1OX1A 1YY3A 3DHKH 3CP7A 4GVUA 1UO6A 3E3TA 2Z7FE 1AY6H 1F0TA 2LELA 5EXNA 1G32B 3GCNA 2VINA 3AW1A 2P93A 5DJ7A 4F48B 3RXPA 3QZQA 4JYUH 3OEHD 1AVXA 1INCA 2UUYA 5DKMA 1ESBA 5CHEC 4JK6A 3ZVBA 2XC5A 1QTFA 3FKHA 3OX7U 1GJ5H 1V2UT 5HGGA 1G76A 2VB0A 3P8FA 4AC9A 2NU3E 4JK5A 1HB0B 3HMZA 3UNRA 4BNRA 1AB9B 1QHRB 1S84A 2BLVA 1UTKA 5SGAE 1SB1H 1YKTA 5FBIA 1GBJA 1HJAC 1NO9H 3HKJB 3B9FH 1ARBA 1WYKA 3M5MA 1UCYE 2F4LA 3QUMP 1Y3VA 1AFEH 5FCKA 4MTKA 1L4ZA 3VGCB 1A0HB 1YPEH 3D65E 3LGYA 4Y7AA 1O5CB 4RT0A 2OP9A 2H5DA 1JNWA 1D3PB 4AX9H 1F5RA 1O3PB 4KELA 1TONA 3SU2A 1HDTH 2ZA5A 3STJA 4FVBA 2SNWA 2ODPA 1M9UA 1SQTA 2BD4A 1BRCE 2OC8A 4D7FA 3TVJB 1ZLRA 3GISB 1QURH 4BAKB 1DY8A 4UFGH 2IPQX 3I29A 4K60A 1OSSA 1TFXA 3TGJE 1MKWK 4O03A 1QBVH 1NY22 1GJCB 2LNCA 2WUCA 1GHVH 2TGPZ 3A8CA 2F9PA 2A5AA 1BQYA 1VCWA 3QK1A 1U6QA 3UREA 5PTPA 1A2CH 5C1YA 2GUJA 1ZJKA 2Y82A 1SOTA 1NBMD 2A0QB 1MABB 2RA0A 1QJ1B 1PPFE 2Z3EA 2Z9KA 3RC6A 1PYTD 4BAOB 2BDIA 5JPMH 1AI8H 2UUJB 1QJ6B 3KQEA 3MHWU 4I33A 3C27B 1AKSA 1CGHA 2W3KA 1ANCA 1EPTA 1UHBA 1UTLM 1O3EA 2EC9H 1DITH 1XVMA 3E6PH 8GCHF 5EIYA 1G79A 4I86A 4ACBA 1J16A 1MU8B 3ZZ5A 1TX8A 4YOGA 3GY3A 1C1UH 1O38A 3VY5A 3BN9A 1NFUA 1C5VA 2A2JA 5J4QA 4X2WA 3VB6A 2QXGA 1LVMA 1XUKA 1AE5A 3MI4A 1MAYA 5CE1A 5T6FA 1K1IA 4DIIH 1GVLA 5GCHG 1MKWH
chains in the Genus database with same CATH topology
1G76A 1T9MA 2R6VA 1XHNA 1W3PA 3ZOHA 2ECUA 1RZ1A 3HMZA 4HMSA 1I0RA 3ZOFA 3VYAA 4XJ2A 4F07A 2I51A 1CI0A 4P02A 3A6QA 2HTIA 2ED4A 5EJZA 3HY8A 2GJGA 1YLNA 1WLKA 4L82A 4HG6A 3KYFA 1WLIA 3E4VA 4HMWA 2HHZA 2Q9KA 3RH7A 3PFTA 3CB0A 3VY2A 3KYGA 3DB0A 2NR4A 2D37A 3DSGA 1FLMA 2AQ6A 5BNCA 4RT0A 2X1KA 1JNWA 5CHOA 3DMBA 1Y30A 3ZOGA 3EC6A 3ZODA 2VPAA 2X1JA 3U34A 5KGOA 4IRAA 3GASA 3A20A 2FG9A 2HQ9A 3BA3A 2PTFA 1RFEA 1WV4A 2FHQA 3ZOEA 3BPKA 2OL5A 3FGEA 5EJ1A 1DNLA 4YBNA 3U35A 3CNRA 4P00A 4HMUA 5JABA 1VL7A 2RE7A 3NFWA 1YWUA 2D5MA 4FOUC 4RT1A 1TY9A 4HMTA 4ZKYA 1XXOA 1YOAA 3K87A 4QVBA 2IG6A 3IN6A 3TGVA 2IABA 2L74A 2HQ7A 3CP3A 3R5WA 3F7EA 3SWJA 3DNHA 2ARZA 2QCKA 2OU5A 2D38A 1USFA 4Y9IA 1AXJA 2ASFA 1EJEA 1W3RA 4HX6A 1W3QA 1W9AA 4HMVA 3U0IA 1I0SA 2RDEA 3K86A 5KEDA 4HMXA 3U5WA 5EIYA 1G79A 4I86A 2I02A 3ZOCA 3AMFA 2E83A 3VY5A 3K88A 1G78A 1USCA 1W3OA 4F48B 2R0XA 2A2JA 1NRGA 3A6RA 5ESCA 2FURA 2D36A 4XHYA 2QEAA 3R5ZA 5EJLA 1RZ0A 4Z85A 2HTDA 3R5RA 4N7RC 1WGBA 4XRNA 3BNKA 3R5YA 3AWHA 3R5LA 4R82A 3B5MA 5CHEC 2ECRA 3FKHA 2IMLA 4YWNA 5KECA 3R5PA 1G77A 3H96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G76 A;  1T9M A;  2R6V A;  1XHN A;  1W3P A;  3ZOH A;  2ECU A;  1RZ1 A;  3HMZ A;  4HMS A;  1I0R A;  3ZOF A;  3VYA A;  4XJ2 A;  4F07 A;  2I51 A;  1CI0 A;  4P02 A;  3A6Q A;  2HTI A;  2ED4 A;  5EJZ A;  3HY8 A;  2GJG A;  1YLN A;  1WLK A;  4L82 A;  4HG6 A;  3KYF A;  1WLI A;  3E4V A;  4HMW A;  2HHZ A;  2Q9K A;  3RH7 A;  3PFT A;  3CB0 A;  3VY2 A;  3KYG A;  3DB0 A;  2NR4 A;  2D37 A;  3DSG A;  1FLM A;  2AQ6 A;  5BNC A;  4RT0 A;  2X1K A;  1JNW A;  5CHO A;  3DMB A;  1Y30 A;  3ZOG A;  3EC6 A;  3ZOD A;  2VPA A;  2X1J A;  3U34 A;  5KGO A;  4IRA A;  3GAS A;  3A20 A;  2FG9 A;  2HQ9 A;  3BA3 A;  2PTF A;  1RFE A;  1WV4 A;  2FHQ A;  3ZOE A;  3BPK A;  2OL5 A;  3FGE A;  5EJ1 A;  1DNL A;  4YBN A;  3U35 A;  3CNR A;  4P00 A;  4HMU A;  5JAB A;  1VL7 A;  2RE7 A;  3NFW A;  1YWU A;  2D5M A;  4FOU C;  4RT1 A;  1TY9 A;  4HMT A;  4ZKY A;  1XXO A;  1YOA A;  3K87 A;  4QVB A;  2IG6 A;  3IN6 A;  3TGV A;  2IAB A;  2L74 A;  2HQ7 A;  3CP3 A;  3R5W A;  3F7E A;  3SWJ A;  3DNH A;  2ARZ A;  2QCK A;  2OU5 A;  2D38 A;  1USF A;  4Y9I A;  1AXJ A;  2ASF A;  1EJE A;  1W3R A;  4HX6 A;  1W3Q A;  1W9A A;  4HMV A;  3U0I A;  1I0S A;  2RDE A;  3K86 A;  5KED A;  4HMX A;  3U5W A;  5EIY A;  1G79 A;  4I86 A;  2I02 A;  3ZOC A;  3AMF A;  2E83 A;  3VY5 A;  3K88 A;  1G78 A;  1USC A;  1W3O A;  4F48 B;  2R0X A;  2A2J A;  1NRG A;  3A6R A;  5ESC A;  2FUR A;  2D36 A;  4XHY A;  2QEA A;  3R5Z A;  5EJL A;  1RZ0 A;  4Z85 A;  2HTD A;  3R5R A;  4N7R C;  1WGB A;  4XRN A;  3BNK A;  3R5Y A;  3AWH A;  3R5L A;  4R82 A;  3B5M A;  5CHE C;  2ECR A;  3FKH A;  2IML A;  4YWN A;  5KEC A;  3R5P A;  1G77 A;  3H96 A; 
#chains in the Genus database with same CATH topology
 3FP6 E;  4K3J A;  2QCY A;  3LKW A;  1D4P B;  1LKB A;  1FAX A;  3LGU A;  1ZTJ A;  3N7O A;  2KAI A;  4F07 A;  2XCN A;  1O2I A;  5B6L A;  2SGD E;  2ZPR A;  4UHV A;  2WV4 A;  4GCH G;  1O3H A;  2D2D A;  2OIN A;  2QXH A;  2GCH G;  4L82 A;  2VWO A;  2CHA C;  2OC1 A;  4FET A;  1S82 A;  4CRE A;  2ZHW H;  5C5N A;  1C5Q A;  2XYA A;  1ZHP A;  1C5P A;  4YTA A;  1BA8 B;  1SR5 C;  4TY6 A;  2D37 A;  2UWL A;  2BHG A;  4JZF H;  3H7T A;  4E7N A;  1CVW H;  1BRA A;  1GVK B;  1TMT H;  4CR9 A;  3SNE A;  1Y3X A;  3SUG A;  2PGQ B;  2ZU2 A;  4ISL A;  4FVD A;  3ATW A;  1A3B H;  1E79 D;  4WVP E;  1BBR E;  1NRP H;  3DFJ A;  4YM9 A;  3AVZ A;  3UWI A;  1ELV A;  1IHS H;  3FAN A;  5BRR E;  1JIR A;  2QE7 D;  3OU0 A;  3DSO A;  1Z1I A;  1AFQ C;  2HNT F;  1FQ3 A;  3R3G B;  2PTF A;  1XVO A;  1RFE A;  4Y8Z A;  3MQK C;  3A7T A;  3MH5 A;  1AHT H;  3SQH E;  2ZHD A;  4ZAE A;  1G9I E;  2BY6 X;  1GCD A;  3ENS B;  2BXU H;  3HKI B;  3NUM A;  1GL1 A;  4QVB A;  5LH8 A;  1C2E A;  3U1I B;  3S0N A;  1KXA A;  1TNL A;  3MOC A;  1O2T A;  5DSF A;  1C4V 2;  2W26 A;  3U98 H;  1EKB B;  1KDQ B;  3EA9 A;  4UDW H;  4KP0 A;  4FUC A;  1YC0 A;  4Q7Y A;  5L30 H;  1O5E H;  1MQ5 A;  1HXE H;  1YCP M;  2BDC A;  5I46 H;  2TPI Z;  1N1L A;  3UFA A;  1O2V A;  4MQA A;  2QA9 E;  1EFR D;  1QB9 A;  5EQR A;  4GHT A;  1O36 A;  4MPV A;  1SQR A;  5KED A;  3A81 A;  4NFF A;  2OQU A;  1DIC A;  2SGP E;  3GYL B;  4Y76 A;  4NIY A;  1QB1 A;  3ZZC A;  1H9L B;  3LOX A;  3ATL A;  4O97 A;  2D36 A;  1AND A;  1T4U H;  1C1P A;  4Z85 A;  5A09 A;  1FDP A;  4E06 H;  2AFQ B;  1SHH B;  1TWX B;  1ID5 H;  2BZA A;  1P03 A;  4OS4 A;  3ATM A;  1ACB E;  4YXW D;  3Q3K A;  1PPZ A;  1LPK B;  2K4Q A;  1GHA F;  3UTU H;  2V3H H;  1TA2 A;  1SLV B;  1PQ7 A;  2B9L A;  1ELT A;  2P94 A;  2Z9J A;  1UTP A;  2YMS D;  1BTH H;  2IJD 1;  4GAW A;  1YLN A;  1TBR H;  3P6Z B;  1TX6 A;  1GBA A;  1VJ9 U;  3PTN A;  2NU2 E;  1P01 A;  5FX5 A;  2FOM B;  3UNQ A;  2J92 A;  1LO6 A;  2PSX A;  2Z9L A;  1LTO A;  3PRB A;  3URC A;  4BTU B;  1SC8 U;  2ODQ A;  3EE0 B;  6CHA C;  2F43 B;  3RP2 A;  2WYG A;  3DUX H;  4Y8Y A;  2EST E;  1C1M A;  2BLW A;  2GV7 A;  3OY6 U;  1DY9 A;  1NTP A;  2H9E H;  5FBE A;  3EDX B;  3TK5 A;  1F2S E;  1LQD B;  1G3C A;  3FFG A;  2JKH A;  3P70 B;  3GCT F;  3OAA D;  1Y12 A;  1GDQ A;  1MH0 A;  2ZFR H;  1GJ8 B;  1OS8 A;  1V2R T;  1T8M A;  3QTV H;  2OL5 A;  3MU8 A;  1FLE E;  2BOH B;  1P9S A;  1QR3 E;  4IMZ A;  1H9I E;  5HKK D;  4YBN A;  1NM6 A;  4YLU A;  1NRR H;  1S0R A;  2A1D B;  1SI5 H;  3SBK A;  2OCV B;  2D5M A;  4TY7 A;  2SGE E;  2FOD A;  1TMU H;  3UY9 A;  3V7T A;  1DE7 H;  3RXL A;  2AGG X;  1O3F A;  2OK5 A;  2WZQ A;  2ZCK P;  3CP3 A;  2ZO3 H;  5A0B A;  3LU9 B;  3SNC A;  2PKS B;  3UUZ A;  1DOJ A;  1D9I A;  1GI4 A;  3QTO H;  5IDK A;  2KFW A;  5A2M H;  4ISN A;  2OU5 A;  1UK4 A;  3PV2 A;  4OGX A;  3ZVD A;  1LVO A;  1EAW A;  3LGI A;  1GBH A;  3M7U A;  2F83 A;  1VCQ A;  5DPA A;  1CSO E;  1MZD A;  5F8Z A;  8KME 2;  4FUD A;  2VIV A;  2YMS B;  2SGA A;  1Z6E A;  3U8R H;  2JH5 D;  3ZOC A;  1JMO H;  1TGT A;  3A83 A;  2W7S A;  1FPC H;  1OP2 A;  1UK3 A;  3RC5 A;  3PMH B;  1K1M A;  5HXF A;  3QGN B;  1CGI E;  1MTS A;  2BY5 X;  1AWH B;  3BNK A;  1TOM H;  1W0K D;  7EST E;  2A4Q A;  1GDN A;  4JZE H;  1AVG H;  1PPC E;  3A7Z A;  2GCT B;  2AHM E;  1GI9 B;  1ETR H;  1S83 A;  1O2S A;  3H09 A;  2Q1J A;  1BZX E;  1CO7 E;  1LCY A;  3BTQ E;  1QIX B;  1TQ0 B;  1C2I A;  3KHV A;  5F8X A;  3RXU A;  1EB1 H;  3RXQ A;  3UQO A;  1HUT H;  1RTL A;  4XSK U;  3SJI A;  3ZZ3 A;  4ABA A;  2PKS C;  4A1T A;  1QL9 A;  3LGV A;  1DVA H;  2A2Q H;  2FPZ A;  3PFT A;  2GZ7 A;  4AYV B;  3SJ9 A;  2VWM A;  3A88 A;  1Z7K A;  4YO9 A;  1FN6 A;  2FOA A;  4D9Q A;  3SU3 A;  5EQS A;  4U32 A;  4AOQ A;  4A6L A;  1UVO A;  2J34 A;  3W94 A;  5ETX A;  1AWF H;  3RC4 A;  2ZNK H;  1OXG A;  5LPR A;  1XKA C;  5EU8 A;  3RDZ A;  2J98 B;  1GBT A;  3BG4 B;  5KGO A;  2GVF A;  5L2Z H;  1GMC F;  3DCL A;  6GCH G;  1QGF A;  4Q4L A;  1EZX C;  2WHX A;  4ABE A;  2GD4 B;  2PW8 H;  5CHA C;  3ZYE A;  3GY7 A;  1GJ4 H;  2VVC A;  4CRD A;  3RXR A;  2CF8 H;  1KY9 A;  3KQB A;  1THR H;  1EXF A;  2ZGB H;  4IW4 E;  3BTK E;  4JZI A;  1HAI H;  1TNH A;  3P8N A;  2F9V A;  4ZKY A;  2JH6 D;  1GJD B;  2B7D H;  2TBS A;  2IAB A;  1TNK A;  2QF3 A;  2BD2 A;  3QX5 H;  3RU4 D;  4AZ2 B;  4DT7 B;  3RXV A;  2VGC B;  1DAN H;  2STA E;  1P2I A;  4Y9I A;  3A7Y A;  1BBR K;  1GPZ A;  1HIA A;  2GTB A;  1KLI H;  4I31 A;  1YLD A;  2STB E;  3RMM H;  4WY3 A;  1H8I H;  1QNJ A;  2RA3 A;  3SO3 A;  3KL6 A;  2V3M A;  1V2M T;  2GGV B;  4B2C A;  3BG4 C;  3MU4 A;  3GY4 A;  1TNJ A;  2ZFS A;  3F6U H;  3BEF B;  2AGE X;  1TYN A;  5ESC A;  2WSS D;  3E0N B;  2H9T H;  3LJO A;  4XHY A;  3SYJ A;  1O3I A;  3R5Z A;  2H2Z A;  1P8V C;  1Y5A T;  3VFE A;  1V2W T;  3N7D A;  2XWB I;  1CHG A;  1Z71 A;  4AFZ A;  1A5G H;  3W1E A;  3R5L A;  4R82 A;  2J5U A;  2IML A;  1Y59 T;  1MCV A;  1ZMJ A;  3BTD E;  1WCZ A;  4TPY A;  1L1J A;  1TAW A;  3RXS A;  2HAL A;  1O37 A;  2BDA A;  2KX4 A;  4CRA A;  1C1W H;  4ZHM U;  2PFE A;  4B6F A;  1DDJ A;  2R3Y A;  3A6Q A;  1Q31 A;  1VKY A;  3UR9 A;  2ZCL P;  3ELA H;  1ZPB A;  5JBA S;  2JDI D;  4CR5 A;  1GBL A;  1O5A B;  2AYW A;  1E35 B;  2ZDA H;  2AIP A;  2M5T A;  2OBQ A;  1CHO G;  3MTY A;  3V13 A;  3LON A;  4ZMA H;  1WXR A;  4VGC C;  3PWC A;  1EZQ A;  3CB0 A;  2JET C;  5C5O A;  1K9O E;  2TGT A;  2FIR H;  1O31 A;  1BBR H;  4FUG A;  2ZGX H;  1O3M A;  4B74 A;  1Z8R A;  1O2Y A;  5EQQ A;  4BAQ B;  1D6R A;  1FI8 A;  1XXF A;  3EC6 A;  2FOH A;  1QBN A;  2ZFQ H;  1OWH A;  1DFP A;  5FPY A;  2Q6D A;  3IWM A;  3VB5 A;  1P9U A;  1MTW A;  4XFQ A;  5JB9 S;  4GLY A;  5A8X A;  2A4R A;  4D7G A;  4GPG A;  4H6S B;  2R0L A;  3RXM A;  3TJN A;  3PLP A;  1V2V T;  1C1Q A;  2BY7 X;  2RCE A;  3RUO A;  2BXT H;  1RRK A;  1ZSL A;  1EB2 A;  1GCT B;  1QCP A;  4E05 H;  3SOR A;  1GBM A;  4GHQ A;  4X2X A;  2PTN A;  2IJO B;  1EAX A;  3UOP A;  3H5C B;  2Y5G A;  2KR7 A;  3EQ0 H;  2WPM S;  3ZVG A;  1SMF E;  1BRU P;  2W6I D;  1E36 B;  1HAV B;  1ZPZ A;  1TMB H;  3QN7 A;  3ZZ8 A;  3F2F A;  4X2V A;  5E8E H;  4IC5 A;  1W9A A;  1ETT H;  1P3C A;  3FO8 D;  2Y7Z A;  4Q63 A;  1O2Z A;  2ZEB A;  1NFX A;  4X6M A;  2BOK A;  1AUJ A;  3AMF A;  2C3S A;  9LPR A;  5C17 A;  4TWW A;  4MPX A;  1USC A;  1MUE B;  2GMT B;  2I6Q A;  2FS8 A;  1C2D A;  2ZDK A;  3MH4 A;  1C4Y 2;  4FU7 A;  4MNX A;  4J2Y B;  3LC3 A;  1OWD A;  1G2M A;  2BZ6 H;  1Y3U A;  1P11 E;  3B5M A;  2FI5 E;  1FXY A;  1FON A;  2PP6 A;  1K1L A;  4X8T H;  5GDS H;  4I8H A;  1T8O A;  2R6V A;  1J17 T;  1W3P A;  1WAY B;  7KME H;  1AO5 A;  1VR1 H;  1ZSJ A;  4HMS A;  1C2J A;  4Y0Z E;  1GJB B;  5I25 A;  1BTU A;  1P09 A;  1HJ8 A;  1LQE A;  1F0U A;  2I51 A;  1UK2 A;  1CA0 C;  2J9N A;  2M2A A;  2QIQ A;  1GHX H;  1C5O H;  2I6S A;  1WLK A;  4CRG A;  2G5V A;  5DN6 D;  1C5L H;  1FIW A;  4TV4 A;  3GY5 A;  1IOE A;  3ODF A;  1ELB A;  2A5I A;  1SSX A;  1V2S T;  4BOH A;  2QF4 A;  1W3C A;  3L6P A;  4LZ4 B;  1T7C A;  3FZD A;  5HYO A;  1P06 A;  2GDE H;  1EST A;  2FI4 E;  4JYT A;  5HMA A;  1GHA G;  2BM2 A;  2ZHQ H;  4ASU D;  7GCH F;  1E34 B;  2P8O B;  2XC0 A;  3RXJ A;  2R0K A;  3N7E A;  4INL A;  4MNY A;  4A1V A;  1BOQ A;  7LPR A;  5L2Y H;  5C0U A;  3ZZD A;  5EOD A;  4Y10 E;  3GDV A;  3RXG A;  3RXF A;  2CJI A;  2CMY A;  2KCY A;  5FAH A;  1GJ6 A;  1GDU A;  1EP5 A;  4K69 A;  1Q2W A;  2V6N A;  3GCH B;  3MU1 A;  1NC6 A;  1Y3Y A;  2TGA A;  3T29 A;  4AGJ A;  1AQ7 A;  3ODD A;  3NRL A;  1C9P A;  1MD7 A;  1D3T B;  1J15 A;  1ZPC A;  2ZTZ A;  1EJA A;  1O5F H;  3PV4 A;  1GGD B;  1PPE E;  3PLB A;  3PTB A;  1E0F D;  1LHD H;  1O3B A;  1TAL A;  1XUF A;  1HAH H;  1V6D A;  1TGB A;  1YOA A;  2UWP A;  3GCT G;  1K1J A;  1TA6 A;  1TPO A;  2C93 B;  4X8S H;  1WV7 H;  1PPH E;  2XTT B;  1TBZ H;  4UON A;  5C1X A;  1F5K U;  4H42 U;  3T26 A;  3RML H;  1YP9 A;  2ARZ A;  2QN5 T;  2XCF A;  4IGD A;  4UFE H;  2O8L A;  3SNB A;  4MPW A;  2EI6 A;  2JJ1 D;  1WOF A;  3Q3X A;  3QZR A;  4DG4 A;  4B76 A;  1P05 A;  1W3R A;  3SN8 A;  4YOJ A;  3GYM A;  2RDE A;  3SU5 A;  2FX6 A;  1A46 H;  1GI7 B;  1KIG H;  3ZZ6 A;  3KCG H;  2O8T A;  1AB9 C;  1AMH A;  4IBL H;  5JB8 S;  3M61 U;  3RXC A;  1BDA A;  1FN8 A;  2BQ6 B;  2AGI X;  3KQC A;  2ZWL H;  3SU6 A;  2KZ4 A;  2CF9 H;  1NN6 A;  5A8Y A;  3VGC C;  3F68 H;  1C2M A;  5H4I B;  2FTM A;  2O9Q A;  3HAT H;  1GGD C;  3HGP A;  4JZD H;  3SJK A;  3HGN A;  4ABI A;  1T9M A;  2A7H A;  1W0Y H;  1S5S A;  2ECU A;  2TIO A;  1EZS C;  4D76 A;  4X6N A;  3MO6 A;  2THF B;  1QY6 A;  4P02 A;  5FPS A;  2HTI A;  3M5L A;  2ZZU H;  3DA9 B;  1HCG A;  3BV9 B;  1CBW B;  1EAT A;  4ABH A;  3FZZ A;  2A4O A;  3KYF A;  3SJ8 A;  1O33 A;  1ELD E;  3V3M A;  3RH7 A;  4YES B;  1ZOM A;  3W95 A;  4NA8 A;  1C1S A;  1ZGI A;  1FLM A;  5BNC A;  3TJV A;  4AG1 A;  1SQO A;  1TPS A;  2SFA A;  1LPG B;  4OS5 A;  3EAA A;  5C94 A;  4AFQ A;  1GBB A;  3A84 A;  1OPH B;  1FJS A;  1GJ7 B;  1ORF A;  2ZDM A;  1QB6 A;  3TLO A;  1GMD F;  4W64 A;  2ZTY A;  5AVD A;  4MNW A;  4TPI Z;  1BB0 B;  2VIP A;  4JCN A;  2FES H;  4TWY A;  1FUJ A;  1C1O A;  1MBM A;  1QQU A;  5C0T A;  1P2Q A;  1ELF A;  3FN8 A;  5EGM A;  1WDI A;  3C1K A;  1HAO H;  2F3C E;  3RU4 T;  2OD3 B;  2GZ9 A;  3K9X B;  1YLC A;  3FVF B;  1WTG H;  3MYW A;  3U28 C;  2QYI A;  1GBF A;  1N6X A;  2EY4 C;  3K87 A;  2KCA A;  2P5Z X;  1NRN H;  1GHZ A;  3TGV A;  2RFK C;  2HWL B;  3D23 A;  1WQV H;  3SWJ A;  1GHB G;  1P2N A;  4NG9 H;  1SLU B;  1O2N A;  1AXJ A;  1VIT F;  2ZFP H;  1W11 U;  1GMH F;  1I0S A;  3IG6 B;  2Z6B D;  1COW D;  2ZPS A;  1V2O T;  3DFL A;  3ZVC A;  3OEE D;  1KXD A;  4ISI H;  2ZCH P;  2G5N A;  4IN1 A;  1S6L A;  1J9C H;  2G8T A;  3SU0 A;  4EST E;  3A8D A;  2Y81 A;  3E8L A;  1W3O A;  4ZKS U;  1RIW B;  2HNT C;  1G2L A;  1RTK A;  2EQN A;  1DPO A;  1B5G H;  4MDS A;  1EAI A;  4MPU A;  3WW7 A;  1SGP E;  3AWH A;  2C4F H;  3RM0 H;  3H96 A;  1LPZ B;  2W5E A;  1HBT H;  2KM0 A;  2Z9G A;  1Z8I B;  3BEI B;  4YLQ H;  1I0R A;  2C8Y B;  4H4F A;  1LHF H;  1EJM A;  1ZTK A;  2HNT E;  4AG2 A;  2OTV A;  4I8G A;  1O32 A;  2VH0 A;  1C2K A;  1O2R A;  3F9H A;  3A8A A;  3SQE E;  3M5N A;  1PYT C;  3L3T A;  1C2G A;  1NES E;  3D49 H;  4WWY A;  1K1P A;  3DT0 H;  1XUJ A;  1Y3W A;  1LHG H;  5J4S A;  2PV9 B;  2Q9K A;  1IQN A;  2W7U A;  2BVR H;  1V2Q T;  4OM9 A;  1H4W A;  5HIZ A;  8EST E;  2P95 A;  1QJ7 B;  4X8U H;  2AQ6 A;  2J97 A;  3OE7 D;  3V4H A;  4MLF B;  4ZXX H;  3EAJ A;  3ZZA A;  5EG4 A;  2W3I A;  1EQ9 A;  3AW0 A;  1A61 H;  1NBM E;  1V2L T;  2QGR A;  4X0W U;  1HGT H;  2PLX A;  4LXB H;  2V7Q D;  1FAK H;  1UMA H;  5EOK A;  4GUX A;  4O3U A;  4DCD A;  4HZH A;  5FXL A;  4Z6A H;  3TU7 H;  5E0J A;  2XW9 A;  1C9T A;  2YNB A;  3Q00 A;  2JH0 D;  3ZZ9 A;  1HRT H;  2FM2 A;  4WME A;  4ZHL U;  3E0P B;  4P00 A;  1FPH H;  3TGK E;  1TRM A;  2XXL A;  1ZRK A;  2FOB A;  4XDE A;  5CMX H;  1P3E A;  4RT1 A;  2D8W A;  2ZDN A;  1D6W A;  2P3U B;  4BAH B;  2H1U A;  2XBV A;  2Q6F A;  4WXV A;  5DP3 A;  1MKX H;  1GJA B;  2SGQ E;  1QQ4 A;  3SU4 A;  1Y5B T;  2K1Q A;  4B71 A;  4BTT B;  2OLG A;  3F7E A;  3QWC H;  1V2K T;  1P0S H;  4NSV A;  1SOZ A;  1YPM H;  2WYJ A;  3PO1 B;  2BD3 A;  1CQQ A;  2WPH S;  3MMG A;  3U69 H;  3UAI C;  4Y79 A;  2FEQ H;  1SL3 A;  2BDH A;  4DOQ A;  3RLW H;  3LIW A;  1O3L A;  4HMX A;  1HAX B;  1O2O A;  2GX4 A;  3A86 A;  2QF5 A;  3IIT A;  1C5M D;  1QA0 A;  2HPP H;  1G78 A;  1TGS Z;  1RZ0 A;  4XBC A;  1O3N A;  1Q3X A;  4OS1 A;  4X2Y A;  3Q76 A;  1GBK A;  3ZVE A;  1VCP A;  1GI5 A;  1G3D A;  1S6F A;  2VIO A;  1XHN A;  2BQW B;  1SBW A;  5DP9 A;  4HTC H;  3ZOF A;  1ANE A;  1YBW A;  2H6M A;  3LH3 A;  5HM9 A;  2G4U A;  2O8U A;  1IQF A;  3F0P A;  5T6G A;  1O2P A;  3SZE A;  4U01 A;  4Y7B A;  2FZZ A;  3SOS A;  1B0F A;  1O5G H;  4J1Y A;  4R8T B;  5K0H A;  1WLI A;  3QDZ B;  2XWA A;  5JYI A;  3PO1 C;  3Q77 A;  3DB0 A;  2FO9 A;  5DK1 A;  4QT8 C;  4B73 A;  3TJO A;  1EJN A;  1IQL A;  1F5L A;  4WMF A;  5FL7 D;  3PLK A;  3BF6 H;  1C4U 2;  3MNB A;  2PKA B;  2WV9 A;  2LP6 A;  2Y6T A;  3V0X A;  1AZ8 A;  1Z6J H;  2AMQ A;  3T25 A;  2EI8 A;  1BTZ A;  3UPE A;  1YCP K;  1C5R A;  1Z8G A;  1OWK A;  3UOU A;  1TX7 A;  5E0G A;  1SKY E;  4X8V H;  1C5S A;  4FU9 A;  2ZI2 H;  5EW2 H;  5GWZ A;  3MFJ A;  1O3G A;  5A0A E;  1LMW B;  2GT7 A;  1E38 B;  2P3T B;  4CH2 B;  4HMU A;  5GCH F;  4YT7 H;  1GBI A;  1CGJ E;  1QRZ A;  3A7V A;  2YMS C;  4UE7 H;  1GI8 B;  1GWA A;  4HMT A;  1XM1 A;  4Z1M D;  3GIC B;  3K2U A;  5FCR A;  4AGK A;  1GG6 B;  2ZHE H;  4GCH F;  1C5Y B;  2V3O H;  5C1U A;  2JIZ D;  2J94 A;  1C5X B;  4DJZ B;  1MTU A;  2GZ8 A;  1MAX A;  2ZG0 H;  2A7J A;  2FOC A;  2L1T A;  2P16 A;  1BJU A;  1JBU H;  4TYD A;  1BMF D;  1SGE E;  1KTS B;  1KDQ A;  4Y11 E;  2TRM A;  1UW7 A;  2GCT C;  1IQI A;  2ZP0 H;  1W3Q A;  1SG8 B;  4BTI B;  1YF4 A;  3U0I A;  1BTX A;  1RJX B;  3SNA A;  2QF0 A;  4ZKN U;  1O2U A;  5A8Z A;  5TJX A;  2HVY B;  5F53 A;  3TNT A;  2GP9 B;  5DGJ A;  3K88 A;  5GJ4 B;  1HV7 A;  4FUB A;  2R0X A;  1NRG A;  1YCP H;  3UQV A;  2HGT H;  3HK6 B;  2J4I A;  4N7R C;  1WGB A;  2EEK A;  4ZUH A;  3TK9 A;  4DUR A;  2FI3 E;  1CT0 E;  1G77 A;  3O8C A;  1GI1 A;  3VB3 A;  1BUI A;  2H9H A;  1IQH A;  3A7W A;  2ALV A;  1C2F A;  3CEN A;  1FZZ A;  1QRX A;  4NGA H;  4SGB E;  1P2K A;  1GVZ A;  1XKB C;  1GG6 C;  3N99 A;  1ANB A;  1W0Z U;  2K0Q A;  2BD7 A;  3FP8 E;  5DP8 A;  4PRO A;  1GBC A;  2XBW A;  5AHG H;  1NFY A;  1OWE A;  2GDD A;  2CXV A;  4LK4 A;  5FX6 A;  1OWJ A;  1RGQ A;  2VID A;  3KYG A;  3SV9 A;  2AEI H;  1ABI H;  3K65 B;  2ZHF H;  1BCU H;  3RXD A;  4DT4 A;  5JBC S;  1RTF B;  3SI4 H;  3VXE H;  1FY5 A;  2JJ2 D;  2RDL A;  2XND D;  2YOL A;  4BAN B;  1JWT A;  1V2J T;  8GCH G;  3D62 A;  1C5W B;  1XUI A;  3DSP A;  3OSY A;  2A45 B;  2Z3C A;  3PMA B;  1KXF A;  1JXP A;  2ZU3 A;  4MTB A;  2UWO A;  1W13 U;  2FTL E;  3PM3 A;  3VG8 A;  3U34 A;  2BYA X;  1RXP A;  2BQ7 B;  1OYT H;  3BIU H;  2VGC C;  1N8O B;  3A87 A;  2ANK H;  3T2N A;  3ZV8 A;  4JYV H;  2J2U A;  1BT7 A;  2ZTX A;  3RM2 H;  1CE5 A;  3Q3Y A;  4NZL A;  1SVP A;  2Z94 A;  1FX0 B;  2FS9 A;  5L6N H;  2Y5H A;  1AIX H;  1XXD A;  3EA7 A;  3PYH A;  4U2W A;  3RXE A;  3FP7 E;  1SLX B;  2GV6 A;  3E90 B;  3BIV H;  4OS6 A;  3A89 A;  1AKS B;  1AUT C;  2WPK S;  4ABB A;  1JRT A;  2B0F A;  4WJG 2;  4K8Y A;  3P95 A;  2BVS H;  1EPT B;  1KLT A;  1UHB B;  3QO6 A;  3P17 H;  5ABW A;  3SUD A;  2F9B H;  3I78 A;  1PQ5 A;  4FUI A;  1MTN B;  2QAA A;  3SGA E;  1Y8T A;  1KSN A;  3F9F A;  4CRF A;  3F9E A;  4ACA A;  3AAU A;  1O2K A;  4X6P A;  3NWU A;  2G00 A;  4Q80 A;  4NA9 H;  3BTF E;  1FY3 A;  1GL0 E;  2IN2 A;  4WXI A;  2A5K A;  1WQS A;  3ZVA A;  1YGC H;  4D9R A;  9EST A;  3P8G A;  1CA8 B;  3LDX H;  3T27 A;  3TH3 H;  1THP B;  2HTD A;  1ETS H;  1HLT H;  3AK5 A;  1L1G A;  4NIX A;  1OP8 A;  1OHH D;  4YT6 H;  4AB9 A;  1L1N A;  1SGD E;  3PRO A;  4FUH A;  3R5P A;  3LJJ A;  4HGC A;  2GKV E;  1CT4 E;  1BIT A;  3MO9 A;  4K1S A;  4F4O C;  2ZFF H;  2QC2 A;  1QBO A;  1VIT H;  2BLQ A;  4WMD A;  2Z9I A;  1HPG A;  3UNS A;  1A3E H;  5EJZ A;  3SUE A;  1KYN A;  3LT3 A;  5AFZ H;  2P59 A;  1O3J A;  4HMW A;  2HHZ A;  2OQ5 A;  1O39 A;  6LPR A;  1O2M A;  2YNA A;  1KXB A;  1ZZZ A;  1NRO H;  3KF2 A;  2NU0 E;  4NA7 A;  3GDU A;  2PGB B;  4B2A A;  1Y30 A;  1K21 H;  2QV1 A;  3ITI A;  1GCT C;  1SGY E;  4MG3 A;  3RU4 E;  4I8K A;  4RN6 A;  1CT2 E;  3MNC A;  4H6T A;  4HI3 A;  1X7A C;  5DO4 H;  3GY8 A;  2BMG B;  5DP5 A;  3TNS A;  1UTM A;  3SGB E;  3A20 A;  2C8W B;  4CBN A;  4XBD A;  3TH2 H;  3CS0 A;  4ABJ A;  4ZHA A;  2J98 A;  2PSY A;  2ZF0 H;  3GDS A;  1P12 E;  2NU1 E;  1FY1 A;  1T32 A;  1DNL A;  3T5F H;  1EOJ A;  1Y5U T;  1TOC B;  4X1Q U;  3R0F A;  3RLY H;  1YWU A;  3S7K B;  1T4V H;  1C1T A;  1WTH D;  5IYT A;  1F7Z A;  1GHW H;  4NIV A;  4MNV A;  2ZKS A;  2GMT C;  2XRC A;  2BD5 A;  2ZDV H;  4X6O A;  3SI3 H;  2OC0 A;  1F0S A;  3R5W A;  1W7X H;  2BTC E;  1TAB E;  1LVB A;  2QCK A;  2AH4 X;  2WPL S;  3ZIA D;  1J14 A;  4NSY A;  5K7R A;  1PQA A;  2F9U A;  2UUF B;  2PUX B;  3EGK H;  2CGA A;  1G37 A;  3AAS A;  2VBC A;  5F6M A;  4HMV A;  4O9V A;  3SUF A;  1UVS H;  3U5W A;  2J95 A;  4ZRO A;  1XUH A;  1SFQ B;  1A5H A;  2QXI A;  3F9G A;  2BVX H;  3NZI A;  1HJ9 A;  1BMM H;  3KQ5 A;  1BMN H;  1PQ8 A;  1ELC A;  2FOE A;  4TT3 D;  1O3A A;  1SHY A;  2HVX A;  4INH A;  1TB6 H;  2FUR A;  2V0B A;  2AMP A;  2QEA A;  5EJL A;  4AB8 A;  1H9H E;  6GCH F;  3OY5 U;  5EXM A;  3PV5 A;  2ECR A;  5C3N A;  1G3E A;  2HLD D;  1TPA E;  2F9O A;  1O2L A;  1KTT B;  1W14 U;  1DLK B;  1W2K H;  2P8O C;  3V12 A;  3NXP A;  3ZOH A;  1GI0 A;  1V2T T;  2ILN A;  2Q6G A;  1RFN A;  1IQE A;  2XNI A;  1O34 A;  2R3U A;  3OTJ E;  1G30 B;  4KGA A;  2ZC9 H;  4UFD H;  3WWF A;  2FOG A;  1A5I A;  1ZGV A;  3NKK A;  3PRD A;  1NU7 B;  1HAZ B;  1P2O A;  1H8E D;  1ESA A;  3LPR A;  1ZSK A;  3GCH C;  1AGJ A;  2VIW A;  5DP6 A;  1FIZ A;  1BTW A;  1SLW B;  1GJ9 B;  3SZN A;  3VY2 A;  3U1J B;  2NR4 A;  4U30 A;  4IN2 A;  1BRB E;  1YPL H;  5BPE A;  2X1K A;  3TGI E;  4I8L A;  3EE7 A;  1AE8 H;  2ANY A;  1CU1 A;  1MU6 B;  1ZYO A;  2QXJ A;  5GIB A;  1AVW A;  1C5N H;  1OWI A;  1KLJ H;  1AN1 E;  1PFX C;  4B75 A;  1JOU B;  2ZFT A;  2C8Z B;  2VPA A;  2ZGH A;  1NS3 A;  1K1O A;  2AER H;  1Z1J A;  2VWN A;  3P92 A;  1TNI A;  3OFN D;  2CHA B;  3BA3 A;  2SNV A;  3VB4 A;  5CDF E;  1O5B B;  3FKS D;  4Y6D A;  1DS2 E;  1EUF A;  3F0O A;  1ELG A;  1UTJ A;  4K2Y A;  2C90 B;  4Y71 A;  3TH4 H;  2OBO A;  3JZ2 B;  1C5T A;  1XX9 A;  5T6D A;  4ABG A;  2Y7X A;  1JIM A;  4RI0 A;  1MQ6 A;  2GT8 A;  4HKH A;  4RSP A;  3TK6 A;  4I32 A;  2ZU4 A;  4Q7X A;  4RKO B;  3S9A A;  2BLO A;  4CBO A;  1AFQ B;  3VXF H;  3BG8 A;  3RXT A;  4FXG H;  1CHO F;  1O3O A;  1TLD A;  1S85 A;  2OC7 A;  1USF A;  3O8B A;  3RMN H;  4XE4 A;  1DM4 B;  8LPR A;  2PR3 A;  5TCC A;  4Y0Y E;  1H8H D;  3A7X A;  1MCT A;  2VH6 A;  4XD7 D;  1TPP A;  1HAV A;  1K1N A;  2ODY B;  1UTO A;  2VVU A;  1TGC A;  1IAU A;  3LGW A;  3MU5 A;  2A4G A;  2E83 A;  2VIQ A;  1IQM A;  1GMC G;  3E91 A;  1CBW C;  1TE0 A;  3TIU A;  4ASH A;  1BHX B;  2SGF E;  2BY8 X;  2FXR A;  4XBB A;  3UB0 A;  2H5C A;  4K1T A;  1LDT T;  4ZH8 A;  1ELE E;  1S6H A;  3JZ1 B;  4OS2 A;  4A1X A;  3UWJ H;  1H8D H;  3PWB A;  1XMN B;  1MD8 A;  1DXP A;  3O8R A;  4HX6 A;  1P2M A;  3U9A H;  3B8J A;  2G55 A;  1XUG A;  1ZHR A;  2FX4 A;  2G81 E;  3TIT A;  1G3B A;  1KMH B;  4DGJ A;  2ZQ2 A;  1FMG A;  1NRQ H;  4INK A;  2D1J A;  1ZRB A;  3ZZ7 A;  4WH6 A;  4BAM B;  2ED4 A;  1DSU A;  3RXK A;  4LOY H;  2BDG A;  1LKA A;  2FLR H;  1IQK A;  1GI3 A;  5JDU B;  1BHX F;  2XBY A;  1BIO A;  2IPH A;  1T8L A;  1JRS A;  3VPK A;  3RXO A;  4AFS A;  3KQD A;  3MH6 A;  2FYQ A;  3NCL A;  3BSQ A;  4KTC A;  4FU8 A;  3SGQ E;  3M5O A;  1YM0 A;  3DMB A;  2ZU1 A;  3MU0 A;  1MKX K;  5EPY A;  4ISH H;  5LPF A;  2X1J A;  3RXI A;  4IRA A;  3A8B A;  1TRN A;  3A85 A;  1WV4 A;  1DXW A;  3ZOE A;  1FY4 A;  1BTY A;  2B5T B;  1AD8 H;  3P8O A;  4IMQ A;  4ZKO U;  3QGJ A;  2FP7 B;  6CHA B;  1UJ1 A;  4XOJ A;  2BDY A;  3QLP H;  2BD8 A;  3ZV9 A;  1QA7 A;  2VWL A;  4FOU C;  2A2X H;  1TY9 A;  2WPI S;  4DIH H;  1ELA A;  1FY8 E;  1EOL A;  1NFW A;  1O2G H;  3BTE E;  1OKX A;  1RIW C;  3UR6 A;  1J8A A;  2FMJ A;  4IC6 A;  3MNX A;  2NWN A;  1HIA B;  1HXF H;  3GY2 A;  1D3Q B;  2ZQ1 A;  2A7C A;  2D38 A;  1O2J A;  2ASF A;  3SND A;  1DLE A;  5JBB S;  1SGF A;  3RXB A;  4ZKR U;  3HPT B;  4ISO A;  2Y5F A;  2ANM H;  2HRV A;  3ZZ4 A;  3K86 A;  2ANW A;  2KCO A;  3SU1 A;  3I77 A;  4B1T A;  3S9B A;  2WPJ S;  4KTU A;  1TBQ H;  3A6R A;  5JBT A;  3E1X B;  1YPK H;  2Y80 A;  1ZTL A;  2R2M B;  5EXL A;  3SV8 A;  4Q7Z A;  1TGN A;  1Z8J B;  4XRN A;  5E0H A;  1RS0 A;  3MH7 A;  1O3K A;  1QL7 A;  3AAV A;  3ZVF A;  1DWB H;  1KXC A;  3HE1 A;  1YYY 1;  5FPT A;  4B2B A;  1GI2 A;  2CN0 H;  1RZ1 A;  4KKD A;  4Q2K A;  1MZA A;  2UUK B;  3ATK A;  3KN2 A;  6EST A;  1OP0 A;  1O3C A;  1EZU C;  1DX5 M;  4NWK A;  5G4B A;  4ZXY H;  3M7T A;  4D8N A;  3E16 B;  3HY8 A;  1THS H;  3M3V A;  1L2E A;  1NZQ H;  5C20 A;  5T1V A;  3E4V A;  2O8M A;  5ESB A;  1O3D A;  2ZU5 A;  1O2X A;  1K0H A;  3LGT A;  3PMJ A;  2HPQ H;  4ZCN A;  5EW1 H;  2OUA A;  1DUE A;  3M7Q A;  5EST E;  4WH8 A;  5CHO A;  1C1R A;  2XC4 A;  2BX4 A;  1UCY K;  1UVT H;  3FAO A;  3ZYD A;  2FOF A;  3U8T H;  1OYQ A;  4I7Y H;  1UTQ A;  1MMJ N;  3ZOG A;  2VVV A;  2WV5 A;  2KCP A;  3F2H A;  3GY6 A;  1L0Z A;  2ASU B;  1O2W A;  2FWW A;  4M7G A;  2ZGC A;  2FG9 A;  4IS5 A;  1MTV A;  1O0D H;  2V35 A;  5FHT A;  2FHQ A;  1T8N A;  3K6Y A;  2L6O A;  1YPJ H;  4X1R U;  3GCO A;  3LH1 A;  1KXE A;  2RG3 A;  1GHY H;  2BY9 X;  2WPD D;  1W8B H;  2ZIQ H;  1VL7 A;  4K5Z A;  2DE9 A;  3M3S A;  1A0J A;  5DG6 A;  2W6J D;  1D3D B;  4YZU A;  2IG6 A;  1QZ8 A;  3NK8 A;  1NT1 A;  3PMB B;  3SW2 B;  2L74 A;  5CHB A;  2HQ7 A;  1HNE E;  4F49 A;  3RXA A;  5A0C A;  1YPH C;  2CV3 A;  4X1S U;  3SV6 A;  2HLC A;  3S7H B;  3S69 A;  4AFU A;  5CHA B;  1P02 A;  1EJE A;  7GCH G;  1ZJD A;  2EI7 A;  3T28 A;  1W10 U;  1QFK H;  1IHT H;  1UCY H;  3DD2 H;  4DVA U;  3KNX A;  1E1R D;  1YPH E;  1WUN H;  2WIN I;  4K8B A;  2G4T A;  1O30 A;  2EA3 A;  4A7I B;  1SGN E;  3KEE A;  4FUF A;  1DUA A;  1TQ7 B;  2GCH F;  1P57 B;  1C1N A;  4BXS A;  3R5Y A;  4JMY A;  3STI A;  4THN H;  4YWN A;  1G36 A;  1VGC B;  5KEC A;  1B0E A;  4RKJ B;  2A31 A;  2HOB A;  1A7S A;  3BTW E;  2Z3D A;  2VNT A;  4ABF A;  1IQJ A;  4O3T A;  4X1P U;  1DWC H;  2IOT A;  1WBG B;  4XJ2 A;  1SGC A;  1UVU H;  4LZ1 H;  3PB1 E;  1CI0 A;  4Y8X A;  5AFY H;  2BB4 A;  3LC5 A;  2O8W A;  4NCY A;  5T3H A;  1SGI B;  3NPS A;  1W0J D;  1A0L A;  1BTP A;  1WSS H;  2AIQ A;  3MWI U;  3H7O A;  2PWX A;  4UD9 H;  1MBQ A;  4F55 A;  1ZML A;  4K1E A;  4M9F A;  3B23 B;  1FV9 A;  1LVY A;  1QL8 A;  1GHB F;  1O2Q A;  3OTP A;  2ZGJ A;  4E7R G;  3MO3 A;  5F8T A;  5GXP A;  1LHE H;  1SFI A;  1T31 A;  3BTH E;  3GOV B;  1L4D A;  1GBD A;  1PPB H;  5HM2 A;  3SV7 A;  1BJV A;  2BDB A;  4HFP B;  2LPR A;  5LGO A;  2AMD A;  3GAS A;  4WF8 A;  3O8D A;  1V2N T;  1ZMN A;  1LHC H;  1VZQ H;  1ARC A;  4UEH H;  2FDA A;  1NU9 A;  4ABD A;  2A32 A;  1SGF G;  2QY0 B;  2XBX A;  4VGC B;  4BXW A;  1F0R A;  1VGC C;  1RD3 B;  2JET B;  4DY7 B;  2B8O H;  3EA8 A;  3G01 A;  2VJ1 A;  1TRY A;  2P3F H;  4X1N U;  3VEQ B;  4AN7 A;  4MVN A;  1HAY B;  4FUE A;  1OOK B;  2G51 A;  1C2H A;  3KID U;  1C5Z B;  5DP4 A;  1EP6 A;  2AS9 A;  5AF9 H;  4TSF D;  2R2W U;  5C2Z A;  4OS7 A;  4NFE A;  2BD9 A;  1O5D H;  2DUC A;  2ZEC A;  4CHA B;  2OXS A;  1S0Q A;  1V3X A;  1AU8 A;  1ABJ H;  1K22 H;  2C8X B;  5GPI B;  5IK2 D;  1AZZ A;  1NPM A;  4CRC A;  1DWD H;  1P04 A;  4NWL A;  4JZ1 A;  3UIR A;  2I02 A;  3K6Z A;  1TNG A;  4KTS A;  1S81 A;  1GMD G;  1BML A;  2F91 A;  3EST A;  3ATI A;  2ULL A;  2K8I A;  1O2H A;  2FYR A;  4AOR A;  3R5R A;  3CS7 A;  3KGP A;  3TPI Z;  1K2I 1;  3A82 A;  5B6O A;  1GBE A;  1HFD A;  3MNS A;  2ZPQ A;  4A92 A;  3OYP A;  1WU1 A;  1EAU A;  5EPN A;  2CK3 D;  3GS9 A;  1SGT A;  2G52 A;  4AYY B;  1QRW A;  4DW2 U;  1N6Y A;  1VJA U;  3VYA A;  3BTM E;  4YOI A;  2GJG A;  1K28 D;  2TGD A;  4HG6 A;  1IQG A;  1DWE H;  3BTT E;  3SV2 H;  5GND A;  4CHA C;  1HAP H;  1PJP A;  1H1B A;  1N8O C;  5E2O A;  1DST A;  3WWB A;  1VIT G;  1A4W H;  1B7X B;  3DSG A;  4NIW A;  5E2P A;  3VB7 A;  1GMH G;  2KAI B;  2PHB A;  3M35 A;  4UFF H;  4B6E A;  2PTC E;  3BEU A;  3HK3 B;  1DT2 A;  4CH8 B;  1GI6 A;  1UTN A;  5DP7 A;  3SHA H;  3WY8 A;  3SJO A;  1ZHM A;  4OGY A;  2PUQ H;  4GSO A;  1C2L A;  1CA0 B;  5TCA A;  3ZOD A;  1EX3 A;  3F2G A;  1YPG H;  1SPJ A;  1SQA A;  1E37 B;  1TIO A;  4Z0K A;  3F1S B;  4I8J A;  1V2P T;  3ZZB A;  1ZR0 A;  2WUB A;  2PKA A;  1EPT C;  1P2J A;  3M36 A;  4NZQ A;  3S9C A;  2HQ9 A;  1NRS H;  3M37 A;  3RMO H;  3BPK A;  1A1R A;  3F3B A;  2BX3 A;  1EAS A;  3FGE A;  1SGQ E;  5EJ1 A;  1MTN C;  3URD A;  3U35 A;  3CNR A;  1W7G H;  3U8O H;  1C1V H;  1FNI A;  5JAB A;  2R9P A;  4SGA E;  2RE7 A;  1BMA A;  1SGR E;  3RXH A;  3NFW A;  1E1Q D;  2ZDL A;  5HIY A;  1UVP A;  2J38 A;  3FOA A;  1XXO A;  2F9N A;  1W12 U;  3IN6 A;  2FLB H;  2D26 C;  1F92 A;  4A5T S;  4FUJ A;  1HYL A;  1HAG E;  1C5U A;  1HJA B;  2XOK D;  3A80 A;  3EYD A;  3DNH A;  5F03 A;  3M3T A;  3L33 A;  3T62 A;  3TJU A;  5C67 A;  2VU8 E;  2ALP A;  1O35 A;  2DE8 A;  2NU4 E;  4CRB A;  4R0I A;  3SHC H;  3BTG E;  1PPG E;  5LPE A;  1P10 A;  1OX1 A;  1YY3 A;  3DHK H;  3CP7 A;  4GVU A;  1UO6 A;  3E3T A;  2Z7F E;  1AY6 H;  1F0T A;  2LEL A;  5EXN A;  1G32 B;  3GCN A;  2VIN A;  3AW1 A;  2P93 A;  5DJ7 A;  4F48 B;  3RXP A;  3QZQ A;  4JYU H;  3OEH D;  1AVX A;  1INC A;  2UUY A;  5DKM A;  1ESB A;  5CHE C;  4JK6 A;  3ZVB A;  2XC5 A;  1QTF A;  3FKH A;  3OX7 U;  1GJ5 H;  1V2U T;  5HGG A;  1G76 A;  2VB0 A;  3P8F A;  4AC9 A;  2NU3 E;  4JK5 A;  1HB0 B;  3HMZ A;  3UNR A;  4BNR A;  1AB9 B;  1QHR B;  1S84 A;  2BLV A;  1UTK A;  5SGA E;  1SB1 H;  1YKT A;  5FBI A;  1GBJ A;  1HJA C;  1NO9 H;  3HKJ B;  3B9F H;  1ARB A;  1WYK A;  3M5M A;  1UCY E;  2F4L A;  3QUM P;  1Y3V A;  1AFE H;  5FCK A;  4MTK A;  1L4Z A;  3VGC B;  1A0H B;  1YPE H;  3D65 E;  3LGY A;  4Y7A A;  1O5C B;  4RT0 A;  2OP9 A;  2H5D A;  1JNW A;  1D3P B;  4AX9 H;  1F5R A;  1O3P B;  4KEL A;  1TON A;  3SU2 A;  1HDT H;  2ZA5 A;  3STJ A;  4FVB A;  2SNW A;  2ODP A;  1M9U A;  1SQT A;  2BD4 A;  1BRC E;  2OC8 A;  4D7F A;  3TVJ B;  1ZLR A;  3GIS B;  1QUR H;  4BAK B;  1DY8 A;  4UFG H;  2IPQ X;  3I29 A;  4K60 A;  1OSS A;  1TFX A;  3TGJ E;  1MKW K;  4O03 A;  1QBV H;  1NY2 2;  1GJC B;  2LNC A;  2WUC A;  1GHV H;  2TGP Z;  3A8C A;  2F9P A;  2A5A A;  1BQY A;  1VCW A;  3QK1 A;  1U6Q A;  3URE A;  5PTP A;  1A2C H;  5C1Y A;  2GUJ A;  1ZJK A;  2Y82 A;  1SOT A;  1NBM D;  2A0Q B;  1MAB B;  2RA0 A;  1QJ1 B;  1PPF E;  2Z3E A;  2Z9K A;  3RC6 A;  1PYT D;  4BAO B;  2BDI A;  5JPM H;  1AI8 H;  2UUJ B;  1QJ6 B;  3KQE A;  3MHW U;  4I33 A;  3C27 B;  1AKS A;  1CGH A;  2W3K A;  1ANC A;  1EPT A;  1UHB A;  1UTL M;  1O3E A;  2EC9 H;  1DIT H;  1XVM A;  3E6P H;  8GCH F;  5EIY A;  1G79 A;  4I86 A;  4ACB A;  1J16 A;  1MU8 B;  3ZZ5 A;  1TX8 A;  4YOG A;  3GY3 A;  1C1U H;  1O38 A;  3VY5 A;  3BN9 A;  1NFU A;  1C5V A;  2A2J A;  5J4Q A;  4X2W A;  3VB6 A;  2QXG A;  1LVM A;  1XUK A;  1AE5 A;  3MI4 A;  1MAY A;  5CE1 A;  5T6F A;  1K1I A;  4DII H;  1GVL A;  5GCH G;  1MKW H; 
#chains in the Genus database with same CATH homology
 1G76 A;  1T9M A;  2R6V A;  1XHN A;  1W3P A;  3ZOH A;  2ECU A;  1RZ1 A;  3HMZ A;  4HMS A;  1I0R A;  3ZOF A;  3VYA A;  4XJ2 A;  4F07 A;  2I51 A;  1CI0 A;  4P02 A;  3A6Q A;  2HTI A;  2ED4 A;  5EJZ A;  3HY8 A;  2GJG A;  1YLN A;  1WLK A;  4L82 A;  4HG6 A;  3KYF A;  1WLI A;  3E4V A;  4HMW A;  2HHZ A;  2Q9K A;  3RH7 A;  3PFT A;  3CB0 A;  3VY2 A;  3KYG A;  3DB0 A;  2NR4 A;  2D37 A;  3DSG A;  1FLM A;  2AQ6 A;  5BNC A;  4RT0 A;  2X1K A;  1JNW A;  5CHO A;  3DMB A;  1Y30 A;  3ZOG A;  3EC6 A;  3ZOD A;  2VPA A;  2X1J A;  3U34 A;  5KGO A;  4IRA A;  3GAS A;  3A20 A;  2FG9 A;  2HQ9 A;  3BA3 A;  2PTF A;  1RFE A;  1WV4 A;  2FHQ A;  3ZOE A;  3BPK A;  2OL5 A;  3FGE A;  5EJ1 A;  1DNL A;  4YBN A;  3U35 A;  3CNR A;  4P00 A;  4HMU A;  5JAB A;  1VL7 A;  2RE7 A;  3NFW A;  1YWU A;  2D5M A;  4FOU C;  4RT1 A;  1TY9 A;  4HMT A;  4ZKY A;  1XXO A;  1YOA A;  3K87 A;  4QVB A;  2IG6 A;  3IN6 A;  3TGV A;  2IAB A;  2L74 A;  2HQ7 A;  3CP3 A;  3R5W A;  3F7E A;  3SWJ A;  3DNH A;  2ARZ A;  2QCK A;  2OU5 A;  2D38 A;  1USF A;  4Y9I A;  1AXJ A;  2ASF A;  1EJE A;  1W3R A;  4HX6 A;  1W3Q A;  1W9A A;  4HMV A;  3U0I A;  1I0S A;  2RDE A;  3K86 A;  5KED A;  4HMX A;  3U5W A;  5EIY A;  1G79 A;  4I86 A;  2I02 A;  3ZOC A;  3AMF A;  2E83 A;  3VY5 A;  3K88 A;  1G78 A;  1USC A;  1W3O A;  4F48 B;  2R0X A;  2A2J A;  1NRG A;  3A6R A;  5ESC A;  2FUR A;  2D36 A;  4XHY A;  2QEA A;  3R5Z A;  5EJL A;  1RZ0 A;  4Z85 A;  2HTD A;  3R5R A;  4N7R C;  1WGB A;  4XRN A;  3BNK A;  3R5Y A;  3AWH A;  3R5L A;  4R82 A;  3B5M A;  5CHE C;  2ECR A;  3FKH A;  2IML A;  4YWN A;  5KEC A;  3R5P A;  1G77 A;  3H96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...