3KYGA

Crystal structure of vca0042 (l135r) complexed with c-di-gmp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
227
structure length
227
Chain Sequence
SKTVSTINSTDALAMVEHSSELTLSITTPVGTKFVCRTPFIGTHTDKFLLVEMPKISADDLQYFFQEGFWMNIRAISPRGEGALIHFRSQLMHILQEPVPMAFLSIPNTMQVSQRRKEPRFELNLAGKVLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVALEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKFNGTKLTLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of PP4397 Reveals the Molecular Basis for Different c-di-GMP Binding Modes by Pilz Domain Proteins.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Unknown function
molecule keywords Putative uncharacterized protein VCA0042
total genus 39
structure length 227
sequence length 227
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07238 PilZ PilZ domain
A PF12945 YcgR_2 Flagellar protein YcgR
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.110.10 Mainly Beta Roll Pnp Oxidase; Chain A Electron Transport, Fmn-binding Protein; Chain A 3kygA01
2.40.10.220 Mainly Beta Beta Barrel Thrombin, subunit H predicted glycosyltransferase like domains 3kygA02
2IMLA 5ESCA 3HY8A 3R5LA 1AXJA 3A6QA 1RZ0A 3U34A 1YOAA 3R5YA 4Y9IA 3AWHA 5CHOA 1W3QA 4Z85A 1WGBA 2I51A 2D37A 3ZOHA 4P00A 1WLIA 3ZODA 3DSGA 4YBNA 2RDEA 1W3OA 3KYFA 3R5PA 3U0IA 1W9AA 2D5MA 3FGEA 3NFWA 3RH7A 4HG6A 3KYGA 5EJ1A 3U35A 1T9MA 2X1JA 5BNCA 4ZKYA 1RFEA 3DNHA 4P02A 1TY9A 3BNKA 1G79A 3CNRA 3CP3A 2HTDA 3VYAA 1YLNA 1I0SA 2HQ9A 5KGOA 2ARZA 2FURA 3VY2A 3BPKA 2FHQA 3H96A 4I86A 4RT1A 2Q9KA 2L74A 1VL7A 2HQ7A 2OU5A 1WV4A 3AMFA 4QVBA 1I0RA 2HHZA 2A2JA 3K86A 3E4VA 3ZOEA 3VY5A 1NRGA 1WLKA 1W3PA 2D38A 3F7EA 3FKHA 2E83A 1JNWA 3K87A 1DNLA 1RZ1A 2FG9A 3ZOCA 3IN6A 3PFTA 3GASA 1XXOA 2X1KA 3R5RA 4HMWA 5EJLA 2IG6A 3A6RA 4L82A 3R5ZA 2R0XA 3DB0A 3U5WA 3B5MA 1G78A 3SWJA 3EC6A 4XJ2A 5CHEC 4HMSA 5KEDA 1Y30A 2IABA 1G77A 3HMZA 4HMUA 2QEAA 3CB0A 2RE7A 1USFA 4HMVA 3BA3A 4N7RC 4XHYA 3DMBA 2VPAA 4RT0A 2ECUA 2ECRA 2QCKA 1EJEA 4HMXA 1CI0A 5EJZA 5KECA 3TGVA 4F48B 4IRAA 2OL5A 1G76A 1XHNA 2AQ6A 3ZOGA 1FLMA 4FOUC 2D36A 4XRNA 1USCA 3K88A 1W3RA 5JABA 2R6VA 3A20A 4HX6A 3R5WA 2GJGA 2HTIA 1YWUA 2NR4A 3ZOFA 2I02A 4HMTA 5EIYA 2PTFA 4YWNA 4F07A 4R82A 2ASFA 2ED4A
chains in the Genus database with same CATH superfamily
2BD8A 2XNIA 3PV5A 1CGHA 3FOAA 2XC0A 1IQIA 4DY7B 3N7OA 2WPHS 4FXGH 2ZHWH 3F9HA 3RXCA 3SJ8A 1ANEA 2CJIA 5HKKD 1TBRH 1UCYE 1QNJA 1W3OA 3U0IA 1D6RA 5EXNA 2VGCC 2GT7A 2RCEA 1H9LB 3U35A 4ISNA 1DS2E 1GBKA 1P01A 2G00A 3HPTB 4LZ1H 1CA0B 1XVOA 4ASHA 4YOIA 3FZDA 2NU2E 4UONA 1EZXC 2NWNA 2Y82A 3QK1A 3KL6A 4I8JA 3KQCA 2WV9A 4YO9A 1TRYA 1CU1A 2ODYB 1S6FA 3BG4C 3TH4H 4B2AA 1IQFA 1ELAA 3RXTA 1WQVH 2C8XB 1HIAB 3DA9B 5FX6A 1PJPA 2FI5E 4BANB 2BM2A 4INKA 4CHAC 5GWZA 2ODPA 2BVRH 2ANWA 5F8ZA 3MU1A 2OQ5A 3D62A 1ZR0A 5DJ7A 4ZXXH 1O3MA 5ESBA 4A92A 6GCHG 3CS7A 1GHVH 1C1OA 1D6WA 3FKSD 5EJLA 4WJG2 4I32A 3SV6A 2ZIQH 1OHHD 2AYWA 4ABHA 5C17A 3LU9B 1O5AB 2Y5HA 1HJ8A 1P57B 4Z6AH 3U69H 4X6OA 1FN6A 1YYY1 3F2FA 1OWJA 2A31A 5HMAA 1TX8A 3DSPA 2GKVE 2QY0B 2BVXH 4ZCNA 4AGKA 3A8CA 3VGCC 2YNBA 5FPSA 2ZO3H 1ZZZA 2OK5A 1Z8JB 2PR3A 2HGTH 3OTPA 1CT0E 3MU4A 1ZTJA 2HPQH 4UD9H 1O3JA 3NUMA 4F48B 1VGCB 3OU0A 4NIXA 3IITA 1DXPA 3T27A 5DO4H 1XHNA 1EZUC 3SZEA 3M7TA 4WMFA 1BRAA 2FDAA 1P3EA 5L2YH 1ANBA 1HV7A 1A0HB 2NU1E 3QN7A 1AFQB 4NGAH 5EXLA 1O3GA 1G2MA 3R5LA 3RC5A 1H8ED 1GI1A 2Z3EA 3URCA 1ANCA 1GJ4H 2D2DA 2HPPH 1QRXA 1WGBA 2PGQB 1BMNH 2ZFPH 4O3TA 3SJOA 1ESBA 1SLVB 4GUXA 4D7FA 1E1RD 2W7UA 2ZEBA 4D76A 3EQ0H 3BTDE 3R5PA 1QCPA 5FX5A 2ZDVH 4AG2A 3MNBA 1ZGVA 1DY8A 1QL8A 2A32A 2YNAA 4ZKYA 4ZHLU 2FO9A 4KELA 3LONA 1Q2WA 1KDQB 1A61H 7GCHF 3ATLA 1O2LA 2R9PA 2D26C 5A0CA 3GCTF 4AB9A 1NFXA 4H6SB 1UTNA 4ACBA 1ZGIA 3FN8A 4INHA 2J2UA 3BN9A 1P11E 2BDIA 3QTVH 4HZHA 2PWXA 1GMCG 2OU5A 1AE8H 1UTJA 2BXUH 3E90B 1S0RA 1OS8A 2XC5A 1GGDB 3FVFB 1TYNA 1WU1A 5C0UA 3V4HA 1FAKH 1S85A 2VIOA 2L6OA 1Y12A 3M7UA 1GI7B 1J17T 1C1TA 2BB4A 8GCHF 4TPIZ 2HRVA 2ZU2A 2FS8A 1H4WA 2HNTC 2ZCLP 3RXUA 1DWCH 4AG1A 1RTKA 2ZHQH 1AKSB 3SV8A 7LPRA 4NZLA 3E3TA 1O30A 3HGPA 1UVUH 1ZMLA 5GCHG 3L33A 4MLFB 5EPNA 1GBTA 2OTVA 3A7YA 2QXIA 3GCOA 2J5UA 2F4LA 1UCYH 4RT0A 1RJXB 1BBRK 1SGFA 3GY3A 3RC6A 1GDQA 1BBRH 1G3BA 1Z8IB 2D8WA 1UTPA 4HTCH 1BBRE 1FLMA 3K9XB 1JRTA 2FESH 4ABGA 2F43B 5A0AE 1MTVA 4AFZA 2BQWB 3O8RA 3RXKA 3RLYH 1GVZA 1O3EA 4M9FA 1ANDA 1YCPH 2IMLA 3NWUA 1GBCA 1QIXB 2AGEX 5JBCS 5FBIA 2ZGBH 6ESTA 4MNYA 1F0SA 2OCVB 2KX4A 1W3QA 1F5KU 3RP2A 1ZMNA 1O3NA 2XTTB 4JYTA 5JYIA 3ZODA 1DY9A 2CHAB 4F4OC 1AMHA 1O37A 3S7HB 1C9TA 1Z6EA 4ZKRU 1CSOE 4OS7A 4BXWA 3RH7A 1C5WB 1GBHA 2F3CE 2OBQA 5EU8A 2VNTA 2F83A 3ATIA 4MPXA 4F55A 1N8OB 2STBE 1ZJKA 1P12E 3U1IB 1BTWA 2H2ZA 1GBAA 4INLA 4ZH8A 3SU0A 1WAYB 2OC8A 3RM2H 1N6YA 3E91A 1BRCE 4IN2A 5GJ4B 4PROA 2QXJA 1NPMA 3RXHA 3V7TA 1GHWH 2HTDA 2BDYA 3GYMA 3P17H 1C5TA 4CRCA 2UUYA 2ZTYA 3FP7E 3STIA 2AEIH 4FETA 1P2NA 4ZHAA 1LHDH 3LGYA 4XSKU 4ZUHA 2W5EA 5LPFA 4QVBA 1P0SH 1K1NA 4NIYA 3TIUA 3RDZA 1P05A 2ZPSA 3K87A 2ALPA 1SB1H 2CN0H 2UUFB 3L3TA 5LH8A 3T2NA 3Q00A 4A5TS 1S83A 3NXPA 1DFPA 1C2MA 1C4V2 1HAGE 1MQ6A 3EC6A 4JCNA 1PPGE 1NY22 4KP0A 4Y7AA 1PPCE 1FX0B 1A3EH 1XUGA 5LPEA 1SGEE 3B23B 1FPCH 1W3CA 5AF9H 3HMZA 1Y5AT 1C2DA 3JZ1B 4WY3A 1S6HA 3AAVA 4AN7A 1NFUA 1P3CA 1HJAC 1TX6A 2A7HA 1XUIA 1CBWC 3UB0A 2QCKA 1FI8A 1EJEA 1OWKA 1O3PB 2WZQA 1WOFA 2XC4A 1GCTB 3QX5H 1D4PB 2CV3A 2OL5A 2BD2A 2GCTC 1O5DH 4ZROA 4FUBA 1HB0B 2D36A 4K60A 2R2WU 2FYRA 4GHTA 4CRBA 3K88A 1QB6A 2GJGA 1C1RA 1H8DH 2PW8H 1TONA 2QAAA 5E8EH 1KXDA 2JJ1D 1SVPA 2ED4A 2GDEH 3DT0H 1LQEA 2M5TA 3HY8A 1GG6C 1ELBA 4KTSA 1QA0A 4TPYA 1E38B 1QJ1B 3HK3B 3AWHA 3ATWA 2KCYA 2ASUB 1BHXF 3Q77A 1W7GH 2I51A 5EODA 1BMFD 1MCVA 2BY8X 5DG6A 4X1NU 1ZHRA 2AMPA 1W9AA 2K8IA 2PP6A 4FUGA 1F7ZA 1XUFA 3S0NA 1VGCC 4NA8A 2FYQA 4CBNA 3LKWA 4ESTE 2WUBA 5A8ZA 3ZVFA 1QRZA 4X8TH 1NO9H 1ELDE 2FMJA 1AVXA 1FLEE 2A4RA 3A80A 1Y3UA 1IAUA 3SU5A 4CR5A 1QL9A 2BZ6H 1H1BA 1HBTH 3SN8A 1VL7A 1D9IA 1YY3A 4ZKNU 3TJVA 2AMDA 2BLQA 4FUCA 2BYAX 2GP9B 1EX3A 2B9LA 3GY5A 1DE7H 2J92A 1V2QT 1UVOA 1W0YH 2Y5GA 2W3IA 1W0KD 1NU9A 1OYTH 2I6QA 1QR3E 1ZRBA 3PFTA 4IMZA 5L2ZH 2VIDA 2VWNA 5F8XA 4UEHH 1FXYA 2BTCE 1DT2A 2Q6FA 2XWBI 4WH6A 2Y81A 4NSVA 3GY8A 4XJ2A 3Q3XA 3TGKE 1CA0C 1DOJA 2FWWA 3RU4E 3AW0A 1MBMA 2ZU3A 3GY7A 2Z3DA 4TWWA 3AAUA 1T4VH 2V6NA 1CA8B 2IABA 1GI2A 1MMJN 3BG4B 3F6UH 3UFAA 1K1OA 1C5UA 2ZHEH 1MD8A 1DLKB 1O3DA 2KCPA 1UK3A 1TOCB 2WPDD 5AFYH 4XDEA 1NC6A 1O33A 1O2WA 5H4IB 1V2LT 2Z9GA 3EA7A 4XOJA 6LPRA 4O97A 3FP8E 2FM2A 2C4FH 3KQBA 1FIZA 5EGMA 2C93B 5JPMH 3ZVAA 2GTBA 3HKJB 4JZDH 3MOCA 5EQQA 1C1SA 1COWD 1WUNH 3ZZ4A 2Z9IA 2VWLA 1C1MA 4AFSA 1YOAA 5DKMA 1TBQH 3EE7A 1SGFG 3A85A 1XUJA 2ZU4A 1O39A 3OSYA 1SSXA 1UW7A 3PM3A 2ZDLA 5A09A 3LT3A 2H9EH 2BY7X 1MKXK 2J38A 2RDEA 2WYJA 3LJJA 4X6MA 4Z1MD 1O2HA 2BDGA 1RRKA 2ILNA 2G52A 2UUJB 1T9MA 2HOBA 3A88A 3K65B 3MU0A 3BNKA 1GHYH 2ZFSA 3GISB 1E35B 3P8OA 4M7GA 3SI3H 1QJ6B 1SGIB 2GZ9A 2LELA 1K9OE 3GOVB 1PYTD 4RI0A 1MZDA 1TNHA 3KHVA 3LH1A 4X8SH 3H09A 4SGBE 1YLNA 3F68H 1F0RA 1O36A 4K8YA 2LNCA 1CGIE 1GWAA 1RS0A 1ESAA 1BMMH 4BAQB 1EFRD 4B71A 1TNKA 1TWXB 3LGIA 2ODQA 3E4VA 3ZOEA 1QQUA 1W3PA 5E2OA 2AGIX 2ZFQH 1O32A 1WYKA 2BY6X 2P16A 2PSYA 1PQ5A 2Y7XA 2NU4E 2RG3A 1VITF 4IW4E 3R5ZA 1FN8A 4OS2A 3U5WA 3HKIB 3MU8A 1AGJA 1RFNA 1YCPK 3DUXH 3RXPA 3WW7A 1AWFH 1CBWB 4GPGA 5KEDA 1KXCA 2UUKB 4DT7B 1NM6A 2G8TA 3SZNA 2BLWA 1T8NA 1MCTA 5CHAB 5FPYA 1FAXA 5GPIB 3SV7A 1OPHB 3GCHB 5K0HA 4UFDH 2ECUA 2J34A 2F91A 5E0HA 5FCRA 1KY9A 1VJAU 1O2XA 4UHVA 3ZZ8A 4D9RA 1K22H 4R8TB 3PTNA 3UIRA 3R5WA 2OBOA 1MZAA 4E05H 1YWUA 4YXWD 1C1VH 8KME2 2EC9H 2BD5A 2C8ZB 1SFIA 1KYNA 1F5RA 1OXGA 3VEQB 3A83A 4IC5A 1ABIH 3OYPA 3A8AA 3RXDA 1KTTB 1DVAH 2QF0A 1TPPA 1GL1A 1EAUA 2VINA 3F0OA 1ZTLA 2OC7A 3JZ2B 1JXPA 1O2SA 2FS9A 4BAMB 1GJ6A 1FJSA 3EE0B 1A5IA 3LGTA 3FGEA 3CP7A 2YMSD 1N6XA 1Z6JH 3MH6A 3I77A 1EJMA 1Y3WA 2BD4A 3F9EA 5FL7D 2H6MA 3S7KB 3DNHA 3PYHA 4Y76A 3ITIA 1SLUB 1FNIA 2HNTF 4AFQA 1ELFA 3VB3A 1AIXH 1ESTA 5CHAC 3ZZCA 4F49A 4JZIA 1ORFA 2VH0A 4U32A 1G37A 3MH5A 4K2YA 3URDA 5J4QA 1IOEA 5LPRA 2VU8E 5C5OA 4TV4A 5IYTA 1EPTC 1V2JT 3K86A 3EDXB 5EOKA 3BSQA 4Y0ZE 4AOQA 1BQYA 3FKHA 3F7EA 4KTCA 1ZPCA 1T7CA 1P09A 1JNWA 3LJOA 1DNLA 4ABBA 3ZOCA 4DCDA 4UE7H 3U8RH 2FIRH 1YPHE 1BUIA 2P3FH 1EB2A 2R0XA 1C5ZB 2RDLA 2W7SA 4WVPE 1BMLA 2P3TB 2XBWA 2QIQA 3MO6A 5ESTE 4Y79A 1Y30A 1AVWA 4ABEA 1ZMJA 3PMAB 3RXBA 5T3HA 4NA7A 2WYGA 4HMUA 1BHXB 1BTHH 2JJ2D 2WSSD 2ZC9H 3GY6A 1GJ8B 2VB0A 3P95A 1Z71A 1EUFA 2VH6A 4N7RC 3ZVBA 3H7OA 1BTUA 4NIWA 3TJUA 5C5NA 1FY1A 1WTGH 2KZ4A 4WH8A 4I8GA 4IBLH 2B5TB 1KXEA 4JYVH 1LDTT 3LOXA 3SW2B 1VZQH 3A8DA 2F9BH 2QGRA 1FQ3A 4Q7YA 1W2KH 1G76A 2AQ6A 1AUJA 1C9PA 1V3XA 2H5DA 4NFEA 1C1UH 1SOTA 2KM0A 1E1QD 1GMDF 1UVPA 3DHKH 1G9IE 2G5VA 1CE5A 4Q2KA 1W0ZU 2D1JA 2I02A 1EQ9A 1PYTC 5FCKA 4DIIH 1ELEE 4YWNA 3RU4D 2Z7FE 2ASFA 2SFAA 1RZ0A 4X2WA 1FY3A 1SC8U 4AYYB 2VIWA 1KDQA 1HCGA 2O8LA 1O5CB 1SR5C 5HYOA 1T8OA 1O2RA 1BOQA 1XKBC 2ZKSA 4R0IA 1HXEH 4H42U 4GCHF 3BTFE 1CHOF 2WPIS 3QO6A 2PLXA 2F9OA 2H5CA 1N1LA 2LP6A 4Y6DA 5FAHA 1ETRH 4ZMAH 3TGJE 1O3CA 1NRQH 1RFEA 4YTAA 2VIPA 1KMHB 4P02A 1YPJH 1TY9A 1THSH 6GCHF 4X0WU 3DFLA 2XOKD 2VWOA 3CP3A 3ELAH 1DX5M 1P2QA 1BITA 1ZTKA 3GDUA 1GBBA 1GI5A 1NRRH 2AFQB 1H9IE 2PFEA 2FHQA 3P92A 3FP6E 4LOYH 1LVYA 5DN6D 1ELGA 2ZTXA 4GVUA 1O3BA 1ZOMA 1L1NA 2TIOA 8ESTE 2FXRA 1L2EA 3V0XA 4MPWA 2JETC 4OS6A 1FV9A 1RD3B 3D49H 1FUJA 1V6DA 2QV1A 5BPEA 2PTCE 1W7XH 5CHBA 3R5RA 3TPIZ 2IG6A 4X8VH 1AHTH 1G78A 4RN6A 1QRWA 1BTYA 3PV4A 2NU0E 1O2ZA 3F2HA 1KTSB 1NBME 1L4DA 2GCHF 3FO8D 4B6FA 4BTIB 1O0DH 3PO1C 4MPVA 2FLRH 1P06A 3OEHD 1C5SA 3MHWU 2GVFA 4X6NA 1LPGB 4DOQA 2SGFE 4JYUH 2ZWLH 4OS4A 1WCZA 2A45B 1K1LA 2BQ6B 5HIZA 4DJZB 2FOAA 5EJZA 1ZSJA 3LDXH 2GGVB 4H6TA 1P2JA 1BTPA 2P8OB 3U8OH 1EB1H 2TBSA 2F9UA 3MO9A 2XW9A 1TNLA 1BCUH 3SU1A 2IJD1 3TVJB 3A82A 4XRNA 3SJKA 2G4TA 1C5QA 3UWIA 2SGAA 2A1DB 3AW1A 2SNVA 5EIYA 4F07A 2SNWA 1C5NH 3U28C 1TIOA 5ESCA 1KLTA 1GBMA 1NTPA 1NRNH 3R5YA 1Y3YA 4BAHB 4YOGA 4B73A 1V2OT 3RLWH 3SUFA 2W26A 3A81A 3RXJA 3GCTG 3OX7U 1GI8B 2C8YB 3BIVH 4I33A 1G3EA 3O8BA 5T6GA 1K1MA 2JH6D 4WXIA 1JRSA 4CREA 1O2PA 3M7QA 1GCDA 3MH7A 3QDZB 3K2UA 3R3GB 4WWYA 3BTWE 1O3FA 1VCWA 1EOLA 3S9BA 2VGCB 4O3UA 2BD3A 1OWIA 1SGCA 1A7SA 3TK6A 3F0PA 2THFB 1SGYE 1MAXA 3SV9A 1TQ0B 1RTFB 3LH3A 3N7EA 2OINA 3ZVDA 3SQHE 2IN2A 3SOSA 2CK3D 2EY4C 1I0SA 4ISHH 2DE8A 1NS3A 4ZKSU 5E2PA 1K1JA 4Y10E 1O5EH 1OOKB 1O5BB 4OGXA 1BA8B 1O2UA 2H1UA 4LZ4B 3PMHB 2A2JA 3VXFH 5IK2D 1GPZA 2HNTE 3EGKH 3E1XB 1O2YA 4Y8ZA 3UOUA 4YLUA 5ETXA 1EJNA 1QBNA 2R0KA 4DW2U 2JKHA 1Y8TA 2FG9A 5T1VA 4K1EA 3RU4T 2J98A 1C1QA 1PFXC 2AIQA 1VCPA 2FOFA 1IQNA 2PUXB 3VB4A 3A6RA 4WMDA 5GIBA 2ZDKA 1UCYK 2QA9E 3SGBE 3TJNA 2O8MA 3NZIA 1V2VT 5PTPA 1E79D 4Y7BA 1C5RA 1GBJA 3SNBA 1TGTA 1HRTH 3BTQE 1TLDA 4HGCA 2J4IA 2PGBB 4AX9H 3CB0A 3RXVA 4HMVA 4BAOB 3T5FH 2LPRA 5EW2H 1YKTA 2GT8A 1C1PA 1ZYOA 5DP5A 2KFWA 3RXEA 3ODFA 1MKXH 1ZLRA 1HAXB 1L4ZA 3U98H 1CHGA 4MNVA 1N8OC 3HK6B 2Z3CA 3SORA 4X1PU 3MFJA 3TNSA 2Y80A 1B7XB 4IMQA 3Q3YA 1IQJA 3C27B 3E0NB 3E6PH 1GMCF 1TRMA 4HX6A 3UOPA 1C2KA 2CHAC 4YESB 5EG4A 2ANYA 2FOGA 4K8BA 3IWMA 3UR6A 4HMTA 3ZZ7A 1LVOA 2JH5D 1MKWK 1VCQA 3PRDA 1SMFE 4Q7ZA 1T31A 2EEKA 1OKXA 3T29A 2HLCA 4JZ1A 1A46H 1V2MT 1QB1A 3S9CA 1WXRA 1THRH 3GYLB 3GCNA 2J9NA 2UWOA 4SGAE 4E7RG 2BLOA 1C2HA 1Q31A 1FY8E 2FTMA 2SGQE 2P3UB 2ZQ2A 1HGTH 2EI7A 4HG6A 1GJ5H 3P8NA 3ZZ6A 5FXLA 4NWKA 2H9TH 1VKYA 1MABB 2B7DH 4JK5A 4I31A 4NIVA 1DXWA 3S9AA 4J1YA 1G3DA 3ZZ5A 1BMAA 1W13U 3QTOH 3STJA 1ZSLA 1YP9A 3SV2H 1ZHMA 1CT2E 2ZPRA 1H8HD 3KEEA 3OY6U 3RM0H 3TITA 2FOBA 5TCAA 2JETB 3M3SA 3A7VA 3M3TA 4FU7A 3A7XA 2O8TA 2FURA 3QZRA 1SQRA 3H96A 1MTWA 1SQOA 1E34B 1G36A 1SGPE 4Z0KA 2BD7A 4IC6A 1XMNB 2CF8H 2ZI2H 1UVTH 2FTLE 4XFQA 1KSNA 2ZFRH 2WINI 3HE1A 3I78A 4A1VA 1SQTA 1SI5H 4HMWA 2RFKC 2AS9A 1C2LA 2VVUA 2ANKH 1GJBB 2BDAA 3T28A 1HYLA 1A5GH 4Y71A 1O3OA 1RXPA 1Q3XA 3LGVA 2P59A 4MG3A 3D65E 1GVKB 1T8LA 4YLQH 3T25A 1Y5UT 1RIWB 4XD7D 3SJIA 1SGDE 1AB9C 2AHME 1OP2A 1LCYA 3KCGH 1ELTA 3BA3A 2ZQ1A 3UREA 1NRSH 1NU7B 1W10U 1ZSKA 3TK9A 2QXHA 1MTNC 3A87A 1SLXB 1C5LH 3M37A 3LC3A 1O2GH 7GCHG 3A89A 3KF2A 1K0HA 4GHQA 1C5XB 1UTOA 2FOMB 4I8HA 2GMTC 4D8NA 4O03A 1AE5A 1E36B 1ELVA 1BJUA 1C1WH 2HTIA 1P02A 3W1EA 1DSTA 2ZZUH 1TQ7B 2OP9A 4MVNA 2M2AA 1BTXA 1SG8B 4X1QU 3T26A 3P6ZB 1EJAA 4DURA 3SNCA 3ZVEA 3PWCA 1AU8A 1O3KA 4THNH 3RMLH 3BTGE 1HAIH 4K1TA 2GZ7A 4Z85A 1S84A 5GXPA 3KNXA 5EPYA 3ZVGA 1PPHE 1GBEA 1P2OA 1O3AA 1GHXH 1MH0A 3MH4A 5ABWA 1S6LA 5HM2A 3KGPA 1W12U 3FANA 4Y11E 1NFWA 2Y7ZA 2ZFTA 4WMEA 3SUGA 3SGQE 1FMGA 1QQ4A 1TGNA 2BY9X 4RSPA 4HI3A 3VFEA 1Y59T 3L6PA 3RMOH 2P95A 2ZF0H 1YGCH 1P8VC 4ABDA 2Y6TA 2PUQH 1DM4B 2HQ9A 2C3SA 2W6ID 2Z9KA 3PROA 5A8XA 3BPKA 6CHAC 1LVBA 1Z7KA 1GMHF 2NU3E 2L74A 2Q6DA 3M5MA 1WV4A 1I0RA 1DITH 1O5FH 1QBVH 2XBXA 1YM0A 3U1JB 4MPUA 2CF9H 4ZAEA 4UFFH 1C5YB 1XXFA 3BG8A 3GASA 2EA3A 4B2BA 2X1KA 3ZV9A 4HKHA 1EATA 2C90B 1H8IH 2BOKA 4YOJA 1RIWC 5CHEC 2UWLA 1RGQA 1AKSA 1B0EA 4ISLA 1FDPA 1MKWH 1KIGH 2P94A 1ARBA 1AUTC 1GMHG 1THPB 2W6JD 3ZVCA 5EW1H 3NRLA 1PPEE 4KTUA 4Y8YA 2TGDA 4TYDA 3ENSB 1AO5A 1GBFA 1QZ8A 1O35A 1FZZA 1HJ9A 2ECRA 3QWCH 1XM1A 2V7QD 1OP0A 1P10A 1MBQA 4WXVA 1GVLA 3O8DA 1NN6A 1SFQB 1XUHA 1NFYA 2GCTB 1O2NA 2A4QA 3SNEA 1OX1A 1O5GH 3BEUA 4R82A 3HGNA 1TALA 2BZAA 3TNTA 1AZZA 4JMYA 4ISIH 1T32A 1UK2A 2ZDNA 1ZPZA 4Y9IA 1UHBB 3SU6A 3QLPH 2CGAA 1MU8B 5CHOA 4VGCC 1QFKH 3V12A 4X1SU 5DGJA 5DP7A 2ZHFH 2ZA5A 2AIPA 4Y8XA 3A7ZA 3MYWA 3OFND 3NFWA 4AB8A 2BDHA 2J95A 1KLJH 3MO3A 2JIZD 2GDDA 2O9QA 3F2GA 1HPGA 3PMJA 4KKDA 4TT3D 1S81A 4AFUA 3MNXA 3UUZA 3AVZA 1SGQE 1DWEH 3UNRA 2ZGCA 5GDSH 3UAIC 4CH8B 1V2RT 1ZJDA 5B6OA 3PRBA 4I8KA 2PTNA 1XVMA 3RXMA 5DSFA 1HAYB 4MNWA 1O3IA 3K6ZA 4X2YA 1DANH 1MD7A 1EOJA 4ABFA 1QA7A 2XBYA 1DWBH 2FPZA 1TRNA 3H7TA 4K3JA 1EZSC 1QL7A 5L6NH 1PPFE 1IQMA 4Q80A 1HDTH 4NA9H 1J16A 2E83A 2GUJA 3RXIA 2VIQA 2YMSC 1AY6H 3AK5A 4FUIA 4X6PA 5SGAE 1IHSH 3RXQA 1JIMA 2BY5X 2ULLA 4WF8A 1EASA 1Z8RA 1YC0A 1TAWA 1PQ8A 2ZG0H 2OQUA 3KN2A 4B2CA 2UWPA 2JH0D 1UTKA 3H5CB 1C2GA 4YZUA 5HGGA 2J97A 2A0QB 3A7TA 1OYQA 1JIRA 1GHAG 4OM9A 1IQGA 1XX9A 3WY8A 4LXBH 3CENA 1QHRB 4FUFA 1INCA 2WV4A 3N99A 3VG8A 3RXRA 3TJOA 2BHGA 5I46H 1GCTC 3RXSA 2TRMA 3AASA 2IPHA 2OLGA 1K1PA 1TGSZ 3TGVA 2WV5A 4FU8A 1YPGH 5DP4A 3SI4H 4IRAA 3ZZAA 3ZOGA 1SKYE 4ZKOU 1TPSA 4FUJA 1S0QA 1ZPBA 3MMGA 3MQKC 2KAIB 3ODDA 3T62A 3ZOFA 4MQAA 3P8GA 2BX3A 2HALA 2A5IA 3PLPA 4A6LA 1O2QA 3SJ9A 3U8TH 1UK4A 2Z9LA 4U30A 4B1TA 4RKJB 1M9UA 4FVDA 2F9PA 1L1GA 3GY2A 4D9QA 4CBOA 2ZDAH 1A3BH 1L1JA 1C2EA 1NT1A 2ZDMA 3B9FH 4P00A 1WLIA 1ARCA 1HJAB 2PKAB 8GCHG 4BAKB 4CRFA 4ABIA 2R3UA 4ACAA 4AZ2B 4UDWH 4NZQA 1O3HA 1TMUH 4U2WA 1GDNA 5EJ1A 4O9VA 2RA0A 3S69A 5K7RA 1GHAF 1O34A 3M36A 1ZHPA 2FZZA 5BNCA 5GCHF 2PSXA 4FUHA 3ZYDA 2XBVA 3F9GA 1TFXA 2WUCA 4IN1A 4Q4LA 4A1XA 1WQSA 3MNCA 3BV9B 1BB0B 1WDIA 4AORA 5CDFE 1MTUA 5A8YA 4RT1A 4CR9A 1P2KA 3P8FA 4YT6H 5DPAA 1SGTA 1JOUB 1O2VA 3TGIE 3VY5A 1GJDB 3V13A 2VIVA 2HVYB 3GS9A 3V3MA 1MAYA 2ZU5A 2FEQH 2V3OH 1DDJA 1B5GH 2Q1JA 1XXOA 3ZZ3A 1HAVA 2J94A 2BXTH 3NKKA 2K4QA 1MU6B 1QGFA 3B5MA 3ZZDA 4MDSA 1GMDG 2F9NA 3HATH 3GDSA 4CRDA 5CE1A 1CVWH 4MTKA 2RE7A 1LVMA 1YPHC 4TY6A 1USFA 5JB9S 4TWYA 5C1XA 3B8JA 2OD3B 2FI4E 1LQDB 1VJ9U 1OWEA 3F3BA 4NWLA 5DP6A 2BOHB 1F5LA 5T6DA 4BNRA 5KECA 1EP6A 3M5NA 4GCHG 2A4OA 3OEED 3UY9A 1P03A 4CHAB 4FOUC 1AI8H 1D3TB 4I8LA 2B0FA 1K28D 1USCA 1ABJH 3SUDA 1GI6A 1KXAA 4CRAA 2R6VA 1UO6A 5BRRE 2XWAA 2TGPZ 2Z9JA 2NR4A 3A7WA 1QTFA 2ZTZA 3SQEE 3M35A 2QF5A 2OC0A 2PKSC 1O2IA 3Q3KA 1TABE 3PB1E 1AXJA 1EAXA 1AFEH 2XCNA 1TE0A 1YPLH 5L30H 3U34A 3PTBA 5HXFA 4E7NA 5HIYA 1UHBA 3MWIU 1TPAE 3SU2A 1NRPH 3UPEA 1C2IA 1J15A 3UTUH 2VWMA 4TY7A 5DP3A 2BX4A 1VITG 2ZGHA 1LKBA 3VGCB 5JBBS 1LPKB 3DSGA 4B74A 1GJ7B 1TGCA 4DIHH 3GICB 1NROH 3KYFA 5DK1A 1HNEE 2D5MA 2I6SA 5TJXA 3DD2H 1W0JD 1D3DB 1UTMA 3BEFB 1YPEH 2HVXA 1HXFH 3G01A 1A4WH 2ZPQA 1EXFA 5GNDA 1IQLA 4HFPB 3NPSA 1G79A 5AFZH 1V2TT 3CNRA 1H9HE 3EA9A 1LHEH 2VVVA 1K2I1 4BXSA 2DE9A 4XBCA 3F1SB 3DFJA 5T6FA 1G32B 2ARZA 1HIAA 1BJVA 1IQKA 2WPMS 2BQ7B 1F0TA 4OS1A 1ACBE 3VXEH 5C1UA 1TA6A 4RKOB 1ETTH 3CS0A 1TNIA 5E0GA 1O31A 3U9AH 2PKSB 2FOEA 1RZ1A 1T4UH 4MNXA 1BRBE 1V2UT 1DICA 4JZFH 5F8TA 1BIOA 2BDBA 2TPIZ 3DB0A 2GV6A 3QGNB 3SWJA 1FONA 3QZQA 1HFDA 1LMWB 1YPMH 1DLEA 2AH4X 1B0FA 4HMSA 5FHTA 3I29A 1NESE 4IGDA 3E16B 1HLTH 2WHXA 2Y5FA 3SO3A 1C2JA 7KMEH 5HM9A 1S82A 4FUEA 4ABAA 5F6MA 4XHYA 4ABJA 1K21H 3DSOA 9LPRA 4HMXA 1LHFH 4FVBA 3SHAH 1EKBB 1EAIA 1WBGB 1EPTA 2C8WB 5JBTA 1HAPH 2R2MB 1EPTB 1O38A 4AYVB 2ESTE 1DUAA 3KQ5A 1F0UA 2FOHA 2KAIA 1MQ5A 1OSSA 3LPRA 3A20A 1AFQC 1BZXE 3VB7A 5C94A 1FY5A 2R3YA 3EYDA 1IQHA 1QJ7B 4ASUD 1EAWA 1DPOA 2G4UA 1E37B 5EXMA 1PPZA 1KXBA 2FOCA 1BRUP 3R0FA 2ANMH 4IS5A 1GJ9B 1TPOA 1IHTH 1TNGA 5FPTA 5F03A 2ZFFH 2O8WA 1AWHB 2BDCA 1ZRKA 2A7CA 4UFGH 5AHGH 1SHHB 1C2FA 1CT4E 2DUCA 1BTZA 3SNAA 4GSOA 1DSUA 4DT4A 3UQOA 3MI4A 5EQRA 1GI3A 5FBEA 4BOHA 1P04A 1LPZB 1AN1E 4X1RU 3UQVA 1TGBA 1EZQA 2Q6GA 4VGCB 2F9VA 4ZHMU 4I7YH 2WPJS 2FX4A 3PLKA 3RXAA 7ESTE 2OXSA 2VBCA 1TX7A 2HQ7A 1D3PB 1HAHH 1SOZA 1OP8A 1X7AC 5IDKA 5JDUB 2XYAA 4Q7XA 4FU9A 2ZCKP 5J4SA 1C1NA 2EI6A 1V2PT 3EA8A 2J98B 1YCPM 4JK6A 4H4FA 1A0JA 3WWFA 2GX4A 2BLVA 3SNDA 1HAVB 2XNDD 3BTTE 5AVDA 3LGUA 5C3NA 2CXVA 4L82A 3UNQA 1QB9A 5EQSA 1A0LA 1Y3VA 1T8MA 5DP9A 1C5OH 2BD9A 3LGWA 1V2KT 3M61U 3RXLA 2SGDE 4QT8C 3QUMP 4CRGA 1TNJA 2YOLA 3K6YA 3M5OA 3C1KA 2PHBA 1G77A 3ZZ9A 1O2KA 2ALVA 1AQ7A 3GCHC 2AGGX 1GHBF 3BEIB 1TBZH 1YBWA 2FI3E 2K0QA 2VVCA 1O2MA 2FX6A 1J9CH 1LHCH 2OUAA 5C2ZA 2L1TA 1YLDA 1CQQA 4UFEH 1VR1H 1LTOA 1UVSH 2OC1A 3NK8A 1SHYA 3M5LA 3RXOA 1FIWA 4JZEH 1YLCA 4NG9H 1HAOH 2TGAA 3Q76A 3ATKA 1UTQA 2ZECA 3A86A 1GBDA 2EQNA 3RUOA 1V2WT 2PTFA 4A1TA 5C67A 3N7DA 4BTUB 1P2IA 2HWLB 1UTLM 3ESTA 1IQEA 2W3KA 3A6QA 3M3VA 1O2JA 2TGTA 3A84A 1KXFA 2ZP0H 1D3QB 1FY4A 4XBBA 2CMYA 1WSSH 2D37A 3ZOHA 2KCOA 2AMQA 2XRCA 2ZGXH 3MTYA 3UR9A 1O3LA 3MNSA 2A2XH 4NSYA 1Y5BT 1CGJE 2JDID 2STAE 3RMNH 2X1JA 1CO7E 2AERH 3ATMA 3TK5A 1BT7A 1RTLA 3LIWA 1P2MA 5JBAS 1O2OA 3VB6A 5JB8S 4E06H 1XUKA 1ETSH 1TB6H 1W11U 3ZIAD 2V3MA 3TLOA 3PO1B 4X2XA 1SPJA 1GI4A 1W8BH 2A5AA 4BTTB 5KGOA 3VY2A 1LO6A 3ZZBA 1GG6B 3PV2A 4XBDA 1V2ST 2A7JA 2A2QH 3AMFA 3KIDU 2QYIA 2HHZA 1J8AA 1NRGA 1WLKA 1E0FD 1HAZB 2D38A 3MU5A 1FPHH 1Z1JA 1C5PA 1ELCA 3TH2H 3F9FA 4DG4A 3IN6A 3EAJA 3SUEA 2WPKS 2GD4B 4D7GA 4XE4A 2PV9B 3UNSA 4K5ZA 2FLBH 4B76A 3A8BA 3GDVA 3SGAE 2BVSH 2FP7B 3FAOA 5E0JA 2O8UA 1MTNB 2KR7A 3W94A 4YM9A 1GJCB 1DWDH 4W64A 4X8UH 2G81E 3SHCH 2Z6BD 2QXGA 1YPKH 2QEAA 3RXFA 2XXLA 1DUEA 1MUEB 1P9UA 2GMTB 2SGEE 1XKAC 4X2VA 3DMBA 1C5MD 1G30B 1MTSA 1GHZA 2QF4A 2KCAA 4NFFA 5TCCA 1W14U 1PQ7A 4MTBA 3IG6B 2QF3A 2QCYA 2IOTA 1W3RA 4J2YB 2IPQX 2A4GA 1TOMH 3W95A 1AZ8A 1NZQH 4CH2B 4ISOA 3BTHE 4B6EA 1A5HA 2ZU1A 4Q63A 3VPKA 4GLYA 1K1IA 2QC2A 4FUDA 1OWHA 2VJ1A 1QBOA 1QURH 2V0BA 1GI0A 2G5NA 3BIUH 3OY5U 1GL0E 1AD8H 1OWDA 2ZHDA 1GDUA 1P9SA 2GCHG 4YBNA 2PKAA 1LKAA 1WTHD 1XXDA 3EAAA 2P5ZX 1F92A 2V3HH 4NCYA 3SYJA 1O2TA 3WWBA 4KGAA 4AC9A 2G51A 1J14A 3PMBB 5C20A 3KQDA 3KYGA 3RC4A 2HLDD 1GJAB 2H9HA 2G55A 3O8CA 2GZ8A 1UMAH 4DGJA 1VITH 3BF6H 1PPBH 1GHBG 6CHAB 2A5KA 3SU4A 4B75A 1GBIA 2R0LA 3SBKA 4OGYA 5C0TA 1ID5H 3E0PB 8LPRA 3NCLA 4AGJA 3RMMH 1SQAA 1G3CA 1C4U2 3TH3H 3VYAA 1S5SA 3BTEE 2SGPE 1QY6A 1V2NT 5F53A 4I86A 2Q9KA 3LC5A 1TMBH 3DCLA 3BTKE 2QE7D 3P70B 4K69A 4OS5A 4K1SA 4U01A 1JMOH 1BDAA 4Y0YE 2YMSB 1C5VA 9ESTA 2GV7A 1G2LA 5G4BA 2ZNKH 1JBUH 2P93A 1EP5A 3KQEA 1WV7H 5I25A 3QGJA 3UWJH 1JWTA 4ZXYH 2ZCHP 4LK4A 1F2SE 1SL3A 5A2MH 1SGRE 1CHOG 3OE7D 3TU7H 5CMXH 3PWBA 4TSFD 1GI9B 1L0ZA 4DVAU 1SLWB 1LHGH 2FODA 1AVGH 3FZZA 5C1YA 1Y3XA 1SBWA 2EI8A 2B8OH 3OTJE 2WPLS 1YF4A 2VPAA 2K1QA 2XCFA 1AB9B 2P8OC 3ZV8A 3PLBA 1CI0A 1HUTH 2QN5T 2V35A 3RXGA 1TMTH 5DP8A 3OAAD 1U6QA 1UJ1A 1SGNE 3D23A 3SU3A 2Z94A 3BTME 3E8LA 1PQAA 2ZGJA 1TA2A 1A1RA 4GAWA 5JABA 1A2CH 4YT7H 5B6LA 5A0BA 1Z1IA 2BMGB 1KLIH 1GBLA 2RA3A 1Z8GA 1GGDC 3GY4A 1NBMD 3FFGA 3VB5A 5LGOA 2IJOB 1C4Y2 3ZYEA 4A7IB
chains in the Genus database with same CATH topology
2IMLA 5ESCA 3HY8A 3R5LA 1AXJA 3A6QA 1RZ0A 3U34A 1YOAA 3R5YA 4Y9IA 3AWHA 5CHOA 1W3QA 4Z85A 1WGBA 2I51A 2D37A 3ZOHA 4P00A 1WLIA 3ZODA 3DSGA 4YBNA 2RDEA 1W3OA 3KYFA 3R5PA 3U0IA 1W9AA 2D5MA 3FGEA 3NFWA 3RH7A 4HG6A 3KYGA 5EJ1A 3U35A 1T9MA 2X1JA 5BNCA 4ZKYA 1RFEA 3DNHA 4P02A 1TY9A 3BNKA 1G79A 3CNRA 3CP3A 2HTDA 3VYAA 1YLNA 1I0SA 2HQ9A 5KGOA 2ARZA 2FURA 3VY2A 3BPKA 2FHQA 3H96A 4I86A 4RT1A 2Q9KA 2L74A 1VL7A 2HQ7A 2OU5A 1WV4A 3AMFA 4QVBA 1I0RA 2HHZA 2A2JA 3K86A 3E4VA 3ZOEA 3VY5A 1NRGA 1WLKA 1W3PA 2D38A 3F7EA 3FKHA 2E83A 1JNWA 3K87A 1DNLA 1RZ1A 2FG9A 3ZOCA 3IN6A 3PFTA 3GASA 1XXOA 2X1KA 3R5RA 4HMWA 5EJLA 2IG6A 3A6RA 4L82A 3R5ZA 2R0XA 3DB0A 3U5WA 3B5MA 1G78A 3SWJA 3EC6A 4XJ2A 5CHEC 4HMSA 5KEDA 1Y30A 2IABA 1G77A 3HMZA 4HMUA 2QEAA 3CB0A 2RE7A 1USFA 4HMVA 3BA3A 4N7RC 4XHYA 3DMBA 2VPAA 4RT0A 2ECUA 2ECRA 2QCKA 1EJEA 4HMXA 1CI0A 5EJZA 5KECA 3TGVA 4F48B 4IRAA 2OL5A 1G76A 1XHNA 2AQ6A 3ZOGA 1FLMA 4FOUC 2D36A 4XRNA 1USCA 3K88A 1W3RA 5JABA 2R6VA 3A20A 4HX6A 3R5WA 2GJGA 2HTIA 1YWUA 2NR4A 3ZOFA 2I02A 4HMTA 5EIYA 2PTFA 4YWNA 4F07A 4R82A 2ASFA 2ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IML A;  5ESC A;  3HY8 A;  3R5L A;  1AXJ A;  3A6Q A;  1RZ0 A;  3U34 A;  1YOA A;  3R5Y A;  4Y9I A;  3AWH A;  5CHO A;  1W3Q A;  4Z85 A;  1WGB A;  2I51 A;  2D37 A;  3ZOH A;  4P00 A;  1WLI A;  3ZOD A;  3DSG A;  4YBN A;  2RDE A;  1W3O A;  3KYF A;  3R5P A;  3U0I A;  1W9A A;  2D5M A;  3FGE A;  3NFW A;  3RH7 A;  4HG6 A;  3KYG A;  5EJ1 A;  3U35 A;  1T9M A;  2X1J A;  5BNC A;  4ZKY A;  1RFE A;  3DNH A;  4P02 A;  1TY9 A;  3BNK A;  1G79 A;  3CNR A;  3CP3 A;  2HTD A;  3VYA A;  1YLN A;  1I0S A;  2HQ9 A;  5KGO A;  2ARZ A;  2FUR A;  3VY2 A;  3BPK A;  2FHQ A;  3H96 A;  4I86 A;  4RT1 A;  2Q9K A;  2L74 A;  1VL7 A;  2HQ7 A;  2OU5 A;  1WV4 A;  3AMF A;  4QVB A;  1I0R A;  2HHZ A;  2A2J A;  3K86 A;  3E4V A;  3ZOE A;  3VY5 A;  1NRG A;  1WLK A;  1W3P A;  2D38 A;  3F7E A;  3FKH A;  2E83 A;  1JNW A;  3K87 A;  1DNL A;  1RZ1 A;  2FG9 A;  3ZOC A;  3IN6 A;  3PFT A;  3GAS A;  1XXO A;  2X1K A;  3R5R A;  4HMW A;  5EJL A;  2IG6 A;  3A6R A;  4L82 A;  3R5Z A;  2R0X A;  3DB0 A;  3U5W A;  3B5M A;  1G78 A;  3SWJ A;  3EC6 A;  4XJ2 A;  5CHE C;  4HMS A;  5KED A;  1Y30 A;  2IAB A;  1G77 A;  3HMZ A;  4HMU A;  2QEA A;  3CB0 A;  2RE7 A;  1USF A;  4HMV A;  3BA3 A;  4N7R C;  4XHY A;  3DMB A;  2VPA A;  4RT0 A;  2ECU A;  2ECR A;  2QCK A;  1EJE A;  4HMX A;  1CI0 A;  5EJZ A;  5KEC A;  3TGV A;  4F48 B;  4IRA A;  2OL5 A;  1G76 A;  1XHN A;  2AQ6 A;  3ZOG A;  1FLM A;  4FOU C;  2D36 A;  4XRN A;  1USC A;  3K88 A;  1W3R A;  5JAB A;  2R6V A;  3A20 A;  4HX6 A;  3R5W A;  2GJG A;  2HTI A;  1YWU A;  2NR4 A;  3ZOF A;  2I02 A;  4HMT A;  5EIY A;  2PTF A;  4YWN A;  4F07 A;  4R82 A;  2ASF A;  2ED4 A; 
#chains in the Genus database with same CATH topology
 2BD8 A;  2XNI A;  3PV5 A;  1CGH A;  3FOA A;  2XC0 A;  1IQI A;  4DY7 B;  3N7O A;  2WPH S;  4FXG H;  2ZHW H;  3F9H A;  3RXC A;  3SJ8 A;  1ANE A;  2CJI A;  5HKK D;  1TBR H;  1UCY E;  1QNJ A;  1W3O A;  3U0I A;  1D6R A;  5EXN A;  2VGC C;  2GT7 A;  2RCE A;  1H9L B;  3U35 A;  4ISN A;  1DS2 E;  1GBK A;  1P01 A;  2G00 A;  3HPT B;  4LZ1 H;  1CA0 B;  1XVO A;  4ASH A;  4YOI A;  3FZD A;  2NU2 E;  4UON A;  1EZX C;  2NWN A;  2Y82 A;  3QK1 A;  3KL6 A;  4I8J A;  3KQC A;  2WV9 A;  4YO9 A;  1TRY A;  1CU1 A;  2ODY B;  1S6F A;  3BG4 C;  3TH4 H;  4B2A A;  1IQF A;  1ELA A;  3RXT A;  1WQV H;  2C8X B;  1HIA B;  3DA9 B;  5FX6 A;  1PJP A;  2FI5 E;  4BAN B;  2BM2 A;  4INK A;  4CHA C;  5GWZ A;  2ODP A;  2BVR H;  2ANW A;  5F8Z A;  3MU1 A;  2OQ5 A;  3D62 A;  1ZR0 A;  5DJ7 A;  4ZXX H;  1O3M A;  5ESB A;  4A92 A;  6GCH G;  3CS7 A;  1GHV H;  1C1O A;  1D6W A;  3FKS D;  5EJL A;  4WJG 2;  4I32 A;  3SV6 A;  2ZIQ H;  1OHH D;  2AYW A;  4ABH A;  5C17 A;  3LU9 B;  1O5A B;  2Y5H A;  1HJ8 A;  1P57 B;  4Z6A H;  3U69 H;  4X6O A;  1FN6 A;  1YYY 1;  3F2F A;  1OWJ A;  2A31 A;  5HMA A;  1TX8 A;  3DSP A;  2GKV E;  2QY0 B;  2BVX H;  4ZCN A;  4AGK A;  3A8C A;  3VGC C;  2YNB A;  5FPS A;  2ZO3 H;  1ZZZ A;  2OK5 A;  1Z8J B;  2PR3 A;  2HGT H;  3OTP A;  1CT0 E;  3MU4 A;  1ZTJ A;  2HPQ H;  4UD9 H;  1O3J A;  3NUM A;  4F48 B;  1VGC B;  3OU0 A;  4NIX A;  3IIT A;  1DXP A;  3T27 A;  5DO4 H;  1XHN A;  1EZU C;  3SZE A;  3M7T A;  4WMF A;  1BRA A;  2FDA A;  1P3E A;  5L2Y H;  1ANB A;  1HV7 A;  1A0H B;  2NU1 E;  3QN7 A;  1AFQ B;  4NGA H;  5EXL A;  1O3G A;  1G2M A;  3R5L A;  3RC5 A;  1H8E D;  1GI1 A;  2Z3E A;  3URC A;  1ANC A;  1GJ4 H;  2D2D A;  2HPP H;  1QRX A;  1WGB A;  2PGQ B;  1BMN H;  2ZFP H;  4O3T A;  3SJO A;  1ESB A;  1SLV B;  4GUX A;  4D7F A;  1E1R D;  2W7U A;  2ZEB A;  4D76 A;  3EQ0 H;  3BTD E;  3R5P A;  1QCP A;  5FX5 A;  2ZDV H;  4AG2 A;  3MNB A;  1ZGV A;  1DY8 A;  1QL8 A;  2A32 A;  2YNA A;  4ZKY A;  4ZHL U;  2FO9 A;  4KEL A;  3LON A;  1Q2W A;  1KDQ B;  1A61 H;  7GCH F;  3ATL A;  1O2L A;  2R9P A;  2D26 C;  5A0C A;  3GCT F;  4AB9 A;  1NFX A;  4H6S B;  1UTN A;  4ACB A;  1ZGI A;  3FN8 A;  4INH A;  2J2U A;  3BN9 A;  1P11 E;  2BDI A;  3QTV H;  4HZH A;  2PWX A;  1GMC G;  2OU5 A;  1AE8 H;  1UTJ A;  2BXU H;  3E90 B;  1S0R A;  1OS8 A;  2XC5 A;  1GGD B;  3FVF B;  1TYN A;  1WU1 A;  5C0U A;  3V4H A;  1FAK H;  1S85 A;  2VIO A;  2L6O A;  1Y12 A;  3M7U A;  1GI7 B;  1J17 T;  1C1T A;  2BB4 A;  8GCH F;  4TPI Z;  2HRV A;  2ZU2 A;  2FS8 A;  1H4W A;  2HNT C;  2ZCL P;  3RXU A;  1DWC H;  4AG1 A;  1RTK A;  2ZHQ H;  1AKS B;  3SV8 A;  7LPR A;  4NZL A;  3E3T A;  1O30 A;  3HGP A;  1UVU H;  1ZML A;  5GCH G;  3L33 A;  4MLF B;  5EPN A;  1GBT A;  2OTV A;  3A7Y A;  2QXI A;  3GCO A;  2J5U A;  2F4L A;  1UCY H;  4RT0 A;  1RJX B;  1BBR K;  1SGF A;  3GY3 A;  3RC6 A;  1GDQ A;  1BBR H;  1G3B A;  1Z8I B;  2D8W A;  1UTP A;  4HTC H;  1BBR E;  1FLM A;  3K9X B;  1JRT A;  2FES H;  4ABG A;  2F43 B;  5A0A E;  1MTV A;  4AFZ A;  2BQW B;  3O8R A;  3RXK A;  3RLY H;  1GVZ A;  1O3E A;  4M9F A;  1AND A;  1YCP H;  2IML A;  3NWU A;  1GBC A;  1QIX B;  2AGE X;  5JBC S;  5FBI A;  2ZGB H;  6EST A;  4MNY A;  1F0S A;  2OCV B;  2KX4 A;  1W3Q A;  1F5K U;  3RP2 A;  1ZMN A;  1O3N A;  2XTT B;  4JYT A;  5JYI A;  3ZOD A;  1DY9 A;  2CHA B;  4F4O C;  1AMH A;  1O37 A;  3S7H B;  1C9T A;  1Z6E A;  4ZKR U;  1CSO E;  4OS7 A;  4BXW A;  3RH7 A;  1C5W B;  1GBH A;  2F3C E;  2OBQ A;  5EU8 A;  2VNT A;  2F83 A;  3ATI A;  4MPX A;  4F55 A;  1N8O B;  2STB E;  1ZJK A;  1P12 E;  3U1I B;  1BTW A;  2H2Z A;  1GBA A;  4INL A;  4ZH8 A;  3SU0 A;  1WAY B;  2OC8 A;  3RM2 H;  1N6Y A;  3E91 A;  1BRC E;  4IN2 A;  5GJ4 B;  4PRO A;  2QXJ A;  1NPM A;  3RXH A;  3V7T A;  1GHW H;  2HTD A;  2BDY A;  3GYM A;  3P17 H;  1C5T A;  4CRC A;  2UUY A;  2ZTY A;  3FP7 E;  3STI A;  2AEI H;  4FET A;  1P2N A;  4ZHA A;  1LHD H;  3LGY A;  4XSK U;  4ZUH A;  2W5E A;  5LPF A;  4QVB A;  1P0S H;  1K1N A;  4NIY A;  3TIU A;  3RDZ A;  1P05 A;  2ZPS A;  3K87 A;  2ALP A;  1SB1 H;  2CN0 H;  2UUF B;  3L3T A;  5LH8 A;  3T2N A;  3Q00 A;  4A5T S;  1S83 A;  3NXP A;  1DFP A;  1C2M A;  1C4V 2;  1HAG E;  1MQ6 A;  3EC6 A;  4JCN A;  1PPG E;  1NY2 2;  4KP0 A;  4Y7A A;  1PPC E;  1FX0 B;  1A3E H;  1XUG A;  5LPE A;  1SGE E;  3B23 B;  1FPC H;  1W3C A;  5AF9 H;  3HMZ A;  1Y5A T;  1C2D A;  3JZ1 B;  4WY3 A;  1S6H A;  3AAV A;  4AN7 A;  1NFU A;  1P3C A;  1HJA C;  1TX6 A;  2A7H A;  1XUI A;  1CBW C;  3UB0 A;  2QCK A;  1FI8 A;  1EJE A;  1OWK A;  1O3P B;  2WZQ A;  1WOF A;  2XC4 A;  1GCT B;  3QX5 H;  1D4P B;  2CV3 A;  2OL5 A;  2BD2 A;  2GCT C;  1O5D H;  4ZRO A;  4FUB A;  1HB0 B;  2D36 A;  4K60 A;  2R2W U;  2FYR A;  4GHT A;  4CRB A;  3K88 A;  1QB6 A;  2GJG A;  1C1R A;  1H8D H;  2PW8 H;  1TON A;  2QAA A;  5E8E H;  1KXD A;  2JJ1 D;  1SVP A;  2ED4 A;  2GDE H;  3DT0 H;  1LQE A;  2M5T A;  3HY8 A;  1GG6 C;  1ELB A;  4KTS A;  1QA0 A;  4TPY A;  1E38 B;  1QJ1 B;  3HK3 B;  3AWH A;  3ATW A;  2KCY A;  2ASU B;  1BHX F;  3Q77 A;  1W7G H;  2I51 A;  5EOD A;  1BMF D;  1MCV A;  2BY8 X;  5DG6 A;  4X1N U;  1ZHR A;  2AMP A;  1W9A A;  2K8I A;  2PP6 A;  4FUG A;  1F7Z A;  1XUF A;  3S0N A;  1VGC C;  4NA8 A;  2FYQ A;  4CBN A;  3LKW A;  4EST E;  2WUB A;  5A8Z A;  3ZVF A;  1QRZ A;  4X8T H;  1NO9 H;  1ELD E;  2FMJ A;  1AVX A;  1FLE E;  2A4R A;  3A80 A;  1Y3U A;  1IAU A;  3SU5 A;  4CR5 A;  1QL9 A;  2BZ6 H;  1H1B A;  1HBT H;  3SN8 A;  1VL7 A;  1D9I A;  1YY3 A;  4ZKN U;  3TJV A;  2AMD A;  2BLQ A;  4FUC A;  2BYA X;  2GP9 B;  1EX3 A;  2B9L A;  3GY5 A;  1DE7 H;  2J92 A;  1V2Q T;  1UVO A;  1W0Y H;  2Y5G A;  2W3I A;  1W0K D;  1NU9 A;  1OYT H;  2I6Q A;  1QR3 E;  1ZRB A;  3PFT A;  4IMZ A;  5L2Z H;  2VID A;  2VWN A;  5F8X A;  4UEH H;  1FXY A;  2BTC E;  1DT2 A;  2Q6F A;  2XWB I;  4WH6 A;  2Y81 A;  4NSV A;  3GY8 A;  4XJ2 A;  3Q3X A;  3TGK E;  1CA0 C;  1DOJ A;  2FWW A;  3RU4 E;  3AW0 A;  1MBM A;  2ZU3 A;  3GY7 A;  2Z3D A;  4TWW A;  3AAU A;  1T4V H;  2V6N A;  1CA8 B;  2IAB A;  1GI2 A;  1MMJ N;  3BG4 B;  3F6U H;  3UFA A;  1K1O A;  1C5U A;  2ZHE H;  1MD8 A;  1DLK B;  1O3D A;  2KCP A;  1UK3 A;  1TOC B;  2WPD D;  5AFY H;  4XDE A;  1NC6 A;  1O33 A;  1O2W A;  5H4I B;  1V2L T;  2Z9G A;  3EA7 A;  4XOJ A;  6LPR A;  4O97 A;  3FP8 E;  2FM2 A;  2C4F H;  3KQB A;  1FIZ A;  5EGM A;  2C93 B;  5JPM H;  3ZVA A;  2GTB A;  3HKJ B;  4JZD H;  3MOC A;  5EQQ A;  1C1S A;  1COW D;  1WUN H;  3ZZ4 A;  2Z9I A;  2VWL A;  1C1M A;  4AFS A;  1YOA A;  5DKM A;  1TBQ H;  3EE7 A;  1SGF G;  3A85 A;  1XUJ A;  2ZU4 A;  1O39 A;  3OSY A;  1SSX A;  1UW7 A;  3PM3 A;  2ZDL A;  5A09 A;  3LT3 A;  2H9E H;  2BY7 X;  1MKX K;  2J38 A;  2RDE A;  2WYJ A;  3LJJ A;  4X6M A;  4Z1M D;  1O2H A;  2BDG A;  1RRK A;  2ILN A;  2G52 A;  2UUJ B;  1T9M A;  2HOB A;  3A88 A;  3K65 B;  3MU0 A;  3BNK A;  1GHY H;  2ZFS A;  3GIS B;  1E35 B;  3P8O A;  4M7G A;  3SI3 H;  1QJ6 B;  1SGI B;  2GZ9 A;  2LEL A;  1K9O E;  3GOV B;  1PYT D;  4RI0 A;  1MZD A;  1TNH A;  3KHV A;  3LH1 A;  4X8S H;  3H09 A;  4SGB E;  1YLN A;  3F68 H;  1F0R A;  1O36 A;  4K8Y A;  2LNC A;  1CGI E;  1GWA A;  1RS0 A;  1ESA A;  1BMM H;  4BAQ B;  1EFR D;  4B71 A;  1TNK A;  1TWX B;  3LGI A;  2ODQ A;  3E4V A;  3ZOE A;  1QQU A;  1W3P A;  5E2O A;  2AGI X;  2ZFQ H;  1O32 A;  1WYK A;  2BY6 X;  2P16 A;  2PSY A;  1PQ5 A;  2Y7X A;  2NU4 E;  2RG3 A;  1VIT F;  4IW4 E;  3R5Z A;  1FN8 A;  4OS2 A;  3U5W A;  3HKI B;  3MU8 A;  1AGJ A;  1RFN A;  1YCP K;  3DUX H;  3RXP A;  3WW7 A;  1AWF H;  1CBW B;  4GPG A;  5KED A;  1KXC A;  2UUK B;  4DT7 B;  1NM6 A;  2G8T A;  3SZN A;  2BLW A;  1T8N A;  1MCT A;  5CHA B;  5FPY A;  1FAX A;  5GPI B;  3SV7 A;  1OPH B;  3GCH B;  5K0H A;  4UFD H;  2ECU A;  2J34 A;  2F91 A;  5E0H A;  5FCR A;  1KY9 A;  1VJA U;  1O2X A;  4UHV A;  3ZZ8 A;  4D9R A;  1K22 H;  4R8T B;  3PTN A;  3UIR A;  3R5W A;  2OBO A;  1MZA A;  4E05 H;  1YWU A;  4YXW D;  1C1V H;  8KME 2;  2EC9 H;  2BD5 A;  2C8Z B;  1SFI A;  1KYN A;  1F5R A;  1OXG A;  3VEQ B;  3A83 A;  4IC5 A;  1ABI H;  3OYP A;  3A8A A;  3RXD A;  1KTT B;  1DVA H;  2QF0 A;  1TPP A;  1GL1 A;  1EAU A;  2VIN A;  3F0O A;  1ZTL A;  2OC7 A;  3JZ2 B;  1JXP A;  1O2S A;  2FS9 A;  4BAM B;  1GJ6 A;  1FJS A;  3EE0 B;  1A5I A;  3LGT A;  3FGE A;  3CP7 A;  2YMS D;  1N6X A;  1Z6J H;  3MH6 A;  3I77 A;  1EJM A;  1Y3W A;  2BD4 A;  3F9E A;  5FL7 D;  2H6M A;  3S7K B;  3DNH A;  3PYH A;  4Y76 A;  3ITI A;  1SLU B;  1FNI A;  2HNT F;  4AFQ A;  1ELF A;  3VB3 A;  1AIX H;  1EST A;  5CHA C;  3ZZC A;  4F49 A;  4JZI A;  1ORF A;  2VH0 A;  4U32 A;  1G37 A;  3MH5 A;  4K2Y A;  3URD A;  5J4Q A;  1IOE A;  5LPR A;  2VU8 E;  5C5O A;  4TV4 A;  5IYT A;  1EPT C;  1V2J T;  3K86 A;  3EDX B;  5EOK A;  3BSQ A;  4Y0Z E;  4AOQ A;  1BQY A;  3FKH A;  3F7E A;  4KTC A;  1ZPC A;  1T7C A;  1P09 A;  1JNW A;  3LJO A;  1DNL A;  4ABB A;  3ZOC A;  4DCD A;  4UE7 H;  3U8R H;  2FIR H;  1YPH E;  1BUI A;  2P3F H;  1EB2 A;  2R0X A;  1C5Z B;  2RDL A;  2W7S A;  4WVP E;  1BML A;  2P3T B;  2XBW A;  2QIQ A;  3MO6 A;  5EST E;  4Y79 A;  1Y30 A;  1AVW A;  4ABE A;  1ZMJ A;  3PMA B;  3RXB A;  5T3H A;  4NA7 A;  2WYG A;  4HMU A;  1BHX B;  1BTH H;  2JJ2 D;  2WSS D;  2ZC9 H;  3GY6 A;  1GJ8 B;  2VB0 A;  3P95 A;  1Z71 A;  1EUF A;  2VH6 A;  4N7R C;  3ZVB A;  3H7O A;  1BTU A;  4NIW A;  3TJU A;  5C5N A;  1FY1 A;  1WTG H;  2KZ4 A;  4WH8 A;  4I8G A;  4IBL H;  2B5T B;  1KXE A;  4JYV H;  1LDT T;  3LOX A;  3SW2 B;  1VZQ H;  3A8D A;  2F9B H;  2QGR A;  1FQ3 A;  4Q7Y A;  1W2K H;  1G76 A;  2AQ6 A;  1AUJ A;  1C9P A;  1V3X A;  2H5D A;  4NFE A;  1C1U H;  1SOT A;  2KM0 A;  1E1Q D;  1GMD F;  1UVP A;  3DHK H;  1G9I E;  2G5V A;  1CE5 A;  4Q2K A;  1W0Z U;  2D1J A;  2I02 A;  1EQ9 A;  1PYT C;  5FCK A;  4DII H;  1ELE E;  4YWN A;  3RU4 D;  2Z7F E;  2ASF A;  2SFA A;  1RZ0 A;  4X2W A;  1FY3 A;  1SC8 U;  4AYY B;  2VIW A;  1KDQ A;  1HCG A;  2O8L A;  1O5C B;  1SR5 C;  5HYO A;  1T8O A;  1O2R A;  1BOQ A;  1XKB C;  2ZKS A;  4R0I A;  1HXE H;  4H42 U;  4GCH F;  3BTF E;  1CHO F;  2WPI S;  3QO6 A;  2PLX A;  2F9O A;  2H5C A;  1N1L A;  2LP6 A;  4Y6D A;  5FAH A;  1ETR H;  4ZMA H;  3TGJ E;  1O3C A;  1NRQ H;  1RFE A;  4YTA A;  2VIP A;  1KMH B;  4P02 A;  1YPJ H;  1TY9 A;  1THS H;  6GCH F;  4X0W U;  3DFL A;  2XOK D;  2VWO A;  3CP3 A;  3ELA H;  1DX5 M;  1P2Q A;  1BIT A;  1ZTK A;  3GDU A;  1GBB A;  1GI5 A;  1NRR H;  2AFQ B;  1H9I E;  2PFE A;  2FHQ A;  3P92 A;  3FP6 E;  4LOY H;  1LVY A;  5DN6 D;  1ELG A;  2ZTX A;  4GVU A;  1O3B A;  1ZOM A;  1L1N A;  2TIO A;  8EST E;  2FXR A;  1L2E A;  3V0X A;  4MPW A;  2JET C;  4OS6 A;  1FV9 A;  1RD3 B;  3D49 H;  1FUJ A;  1V6D A;  2QV1 A;  5BPE A;  2PTC E;  1W7X H;  5CHB A;  3R5R A;  3TPI Z;  2IG6 A;  4X8V H;  1AHT H;  1G78 A;  4RN6 A;  1QRW A;  1BTY A;  3PV4 A;  2NU0 E;  1O2Z A;  3F2H A;  1KTS B;  1NBM E;  1L4D A;  2GCH F;  3FO8 D;  4B6F A;  4BTI B;  1O0D H;  3PO1 C;  4MPV A;  2FLR H;  1P06 A;  3OEH D;  1C5S A;  3MHW U;  2GVF A;  4X6N A;  1LPG B;  4DOQ A;  2SGF E;  4JYU H;  2ZWL H;  4OS4 A;  1WCZ A;  2A45 B;  1K1L A;  2BQ6 B;  5HIZ A;  4DJZ B;  2FOA A;  5EJZ A;  1ZSJ A;  3LDX H;  2GGV B;  4H6T A;  1P2J A;  1BTP A;  2P8O B;  3U8O H;  1EB1 H;  2TBS A;  2F9U A;  3MO9 A;  2XW9 A;  1TNL A;  1BCU H;  3SU1 A;  2IJD 1;  3TVJ B;  3A82 A;  4XRN A;  3SJK A;  2G4T A;  1C5Q A;  3UWI A;  2SGA A;  2A1D B;  3AW1 A;  2SNV A;  5EIY A;  4F07 A;  2SNW A;  1C5N H;  3U28 C;  1TIO A;  5ESC A;  1KLT A;  1GBM A;  1NTP A;  1NRN H;  3R5Y A;  1Y3Y A;  4BAH B;  4YOG A;  4B73 A;  1V2O T;  3RLW H;  3SUF A;  2W26 A;  3A81 A;  3RXJ A;  3GCT G;  3OX7 U;  1GI8 B;  2C8Y B;  3BIV H;  4I33 A;  1G3E A;  3O8B A;  5T6G A;  1K1M A;  2JH6 D;  4WXI A;  1JRS A;  4CRE A;  1O2P A;  3M7Q A;  1GCD A;  3MH7 A;  3QDZ B;  3K2U A;  3R3G B;  4WWY A;  3BTW E;  1O3F A;  1VCW A;  1EOL A;  3S9B A;  2VGC B;  4O3U A;  2BD3 A;  1OWI A;  1SGC A;  1A7S A;  3TK6 A;  3F0P A;  2THF B;  1SGY E;  1MAX A;  3SV9 A;  1TQ0 B;  1RTF B;  3LH3 A;  3N7E A;  2OIN A;  3ZVD A;  3SQH E;  2IN2 A;  3SOS A;  2CK3 D;  2EY4 C;  1I0S A;  4ISH H;  2DE8 A;  1NS3 A;  4ZKS U;  5E2P A;  1K1J A;  4Y10 E;  1O5E H;  1OOK B;  1O5B B;  4OGX A;  1BA8 B;  1O2U A;  2H1U A;  4LZ4 B;  3PMH B;  2A2J A;  3VXF H;  5IK2 D;  1GPZ A;  2HNT E;  3EGK H;  3E1X B;  1O2Y A;  4Y8Z A;  3UOU A;  4YLU A;  5ETX A;  1EJN A;  1QBN A;  2R0K A;  4DW2 U;  2JKH A;  1Y8T A;  2FG9 A;  5T1V A;  4K1E A;  3RU4 T;  2J98 A;  1C1Q A;  1PFX C;  2AIQ A;  1VCP A;  2FOF A;  1IQN A;  2PUX B;  3VB4 A;  3A6R A;  4WMD A;  5GIB A;  2ZDK A;  1UCY K;  2QA9 E;  3SGB E;  3TJN A;  2O8M A;  3NZI A;  1V2V T;  5PTP A;  1E79 D;  4Y7B A;  1C5R A;  1GBJ A;  3SNB A;  1TGT A;  1HRT H;  3BTQ E;  1TLD A;  4HGC A;  2J4I A;  2PGB B;  4AX9 H;  3CB0 A;  3RXV A;  4HMV A;  4BAO B;  3T5F H;  2LPR A;  5EW2 H;  1YKT A;  2GT8 A;  1C1P A;  1ZYO A;  5DP5 A;  2KFW A;  3RXE A;  3ODF A;  1MKX H;  1ZLR A;  1HAX B;  1L4Z A;  3U98 H;  1CHG A;  4MNV A;  1N8O C;  3HK6 B;  2Z3C A;  3SOR A;  4X1P U;  3MFJ A;  3TNS A;  2Y80 A;  1B7X B;  4IMQ A;  3Q3Y A;  1IQJ A;  3C27 B;  3E0N B;  3E6P H;  1GMC F;  1TRM A;  4HX6 A;  3UOP A;  1C2K A;  2CHA C;  4YES B;  5EG4 A;  2ANY A;  2FOG A;  4K8B A;  3IWM A;  3UR6 A;  4HMT A;  3ZZ7 A;  1LVO A;  2JH5 D;  1MKW K;  1VCQ A;  3PRD A;  1SMF E;  4Q7Z A;  1T31 A;  2EEK A;  1OKX A;  3T29 A;  2HLC A;  4JZ1 A;  1A46 H;  1V2M T;  1QB1 A;  3S9C A;  1WXR A;  1THR H;  3GYL B;  3GCN A;  2J9N A;  2UWO A;  4SGA E;  4E7R G;  2BLO A;  1C2H A;  1Q31 A;  1FY8 E;  2FTM A;  2SGQ E;  2P3U B;  2ZQ2 A;  1HGT H;  2EI7 A;  4HG6 A;  1GJ5 H;  3P8N A;  3ZZ6 A;  5FXL A;  4NWK A;  2H9T H;  1VKY A;  1MAB B;  2B7D H;  4JK5 A;  4I31 A;  4NIV A;  1DXW A;  3S9A A;  4J1Y A;  1G3D A;  3ZZ5 A;  1BMA A;  1W13 U;  3QTO H;  3STJ A;  1ZSL A;  1YP9 A;  3SV2 H;  1ZHM A;  1CT2 E;  2ZPR A;  1H8H D;  3KEE A;  3OY6 U;  3RM0 H;  3TIT A;  2FOB A;  5TCA A;  2JET B;  3M3S A;  3A7V A;  3M3T A;  4FU7 A;  3A7X A;  2O8T A;  2FUR A;  3QZR A;  1SQR A;  3H96 A;  1MTW A;  1SQO A;  1E34 B;  1G36 A;  1SGP E;  4Z0K A;  2BD7 A;  4IC6 A;  1XMN B;  2CF8 H;  2ZI2 H;  1UVT H;  2FTL E;  4XFQ A;  1KSN A;  2ZFR H;  2WIN I;  3HE1 A;  3I78 A;  4A1V A;  1SQT A;  1SI5 H;  4HMW A;  2RFK C;  2AS9 A;  1C2L A;  2VVU A;  2ANK H;  1GJB B;  2BDA A;  3T28 A;  1HYL A;  1A5G H;  4Y71 A;  1O3O A;  1RXP A;  1Q3X A;  3LGV A;  2P59 A;  4MG3 A;  3D65 E;  1GVK B;  1T8L A;  4YLQ H;  3T25 A;  1Y5U T;  1RIW B;  4XD7 D;  3SJI A;  1SGD E;  1AB9 C;  2AHM E;  1OP2 A;  1LCY A;  3KCG H;  1ELT A;  3BA3 A;  2ZQ1 A;  3URE A;  1NRS H;  1NU7 B;  1W10 U;  1ZSK A;  3TK9 A;  2QXH A;  1MTN C;  3A87 A;  1SLX B;  1C5L H;  3M37 A;  3LC3 A;  1O2G H;  7GCH G;  3A89 A;  3KF2 A;  1K0H A;  4GHQ A;  1C5X B;  1UTO A;  2FOM B;  4I8H A;  2GMT C;  4D8N A;  4O03 A;  1AE5 A;  1E36 B;  1ELV A;  1BJU A;  1C1W H;  2HTI A;  1P02 A;  3W1E A;  1DST A;  2ZZU H;  1TQ7 B;  2OP9 A;  4MVN A;  2M2A A;  1BTX A;  1SG8 B;  4X1Q U;  3T26 A;  3P6Z B;  1EJA A;  4DUR A;  3SNC A;  3ZVE A;  3PWC A;  1AU8 A;  1O3K A;  4THN H;  3RML H;  3BTG E;  1HAI H;  4K1T A;  2GZ7 A;  4Z85 A;  1S84 A;  5GXP A;  3KNX A;  5EPY A;  3ZVG A;  1PPH E;  1GBE A;  1P2O A;  1O3A A;  1GHX H;  1MH0 A;  3MH4 A;  5ABW A;  1S6L A;  5HM2 A;  3KGP A;  1W12 U;  3FAN A;  4Y11 E;  1NFW A;  2Y7Z A;  2ZFT A;  4WME A;  3SUG A;  3SGQ E;  1FMG A;  1QQ4 A;  1TGN A;  2BY9 X;  4RSP A;  4HI3 A;  3VFE A;  1Y59 T;  3L6P A;  3RMO H;  2P95 A;  2ZF0 H;  1YGC H;  1P8V C;  4ABD A;  2Y6T A;  2PUQ H;  1DM4 B;  2HQ9 A;  2C3S A;  2W6I D;  2Z9K A;  3PRO A;  5A8X A;  3BPK A;  6CHA C;  1LVB A;  1Z7K A;  1GMH F;  2NU3 E;  2L74 A;  2Q6D A;  3M5M A;  1WV4 A;  1I0R A;  1DIT H;  1O5F H;  1QBV H;  2XBX A;  1YM0 A;  3U1J B;  4MPU A;  2CF9 H;  4ZAE A;  4UFF H;  1C5Y B;  1XXF A;  3BG8 A;  3GAS A;  2EA3 A;  4B2B A;  2X1K A;  3ZV9 A;  4HKH A;  1EAT A;  2C90 B;  1H8I H;  2BOK A;  4YOJ A;  1RIW C;  5CHE C;  2UWL A;  1RGQ A;  1AKS A;  1B0E A;  4ISL A;  1FDP A;  1MKW H;  1KIG H;  2P94 A;  1ARB A;  1AUT C;  1GMH G;  1THP B;  2W6J D;  3ZVC A;  5EW1 H;  3NRL A;  1PPE E;  4KTU A;  4Y8Y A;  2TGD A;  4TYD A;  3ENS B;  1AO5 A;  1GBF A;  1QZ8 A;  1O35 A;  1FZZ A;  1HJ9 A;  2ECR A;  3QWC H;  1XM1 A;  2V7Q D;  1OP0 A;  1P10 A;  1MBQ A;  4WXV A;  1GVL A;  3O8D A;  1NN6 A;  1SFQ B;  1XUH A;  1NFY A;  2GCT B;  1O2N A;  2A4Q A;  3SNE A;  1OX1 A;  1O5G H;  3BEU A;  4R82 A;  3HGN A;  1TAL A;  2BZA A;  3TNT A;  1AZZ A;  4JMY A;  4ISI H;  1T32 A;  1UK2 A;  2ZDN A;  1ZPZ A;  4Y9I A;  1UHB B;  3SU6 A;  3QLP H;  2CGA A;  1MU8 B;  5CHO A;  4VGC C;  1QFK H;  3V12 A;  4X1S U;  5DGJ A;  5DP7 A;  2ZHF H;  2ZA5 A;  2AIP A;  4Y8X A;  3A7Z A;  3MYW A;  3OFN D;  3NFW A;  4AB8 A;  2BDH A;  2J95 A;  1KLJ H;  3MO3 A;  2JIZ D;  2GDD A;  2O9Q A;  3F2G A;  1HPG A;  3PMJ A;  4KKD A;  4TT3 D;  1S81 A;  4AFU A;  3MNX A;  3UUZ A;  3AVZ A;  1SGQ E;  1DWE H;  3UNR A;  2ZGC A;  5GDS H;  3UAI C;  4CH8 B;  1V2R T;  1ZJD A;  5B6O A;  3PRB A;  4I8K A;  2PTN A;  1XVM A;  3RXM A;  5DSF A;  1HAY B;  4MNW A;  1O3I A;  3K6Z A;  4X2Y A;  1DAN H;  1MD7 A;  1EOJ A;  4ABF A;  1QA7 A;  2XBY A;  1DWB H;  2FPZ A;  1TRN A;  3H7T A;  4K3J A;  1EZS C;  1QL7 A;  5L6N H;  1PPF E;  1IQM A;  4Q80 A;  1HDT H;  4NA9 H;  1J16 A;  2E83 A;  2GUJ A;  3RXI A;  2VIQ A;  2YMS C;  1AY6 H;  3AK5 A;  4FUI A;  4X6P A;  5SGA E;  1IHS H;  3RXQ A;  1JIM A;  2BY5 X;  2ULL A;  4WF8 A;  1EAS A;  1Z8R A;  1YC0 A;  1TAW A;  1PQ8 A;  2ZG0 H;  2OQU A;  3KN2 A;  4B2C A;  2UWP A;  2JH0 D;  1UTK A;  3H5C B;  1C2G A;  4YZU A;  5HGG A;  2J97 A;  2A0Q B;  3A7T A;  1OYQ A;  1JIR A;  1GHA G;  4OM9 A;  1IQG A;  1XX9 A;  3WY8 A;  4LXB H;  3CEN A;  1QHR B;  4FUF A;  1INC A;  2WV4 A;  3N99 A;  3VG8 A;  3RXR A;  3TJO A;  2BHG A;  5I46 H;  1GCT C;  3RXS A;  2TRM A;  3AAS A;  2IPH A;  2OLG A;  1K1P A;  1TGS Z;  3TGV A;  2WV5 A;  4FU8 A;  1YPG H;  5DP4 A;  3SI4 H;  4IRA A;  3ZZA A;  3ZOG A;  1SKY E;  4ZKO U;  1TPS A;  4FUJ A;  1S0Q A;  1ZPB A;  3MMG A;  3MQK C;  2KAI B;  3ODD A;  3T62 A;  3ZOF A;  4MQA A;  3P8G A;  2BX3 A;  2HAL A;  2A5I A;  3PLP A;  4A6L A;  1O2Q A;  3SJ9 A;  3U8T H;  1UK4 A;  2Z9L A;  4U30 A;  4B1T A;  4RKJ B;  1M9U A;  4FVD A;  2F9P A;  1L1G A;  3GY2 A;  4D9Q A;  4CBO A;  2ZDA H;  1A3B H;  1L1J A;  1C2E A;  1NT1 A;  2ZDM A;  3B9F H;  4P00 A;  1WLI A;  1ARC A;  1HJA B;  2PKA B;  8GCH G;  4BAK B;  4CRF A;  4ABI A;  2R3U A;  4ACA A;  4AZ2 B;  4UDW H;  4NZQ A;  1O3H A;  1TMU H;  4U2W A;  1GDN A;  5EJ1 A;  4O9V A;  2RA0 A;  3S69 A;  5K7R A;  1GHA F;  1O34 A;  3M36 A;  1ZHP A;  2FZZ A;  5BNC A;  5GCH F;  2PSX A;  4FUH A;  3ZYD A;  2XBV A;  3F9G A;  1TFX A;  2WUC A;  4IN1 A;  4Q4L A;  4A1X A;  1WQS A;  3MNC A;  3BV9 B;  1BB0 B;  1WDI A;  4AOR A;  5CDF E;  1MTU A;  5A8Y A;  4RT1 A;  4CR9 A;  1P2K A;  3P8F A;  4YT6 H;  5DPA A;  1SGT A;  1JOU B;  1O2V A;  3TGI E;  3VY5 A;  1GJD B;  3V13 A;  2VIV A;  2HVY B;  3GS9 A;  3V3M A;  1MAY A;  2ZU5 A;  2FEQ H;  2V3O H;  1DDJ A;  1B5G H;  2Q1J A;  1XXO A;  3ZZ3 A;  1HAV A;  2J94 A;  2BXT H;  3NKK A;  2K4Q A;  1MU6 B;  1QGF A;  3B5M A;  3ZZD A;  4MDS A;  1GMD G;  2F9N A;  3HAT H;  3GDS A;  4CRD A;  5CE1 A;  1CVW H;  4MTK A;  2RE7 A;  1LVM A;  1YPH C;  4TY6 A;  1USF A;  5JB9 S;  4TWY A;  5C1X A;  3B8J A;  2OD3 B;  2FI4 E;  1LQD B;  1VJ9 U;  1OWE A;  3F3B A;  4NWL A;  5DP6 A;  2BOH B;  1F5L A;  5T6D A;  4BNR A;  5KEC A;  1EP6 A;  3M5N A;  4GCH G;  2A4O A;  3OEE D;  3UY9 A;  1P03 A;  4CHA B;  4FOU C;  1AI8 H;  1D3T B;  4I8L A;  2B0F A;  1K28 D;  1USC A;  1ABJ H;  3SUD A;  1GI6 A;  1KXA A;  4CRA A;  2R6V A;  1UO6 A;  5BRR E;  2XWA A;  2TGP Z;  2Z9J A;  2NR4 A;  3A7W A;  1QTF A;  2ZTZ A;  3SQE E;  3M35 A;  2QF5 A;  2OC0 A;  2PKS C;  1O2I A;  3Q3K A;  1TAB E;  3PB1 E;  1AXJ A;  1EAX A;  1AFE H;  2XCN A;  1TE0 A;  1YPL H;  5L30 H;  3U34 A;  3PTB A;  5HXF A;  4E7N A;  5HIY A;  1UHB A;  3MWI U;  1TPA E;  3SU2 A;  1NRP H;  3UPE A;  1C2I A;  1J15 A;  3UTU H;  2VWM A;  4TY7 A;  5DP3 A;  2BX4 A;  1VIT G;  2ZGH A;  1LKB A;  3VGC B;  5JBB S;  1LPK B;  3DSG A;  4B74 A;  1GJ7 B;  1TGC A;  4DIH H;  3GIC B;  1NRO H;  3KYF A;  5DK1 A;  1HNE E;  2D5M A;  2I6S A;  5TJX A;  3DD2 H;  1W0J D;  1D3D B;  1UTM A;  3BEF B;  1YPE H;  2HVX A;  1HXF H;  3G01 A;  1A4W H;  2ZPQ A;  1EXF A;  5GND A;  1IQL A;  4HFP B;  3NPS A;  1G79 A;  5AFZ H;  1V2T T;  3CNR A;  1H9H E;  3EA9 A;  1LHE H;  2VVV A;  1K2I 1;  4BXS A;  2DE9 A;  4XBC A;  3F1S B;  3DFJ A;  5T6F A;  1G32 B;  2ARZ A;  1HIA A;  1BJV A;  1IQK A;  2WPM S;  2BQ7 B;  1F0T A;  4OS1 A;  1ACB E;  3VXE H;  5C1U A;  1TA6 A;  4RKO B;  1ETT H;  3CS0 A;  1TNI A;  5E0G A;  1O31 A;  3U9A H;  2PKS B;  2FOE A;  1RZ1 A;  1T4U H;  4MNX A;  1BRB E;  1V2U T;  1DIC A;  4JZF H;  5F8T A;  1BIO A;  2BDB A;  2TPI Z;  3DB0 A;  2GV6 A;  3QGN B;  3SWJ A;  1FON A;  3QZQ A;  1HFD A;  1LMW B;  1YPM H;  1DLE A;  2AH4 X;  1B0F A;  4HMS A;  5FHT A;  3I29 A;  1NES E;  4IGD A;  3E16 B;  1HLT H;  2WHX A;  2Y5F A;  3SO3 A;  1C2J A;  7KME H;  5HM9 A;  1S82 A;  4FUE A;  4ABA A;  5F6M A;  4XHY A;  4ABJ A;  1K21 H;  3DSO A;  9LPR A;  4HMX A;  1LHF H;  4FVB A;  3SHA H;  1EKB B;  1EAI A;  1WBG B;  1EPT A;  2C8W B;  5JBT A;  1HAP H;  2R2M B;  1EPT B;  1O38 A;  4AYV B;  2EST E;  1DUA A;  3KQ5 A;  1F0U A;  2FOH A;  2KAI A;  1MQ5 A;  1OSS A;  3LPR A;  3A20 A;  1AFQ C;  1BZX E;  3VB7 A;  5C94 A;  1FY5 A;  2R3Y A;  3EYD A;  1IQH A;  1QJ7 B;  4ASU D;  1EAW A;  1DPO A;  2G4U A;  1E37 B;  5EXM A;  1PPZ A;  1KXB A;  2FOC A;  1BRU P;  3R0F A;  2ANM H;  4IS5 A;  1GJ9 B;  1TPO A;  1IHT H;  1TNG A;  5FPT A;  5F03 A;  2ZFF H;  2O8W A;  1AWH B;  2BDC A;  1ZRK A;  2A7C A;  4UFG H;  5AHG H;  1SHH B;  1C2F A;  1CT4 E;  2DUC A;  1BTZ A;  3SNA A;  4GSO A;  1DSU A;  4DT4 A;  3UQO A;  3MI4 A;  5EQR A;  1GI3 A;  5FBE A;  4BOH A;  1P04 A;  1LPZ B;  1AN1 E;  4X1R U;  3UQV A;  1TGB A;  1EZQ A;  2Q6G A;  4VGC B;  2F9V A;  4ZHM U;  4I7Y H;  2WPJ S;  2FX4 A;  3PLK A;  3RXA A;  7EST E;  2OXS A;  2VBC A;  1TX7 A;  2HQ7 A;  1D3P B;  1HAH H;  1SOZ A;  1OP8 A;  1X7A C;  5IDK A;  5JDU B;  2XYA A;  4Q7X A;  4FU9 A;  2ZCK P;  5J4S A;  1C1N A;  2EI6 A;  1V2P T;  3EA8 A;  2J98 B;  1YCP M;  4JK6 A;  4H4F A;  1A0J A;  3WWF A;  2GX4 A;  2BLV A;  3SND A;  1HAV B;  2XND D;  3BTT E;  5AVD A;  3LGU A;  5C3N A;  2CXV A;  4L82 A;  3UNQ A;  1QB9 A;  5EQS A;  1A0L A;  1Y3V A;  1T8M A;  5DP9 A;  1C5O H;  2BD9 A;  3LGW A;  1V2K T;  3M61 U;  3RXL A;  2SGD E;  4QT8 C;  3QUM P;  4CRG A;  1TNJ A;  2YOL A;  3K6Y A;  3M5O A;  3C1K A;  2PHB A;  1G77 A;  3ZZ9 A;  1O2K A;  2ALV A;  1AQ7 A;  3GCH C;  2AGG X;  1GHB F;  3BEI B;  1TBZ H;  1YBW A;  2FI3 E;  2K0Q A;  2VVC A;  1O2M A;  2FX6 A;  1J9C H;  1LHC H;  2OUA A;  5C2Z A;  2L1T A;  1YLD A;  1CQQ A;  4UFE H;  1VR1 H;  1LTO A;  1UVS H;  2OC1 A;  3NK8 A;  1SHY A;  3M5L A;  3RXO A;  1FIW A;  4JZE H;  1YLC A;  4NG9 H;  1HAO H;  2TGA A;  3Q76 A;  3ATK A;  1UTQ A;  2ZEC A;  3A86 A;  1GBD A;  2EQN A;  3RUO A;  1V2W T;  2PTF A;  4A1T A;  5C67 A;  3N7D A;  4BTU B;  1P2I A;  2HWL B;  1UTL M;  3EST A;  1IQE A;  2W3K A;  3A6Q A;  3M3V A;  1O2J A;  2TGT A;  3A84 A;  1KXF A;  2ZP0 H;  1D3Q B;  1FY4 A;  4XBB A;  2CMY A;  1WSS H;  2D37 A;  3ZOH A;  2KCO A;  2AMQ A;  2XRC A;  2ZGX H;  3MTY A;  3UR9 A;  1O3L A;  3MNS A;  2A2X H;  4NSY A;  1Y5B T;  1CGJ E;  2JDI D;  2STA E;  3RMN H;  2X1J A;  1CO7 E;  2AER H;  3ATM A;  3TK5 A;  1BT7 A;  1RTL A;  3LIW A;  1P2M A;  5JBA S;  1O2O A;  3VB6 A;  5JB8 S;  4E06 H;  1XUK A;  1ETS H;  1TB6 H;  1W11 U;  3ZIA D;  2V3M A;  3TLO A;  3PO1 B;  4X2X A;  1SPJ A;  1GI4 A;  1W8B H;  2A5A A;  4BTT B;  5KGO A;  3VY2 A;  1LO6 A;  3ZZB A;  1GG6 B;  3PV2 A;  4XBD A;  1V2S T;  2A7J A;  2A2Q H;  3AMF A;  3KID U;  2QYI A;  2HHZ A;  1J8A A;  1NRG A;  1WLK A;  1E0F D;  1HAZ B;  2D38 A;  3MU5 A;  1FPH H;  1Z1J A;  1C5P A;  1ELC A;  3TH2 H;  3F9F A;  4DG4 A;  3IN6 A;  3EAJ A;  3SUE A;  2WPK S;  2GD4 B;  4D7G A;  4XE4 A;  2PV9 B;  3UNS A;  4K5Z A;  2FLB H;  4B76 A;  3A8B A;  3GDV A;  3SGA E;  2BVS H;  2FP7 B;  3FAO A;  5E0J A;  2O8U A;  1MTN B;  2KR7 A;  3W94 A;  4YM9 A;  1GJC B;  1DWD H;  4W64 A;  4X8U H;  2G81 E;  3SHC H;  2Z6B D;  2QXG A;  1YPK H;  2QEA A;  3RXF A;  2XXL A;  1DUE A;  1MUE B;  1P9U A;  2GMT B;  2SGE E;  1XKA C;  4X2V A;  3DMB A;  1C5M D;  1G30 B;  1MTS A;  1GHZ A;  2QF4 A;  2KCA A;  4NFF A;  5TCC A;  1W14 U;  1PQ7 A;  4MTB A;  3IG6 B;  2QF3 A;  2QCY A;  2IOT A;  1W3R A;  4J2Y B;  2IPQ X;  2A4G A;  1TOM H;  3W95 A;  1AZ8 A;  1NZQ H;  4CH2 B;  4ISO A;  3BTH E;  4B6E A;  1A5H A;  2ZU1 A;  4Q63 A;  3VPK A;  4GLY A;  1K1I A;  2QC2 A;  4FUD A;  1OWH A;  2VJ1 A;  1QBO A;  1QUR H;  2V0B A;  1GI0 A;  2G5N A;  3BIU H;  3OY5 U;  1GL0 E;  1AD8 H;  1OWD A;  2ZHD A;  1GDU A;  1P9S A;  2GCH G;  4YBN A;  2PKA A;  1LKA A;  1WTH D;  1XXD A;  3EAA A;  2P5Z X;  1F92 A;  2V3H H;  4NCY A;  3SYJ A;  1O2T A;  3WWB A;  4KGA A;  4AC9 A;  2G51 A;  1J14 A;  3PMB B;  5C20 A;  3KQD A;  3KYG A;  3RC4 A;  2HLD D;  1GJA B;  2H9H A;  2G55 A;  3O8C A;  2GZ8 A;  1UMA H;  4DGJ A;  1VIT H;  3BF6 H;  1PPB H;  1GHB G;  6CHA B;  2A5K A;  3SU4 A;  4B75 A;  1GBI A;  2R0L A;  3SBK A;  4OGY A;  5C0T A;  1ID5 H;  3E0P B;  8LPR A;  3NCL A;  4AGJ A;  3RMM H;  1SQA A;  1G3C A;  1C4U 2;  3TH3 H;  3VYA A;  1S5S A;  3BTE E;  2SGP E;  1QY6 A;  1V2N T;  5F53 A;  4I86 A;  2Q9K A;  3LC5 A;  1TMB H;  3DCL A;  3BTK E;  2QE7 D;  3P70 B;  4K69 A;  4OS5 A;  4K1S A;  4U01 A;  1JMO H;  1BDA A;  4Y0Y E;  2YMS B;  1C5V A;  9EST A;  2GV7 A;  1G2L A;  5G4B A;  2ZNK H;  1JBU H;  2P93 A;  1EP5 A;  3KQE A;  1WV7 H;  5I25 A;  3QGJ A;  3UWJ H;  1JWT A;  4ZXY H;  2ZCH P;  4LK4 A;  1F2S E;  1SL3 A;  5A2M H;  1SGR E;  1CHO G;  3OE7 D;  3TU7 H;  5CMX H;  3PWB A;  4TSF D;  1GI9 B;  1L0Z A;  4DVA U;  1SLW B;  1LHG H;  2FOD A;  1AVG H;  3FZZ A;  5C1Y A;  1Y3X A;  1SBW A;  2EI8 A;  2B8O H;  3OTJ E;  2WPL S;  1YF4 A;  2VPA A;  2K1Q A;  2XCF A;  1AB9 B;  2P8O C;  3ZV8 A;  3PLB A;  1CI0 A;  1HUT H;  2QN5 T;  2V35 A;  3RXG A;  1TMT H;  5DP8 A;  3OAA D;  1U6Q A;  1UJ1 A;  1SGN E;  3D23 A;  3SU3 A;  2Z94 A;  3BTM E;  3E8L A;  1PQA A;  2ZGJ A;  1TA2 A;  1A1R A;  4GAW A;  5JAB A;  1A2C H;  4YT7 H;  5B6L A;  5A0B A;  1Z1I A;  2BMG B;  1KLI H;  1GBL A;  2RA3 A;  1Z8G A;  1GGD C;  3GY4 A;  1NBM D;  3FFG A;  3VB5 A;  5LGO A;  2IJO B;  1C4Y 2;  3ZYE A;  4A7I B; 
#chains in the Genus database with same CATH homology
 2IML A;  5ESC A;  3HY8 A;  3R5L A;  1AXJ A;  3A6Q A;  1RZ0 A;  3U34 A;  1YOA A;  3R5Y A;  4Y9I A;  3AWH A;  5CHO A;  1W3Q A;  4Z85 A;  1WGB A;  2I51 A;  2D37 A;  3ZOH A;  4P00 A;  1WLI A;  3ZOD A;  3DSG A;  4YBN A;  2RDE A;  1W3O A;  3KYF A;  3R5P A;  3U0I A;  1W9A A;  2D5M A;  3FGE A;  3NFW A;  3RH7 A;  4HG6 A;  3KYG A;  5EJ1 A;  3U35 A;  1T9M A;  2X1J A;  5BNC A;  4ZKY A;  1RFE A;  3DNH A;  4P02 A;  1TY9 A;  3BNK A;  1G79 A;  3CNR A;  3CP3 A;  2HTD A;  3VYA A;  1YLN A;  1I0S A;  2HQ9 A;  5KGO A;  2ARZ A;  2FUR A;  3VY2 A;  3BPK A;  2FHQ A;  3H96 A;  4I86 A;  4RT1 A;  2Q9K A;  2L74 A;  1VL7 A;  2HQ7 A;  2OU5 A;  1WV4 A;  3AMF A;  4QVB A;  1I0R A;  2HHZ A;  2A2J A;  3K86 A;  3E4V A;  3ZOE A;  3VY5 A;  1NRG A;  1WLK A;  1W3P A;  2D38 A;  3F7E A;  3FKH A;  2E83 A;  1JNW A;  3K87 A;  1DNL A;  1RZ1 A;  2FG9 A;  3ZOC A;  3IN6 A;  3PFT A;  3GAS A;  1XXO A;  2X1K A;  3R5R A;  4HMW A;  5EJL A;  2IG6 A;  3A6R A;  4L82 A;  3R5Z A;  2R0X A;  3DB0 A;  3U5W A;  3B5M A;  1G78 A;  3SWJ A;  3EC6 A;  4XJ2 A;  5CHE C;  4HMS A;  5KED A;  1Y30 A;  2IAB A;  1G77 A;  3HMZ A;  4HMU A;  2QEA A;  3CB0 A;  2RE7 A;  1USF A;  4HMV A;  3BA3 A;  4N7R C;  4XHY A;  3DMB A;  2VPA A;  4RT0 A;  2ECU A;  2ECR A;  2QCK A;  1EJE A;  4HMX A;  1CI0 A;  5EJZ A;  5KEC A;  3TGV A;  4F48 B;  4IRA A;  2OL5 A;  1G76 A;  1XHN A;  2AQ6 A;  3ZOG A;  1FLM A;  4FOU C;  2D36 A;  4XRN A;  1USC A;  3K88 A;  1W3R A;  5JAB A;  2R6V A;  3A20 A;  4HX6 A;  3R5W A;  2GJG A;  2HTI A;  1YWU A;  2NR4 A;  3ZOF A;  2I02 A;  4HMT A;  5EIY A;  2PTF A;  4YWN A;  4F07 A;  4R82 A;  2ASF A;  2ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...