3KYIA

Crystal structure of the phosphorylated p1 domain of chea3 in complex with chey6 from r. sphaeroides
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
128
structure length
127
Chain Sequence
MDEIWALYADDGAQALDAMEASLLALQAGEDAAAHVGPLFRAVTFKGNSRVLGLSVVESRAHLCEDLIGLVRDAGVPMDGEIVEILLFASDTLRAMLEETAASRADVEGTGSEALMDQLRSKIARCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative histidine protein kinase
publication title Using structural information to change the phosphotransfer specificity of a two-component chemotaxis signalling complex
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 50
structure length 127
sequence length 128
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3kyiA00
2LD6A 1YVIA 2Q4FA 2LCHA 3KYJA 2OOCA 1A0BA 1QSPA 3MYFA 1Y6DA 3U3BA 1OXBA 3KYIA 3IQTA 2A0BA 4EUKB 2LP4A 1FR0A 1TQGA 3US6A 1BDJB 1C03A 1SR2A 1I5NA 4PACA 4G78A 1C02A 1OXKA 1WN0A 2R25A
chains in the Genus database with same CATH superfamily
5TJ5E 3U9MA 4K0DA 4I1MA 3U2LA 2XL4A 1HW2A 1VTMP 3C7JA 2FAPB 3T6BA 4MVUA 3RQGA 1Q0MA 1S05A 1TWHA 2GWWA 2KYHA 2ZD9A 3KPHA 4U5FE 2R7OA 3NYJA 4EBBA 5L0CA 4U9DA 3IQ5A 2CDQA 3C8GA 3EH2A 3LS1A 4JTDB 3QW1A 5E2QA 3M1CB 3V5XA 1Y4CA 2AWYA 2Y3DA 2Q00A 3K1IA 1QPUA 5F28E 3LNMB 4QI2A 4ZLDA 2HS5A 4Z9IA 1YAUO 2OKUA 1HMOA 4IB4A 4G78A 4JJGA 1E85A 2DI3A 4P9TA 4MTFA 4D4XA 1HE9A 1YARO 2NPUA 1JRAA 4G7ZF 4H54A 4O6MA 4MS2A 3FVYA 1M2OA 4CS8C 3HNLA 1OW6A 3HKKA 2CNWA 1GQAA 2IXNA 3SXZA 3IEEA 4OIQF 4HE8D 1EKYA 1CGOA 3AG2C 2VCAA 4Q7CA 5BQGA 3TOLA 4FX5A 2ASRA 2OCCC 4DRJB 3ABLC 4ER9A 3WAQA 2DYSC 2G3KA 1MMAA 3AG4C 1YYXA 2YKZA 3IQTA 4MTGA 4RBNA 3TJ6A 3LJBA 4IWBA 1QQ3A 5DLJA 3CAXA 3K1HA 2ZXPA 3LEOA 1V4AA 2WZGA 2A1DD 2LK4A 2Y69C 3W8IA 4CSAC 1AVOB 3B9QA 3L0IA 1L7CA 1OKKD 3LS0A 2OQMA 3U0CA 2YWAA 4P9FA 4PR9A 2YRFA 1J8MF 3JZ0A 2HJ3A 1HY5A 4YJWA 1TKNA 2EPKX 4RDAA 4FESA 1RJ9A 4U5CE 1HMDA 5KYYB 2L81A 1H6GA 2HV7A 2P1AA 1MNEA 3EFOB 4ULWA 5A6BD 5JVEA 1YVIA 5JT4A 5B3IA 1OW8A 2EIKC 2IXPA 3ABKC 2Q4FA 2HFIA 4JCHA 2L6GA 4IAOA 3G50A 5F5FA 3B0UX 3RQFA 5COGA 3Q7LA 4O6NA 1PCXA 4LERA 1AUEA 4U5DE 1ZYRF 3DWWA 1ZHWA 1YA7O 2WL8A 2OU6A 4KNVA 4AK9A 4C7OA 3L8IA 4YL0A 1IZMA 2PF4E 3MX3A 1OCZC 3HLZA 2J7PA 1SZIA 2W4MA 1OCOC 2ZPAA 4BJ5A 3RF3A 2GAQA 3V7OA 4E0HA 4EIYA 2PBEA 2R02A 2P7VA 4DXWA 1SR2A 3A9CA 3RVZA 2MYSA 2KSFA 1V55C 4XTKA 2YL0A 1VLSA 4OIPF 3M79A 2V26A 1DOVA 2A0UA 4BPMA 3AGUA 3EG9A 4Q5SF 1XZQA 4JJFA 1NG1A 3JCUQ 1FAPB 2WZLA 3SXMA 2QNLA 1ZU4A 1APCA 3RW0A 2VB6A 4MNDA 4W8PA 5L0JA 1G4WR 2Y3GA 1WTYA 1ZHTA 3N2ZB 3FOOA 4O6YA 3TULA 2ZXOA 1QZXA 4GQHA 2IM8A 3K6BA 1BR2A 1GS9A 1NBBA 2LP4A 3N24A 1V74B 2KJGA 1T6UA 2HV6A 3EZHA 2J45A 3ZSUA 4IARA 1V54C 2KQ9A 3G4ZA 3H65A 3T6GB 2GA0A 2Z15A 5T3TA 4IRUA 4NTAA 2VH3A 3NDBB 2MWQA 2FFHA 4U5EE 4YK5A 3IHUA 3F46A 3LAYA 4K7BA 3S9OA 1EA8A 4XEFA 3IPMO 3POVA 4AL0A 1JOGA 1O5HA 3HNKA 4X0RA 4BG0A 4FAPB 1YJGA 2YQYA 1LE4A 3GODA 2WVNA 2H8AA 1H7IA 4JTCB 3HTKC 4MW8A 5JP7A 5BQHA 2X51A 1MMNA 2L7AA 4AE4A 2IBFA 3NRHA 2NUPA 2NG1A 3U3FA 1W2WA 3QZCA 4DBRA 3L1MA 1Y6DA 1RXQA 3WG7C 1XWJA 2NUTB 1T6IA 4LACB 3KYIA 4U9EA 5DS4A 1RKEB 2XLHA 1EI7A 2XXAA 4MTOA 1Q0KA 1CGNA 1JR8A 5DQTA 1K04A 1BDJB 3EGXB 3LESA 1LI5A 4IJJA 1D1CA 3R7CA 3O55A 1OR3A 3AG1C 3R2PA 4WGYA 3UNGC 5T3WA 1R5ID 5A6BA 4YT5A 4LLEA 1E83A 3E9VA 3K7DA 1TWAA 2H7OA 4YL1A 1FFTC 1Z6AA 2OG2A 5COMA 1YZCA 2Q9BA 2PNOA 3AGTA 3U9JA 4YT8A 1JAFA 5HV9A 5IY5C 3UGPA 2FGYA 3AJMA 4BJ6A 2R7UA 1ZHZA 2VCCA 1FMVA 1U89A 2HJMA 3JYHA 5HSWA 3OA1A 4E0IA 2GFHA 2ZXWC 4N6HA 4XPYA 3I5QA 5KYXB 1HE1A 1Z7Qc 2IXOA 4CX9A 1SYQA 3NG1A 1U0BB 4JIOA 1QKRA 2QTVA 4NQFA 3S84A 2A6HF 4XLNF 4W8KA 5AC5A 3MYIA 4ZLCA 3FAJA 1D0ZA 1JPNA 1YDIA 2HZ8A 2PP4A 1MNDA 2KK1A 1OQCA 3Q7GA 3VYWA 3OWTA 4KI2A 3B71A 4E7ZA 4CJGA 2ICWG 4CS9A 1OR2A 1SF8A 4P6IC 4Q4ZF 3JT1A 4JRZA 3FMSA 2AVKA 3DE9A 3GM1A 1ORJA 1Z5ZA 4JVSA 4RD9A 3ZQVA 4D4NA 1ZW2A 3B0VC 5EHHA 3IQCA 2AWCA 4PK4A 4DVYP 3A11A 3QVZA 1I4ZA 1ZU5A 4PJLA 5E3CA 5KYYA 2DB4A 2EIJC 3GEHA 3ZDLA 3RYLA 3JRMO 2V3CC 1UG7A 3EFOA 2O9XA 2J9WA 4NTFA 3ZC4A 1T5OA 3NMJA 4PJJA 2JX0A 1ST6A 2HKVA 4JZAA 1WASA 1Z23A 1A7VA 3G4XA 3FDQA 5A6AA 2YEVA 5E33A 4M63A 3J06A 4JEBA 3DJNB 1PV3A 3K1IC 1Q0DA 4OIRF 4DRIB 2R25A 5L0DA 3OEOA 2Q9CA 5E3AA 3MLGA 3O10A 4J30B 5T1DB 3ZVRA 2XL6A 2HUJA 1QSPA 4EWCA 4O79A 1ZW3A 1RKCA 2YL3A 3FOPA 4I3MA 3WHNA 1D1BA 2EPNA 2XLMA 3ASNC 2JD3A 3DMDA 5KYUA 3RIPA 3EH1A 1LS4A 2H7VC 4BEJA 4EUKB 3T4RA 3RQEA 3AQCA 4AL1A 5JSLA 1YZAA 3CZ6A 2XLVA 3EJNA 1NFNA 3EPVA 1IW7F 1HW1A 5COFA 3CSKA 4CBEA 1I5NA 1RMVA 3IQ6A 4KC9A 2IXMA 3GORA 4NCQA 5JS5A 5KYUB 2QUPA 2Q3TA 5JLIA 2R9RB 1LIHA 2CCYA 2HMQA 3C63A 1T6QA 2C04A 2G3VA 2J46A 2EPOA 3ITFA 4GYTA 4C3BA 4CDVA 1A0BA 3LEVA 4K1OA 3TK0A 4QI0A 3S0XA 1LS1A 5L0GA 4NTBA 2J9UA 3PMRA 2XS8A 4LLCA 2LFFA 3E70C 3RVYA 1VB5A 1T9KA 4EBKA 1WATA 5CI8A 3I5PA 1YLMA 2EILC 2QLAA 1C03A 3EGDB 3QVYA 3V5YA 5CI9A 4ANJA 1JMWA 3DKAA 2H7BA 4PACA 2MHRA 3ZTMA 4MVMA 5K0IA 1L3PA 3N0TA 3HNIA 2NSFA 3QMKA 2PX0A 2C03A 4FWVA 2D4UA 3FHDA 4BJ5C 2KW3C 4JE9A 2YL7A 4YT4A 3BEHA 2OJED 3PDMP 3NKDA 2NUTA 2YL1A 1TR2A 1RKEA 3DI5A 2R7RA 3RFYA 3QW0A 3SEOA 2TMVP 1M2VB 5D91A 1NU7D 3EGXA 4UDVA 2XSEA 5FZTA 3JYYA 1LKXA 4AX2A 4N06A 4PFOA 3PHF2 4GEHA 2A68F 2Y3HA 3C8ZA 4N6CA 1CPRA 3TJ5A 4CDYA 1R4TA 2LFDA 4E7SA 1FR0A 5L3VA 4HEAJ 2D5RB 2Q9AA 5JRAA 2M4EA 4G7OF 3F47A 1OKKA 2ZXRA 5GPGB 1GM5A 3ECSA 1D0XA 3UMIA 4KBLA 3NMIA 4JCZA 2DYRC 4DVZA 2P6VA 3NYLA 5BQIA 4O7GA 3DAFA 2DGJA 2IYLD 2B0HA 2CGEA 1Z63A 1WN0A 1VYKA 2XRHA 3M4BA 1G4US 3SXKA 3GEIA 5AGFA 3CQZA 3B0PA 2E87A 5KYXA 2OOCA 3SZRA 1NFOA 2BE5F 1WGWA 1E84A 4MVRA 3EQLF 2XM0A 3GWLA 4LDKA 1OXBA 5KYWB 3U2MA 3LLIA 256BA 3C18A 3KMIA 2A6EF 1I4YA 3ZWIA 3L8JA 1TQGA 1KTMA 3EHMA 4Z9JA 4IGGA 1FTSA 2QY9A 2R7QA 3V5ZA 3DZAA 4OD4A 4NY3A 3I4UA 4PJNA 3U8PA 3W2WA 2OJQA 3S28A 4CS8A 1ZVZA 5A6JA 1NZEA 3UR3C 1ORYA 2IOQA 2PX3A 1H9GA 1Z3IX 3DE8A 3S90A 2OEVA 3AQBA 3HNJA 1OXKA 1DOWA 3LLKA 1ZHYA 3O39A 2XLDA 4YWQA 1C17M 2LD6A 2W4BA 4R32A 3VAYA 4I44A 3LNRA 3U8VA 2ETSA 1VMAA 3K33A 4CIPA 1D0YA 3KYJA 3ZTZA 2GDCA 1BBHA 2OEXA 3M4CA 1AEPA 4J7YA 4JTAB 2UUHA 4G7HF 4CSAA 4A2NB 3U3BA 1ZHXA 3ABMC 3JTLO 5L0HA 1JPJA 3DM9B 2F22A 1ORSC 1KNYA 4JEAA 2XLEA 1A41A 4N4WA 4BJ6C 3B29A 4MVSA 5FCLA 2J0WA 2J0XA 3SNHA 2YLDA 2PFDA 3KL4A 4G0HA 2CYDA 4EBJA 2R05A 3C8GB 1TWGA 2R7VA 1TFKB 1VYIA 2L6FA 3DM5A 1RCPA 1A7EA 5KYNA 2J8WA 2R7XA 1MMGA 1PD0A 3UMHA 1KU2A 1WOLA 1TWCA 1K05A 3DJUB 3GM2A 3H2UA 3KH2A 4WABA 3RKOF 4F4BA 5AC4A 4IAQA 4A4AA 4Z9HA 3NMKA 4XPWA 2R7WA 1M56C 3UMKA 1O87A 1H9TA 2WVOA 4JC7A 4H4KC 4ONSA 1LPEA 3W2VA 1J8YF 2EPMX 1VOMA 4U5HA 1CGME 2JPUA 4CS9C 2I8BA 2YLIA 3GM3A 1M6TA 3US6A 2HMZA 3JRTA 2EIMC 3M15A 1BR4A 1OCCC 4L6RA 2KNHA 3GANA 2BL2A 5A69A 3GEEA 1QLEC 2WZFA 1O3UA 3MBGA 2B0JA 2P61A 4XWJA 3ZG1A 3UGOA 3QTHA 5DQZA 4U5GA 2UUIA 4JURI 5DS5A 3MFNA 5A6KA 5DS6A 1MMDA 4XPXA 4E17A 1M57C 1NU9C 4OIOF 1UFBA 2XL8A 1S7ZA 1N1CA 3BRJA 3FXHA 1RJ9B 3H2VA 2VCBA 3MYFA 4WGZA 3T9OA 1LVKA 4DRHB 2KGOA 4MW3A 4OD5A 1XZPA 1TFOB 3EGDA 1CPQA 3JSEO 2J9BA 2A69F 3X1OA 4EKWA 1FMWA 2L6HA 2A0BA 4JW1A 4XEKA 5L0FA 4BEMJ 4YT2A 1NSGB 2L9JA 3PCVA 3C8GD 3AOUA 2YVKA 4J7TA 1EQ1A 2CW0F 1G8XA 2AP3A 4DBQA 2Y39A 4C7OB 3Q6NA 1BZ4A 4HFFB 4OINF 4DOZA 2P0NA 5B3SC 1C02A 4I1OB 1M2VA 3CEXA 5BUOA 3EHNA 4MVZA 5B1AC 5L3QA 2LQGA 5B1BC 3AG3C 2YHSA 4CS7A 2R03A 4JKVA 1BR1A 1MQVA 4B6IA 2CNWD 3T6JA 2BC5A 4YN0B 2WB7A 1OW7A 3EG9B 1YA9A 2XLWA 3O6XA 3ZQYA 4XEVA 5EGYA 3FAPB 3Q6MA 1A7DA 4LDRA 2HSQA 2RD9A 1VK5A 1T01A 3NYMA 3VRCA 1U6HA 3DAGA 4ULVA 2YZSA 3LUTB 1E2XA 3KKBA 3SXYA 1GGQA 5F5HA 4LDQA 1QVXA 1E86A 1Q0FA 3S27A 2RSEB 4WJ0A 4CIHA 1PD1A 1SMYF 3X2QC 3WODF 2XM4A 4PFPA 1ZZPA 4DJ9A 2WVQA 4NC3A 5D92A 1NLXA 2QE9A 2EINC 1G5ZA 1OCRC 2LIGA 2R7SA 4YL3A 2M64A 1LE2A 3RH3A 2R7TA 2YLGA 2KC3A 3GWNA 3JSZA 2Q7RA 2I15A 3TD7A 3DXJF 4XQ1A 4CDAA 3ASOC 5KYWA 1B68A 3TOMA 3DD7A 1LI7A 4KNWA 3ZIBA 2LCHA 1FNTc 2LSEA 2AU5A 5EK0A 3W8HA 3L34A 4C3EA 4U5BE 4XLPF 1VLTA 5CIVA 4EHPA 1D1AA 3SYNA 4BJTA 3VF0A 5L0IA 2NSGA 3U5SA 2X0CA 2EPLX 4AE4B 5JUAA 1LM3B 2NUPB 1F1MA 1YYJA 2VC9A 1K40A 2XLOA 4MVOA 3S29A 4MQ9F 3VM6A 4CJOA 4QDLA 2J7PD 5DVWA 4HFKB 4PJMA 3TQOA 3W4YA 3SP1A 1FFHA 2XS1A 3K66A 4MVQA 1Q0GA 3EZIA 3HJCA 2XXAB 4E18A 2W45A 2HSBA 4J32B 4BJ1A 2G62A 2Y3BA 4C3DA 1WWPA 2J9VA 2VASA 3C62A 3NKEA 2W9YA 3ATPA
chains in the Genus database with same CATH topology
2LD6A 1YVIA 2Q4FA 2LCHA 3KYJA 2OOCA 1A0BA 1QSPA 3MYFA 1Y6DA 3U3BA 1OXBA 3KYIA 3IQTA 2A0BA 4EUKB 2LP4A 1FR0A 1TQGA 3US6A 1BDJB 1C03A 1SR2A 1I5NA 4PACA 4G78A 1C02A 1OXKA 1WN0A 2R25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD6 A;  1YVI A;  2Q4F A;  2LCH A;  3KYJ A;  2OOC A;  1A0B A;  1QSP A;  3MYF A;  1Y6D A;  3U3B A;  1OXB A;  3KYI A;  3IQT A;  2A0B A;  4EUK B;  2LP4 A;  1FR0 A;  1TQG A;  3US6 A;  1BDJ B;  1C03 A;  1SR2 A;  1I5N A;  4PAC A;  4G78 A;  1C02 A;  1OXK A;  1WN0 A;  2R25 A; 
#chains in the Genus database with same CATH topology
 5TJ5 E;  3U9M A;  4K0D A;  4I1M A;  3U2L A;  2XL4 A;  1HW2 A;  1VTM P;  3C7J A;  2FAP B;  3T6B A;  4MVU A;  3RQG A;  1Q0M A;  1S05 A;  1TWH A;  2GWW A;  2KYH A;  2ZD9 A;  3KPH A;  4U5F E;  2R7O A;  3NYJ A;  4EBB A;  5L0C A;  4U9D A;  3IQ5 A;  2CDQ A;  3C8G A;  3EH2 A;  3LS1 A;  4JTD B;  3QW1 A;  5E2Q A;  3M1C B;  3V5X A;  1Y4C A;  2AWY A;  2Y3D A;  2Q00 A;  3K1I A;  1QPU A;  5F28 E;  3LNM B;  4QI2 A;  4ZLD A;  2HS5 A;  4Z9I A;  1YAU O;  2OKU A;  1HMO A;  4IB4 A;  4G78 A;  4JJG A;  1E85 A;  2DI3 A;  4P9T A;  4MTF A;  4D4X A;  1HE9 A;  1YAR O;  2NPU A;  1JRA A;  4G7Z F;  4H54 A;  4O6M A;  4MS2 A;  3FVY A;  1M2O A;  4CS8 C;  3HNL A;  1OW6 A;  3HKK A;  2CNW A;  1GQA A;  2IXN A;  3SXZ A;  3IEE A;  4OIQ F;  4HE8 D;  1EKY A;  1CGO A;  3AG2 C;  2VCA A;  4Q7C A;  5BQG A;  3TOL A;  4FX5 A;  2ASR A;  2OCC C;  4DRJ B;  3ABL C;  4ER9 A;  3WAQ A;  2DYS C;  2G3K A;  1MMA A;  3AG4 C;  1YYX A;  2YKZ A;  3IQT A;  4MTG A;  4RBN A;  3TJ6 A;  3LJB A;  4IWB A;  1QQ3 A;  5DLJ A;  3CAX A;  3K1H A;  2ZXP A;  3LEO A;  1V4A A;  2WZG A;  2A1D D;  2LK4 A;  2Y69 C;  3W8I A;  4CSA C;  1AVO B;  3B9Q A;  3L0I A;  1L7C A;  1OKK D;  3LS0 A;  2OQM A;  3U0C A;  2YWA A;  4P9F A;  4PR9 A;  2YRF A;  1J8M F;  3JZ0 A;  2HJ3 A;  1HY5 A;  4YJW A;  1TKN A;  2EPK X;  4RDA A;  4FES A;  1RJ9 A;  4U5C E;  1HMD A;  5KYY B;  2L81 A;  1H6G A;  2HV7 A;  2P1A A;  1MNE A;  3EFO B;  4ULW A;  5A6B D;  5JVE A;  1YVI A;  5JT4 A;  5B3I A;  1OW8 A;  2EIK C;  2IXP A;  3ABK C;  2Q4F A;  2HFI A;  4JCH A;  2L6G A;  4IAO A;  3G50 A;  5F5F A;  3B0U X;  3RQF A;  5COG A;  3Q7L A;  4O6N A;  1PCX A;  4LER A;  1AUE A;  4U5D E;  1ZYR F;  3DWW A;  1ZHW A;  1YA7 O;  2WL8 A;  2OU6 A;  4KNV A;  4AK9 A;  4C7O A;  3L8I A;  4YL0 A;  1IZM A;  2PF4 E;  3MX3 A;  1OCZ C;  3HLZ A;  2J7P A;  1SZI A;  2W4M A;  1OCO C;  2ZPA A;  4BJ5 A;  3RF3 A;  2GAQ A;  3V7O A;  4E0H A;  4EIY A;  2PBE A;  2R02 A;  2P7V A;  4DXW A;  1SR2 A;  3A9C A;  3RVZ A;  2MYS A;  2KSF A;  1V55 C;  4XTK A;  2YL0 A;  1VLS A;  4OIP F;  3M79 A;  2V26 A;  1DOV A;  2A0U A;  4BPM A;  3AGU A;  3EG9 A;  4Q5S F;  1XZQ A;  4JJF A;  1NG1 A;  3JCU Q;  1FAP B;  2WZL A;  3SXM A;  2QNL A;  1ZU4 A;  1APC A;  3RW0 A;  2VB6 A;  4MND A;  4W8P A;  5L0J A;  1G4W R;  2Y3G A;  1WTY A;  1ZHT A;  3N2Z B;  3FOO A;  4O6Y A;  3TUL A;  2ZXO A;  1QZX A;  4GQH A;  2IM8 A;  3K6B A;  1BR2 A;  1GS9 A;  1NBB A;  2LP4 A;  3N24 A;  1V74 B;  2KJG A;  1T6U A;  2HV6 A;  3EZH A;  2J45 A;  3ZSU A;  4IAR A;  1V54 C;  2KQ9 A;  3G4Z A;  3H65 A;  3T6G B;  2GA0 A;  2Z15 A;  5T3T A;  4IRU A;  4NTA A;  2VH3 A;  3NDB B;  2MWQ A;  2FFH A;  4U5E E;  4YK5 A;  3IHU A;  3F46 A;  3LAY A;  4K7B A;  3S9O A;  1EA8 A;  4XEF A;  3IPM O;  3POV A;  4AL0 A;  1JOG A;  1O5H A;  3HNK A;  4X0R A;  4BG0 A;  4FAP B;  1YJG A;  2YQY A;  1LE4 A;  3GOD A;  2WVN A;  2H8A A;  1H7I A;  4JTC B;  3HTK C;  4MW8 A;  5JP7 A;  5BQH A;  2X51 A;  1MMN A;  2L7A A;  4AE4 A;  2IBF A;  3NRH A;  2NUP A;  2NG1 A;  3U3F A;  1W2W A;  3QZC A;  4DBR A;  3L1M A;  1Y6D A;  1RXQ A;  3WG7 C;  1XWJ A;  2NUT B;  1T6I A;  4LAC B;  3KYI A;  4U9E A;  5DS4 A;  1RKE B;  2XLH A;  1EI7 A;  2XXA A;  4MTO A;  1Q0K A;  1CGN A;  1JR8 A;  5DQT A;  1K04 A;  1BDJ B;  3EGX B;  3LES A;  1LI5 A;  4IJJ A;  1D1C A;  3R7C A;  3O55 A;  1OR3 A;  3AG1 C;  3R2P A;  4WGY A;  3UNG C;  5T3W A;  1R5I D;  5A6B A;  4YT5 A;  4LLE A;  1E83 A;  3E9V A;  3K7D A;  1TWA A;  2H7O A;  4YL1 A;  1FFT C;  1Z6A A;  2OG2 A;  5COM A;  1YZC A;  2Q9B A;  2PNO A;  3AGT A;  3U9J A;  4YT8 A;  1JAF A;  5HV9 A;  5IY5 C;  3UGP A;  2FGY A;  3AJM A;  4BJ6 A;  2R7U A;  1ZHZ A;  2VCC A;  1FMV A;  1U89 A;  2HJM A;  3JYH A;  5HSW A;  3OA1 A;  4E0I A;  2GFH A;  2ZXW C;  4N6H A;  4XPY A;  3I5Q A;  5KYX B;  1HE1 A;  1Z7Q c;  2IXO A;  4CX9 A;  1SYQ A;  3NG1 A;  1U0B B;  4JIO A;  1QKR A;  2QTV A;  4NQF A;  3S84 A;  2A6H F;  4XLN F;  4W8K A;  5AC5 A;  3MYI A;  4ZLC A;  3FAJ A;  1D0Z A;  1JPN A;  1YDI A;  2HZ8 A;  2PP4 A;  1MND A;  2KK1 A;  1OQC A;  3Q7G A;  3VYW A;  3OWT A;  4KI2 A;  3B71 A;  4E7Z A;  4CJG A;  2ICW G;  4CS9 A;  1OR2 A;  1SF8 A;  4P6I C;  4Q4Z F;  3JT1 A;  4JRZ A;  3FMS A;  2AVK A;  3DE9 A;  3GM1 A;  1ORJ A;  1Z5Z A;  4JVS A;  4RD9 A;  3ZQV A;  4D4N A;  1ZW2 A;  3B0V C;  5EHH A;  3IQC A;  2AWC A;  4PK4 A;  4DVY P;  3A11 A;  3QVZ A;  1I4Z A;  1ZU5 A;  4PJL A;  5E3C A;  5KYY A;  2DB4 A;  2EIJ C;  3GEH A;  3ZDL A;  3RYL A;  3JRM O;  2V3C C;  1UG7 A;  3EFO A;  2O9X A;  2J9W A;  4NTF A;  3ZC4 A;  1T5O A;  3NMJ A;  4PJJ A;  2JX0 A;  1ST6 A;  2HKV A;  4JZA A;  1WAS A;  1Z23 A;  1A7V A;  3G4X A;  3FDQ A;  5A6A A;  2YEV A;  5E33 A;  4M63 A;  3J06 A;  4JEB A;  3DJN B;  1PV3 A;  3K1I C;  1Q0D A;  4OIR F;  4DRI B;  2R25 A;  5L0D A;  3OEO A;  2Q9C A;  5E3A A;  3MLG A;  3O10 A;  4J30 B;  5T1D B;  3ZVR A;  2XL6 A;  2HUJ A;  1QSP A;  4EWC A;  4O79 A;  1ZW3 A;  1RKC A;  2YL3 A;  3FOP A;  4I3M A;  3WHN A;  1D1B A;  2EPN A;  2XLM A;  3ASN C;  2JD3 A;  3DMD A;  5KYU A;  3RIP A;  3EH1 A;  1LS4 A;  2H7V C;  4BEJ A;  4EUK B;  3T4R A;  3RQE A;  3AQC A;  4AL1 A;  5JSL A;  1YZA A;  3CZ6 A;  2XLV A;  3EJN A;  1NFN A;  3EPV A;  1IW7 F;  1HW1 A;  5COF A;  3CSK A;  4CBE A;  1I5N A;  1RMV A;  3IQ6 A;  4KC9 A;  2IXM A;  3GOR A;  4NCQ A;  5JS5 A;  5KYU B;  2QUP A;  2Q3T A;  5JLI A;  2R9R B;  1LIH A;  2CCY A;  2HMQ A;  3C63 A;  1T6Q A;  2C04 A;  2G3V A;  2J46 A;  2EPO A;  3ITF A;  4GYT A;  4C3B A;  4CDV A;  1A0B A;  3LEV A;  4K1O A;  3TK0 A;  4QI0 A;  3S0X A;  1LS1 A;  5L0G A;  4NTB A;  2J9U A;  3PMR A;  2XS8 A;  4LLC A;  2LFF A;  3E70 C;  3RVY A;  1VB5 A;  1T9K A;  4EBK A;  1WAT A;  5CI8 A;  3I5P A;  1YLM A;  2EIL C;  2QLA A;  1C03 A;  3EGD B;  3QVY A;  3V5Y A;  5CI9 A;  4ANJ A;  1JMW A;  3DKA A;  2H7B A;  4PAC A;  2MHR A;  3ZTM A;  4MVM A;  5K0I A;  1L3P A;  3N0T A;  3HNI A;  2NSF A;  3QMK A;  2PX0 A;  2C03 A;  4FWV A;  2D4U A;  3FHD A;  4BJ5 C;  2KW3 C;  4JE9 A;  2YL7 A;  4YT4 A;  3BEH A;  2OJE D;  3PDM P;  3NKD A;  2NUT A;  2YL1 A;  1TR2 A;  1RKE A;  3DI5 A;  2R7R A;  3RFY A;  3QW0 A;  3SEO A;  2TMV P;  1M2V B;  5D91 A;  1NU7 D;  3EGX A;  4UDV A;  2XSE A;  5FZT A;  3JYY A;  1LKX A;  4AX2 A;  4N06 A;  4PFO A;  3PHF 2;  4GEH A;  2A68 F;  2Y3H A;  3C8Z A;  4N6C A;  1CPR A;  3TJ5 A;  4CDY A;  1R4T A;  2LFD A;  4E7S A;  1FR0 A;  5L3V A;  4HEA J;  2D5R B;  2Q9A A;  5JRA A;  2M4E A;  4G7O F;  3F47 A;  1OKK A;  2ZXR A;  5GPG B;  1GM5 A;  3ECS A;  1D0X A;  3UMI A;  4KBL A;  3NMI A;  4JCZ A;  2DYR C;  4DVZ A;  2P6V A;  3NYL A;  5BQI A;  4O7G A;  3DAF A;  2DGJ A;  2IYL D;  2B0H A;  2CGE A;  1Z63 A;  1WN0 A;  1VYK A;  2XRH A;  3M4B A;  1G4U S;  3SXK A;  3GEI A;  5AGF A;  3CQZ A;  3B0P A;  2E87 A;  5KYX A;  2OOC A;  3SZR A;  1NFO A;  2BE5 F;  1WGW A;  1E84 A;  4MVR A;  3EQL F;  2XM0 A;  3GWL A;  4LDK A;  1OXB A;  5KYW B;  3U2M A;  3LLI A;  256B A;  3C18 A;  3KMI A;  2A6E F;  1I4Y A;  3ZWI A;  3L8J A;  1TQG A;  1KTM A;  3EHM A;  4Z9J A;  4IGG A;  1FTS A;  2QY9 A;  2R7Q A;  3V5Z A;  3DZA A;  4OD4 A;  4NY3 A;  3I4U A;  4PJN A;  3U8P A;  3W2W A;  2OJQ A;  3S28 A;  4CS8 A;  1ZVZ A;  5A6J A;  1NZE A;  3UR3 C;  1ORY A;  2IOQ A;  2PX3 A;  1H9G A;  1Z3I X;  3DE8 A;  3S90 A;  2OEV A;  3AQB A;  3HNJ A;  1OXK A;  1DOW A;  3LLK A;  1ZHY A;  3O39 A;  2XLD A;  4YWQ A;  1C17 M;  2LD6 A;  2W4B A;  4R32 A;  3VAY A;  4I44 A;  3LNR A;  3U8V A;  2ETS A;  1VMA A;  3K33 A;  4CIP A;  1D0Y A;  3KYJ A;  3ZTZ A;  2GDC A;  1BBH A;  2OEX A;  3M4C A;  1AEP A;  4J7Y A;  4JTA B;  2UUH A;  4G7H F;  4CSA A;  4A2N B;  3U3B A;  1ZHX A;  3ABM C;  3JTL O;  5L0H A;  1JPJ A;  3DM9 B;  2F22 A;  1ORS C;  1KNY A;  4JEA A;  2XLE A;  1A41 A;  4N4W A;  4BJ6 C;  3B29 A;  4MVS A;  5FCL A;  2J0W A;  2J0X A;  3SNH A;  2YLD A;  2PFD A;  3KL4 A;  4G0H A;  2CYD A;  4EBJ A;  2R05 A;  3C8G B;  1TWG A;  2R7V A;  1TFK B;  1VYI A;  2L6F A;  3DM5 A;  1RCP A;  1A7E A;  5KYN A;  2J8W A;  2R7X A;  1MMG A;  1PD0 A;  3UMH A;  1KU2 A;  1WOL A;  1TWC A;  1K05 A;  3DJU B;  3GM2 A;  3H2U A;  3KH2 A;  4WAB A;  3RKO F;  4F4B A;  5AC4 A;  4IAQ A;  4A4A A;  4Z9H A;  3NMK A;  4XPW A;  2R7W A;  1M56 C;  3UMK A;  1O87 A;  1H9T A;  2WVO A;  4JC7 A;  4H4K C;  4ONS A;  1LPE A;  3W2V A;  1J8Y F;  2EPM X;  1VOM A;  4U5H A;  1CGM E;  2JPU A;  4CS9 C;  2I8B A;  2YLI A;  3GM3 A;  1M6T A;  3US6 A;  2HMZ A;  3JRT A;  2EIM C;  3M15 A;  1BR4 A;  1OCC C;  4L6R A;  2KNH A;  3GAN A;  2BL2 A;  5A69 A;  3GEE A;  1QLE C;  2WZF A;  1O3U A;  3MBG A;  2B0J A;  2P61 A;  4XWJ A;  3ZG1 A;  3UGO A;  3QTH A;  5DQZ A;  4U5G A;  2UUI A;  4JUR I;  5DS5 A;  3MFN A;  5A6K A;  5DS6 A;  1MMD A;  4XPX A;  4E17 A;  1M57 C;  1NU9 C;  4OIO F;  1UFB A;  2XL8 A;  1S7Z A;  1N1C A;  3BRJ A;  3FXH A;  1RJ9 B;  3H2V A;  2VCB A;  3MYF A;  4WGZ A;  3T9O A;  1LVK A;  4DRH B;  2KGO A;  4MW3 A;  4OD5 A;  1XZP A;  1TFO B;  3EGD A;  1CPQ A;  3JSE O;  2J9B A;  2A69 F;  3X1O A;  4EKW A;  1FMW A;  2L6H A;  2A0B A;  4JW1 A;  4XEK A;  5L0F A;  4BEM J;  4YT2 A;  1NSG B;  2L9J A;  3PCV A;  3C8G D;  3AOU A;  2YVK A;  4J7T A;  1EQ1 A;  2CW0 F;  1G8X A;  2AP3 A;  4DBQ A;  2Y39 A;  4C7O B;  3Q6N A;  1BZ4 A;  4HFF B;  4OIN F;  4DOZ A;  2P0N A;  5B3S C;  1C02 A;  4I1O B;  1M2V A;  3CEX A;  5BUO A;  3EHN A;  4MVZ A;  5B1A C;  5L3Q A;  2LQG A;  5B1B C;  3AG3 C;  2YHS A;  4CS7 A;  2R03 A;  4JKV A;  1BR1 A;  1MQV A;  4B6I A;  2CNW D;  3T6J A;  2BC5 A;  4YN0 B;  2WB7 A;  1OW7 A;  3EG9 B;  1YA9 A;  2XLW A;  3O6X A;  3ZQY A;  4XEV A;  5EGY A;  3FAP B;  3Q6M A;  1A7D A;  4LDR A;  2HSQ A;  2RD9 A;  1VK5 A;  1T01 A;  3NYM A;  3VRC A;  1U6H A;  3DAG A;  4ULV A;  2YZS A;  3LUT B;  1E2X A;  3KKB A;  3SXY A;  1GGQ A;  5F5H A;  4LDQ A;  1QVX A;  1E86 A;  1Q0F A;  3S27 A;  2RSE B;  4WJ0 A;  4CIH A;  1PD1 A;  1SMY F;  3X2Q C;  3WOD F;  2XM4 A;  4PFP A;  1ZZP A;  4DJ9 A;  2WVQ A;  4NC3 A;  5D92 A;  1NLX A;  2QE9 A;  2EIN C;  1G5Z A;  1OCR C;  2LIG A;  2R7S A;  4YL3 A;  2M64 A;  1LE2 A;  3RH3 A;  2R7T A;  2YLG A;  2KC3 A;  3GWN A;  3JSZ A;  2Q7R A;  2I15 A;  3TD7 A;  3DXJ F;  4XQ1 A;  4CDA A;  3ASO C;  5KYW A;  1B68 A;  3TOM A;  3DD7 A;  1LI7 A;  4KNW A;  3ZIB A;  2LCH A;  1FNT c;  2LSE A;  2AU5 A;  5EK0 A;  3W8H A;  3L34 A;  4C3E A;  4U5B E;  4XLP F;  1VLT A;  5CIV A;  4EHP A;  1D1A A;  3SYN A;  4BJT A;  3VF0 A;  5L0I A;  2NSG A;  3U5S A;  2X0C A;  2EPL X;  4AE4 B;  5JUA A;  1LM3 B;  2NUP B;  1F1M A;  1YYJ A;  2VC9 A;  1K40 A;  2XLO A;  4MVO A;  3S29 A;  4MQ9 F;  3VM6 A;  4CJO A;  4QDL A;  2J7P D;  5DVW A;  4HFK B;  4PJM A;  3TQO A;  3W4Y A;  3SP1 A;  1FFH A;  2XS1 A;  3K66 A;  4MVQ A;  1Q0G A;  3EZI A;  3HJC A;  2XXA B;  4E18 A;  2W45 A;  2HSB A;  4J32 B;  4BJ1 A;  2G62 A;  2Y3B A;  4C3D A;  1WWP A;  2J9V A;  2VAS A;  3C62 A;  3NKE A;  2W9Y A;  3ATP A; 
#chains in the Genus database with same CATH homology
 2LD6 A;  1YVI A;  2Q4F A;  2LCH A;  3KYJ A;  2OOC A;  1A0B A;  1QSP A;  3MYF A;  1Y6D A;  3U3B A;  1OXB A;  3KYI A;  3IQT A;  2A0B A;  4EUK B;  2LP4 A;  1FR0 A;  1TQG A;  3US6 A;  1BDJ B;  1C03 A;  1SR2 A;  1I5N A;  4PAC A;  4G78 A;  1C02 A;  1OXK A;  1WN0 A;  2R25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...