3KYJA

Crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
129
structure length
129
Chain Sequence
MDEIWALYADDGAQALDAMEASLLALQAGEDAAAHVGPLFRAVHTFKGNSRVLGLSVVESRAHLCEDLIGLVRDAGVPMDGEIVEILLFASDTLRAMLEETAASRADVEGTGSEALMDQLRSKIARCSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative histidine protein kinase
publication title Using structural information to change the phosphotransfer specificity of a two-component chemotaxis signalling complex
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 59
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3kyjA00
1WN0A 4EUKB 1QSPA 4G78A 1A0BA 1TQGA 1I5NA 2LCHA 2R25A 1C03A 1SR2A 1Y6DA 4PACA 1BDJB 1YVIA 2A0BA 2LD6A 3MYFA 1OXBA 3US6A 3U3BA 3IQTA 2OOCA 3KYIA 2Q4FA 1C02A 1OXKA 2LP4A 3KYJA 1FR0A
chains in the Genus database with same CATH superfamily
1OCCC 3ZQYA 2HUJA 2L6FA 5F28E 3S84A 1ORSC 2YHSA 4CS9A 1QSPA 4PFPA 3UMKA 2HJMA 2ZXPA 3LAYA 4ULVA 5F5HA 4XQ1A 2C03A 4LDQA 3WHNA 1DOVA 1YA7O 2J46A 3M4BA 4O6NA 3GM1A 3IQ6A 3DE8A 3S28A 4E7SA 3LEVA 3ZWIA 3U9JA 3U5SA 3MYFA 4MVQA 4HFFB 4CBEA 4XPWA 1M56C 5COGA 5E3AA 1OCRC 2R02A 1T6IA 4ZLCA 2P0NA 2XLWA 2Q7RA 2IM8A 5BQIA 3JRMO 3SZRA 3PCVA 1OXKA 5A6AA 1ZVZA 1KTMA 4G7OF 1MNDA 3GM3A 4DVYP 3CAXA 4C7OB 2KC3A 2L7AA 3K1IC 1RMVA 1OCZC 2EPKX 1RKEA 3W4YA 5KYUB 2A1DD 2WVQA 2YLDA 3QZCA 3EG9A 4J32B 2CYDA 4EKWA 2M64A 2CDQA 3EGDB 2LFFA 4F4BA 2C04A 3IHUA 4U9DA 4CJGA 1SR2A 1I4YA 1F1MA 2P7VA 1SMYF 2AP3A 3NG1A 3ZTMA 4CX9A 4DBRA 3ASOC 2BE5F 2PP4A 2J0WA 3DKAA 1TFKB 4NCQA 1T01A 4YL3A 2PBEA 3SXMA 4KNWA 1YYJA 3K1IA 4N6HA 4EBBA 1RJ9B 4NTAA 3NKDA 5E33A 5JLIA 4ER9A 4G7ZF 2R7TA 3EHNA 3AG1C 4EBJA 1TWCA 3JTLO 1YZAA 2NPUA 1FMWA 4OD5A 2LIGA 2D5RB 5B3IA 3EH1A 1YJGA 2EPLX 4E0HA 2RSEB 2QLAA 1BR2A 256BA 2YKZA 4M63A 4MVZA 4JW1A 3L1MA 3EFOA 1QZXA 1VMAA 4FX5A 1D1CA 1M2OA 1VOMA 1MQVA 3ASNC 3HKKA 4YL0A 3TULA 5D92A 1J8MF 1MMAA 2MWQA 3L0IA 2OG2A 5A6KA 3AGUA 3LLKA 3V7OA 4JRZA 4OIPF 5FZTA 2YWAA 3RIPA 3SEOA 3V5YA 1Q0FA 3RVYA 3RVZA 4Q5SF 3GODA 1U89A 1Z7Qc 2VB6A 4BJ1A 2W9YA 2KK1A 3HTKC 4CJOA 2J9VA 3GORA 5JUAA 3HNLA 4I1MA 2YEVA 3MX3A 5JT4A 4QDLA 4RBNA 3K1HA 2J9UA 2EIKC 3FOPA 3BRJA 4RDAA 2WB7A 4IJJA 4EUKB 1RKEB 4XPYA 2J45A 5B1AC 3FAJA 3HLZA 4MVMA 4N06A 3L8IA 2AU5A 2UUHA 3EG9B 2DI3A 2WZGA 3FHDA 2YL3A 1H6GA 3SXZA 2J9WA 3DXJF 3WODF 1JR8A 3S27A 4JEBA 2Y3GA 2EIMC 3ZSUA 1ZHTA 2WVNA 2WZLA 3FDQA 1VLSA 2ZXOA 2QE9A 3ECSA 4L6RA 3B0UX 2XLDA 3JRTA 1YVIA 3TJ6A 4DBQA 1YAUO 4GEHA 3GWLA 1NBBA 3X2QC 3EQLF 2WL8A 3OEOA 2MYSA 1T9KA 4JIOA 5COMA 2LK4A 3AOUA 5B3SC 3IQ5A 1L7CA 2Q4FA 3GEHA 1E2XA 4ONSA 1C02A 1V55C 3F46A 1OR2A 4HEAJ 5EK0A 1EKYA 3R7CA 4CDVA 1FTSA 1NLXA 1OQCA 4MVUA 3Q6NA 4C7OA 1MMNA 1G8XA 1M2VA 5KYUA 1AEPA 3ZIBA 3LNRA 2HS5A 1WASA 2Q9AA 3EFOB 3QW0A 2JD3A 1OW7A 1ZW3A 1CGME 1Y4CA 2EILC 1TWHA 3C8GA 2IOQA 3C8ZA 3RQEA 3U2MA 1O87A 1CGNA 1FAPB 2ICWG 1DOWA 3JCUQ 3OA1A 3HNJA 1D0ZA 3L34A 1YLMA 4N6CA 4OIQF 4J7YA 2HJ3A 3A11A 1HMOA 3GM2A 4E17A 4YWQA 2X0CA 2NUPA 3NMJA 4KNVA 2OKUA 2GAQA 2ZXRA 4BG0A 2JX0A 4BEMJ 2CNWA 5E2QA 1HMDA 4CDYA 2R7OA 4QI0A 2XM0A 4GYTA 2I15A 4DRIB 4WGYA 2EPNA 3GEEA 1PD1A 1TQGA 1G5ZA 4A2NB 2GDCA 3WG7C 2IXPA 3TJ5A 3AJMA 3EZIA 4U5GA 1PCXA 1QLEC 4E0IA 1OCOC 2GWWA 2R7WA 4G7HF 5JVEA 5KYWA 1U0BB 2HKVA 2JPUA 2KYHA 2Y69C 4YK5A 3SNHA 1G4WR 1LS4A 3S29A 1V74B 4YT2A 1JPNA 1G4US 4YN0B 1BR4A 3EGXA 2VCBA 5L0GA 4HE8D 1WATA 5CI9A 3ZG1A 2DYSC 2VH3A 1ZHYA 4JC7A 4GQHA 2LFDA 3FVYA 3QW1A 2QTVA 4OIOF 4R32A 3Q7LA 3ZVRA 2KGOA 4AE4A 1ZYRF 3JSZA 1H7IA 3DMDA 3IPMO 3JYYA 3AG3C 1RCPA 1TFOB 1M2VB 3C8GD 1HE1A 2IYLD 3MFNA 4JE9A 4E7ZA 3TD7A 3FXHA 3NMIA 1U6HA 3DM5A 3RKOF 1E85A 3POVA 4X0RA 5K0IA 1PV3A 2YRFA 3C8GB 3OWTA 2LCHA 3FMSA 5BQHA 5L0FA 2IBFA 1LS1A 4XWJA 5L0CA 4KI2A 5A69A 2Y3DA 5DS6A 1YDIA 2R9RB 2QUPA 3LEOA 4MNDA 1VLTA 4Z9IA 2ZXWC 3VF0A 2H7VC 5L0DA 2KQ9A 3LESA 2X51A 2NSFA 2PX3A 4MVOA 4NY3A 2CNWD 4OD4A 2WZFA 4MS2A 2NUPB 3DAGA 2XS8A 3IEEA 3W2VA 4AL0A 4PJJA 1NFOA 1VB5A 4IB4A 5TJ5E 4DRJB 2XM4A 2D4UA 1SYQA 2OJED 1Q0GA 3W8IA 4YL1A 3KPHA 2R7SA 3K6BA 3FAPB 3O10A 4PR9A 1O3UA 4MW8A 3T6BA 5DQZA 1FMVA 2HSBA 1ORJA 2J7PD 4LLCA 2RD9A 4Z9JA 4XEKA 2Y3HA 1GM5A 1KU2A 4BJ6C 3RQGA 4MTFA 2L9JA 5KYWB 4MVSA 1LKXA 3LLIA 2HSQA 1Z5ZA 2IXMA 4XEFA 1Q0KA 2VCCA 3PDMP 4DXWA 1HW2A 5KYXB 2G3VA 3U3BA 2EINC 3EGXB 3QTHA 4EBKA 3Q6MA 3ZQVA 2H7BA 1UFBA 3JZ0A 4LERA 3FOOA 5KYYB 1LE4A 4EWCA 3B0PA 5DS4A 1R4TA 3RH3A 2HMQA 4D4NA 3VAYA 1NU9C 3KYJA 4K1OA 5JP7A 3UNGC 2H7OA 3IQCA 4G0HA 2YL7A 3C7JA 4XLNF 3K7DA 3ZDLA 4AE4B 4BJ6A 1MNEA 1VTMP 3I5QA 2Y39A 5COFA 4BPMA 3LJBA 2YVKA 2YLIA 4LDKA 4U5HA 4D4XA 2R7UA 1WGWA 2L6GA 1ZW2A 3B9QA 3MBGA 3NYMA 4I44A 2R03A 4RD9A 5EHHA 1H9TA 2P1AA 2OQMA 1VYKA 3EH2A 3NKEA 1QQ3A 3AG4C 3NRHA 2NUTA 1XWJA 1T6UA 2IXNA 5E3CA 4XLPF 1D1BA 2W4MA 2Q3TA 2OU6A 1T5OA 2XLEA 4PJNA 1A7EA 3RW0A 3C63A 2OJQA 4LLEA 5L0JA 3VYWA 1ZHWA 2R7XA 4Q4ZF 2XLHA 3UMIA 3KYIA 1QVXA 1I4ZA 3H65A 3U0CA 4BEJA 2H8AA 5GPGB 1ZU4A 2LP4A 3LS1A 4UDVA 2LQGA 3HJCA 4JTAB 1K04A 1XZQA 1Q0MA 2Y3BA 3B71A 3AQCA 1LVKA 3HNKA 4IAOA 4IRUA 3AQBA 3LS0A 4MQ9F 2P61A 4PFOA 2AWYA 3KKBA 3SP1A 1V4AA 3SYNA 1LI7A 3U2LA 3S0XA 1LI5A 3WAQA 2A0BA 4YT5A 2CGEA 5KYNA 5F5FA 1N1CA 1OR3A 1YARO 5BQGA 2NSGA 2MHRA 2Q9CA 3T9OA 1FFHA 4J30B 2XL6A 1YZCA 1MMGA 1ST6A 5AC4A 2HZ8A 3VRCA 3U9MA 5AC5A 5CIVA 2OEVA 1CPRA 2FAPB 4KBLA 5DS5A 4FWVA 4P9TA 2XLOA 5A6JA 1WN0A 2Z15A 1EQ1A 1R5ID 1JAFA 2IXOA 3RF3A 2XXAB 2W4BA 2Q00A 3SXYA 2L81A 1K05A 2XL8A 1A0BA 3DZAA 2HV6A 3DE9A 4WABA 1L3PA 2CCYA 3H2VA 1IZMA 1JOGA 3R2PA 4CS9C 2PX0A 4MW3A 2NUTB 3E70C 2EPMX 4QI2A 1J8YF 3KMIA 1A7DA 2HFIA 2J7PA 2YZSA 5JS5A 1QKRA 1CGOA 1YA9A 4CS7A 2L6HA 1E83A 2NG1A 3US6A 2XS1A 5JSLA 5KYXA 1B68A 1MMDA 3X1OA 1LPEA 3W8HA 4CIPA 3S9OA 5KYYA 1AVOB 2TMVP 1JMWA 4JTDB 4PJMA 3DJUB 3CSKA 4JJGA 3DI5A 5L0HA 2E87A 3K33A 3O6XA 4NTBA 4IARA 4FESA 2AWCA 5L3VA 3N2ZB 3M1CB 3Q7GA 1GS9A 4AX2A 1ZU5A 3QVZA 1Z63A 2YL1A 4JVSA 2GA0A 2KJGA 2A6EF 2VASA 3ABMC 2P6VA 1H9GA 5JRAA 1Z23A 1Q0DA 3JSEO 4EHPA 1K40A 2PNOA 1M57C 4U5EE 3W2WA 3EHMA 3UGOA 4WJ0A 2PF4E 3ITFA 3UR3C 4CS8C 3IQTA 1FNTc 1V54C 4OINF 2R7QA 1M6TA 1JRAA 3H2UA 3MLGA 3B29A 1Z6AA 4YT4A 4O7GA 1AUEA 5FCLA 3RYLA 3T4RA 5D91A 3BEHA 4C3BA 2J8WA 3U3FA 3J06A 1NZEA 3DAFA 2DGJA 1TWGA 1C17M 1EA8A 1NG1A 2VC9A 4HFKB 1ZHZA 3DJNB 5T1DB 4AK9A 3EPVA 1YYXA 4E18A 3A9CA 3E9VA 3M15A 4XEVA 3T6GB 4O6MA 4MTGA 3N24A 2FGYA 2UUIA 4H54A 4EIYA 1NFNA 3RQFA 5DLJA 4CS8A 3UGPA 4JTCB 4YT8A 2V26A 4WGZA 2G62A 4AL1A 2B0HA 2XSEA 3G50A 2FFHA 2DYRC 1WOLA 4I1OB 5T3WA 5AGFA 3N0TA 4OIRF 5EGYA 1OXBA 1RXQA 1SF8A 4Q7CA 3PHF2 1LM3B 4JJFA 1HE9A 4ANJA 1TWAA 3QVYA 1NU7D 1OKKD 4U5DE 2R7RA 4IAQA 3O39A 2BL2A 4U9EA 4DJ9A 2KSFA 2DB4A 4JURI 2F22A 4PK4A 2Q9BA 5DVWA 5B1BC 5T3TA 3NMKA 1O5HA 4CSAC 5HV9A 5L0IA 3AG2C 5CI8A 1QPUA 4C3EA 3UMHA 3TK0A 1HY5A 3ATPA 3K66A 2XXAA 2GFHA 1T6QA 2XRHA 2QNLA 3I5PA 1I5NA 3C62A 4O6YA 5IY5C 2PFDA 4Z9HA 2YLGA 3ZTZA 5BUOA 2YQYA 1CPQA 4DOZA 1C03A 4IGGA 3EJNA 2V3CC 1D0YA 2XLMA 3GWNA 2R7VA 4PACA 2A6HF 1KNYA 1LE2A 4ZLDA 1XZPA 2EPOA 4CSAA 2ZD9A 4XPXA 1A7VA 3TOLA 3M4CA 2OOCA 3RFYA 1EI7A 5A6BA 4I3MA 3B0VC 2AVKA 3CEXA 3NYLA 3DWWA 4MVRA 3I4UA 1SZIA 3LUTB 4W8KA 4KC9A 3TOMA 1JPJA 3EZHA 4H4KC 4IWBA 4XTKA 3KH2A 2ETSA 1VYIA 1Z3IX 2OCCC 2LSEA 2OEXA 2W45A 3C18A 3LNMB 3ABLC 4NC3A 4P9FA 3O55A 4U5FE 1GGQA 1E86A 3PMRA 4DVZA 1BBHA 2WVOA 1D1AA 4JCHA 3V5XA 1ORYA 1BR1A 3SXKA 1PD0A 2QY9A 2YL0A 2M4EA 1S7ZA 3KL4A 1S05A 2J0XA 1LIHA 4BJ5C 1E84A 1Y6DA 3JT1A 2A0UA 1BDJB 4J7TA 1GQAA 1OW8A 3G4ZA 3F47A 4CDAA 1FFTC 2XL4A 4JEAA 2KW3C 4W8PA 4N4WA 1TKNA 2HV7A 3S90A 1IW7F 1ZHXA 2HMZA 4BJTA 3L8JA 3CZ6A 5L3QA 1VK5A 3M79A 3V5ZA 4U5CE 4ULWA 2B0JA 4JZAA 4K7BA 3NYJA 4MTOA 4NTFA 1FR0A 1HW1A 3ABKC 4JCZA 2R05A 1UG7A 5HSWA 2I8BA 4LACB 4BJ5A 3DD7A 1D0XA 4C3DA 2A68F 2XLVA 2ZPAA 4G78A 2BC5A 2O9XA 4PJLA 4LDRA 3T6JA 5DQTA 4DRHB 4FAPB 1BZ4A 4U5BE 3U8PA 1A41A 3EGDA 4CIHA 1W2WA 3GANA 2KNHA 4NQFA 2EIJC 2R25A 3AGTA 1ZZPA 4O79A 3VM6A 2G3KA 3JYHA 3QMKA 2J9BA 3U8VA 2A69F 2LD6A 5A6BD 3NDBB 1RKCA 1TR2A 2ASRA 3HNIA 4A4AA 4JKVA 4P6IC 1WWPA 3G4XA 4YJWA 3ZC4A 3GEIA 2CW0F 1OW6A 1RJ9A 3DM9B 1WTYA 1APCA 2VCAA 3MYIA 4B6IA 4K0DA 1NSGB 3TQOA 3CQZA 1OKKA
chains in the Genus database with same CATH topology
1WN0A 4EUKB 1QSPA 4G78A 1A0BA 1TQGA 1I5NA 2LCHA 2R25A 1C03A 1SR2A 1Y6DA 4PACA 1BDJB 1YVIA 2A0BA 2LD6A 3MYFA 1OXBA 3US6A 3U3BA 3IQTA 2OOCA 3KYIA 2Q4FA 1C02A 1OXKA 2LP4A 3KYJA 1FR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WN0 A;  4EUK B;  1QSP A;  4G78 A;  1A0B A;  1TQG A;  1I5N A;  2LCH A;  2R25 A;  1C03 A;  1SR2 A;  1Y6D A;  4PAC A;  1BDJ B;  1YVI A;  2A0B A;  2LD6 A;  3MYF A;  1OXB A;  3US6 A;  3U3B A;  3IQT A;  2OOC A;  3KYI A;  2Q4F A;  1C02 A;  1OXK A;  2LP4 A;  3KYJ A;  1FR0 A; 
#chains in the Genus database with same CATH topology
 1OCC C;  3ZQY A;  2HUJ A;  2L6F A;  5F28 E;  3S84 A;  1ORS C;  2YHS A;  4CS9 A;  1QSP A;  4PFP A;  3UMK A;  2HJM A;  2ZXP A;  3LAY A;  4ULV A;  5F5H A;  4XQ1 A;  2C03 A;  4LDQ A;  3WHN A;  1DOV A;  1YA7 O;  2J46 A;  3M4B A;  4O6N A;  3GM1 A;  3IQ6 A;  3DE8 A;  3S28 A;  4E7S A;  3LEV A;  3ZWI A;  3U9J A;  3U5S A;  3MYF A;  4MVQ A;  4HFF B;  4CBE A;  4XPW A;  1M56 C;  5COG A;  5E3A A;  1OCR C;  2R02 A;  1T6I A;  4ZLC A;  2P0N A;  2XLW A;  2Q7R A;  2IM8 A;  5BQI A;  3JRM O;  3SZR A;  3PCV A;  1OXK A;  5A6A A;  1ZVZ A;  1KTM A;  4G7O F;  1MND A;  3GM3 A;  4DVY P;  3CAX A;  4C7O B;  2KC3 A;  2L7A A;  3K1I C;  1RMV A;  1OCZ C;  2EPK X;  1RKE A;  3W4Y A;  5KYU B;  2A1D D;  2WVQ A;  2YLD A;  3QZC A;  3EG9 A;  4J32 B;  2CYD A;  4EKW A;  2M64 A;  2CDQ A;  3EGD B;  2LFF A;  4F4B A;  2C04 A;  3IHU A;  4U9D A;  4CJG A;  1SR2 A;  1I4Y A;  1F1M A;  2P7V A;  1SMY F;  2AP3 A;  3NG1 A;  3ZTM A;  4CX9 A;  4DBR A;  3ASO C;  2BE5 F;  2PP4 A;  2J0W A;  3DKA A;  1TFK B;  4NCQ A;  1T01 A;  4YL3 A;  2PBE A;  3SXM A;  4KNW A;  1YYJ A;  3K1I A;  4N6H A;  4EBB A;  1RJ9 B;  4NTA A;  3NKD A;  5E33 A;  5JLI A;  4ER9 A;  4G7Z F;  2R7T A;  3EHN A;  3AG1 C;  4EBJ A;  1TWC A;  3JTL O;  1YZA A;  2NPU A;  1FMW A;  4OD5 A;  2LIG A;  2D5R B;  5B3I A;  3EH1 A;  1YJG A;  2EPL X;  4E0H A;  2RSE B;  2QLA A;  1BR2 A;  256B A;  2YKZ A;  4M63 A;  4MVZ A;  4JW1 A;  3L1M A;  3EFO A;  1QZX A;  1VMA A;  4FX5 A;  1D1C A;  1M2O A;  1VOM A;  1MQV A;  3ASN C;  3HKK A;  4YL0 A;  3TUL A;  5D92 A;  1J8M F;  1MMA A;  2MWQ A;  3L0I A;  2OG2 A;  5A6K A;  3AGU A;  3LLK A;  3V7O A;  4JRZ A;  4OIP F;  5FZT A;  2YWA A;  3RIP A;  3SEO A;  3V5Y A;  1Q0F A;  3RVY A;  3RVZ A;  4Q5S F;  3GOD A;  1U89 A;  1Z7Q c;  2VB6 A;  4BJ1 A;  2W9Y A;  2KK1 A;  3HTK C;  4CJO A;  2J9V A;  3GOR A;  5JUA A;  3HNL A;  4I1M A;  2YEV A;  3MX3 A;  5JT4 A;  4QDL A;  4RBN A;  3K1H A;  2J9U A;  2EIK C;  3FOP A;  3BRJ A;  4RDA A;  2WB7 A;  4IJJ A;  4EUK B;  1RKE B;  4XPY A;  2J45 A;  5B1A C;  3FAJ A;  3HLZ A;  4MVM A;  4N06 A;  3L8I A;  2AU5 A;  2UUH A;  3EG9 B;  2DI3 A;  2WZG A;  3FHD A;  2YL3 A;  1H6G A;  3SXZ A;  2J9W A;  3DXJ F;  3WOD F;  1JR8 A;  3S27 A;  4JEB A;  2Y3G A;  2EIM C;  3ZSU A;  1ZHT A;  2WVN A;  2WZL A;  3FDQ A;  1VLS A;  2ZXO A;  2QE9 A;  3ECS A;  4L6R A;  3B0U X;  2XLD A;  3JRT A;  1YVI A;  3TJ6 A;  4DBQ A;  1YAU O;  4GEH A;  3GWL A;  1NBB A;  3X2Q C;  3EQL F;  2WL8 A;  3OEO A;  2MYS A;  1T9K A;  4JIO A;  5COM A;  2LK4 A;  3AOU A;  5B3S C;  3IQ5 A;  1L7C A;  2Q4F A;  3GEH A;  1E2X A;  4ONS A;  1C02 A;  1V55 C;  3F46 A;  1OR2 A;  4HEA J;  5EK0 A;  1EKY A;  3R7C A;  4CDV A;  1FTS A;  1NLX A;  1OQC A;  4MVU A;  3Q6N A;  4C7O A;  1MMN A;  1G8X A;  1M2V A;  5KYU A;  1AEP A;  3ZIB A;  3LNR A;  2HS5 A;  1WAS A;  2Q9A A;  3EFO B;  3QW0 A;  2JD3 A;  1OW7 A;  1ZW3 A;  1CGM E;  1Y4C A;  2EIL C;  1TWH A;  3C8G A;  2IOQ A;  3C8Z A;  3RQE A;  3U2M A;  1O87 A;  1CGN A;  1FAP B;  2ICW G;  1DOW A;  3JCU Q;  3OA1 A;  3HNJ A;  1D0Z A;  3L34 A;  1YLM A;  4N6C A;  4OIQ F;  4J7Y A;  2HJ3 A;  3A11 A;  1HMO A;  3GM2 A;  4E17 A;  4YWQ A;  2X0C A;  2NUP A;  3NMJ A;  4KNV A;  2OKU A;  2GAQ A;  2ZXR A;  4BG0 A;  2JX0 A;  4BEM J;  2CNW A;  5E2Q A;  1HMD A;  4CDY A;  2R7O A;  4QI0 A;  2XM0 A;  4GYT A;  2I15 A;  4DRI B;  4WGY A;  2EPN A;  3GEE A;  1PD1 A;  1TQG A;  1G5Z A;  4A2N B;  2GDC A;  3WG7 C;  2IXP A;  3TJ5 A;  3AJM A;  3EZI A;  4U5G A;  1PCX A;  1QLE C;  4E0I A;  1OCO C;  2GWW A;  2R7W A;  4G7H F;  5JVE A;  5KYW A;  1U0B B;  2HKV A;  2JPU A;  2KYH A;  2Y69 C;  4YK5 A;  3SNH A;  1G4W R;  1LS4 A;  3S29 A;  1V74 B;  4YT2 A;  1JPN A;  1G4U S;  4YN0 B;  1BR4 A;  3EGX A;  2VCB A;  5L0G A;  4HE8 D;  1WAT A;  5CI9 A;  3ZG1 A;  2DYS C;  2VH3 A;  1ZHY A;  4JC7 A;  4GQH A;  2LFD A;  3FVY A;  3QW1 A;  2QTV A;  4OIO F;  4R32 A;  3Q7L A;  3ZVR A;  2KGO A;  4AE4 A;  1ZYR F;  3JSZ A;  1H7I A;  3DMD A;  3IPM O;  3JYY A;  3AG3 C;  1RCP A;  1TFO B;  1M2V B;  3C8G D;  1HE1 A;  2IYL D;  3MFN A;  4JE9 A;  4E7Z A;  3TD7 A;  3FXH A;  3NMI A;  1U6H A;  3DM5 A;  3RKO F;  1E85 A;  3POV A;  4X0R A;  5K0I A;  1PV3 A;  2YRF A;  3C8G B;  3OWT A;  2LCH A;  3FMS A;  5BQH A;  5L0F A;  2IBF A;  1LS1 A;  4XWJ A;  5L0C A;  4KI2 A;  5A69 A;  2Y3D A;  5DS6 A;  1YDI A;  2R9R B;  2QUP A;  3LEO A;  4MND A;  1VLT A;  4Z9I A;  2ZXW C;  3VF0 A;  2H7V C;  5L0D A;  2KQ9 A;  3LES A;  2X51 A;  2NSF A;  2PX3 A;  4MVO A;  4NY3 A;  2CNW D;  4OD4 A;  2WZF A;  4MS2 A;  2NUP B;  3DAG A;  2XS8 A;  3IEE A;  3W2V A;  4AL0 A;  4PJJ A;  1NFO A;  1VB5 A;  4IB4 A;  5TJ5 E;  4DRJ B;  2XM4 A;  2D4U A;  1SYQ A;  2OJE D;  1Q0G A;  3W8I A;  4YL1 A;  3KPH A;  2R7S A;  3K6B A;  3FAP B;  3O10 A;  4PR9 A;  1O3U A;  4MW8 A;  3T6B A;  5DQZ A;  1FMV A;  2HSB A;  1ORJ A;  2J7P D;  4LLC A;  2RD9 A;  4Z9J A;  4XEK A;  2Y3H A;  1GM5 A;  1KU2 A;  4BJ6 C;  3RQG A;  4MTF A;  2L9J A;  5KYW B;  4MVS A;  1LKX A;  3LLI A;  2HSQ A;  1Z5Z A;  2IXM A;  4XEF A;  1Q0K A;  2VCC A;  3PDM P;  4DXW A;  1HW2 A;  5KYX B;  2G3V A;  3U3B A;  2EIN C;  3EGX B;  3QTH A;  4EBK A;  3Q6M A;  3ZQV A;  2H7B A;  1UFB A;  3JZ0 A;  4LER A;  3FOO A;  5KYY B;  1LE4 A;  4EWC A;  3B0P A;  5DS4 A;  1R4T A;  3RH3 A;  2HMQ A;  4D4N A;  3VAY A;  1NU9 C;  3KYJ A;  4K1O A;  5JP7 A;  3UNG C;  2H7O A;  3IQC A;  4G0H A;  2YL7 A;  3C7J A;  4XLN F;  3K7D A;  3ZDL A;  4AE4 B;  4BJ6 A;  1MNE A;  1VTM P;  3I5Q A;  2Y39 A;  5COF A;  4BPM A;  3LJB A;  2YVK A;  2YLI A;  4LDK A;  4U5H A;  4D4X A;  2R7U A;  1WGW A;  2L6G A;  1ZW2 A;  3B9Q A;  3MBG A;  3NYM A;  4I44 A;  2R03 A;  4RD9 A;  5EHH A;  1H9T A;  2P1A A;  2OQM A;  1VYK A;  3EH2 A;  3NKE A;  1QQ3 A;  3AG4 C;  3NRH A;  2NUT A;  1XWJ A;  1T6U A;  2IXN A;  5E3C A;  4XLP F;  1D1B A;  2W4M A;  2Q3T A;  2OU6 A;  1T5O A;  2XLE A;  4PJN A;  1A7E A;  3RW0 A;  3C63 A;  2OJQ A;  4LLE A;  5L0J A;  3VYW A;  1ZHW A;  2R7X A;  4Q4Z F;  2XLH A;  3UMI A;  3KYI A;  1QVX A;  1I4Z A;  3H65 A;  3U0C A;  4BEJ A;  2H8A A;  5GPG B;  1ZU4 A;  2LP4 A;  3LS1 A;  4UDV A;  2LQG A;  3HJC A;  4JTA B;  1K04 A;  1XZQ A;  1Q0M A;  2Y3B A;  3B71 A;  3AQC A;  1LVK A;  3HNK A;  4IAO A;  4IRU A;  3AQB A;  3LS0 A;  4MQ9 F;  2P61 A;  4PFO A;  2AWY A;  3KKB A;  3SP1 A;  1V4A A;  3SYN A;  1LI7 A;  3U2L A;  3S0X A;  1LI5 A;  3WAQ A;  2A0B A;  4YT5 A;  2CGE A;  5KYN A;  5F5F A;  1N1C A;  1OR3 A;  1YAR O;  5BQG A;  2NSG A;  2MHR A;  2Q9C A;  3T9O A;  1FFH A;  4J30 B;  2XL6 A;  1YZC A;  1MMG A;  1ST6 A;  5AC4 A;  2HZ8 A;  3VRC A;  3U9M A;  5AC5 A;  5CIV A;  2OEV A;  1CPR A;  2FAP B;  4KBL A;  5DS5 A;  4FWV A;  4P9T A;  2XLO A;  5A6J A;  1WN0 A;  2Z15 A;  1EQ1 A;  1R5I D;  1JAF A;  2IXO A;  3RF3 A;  2XXA B;  2W4B A;  2Q00 A;  3SXY A;  2L81 A;  1K05 A;  2XL8 A;  1A0B A;  3DZA A;  2HV6 A;  3DE9 A;  4WAB A;  1L3P A;  2CCY A;  3H2V A;  1IZM A;  1JOG A;  3R2P A;  4CS9 C;  2PX0 A;  4MW3 A;  2NUT B;  3E70 C;  2EPM X;  4QI2 A;  1J8Y F;  3KMI A;  1A7D A;  2HFI A;  2J7P A;  2YZS A;  5JS5 A;  1QKR A;  1CGO A;  1YA9 A;  4CS7 A;  2L6H A;  1E83 A;  2NG1 A;  3US6 A;  2XS1 A;  5JSL A;  5KYX A;  1B68 A;  1MMD A;  3X1O A;  1LPE A;  3W8H A;  4CIP A;  3S9O A;  5KYY A;  1AVO B;  2TMV P;  1JMW A;  4JTD B;  4PJM A;  3DJU B;  3CSK A;  4JJG A;  3DI5 A;  5L0H A;  2E87 A;  3K33 A;  3O6X A;  4NTB A;  4IAR A;  4FES A;  2AWC A;  5L3V A;  3N2Z B;  3M1C B;  3Q7G A;  1GS9 A;  4AX2 A;  1ZU5 A;  3QVZ A;  1Z63 A;  2YL1 A;  4JVS A;  2GA0 A;  2KJG A;  2A6E F;  2VAS A;  3ABM C;  2P6V A;  1H9G A;  5JRA A;  1Z23 A;  1Q0D A;  3JSE O;  4EHP A;  1K40 A;  2PNO A;  1M57 C;  4U5E E;  3W2W A;  3EHM A;  3UGO A;  4WJ0 A;  2PF4 E;  3ITF A;  3UR3 C;  4CS8 C;  3IQT A;  1FNT c;  1V54 C;  4OIN F;  2R7Q A;  1M6T A;  1JRA A;  3H2U A;  3MLG A;  3B29 A;  1Z6A A;  4YT4 A;  4O7G A;  1AUE A;  5FCL A;  3RYL A;  3T4R A;  5D91 A;  3BEH A;  4C3B A;  2J8W A;  3U3F A;  3J06 A;  1NZE A;  3DAF A;  2DGJ A;  1TWG A;  1C17 M;  1EA8 A;  1NG1 A;  2VC9 A;  4HFK B;  1ZHZ A;  3DJN B;  5T1D B;  4AK9 A;  3EPV A;  1YYX A;  4E18 A;  3A9C A;  3E9V A;  3M15 A;  4XEV A;  3T6G B;  4O6M A;  4MTG A;  3N24 A;  2FGY A;  2UUI A;  4H54 A;  4EIY A;  1NFN A;  3RQF A;  5DLJ A;  4CS8 A;  3UGP A;  4JTC B;  4YT8 A;  2V26 A;  4WGZ A;  2G62 A;  4AL1 A;  2B0H A;  2XSE A;  3G50 A;  2FFH A;  2DYR C;  1WOL A;  4I1O B;  5T3W A;  5AGF A;  3N0T A;  4OIR F;  5EGY A;  1OXB A;  1RXQ A;  1SF8 A;  4Q7C A;  3PHF 2;  1LM3 B;  4JJF A;  1HE9 A;  4ANJ A;  1TWA A;  3QVY A;  1NU7 D;  1OKK D;  4U5D E;  2R7R A;  4IAQ A;  3O39 A;  2BL2 A;  4U9E A;  4DJ9 A;  2KSF A;  2DB4 A;  4JUR I;  2F22 A;  4PK4 A;  2Q9B A;  5DVW A;  5B1B C;  5T3T A;  3NMK A;  1O5H A;  4CSA C;  5HV9 A;  5L0I A;  3AG2 C;  5CI8 A;  1QPU A;  4C3E A;  3UMH A;  3TK0 A;  1HY5 A;  3ATP A;  3K66 A;  2XXA A;  2GFH A;  1T6Q A;  2XRH A;  2QNL A;  3I5P A;  1I5N A;  3C62 A;  4O6Y A;  5IY5 C;  2PFD A;  4Z9H A;  2YLG A;  3ZTZ A;  5BUO A;  2YQY A;  1CPQ A;  4DOZ A;  1C03 A;  4IGG A;  3EJN A;  2V3C C;  1D0Y A;  2XLM A;  3GWN A;  2R7V A;  4PAC A;  2A6H F;  1KNY A;  1LE2 A;  4ZLD A;  1XZP A;  2EPO A;  4CSA A;  2ZD9 A;  4XPX A;  1A7V A;  3TOL A;  3M4C A;  2OOC A;  3RFY A;  1EI7 A;  5A6B A;  4I3M A;  3B0V C;  2AVK A;  3CEX A;  3NYL A;  3DWW A;  4MVR A;  3I4U A;  1SZI A;  3LUT B;  4W8K A;  4KC9 A;  3TOM A;  1JPJ A;  3EZH A;  4H4K C;  4IWB A;  4XTK A;  3KH2 A;  2ETS A;  1VYI A;  1Z3I X;  2OCC C;  2LSE A;  2OEX A;  2W45 A;  3C18 A;  3LNM B;  3ABL C;  4NC3 A;  4P9F A;  3O55 A;  4U5F E;  1GGQ A;  1E86 A;  3PMR A;  4DVZ A;  1BBH A;  2WVO A;  1D1A A;  4JCH A;  3V5X A;  1ORY A;  1BR1 A;  3SXK A;  1PD0 A;  2QY9 A;  2YL0 A;  2M4E A;  1S7Z A;  3KL4 A;  1S05 A;  2J0X A;  1LIH A;  4BJ5 C;  1E84 A;  1Y6D A;  3JT1 A;  2A0U A;  1BDJ B;  4J7T A;  1GQA A;  1OW8 A;  3G4Z A;  3F47 A;  4CDA A;  1FFT C;  2XL4 A;  4JEA A;  2KW3 C;  4W8P A;  4N4W A;  1TKN A;  2HV7 A;  3S90 A;  1IW7 F;  1ZHX A;  2HMZ A;  4BJT A;  3L8J A;  3CZ6 A;  5L3Q A;  1VK5 A;  3M79 A;  3V5Z A;  4U5C E;  4ULW A;  2B0J A;  4JZA A;  4K7B A;  3NYJ A;  4MTO A;  4NTF A;  1FR0 A;  1HW1 A;  3ABK C;  4JCZ A;  2R05 A;  1UG7 A;  5HSW A;  2I8B A;  4LAC B;  4BJ5 A;  3DD7 A;  1D0X A;  4C3D A;  2A68 F;  2XLV A;  2ZPA A;  4G78 A;  2BC5 A;  2O9X A;  4PJL A;  4LDR A;  3T6J A;  5DQT A;  4DRH B;  4FAP B;  1BZ4 A;  4U5B E;  3U8P A;  1A41 A;  3EGD A;  4CIH A;  1W2W A;  3GAN A;  2KNH A;  4NQF A;  2EIJ C;  2R25 A;  3AGT A;  1ZZP A;  4O79 A;  3VM6 A;  2G3K A;  3JYH A;  3QMK A;  2J9B A;  3U8V A;  2A69 F;  2LD6 A;  5A6B D;  3NDB B;  1RKC A;  1TR2 A;  2ASR A;  3HNI A;  4A4A A;  4JKV A;  4P6I C;  1WWP A;  3G4X A;  4YJW A;  3ZC4 A;  3GEI A;  2CW0 F;  1OW6 A;  1RJ9 A;  3DM9 B;  1WTY A;  1APC A;  2VCA A;  3MYI A;  4B6I A;  4K0D A;  1NSG B;  3TQO A;  3CQZ A;  1OKK A; 
#chains in the Genus database with same CATH homology
 1WN0 A;  4EUK B;  1QSP A;  4G78 A;  1A0B A;  1TQG A;  1I5N A;  2LCH A;  2R25 A;  1C03 A;  1SR2 A;  1Y6D A;  4PAC A;  1BDJ B;  1YVI A;  2A0B A;  2LD6 A;  3MYF A;  1OXB A;  3US6 A;  3U3B A;  3IQT A;  2OOC A;  3KYI A;  2Q4F A;  1C02 A;  1OXK A;  2LP4 A;  3KYJ A;  1FR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...