3KYJA

Crystal structure of the p1 domain of chea3 in complex with chey6 from r. sphaeroides
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
129
structure length
129
Chain Sequence
b'MDEIWALYADDGAQALDAMEASLLALQAGEDAAAHVGPLFRAVHTFKGNSRVLGLSVVESRAHLCEDLIGLVRDAGVPMDGEIVEILLFASDTLRAMLEETAASRADVEGTGSEALMDQLRSKIARCSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative histidine protein kinase
publication title Using structural information to change the phosphotransfer specificity of a two-component chemotaxis signalling complex
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 59
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01627 Hpt Hpt domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.160 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) HPT domain 3kyjA00
4G78A 3IQTA 1A0BA 2A0BA 1QSPA 2OOCA 3MYFA 3U3BA 1OXKA 3KYJA 2LP4A 1C03A 1I5NA 4EUKB 2Q4FA 1FR0A 1Y6DA 1SR2A 1WN0A 1C02A 4PACA 1BDJB 3US6A 2LCHA 2LD6A 2R25A 3KYIA 1YVIA 1TQGA 1OXBA
chains in the Genus database with same CATH superfamily
3UMHA 3N24A 3MYFA 1Z5ZA 2NUPA 2XL8A 1TWAA 2CGEA 4RBNA 2GWWA 1J8YF 5L0CA 3FDQA 1YARO 2H7BA 4EBBA 4DVYP 4GEHA 1Q0DA 3V7OA 2W45A 5KYXA 1CPRA 5L3VA 1LI7A 2QY9A 2Z15A 4XWJA 3AG4C 3SYNA 3LS1A 4DRIB 5JS5A 3NYJA 1R4TA 1ZZPA 4YL3A 4N06A 1XZQA 5JP7A 1OW8A 3C62A 1E84A 4DRJB 3IHUA 2KQ9A 5JRAA 4Z9IA 1L7CA 1QQ3A 1U6HA 1OCZC 4YL0A 1HMOA 5DS4A 1U0BB 1ORYA 2DYSC 5CIVA 3DXJF 1TQGA 4YN0B 4U5BE 1ZYRF 2HZ8A 3ZIBA 3ABKC 1C17M 1BR4A 1EI7A 1TFOB 3RW0A 2KC3A 4OIOF 4A2NB 1LE2A 4JTCB 3UGOA 4ANJA 4R32A 1Z3IX 1D1AA 3TD7A 3DZAA 4N4WA 2J45A 3S29A 1DOWA 3EPVA 3SZRA 1G4US 2XLVA 4O7GA 2OG2A 2R7QA 2XM4A 1WTYA 4AE4B 3EGDA 3S90A 5T3WA 3RYLA 2YL3A 3U0CA 2J9VA 2OKUA 4I44A 3LEVA 2OU6A 1NU7D 4JZAA 4JE9A 256BA 4KNVA 2IXNA 3S0XA 1EKYA 2C04A 1G4WR 2J7PA 1MMDA 3KPHA 4D4NA 1VTMP 3B0VC 4OIPF 3EFOA 3M4BA 3HJCA 3H2UA 4JKVA 4MVUA 5BUOA 2UUHA 2XLDA 1YYJA 3QZCA 1Z7Qc 1M2OA 1V55C 4LLCA 3GM3A 1QSPA 3HNLA 4CS7A 2LQGA 4WGZA 1RMVA 3X2QC 3KL4A 1T6UA 3AGUA 4C7OA 1NFNA 2WL8A 2XS8A 1ZHXA 4AL1A 3IQ6A 4IAQA 3WHNA 4CIPA 3POVA 1W2WA 2KW3C 4ULVA 2OJED 4QDLA 3H2VA 5DQZA 2HKVA 2WB7A 3TJ5A 2OCCC 4F4BA 4WJ0A 2EILC 4C3EA 3TQOA 4RD9A 2OQMA 2ETSA 3A9CA 3O10A 1Q0KA 2NPUA 3JSEO 2QTVA 3DE8A 4W8KA 2W4MA 5L0IA 1YVIA 2P7VA 3HNKA 5CI8A 4Q7CA 1ZU5A 5E3AA 2J9WA 3F46A 4A4AA 3ASNC 2KYHA 3TK0A 3KKBA 3EH1A 3RQFA 4E18A 3FHDA 1FAPB 4FWVA 5JT4A 1ZW2A 3W2VA 4U5GA 1D1BA 1R5ID 3HKKA 3MYIA 4C3DA 2HV6A 2LP4A 3L8JA 4XQ1A 3JTLO 4OIRF 1I4ZA 1WOLA 4FX5A 1HW2A 2YL1A 1CGOA 1VMAA 3C8GA 3G4ZA 3DAFA 4I1OB 3CQZA 4DXWA 4Z9JA 2MWQA 1YLMA 3EZIA 4FESA 1HE9A 4NTFA 5F5HA 2XXAA 1E2XA 1VK5A 5L0DA 3UGPA 3UMKA 2ICWG 3SP1A 1JMWA 2X0CA 3MX3A 2R7SA 1D0ZA 4XPYA 3NDBB 2LD6A 1T6IA 1BR2A 2P61A 2CDQA 5DS5A 4BPMA 1K04A 2GA0A 2W4BA 3QW1A 4ZLCA 2ZXWC 2L81A 1LE4A 5T1DB 3ZG1A 1Z23A 1OR2A 3NMKA 1CPQA 2HMZA 3EG9A 5L0HA 4JIOA 4C3BA 4DBQA 3QVYA 1B68A 4N6HA 1YAUO 2OJQA 1NG1A 2J0WA 2L6HA 4LDKA 2YHSA 2YL0A 3NMJA 1Q0FA 1D0YA 1MMNA 1RKEA 2B0HA 1M2VB 4K0DA 3EHNA 1M56C 2J0XA 2LFDA 3A11A 2YVKA 4BEMJ 4CS9C 2GDCA 3U3FA 3AG1C 3IEEA 1TWCA 4KNWA 2FGYA 2G3KA 4IRUA 3ITFA 2R9RB 5E33A 5KYYB 3NKEA 4YWQA 5DVWA 4P6IC 3JYHA 1LS4A 2LK4A 2YLDA 3X1OA 2NUTB 3LLIA 3IQTA 4Z9HA 4CSAA 2Y39A 2CCYA 5IY5C 2OEXA 4MTOA 2EPKX 4O6YA 1Q0MA 4YT5A 1YDIA 2C03A 5EHHA 1OKKA 4DOZA 3LUTB 3EGXB 5A6BD 3CEXA 3J06A 2Y3HA 1N1CA 4X0RA 5BQHA 1NFOA 4XEKA 3QTHA 4LDQA 2KSFA 4BG0A 2O9XA 3C63A 3EHMA 3LS0A 5AC5A 4NTAA 1MMGA 2B0JA 2Q3TA 3ZDLA 5B3SC 3B29A 5FZTA 2ASRA 2PX0A 2QNLA 2EPNA 5L0JA 1YYXA 1H9TA 3K66A 3O39A 2QE9A 4BJ6A 4J7TA 4JEAA 3DJUB 2H7OA 2A68F 3QMKA 4K1OA 4MVMA 4W8PA 1KNYA 1V54C 3V5YA 5L0GA 1ST6A 3OEOA 3S9OA 1WATA 1HMDA 1RJ9A 3DE9A 1NZEA 2IXPA 1NU9C 3E70C 1QPUA 1LKXA 4I1MA 3LNRA 4MQ9F 3F47A 2R7UA 5AC4A 5HV9A 4JJGA 1XZPA 3OA1A 4U9DA 2CNWA 3OWTA 2EPLX 4O6NA 4H4KC 1I5NA 2KNHA 1T9KA 3T6JA 4YT8A 2E87A 3NG1A 5KYWA 3ZTMA 1Y6DA 2XRHA 3Q6NA 4PJLA 1SZIA 3HTKC 4U5DE 3DJNB 1GM5A 2PX3A 5F5FA 1GGQA 2RD9A 4M63A 4U9EA 4LLEA 3NKDA 4KC9A 4U5HA 1OCOC 2YQYA 5E3CA 4E0HA 5JLIA 1PV3A 4XTKA 3WODF 4CJGA 2AU5A 3U9MA 3US6A 2LCHA 1E83A 1TWHA 3H65A 3UR3C 1CGNA 2NUPB 5BQIA 5A69A 3PDMP 2VASA 1RXQA 3U2MA 1J8MF 4AX2A 4CX9A 2J9UA 3K7DA 1V74B 3AQBA 2BE5F 4MS2A 4MVZA 4FAPB 5FCLA 5KYXB 1A0BA 2OOCA 1OCCC 2P6VA 3AG2C 3EH2A 4CS8C 5DLJA 3CZ6A 4HEAJ 2R7VA 3RVYA 3JZ0A 3O55A 2AP3A 1OW7A 1C03A 2A69F 2XLWA 2GAQA 4JCZA 4EUKB 4YJWA 3N2ZB 3K1IC 2NSGA 5DS6A 5L0FA 3W4YA 2JPUA 4K7BA 4MVOA 3FOPA 4NTBA 3IPMO 3I4UA 1GQAA 2FFHA 3B9QA 3ZQVA 3RQGA 3LEOA 3U8VA 3ECSA 3Q7LA 5KYUA 1ZU4A 3Q6MA 3DAGA 5B1BC 3NYMA 4G0HA 4BJTA 4XPWA 2L7AA 5D92A 4E0IA 2Y3DA 4CDAA 1EA8A 1OXBA 5CI9A 1APCA 3B0UX 4YT2A 5GPGB 2AWYA 3LNMB 4BJ5C 4U5EE 1SYQA 1G8XA 1ZW3A 2HSQA 1KU2A 3EGDB 4JVSA 5A6AA 1HY5A 1Z6AA 1OKKD 1AVOB 1LVKA 2JD3A 4KBLA 4CS8A 2CYDA 3U2LA 1ZHWA 3C18A 4MW8A 2X51A 2HV7A 5JSLA 2KJGA 4RDAA 3EZHA 4H54A 2DYRC 1BBHA 3JSZA 1EQ1A 3K1IA 3V5XA 1BR1A 3EFOB 3AG3C 4MVRA 1O5HA 1S05A 1T01A 3IQCA 2I8BA 3RF3A 3DI5A 1LIHA 1JPNA 1LS1A 3T4RA 3T6GB 3ZWIA 5BQGA 4XLPF 2W9YA 2YWAA 2WZFA 1D1CA 3GWNA 4MTFA 4P9TA 4ULWA 2VCAA 4JRZA 3TJ6A 4C7OB 3GM1A 3KH2A 4I3MA 3S28A 3EQLF 3HNIA 5E2QA 3C8ZA 2EIJC 2IOQA 3T9OA 2R7TA 3JRMO 1NSGB 4PFOA 4ER9A 4JJFA 3VRCA 2JX0A 3S27A 4L6RA 4NCQA 3GODA 1VLTA 3Q7GA 1S7ZA 4PJJA 4XEVA 3TULA 3T6BA 2Q4FA 2QLAA 1BZ4A 2J9BA 4EBKA 1ORJA 5B3IA 2Q9AA 3ZQYA 3K33A 3IQ5A 4MVQA 2G3VA 1OQCA 5A6JA 1H7IA 2H8AA 3SXYA 2Q00A 1TWGA 2R7XA 1VYIA 4IARA 3G50A 3LESA 4BJ1A 4LDRA 4E7SA 1SMYF 1NBBA 2YRFA 2J7PD 2XLEA 4ZLDA 3R7CA 4G7ZF 3L8IA 1JAFA 3TOMA 1FTSA 1ZHTA 3C8GB 4OD5A 1OXKA 2XSEA 3PHF2 2P1AA 2WVQA 4JEBA 4XEFA 2XXAB 1M6TA 1SF8A 4PFPA 3GANA 1QZXA 5JUAA 3QVZA 1T6QA 3QW0A 4GQHA 4NC3A 4MNDA 4U5CE 3V5ZA 2J8WA 1T5OA 2WVNA 1FFHA 3ABLC 4UDVA 1A41A 3DMDA 5B1AC 2IBFA 3U8PA 4CDYA 3JCUQ 4AE4A 1RCPA 3VM6A 3AQCA 3VAYA 1TKNA 1VYKA 4KI2A 3JYYA 3O6XA 2VB6A 3EG9B 1QLEC 3TOLA 4DRHB 4PJNA 3FAJA 4CS9A 1VB5A 3LJBA 3FMSA 4J32B 2XL4A 4LERA 2XS1A 2HFIA 5D91A 4PR9A 2L9JA 3RKOF 2UUIA 2QUPA 1MNEA 1RKEB 1WGWA 4IJJA 4EIYA 3RVZA 3KYJA 3AOUA 4O79A 2IM8A 4IWBA 2PP4A 3GWLA 4CBEA 3L1MA 4J30B 3RH3A 1SR2A 1DOVA 3ABMC 4D4XA 2IYLD 5EK0A 3C8GD 2R7WA 3FOOA 1E86A 3GORA 2OEVA 4JCHA 1WWPA 2ZXOA 3NRHA 4J7YA 3W2WA 2KK1A 2PNOA 3PMRA 3FVYA 1U89A 3W8HA 2BC5A 1Q0GA 4EKWA 4E17A 3U9JA 2EPOA 1I4YA 2HS5A 3WAQA 4YL1A 2VC9A 2IXMA 3ZVRA 4Q5SF 5KYNA 2Q9CA 3NMIA 4MVSA 1F1MA 2A1DD 2PBEA 2R03A 3M15A 3MBGA 4O6MA 3HNJA 1E85A 2A6HF 2LSEA 2VCCA 3BRJA 2XLHA 3L34A 1D0XA 2EIMC 4OINF 4N6CA 4MTGA 2NG1A 2FAPB 3RIPA 2AWCA 1QKRA 1ZVZA 2XM0A 2WZLA 4DBRA 3FXHA 2ZXPA 1UFBA 1LM3B 1JPJA 1WN0A 2LFFA 1YA9A 4HFKB 4WABA 5K0IA 3M1CB 5EGYA 2NSFA 3PCVA 1LI5A 2G62A 2HJ3A 4IAOA 3GEIA 3R2PA 4PACA 5AGFA 1OW6A 1MQVA 2A0UA 1RJ9B 2MYSA 2MHRA 3RQEA 1H9GA 3WG7C 1JRAA 3ZTZA 2GFHA 1IZMA 2CW0F 2ZPAA 2M4EA 3G4XA 5COGA 5HSWA 1FMWA 1A7VA 2DB4A 1RKCA 3KYIA 2Y69C 3SEOA 2LIGA 1FMVA 1GS9A 1IW7F 2I15A 1OR3A 3U5SA 4DVZA 5JVEA 1A7DA 1QVXA 3MLGA 3SXKA 3S84A 2Y3GA 2BL2A 4U5FE 3L0IA 5KYWB 3HLZA 3DM9B 4Q4ZF 3U3BA 1M57C 2RSEB 3GEHA 3LAYA 3UNGC 4XPXA 2V3CC 2HJMA 2IXOA 2L6FA 5F28E 4LACB 4YT4A 1JR8A 5A6BA 3DD7A 2XLMA 3I5QA 3C7JA 4HE8D 2R02A 1YZCA 2YLIA 3JT1A 1TR2A 3ASOC 1Y4CA 4IB4A 3VYWA 3CSKA 4JW1A 2F22A 3ZC4A 1LPEA 4G7OF 1YZAA 2P0NA 3N0TA 1TFKB 5COFA 2XL6A 2Y3BA 5COMA 3DKAA 1AUEA 4AK9A 4GYTA 4NY3A 4EHPA 2YL7A 1M2VA 4NQFA 1OCRC 1VLSA 2AVKA 2YLGA 2ZXRA 2R25A 2PF4E 3AJMA 3B71A 2R7OA 3SNHA 3DM5A 4EBJA 2A0BA 1K40A 3K1HA 3SXZA 2DGJA 5KYYA 4OIQF 3RFYA 2WVOA 1UG7A 3BEHA 4YK5A 4CJOA 2KGOA 4E7ZA 1A7EA 5L3QA 1PCXA 3UMIA 2CNWD 2NUTA 5KYUB 1XWJA 1FR0A 1MMAA 3GEEA 4MW3A 2VCBA 4BJ5A 2R05A 2VH3A 3DWWA 3W8IA 1L3PA 1VOMA 4ONSA 5T3TA 4XLNF 2J46A 2EINC 3EGXA 4JTDB 1O3UA 2YZSA 1BDJB 1ZHZA 2EPMX 4WGYA 3ZSUA 3VF0A 2D4UA 4CSAC 4JURI 4QI0A 1HW1A 2D5RB 4BEJA 1K05A 3GM2A 4CDVA 1FNTc 1WASA 4JC7A 1CGME 4QI2A 1HE1A 5TJ5E 3NYLA 4G7HF 4PK4A 1JOGA 3FAPB 2PFDA 1FFTC 4G78A 3MFNA 4DJ9A 3JRTA 1Z63A 1PD1A 2XLOA 2TMVP 3EJNA 5DQTA 2YEVA 4P9FA 1ORSC 3AGTA 1AEPA 2L6GA 4IGGA 4AL0A 2ZD9A 1MNDA 4B6IA 4PJMA 2YKZA 4JTAB 4BJ6C 1C02A 5A6KA 3E9VA 1KTMA 3ATPA 1H6GA 2V26A 1YJGA 2A6EF 2HUJA 4HFFB 1PD0A 3SXMA 3CAXA 3I5PA 3B0PA 1O87A 2EIKC 3LLKA 3M79A 1V4AA 4EWCA 3M4CA 2R7RA 1YA7O 2HSBA 4CIHA 2Q9BA 1NLXA 2HMQA 2WZGA 1G5ZA 2DI3A 2H7VC 1ZHYA 3K6BA 3KMIA 2Q7RA 2M64A 4OD4A
chains in the Genus database with same CATH topology
4G78A 3IQTA 1A0BA 2A0BA 1QSPA 2OOCA 3MYFA 3U3BA 1OXKA 3KYJA 2LP4A 1C03A 1I5NA 4EUKB 2Q4FA 1FR0A 1Y6DA 1SR2A 1WN0A 1C02A 4PACA 1BDJB 3US6A 2LCHA 2LD6A 2R25A 3KYIA 1YVIA 1TQGA 1OXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G78 A;  3IQT A;  1A0B A;  2A0B A;  1QSP A;  2OOC A;  3MYF A;  3U3B A;  1OXK A;  3KYJ A;  2LP4 A;  1C03 A;  1I5N A;  4EUK B;  2Q4F A;  1FR0 A;  1Y6D A;  1SR2 A;  1WN0 A;  1C02 A;  4PAC A;  1BDJ B;  3US6 A;  2LCH A;  2LD6 A;  2R25 A;  3KYI A;  1YVI A;  1TQG A;  1OXB A; 
#chains in the Genus database with same CATH topology
 3UMH A;  3N24 A;  3MYF A;  1Z5Z A;  2NUP A;  2XL8 A;  1TWA A;  2CGE A;  4RBN A;  2GWW A;  1J8Y F;  5L0C A;  3FDQ A;  1YAR O;  2H7B A;  4EBB A;  4DVY P;  4GEH A;  1Q0D A;  3V7O A;  2W45 A;  5KYX A;  1CPR A;  5L3V A;  1LI7 A;  2QY9 A;  2Z15 A;  4XWJ A;  3AG4 C;  3SYN A;  3LS1 A;  4DRI B;  5JS5 A;  3NYJ A;  1R4T A;  1ZZP A;  4YL3 A;  4N06 A;  1XZQ A;  5JP7 A;  1OW8 A;  3C62 A;  1E84 A;  4DRJ B;  3IHU A;  2KQ9 A;  5JRA A;  4Z9I A;  1L7C A;  1QQ3 A;  1U6H A;  1OCZ C;  4YL0 A;  1HMO A;  5DS4 A;  1U0B B;  1ORY A;  2DYS C;  5CIV A;  3DXJ F;  1TQG A;  4YN0 B;  4U5B E;  1ZYR F;  2HZ8 A;  3ZIB A;  3ABK C;  1C17 M;  1BR4 A;  1EI7 A;  1TFO B;  3RW0 A;  2KC3 A;  4OIO F;  4A2N B;  1LE2 A;  4JTC B;  3UGO A;  4ANJ A;  4R32 A;  1Z3I X;  1D1A A;  3TD7 A;  3DZA A;  4N4W A;  2J45 A;  3S29 A;  1DOW A;  3EPV A;  3SZR A;  1G4U S;  2XLV A;  4O7G A;  2OG2 A;  2R7Q A;  2XM4 A;  1WTY A;  4AE4 B;  3EGD A;  3S90 A;  5T3W A;  3RYL A;  2YL3 A;  3U0C A;  2J9V A;  2OKU A;  4I44 A;  3LEV A;  2OU6 A;  1NU7 D;  4JZA A;  4JE9 A;  256B A;  4KNV A;  2IXN A;  3S0X A;  1EKY A;  2C04 A;  1G4W R;  2J7P A;  1MMD A;  3KPH A;  4D4N A;  1VTM P;  3B0V C;  4OIP F;  3EFO A;  3M4B A;  3HJC A;  3H2U A;  4JKV A;  4MVU A;  5BUO A;  2UUH A;  2XLD A;  1YYJ A;  3QZC A;  1Z7Q c;  1M2O A;  1V55 C;  4LLC A;  3GM3 A;  1QSP A;  3HNL A;  4CS7 A;  2LQG A;  4WGZ A;  1RMV A;  3X2Q C;  3KL4 A;  1T6U A;  3AGU A;  4C7O A;  1NFN A;  2WL8 A;  2XS8 A;  1ZHX A;  4AL1 A;  3IQ6 A;  4IAQ A;  3WHN A;  4CIP A;  3POV A;  1W2W A;  2KW3 C;  4ULV A;  2OJE D;  4QDL A;  3H2V A;  5DQZ A;  2HKV A;  2WB7 A;  3TJ5 A;  2OCC C;  4F4B A;  4WJ0 A;  2EIL C;  4C3E A;  3TQO A;  4RD9 A;  2OQM A;  2ETS A;  3A9C A;  3O10 A;  1Q0K A;  2NPU A;  3JSE O;  2QTV A;  3DE8 A;  4W8K A;  2W4M A;  5L0I A;  1YVI A;  2P7V A;  3HNK A;  5CI8 A;  4Q7C A;  1ZU5 A;  5E3A A;  2J9W A;  3F46 A;  4A4A A;  3ASN C;  2KYH A;  3TK0 A;  3KKB A;  3EH1 A;  3RQF A;  4E18 A;  3FHD A;  1FAP B;  4FWV A;  5JT4 A;  1ZW2 A;  3W2V A;  4U5G A;  1D1B A;  1R5I D;  3HKK A;  3MYI A;  4C3D A;  2HV6 A;  2LP4 A;  3L8J A;  4XQ1 A;  3JTL O;  4OIR F;  1I4Z A;  1WOL A;  4FX5 A;  1HW2 A;  2YL1 A;  1CGO A;  1VMA A;  3C8G A;  3G4Z A;  3DAF A;  4I1O B;  3CQZ A;  4DXW A;  4Z9J A;  2MWQ A;  1YLM A;  3EZI A;  4FES A;  1HE9 A;  4NTF A;  5F5H A;  2XXA A;  1E2X A;  1VK5 A;  5L0D A;  3UGP A;  3UMK A;  2ICW G;  3SP1 A;  1JMW A;  2X0C A;  3MX3 A;  2R7S A;  1D0Z A;  4XPY A;  3NDB B;  2LD6 A;  1T6I A;  1BR2 A;  2P61 A;  2CDQ A;  5DS5 A;  4BPM A;  1K04 A;  2GA0 A;  2W4B A;  3QW1 A;  4ZLC A;  2ZXW C;  2L81 A;  1LE4 A;  5T1D B;  3ZG1 A;  1Z23 A;  1OR2 A;  3NMK A;  1CPQ A;  2HMZ A;  3EG9 A;  5L0H A;  4JIO A;  4C3B A;  4DBQ A;  3QVY A;  1B68 A;  4N6H A;  1YAU O;  2OJQ A;  1NG1 A;  2J0W A;  2L6H A;  4LDK A;  2YHS A;  2YL0 A;  3NMJ A;  1Q0F A;  1D0Y A;  1MMN A;  1RKE A;  2B0H A;  1M2V B;  4K0D A;  3EHN A;  1M56 C;  2J0X A;  2LFD A;  3A11 A;  2YVK A;  4BEM J;  4CS9 C;  2GDC A;  3U3F A;  3AG1 C;  3IEE A;  1TWC A;  4KNW A;  2FGY A;  2G3K A;  4IRU A;  3ITF A;  2R9R B;  5E33 A;  5KYY B;  3NKE A;  4YWQ A;  5DVW A;  4P6I C;  3JYH A;  1LS4 A;  2LK4 A;  2YLD A;  3X1O A;  2NUT B;  3LLI A;  3IQT A;  4Z9H A;  4CSA A;  2Y39 A;  2CCY A;  5IY5 C;  2OEX A;  4MTO A;  2EPK X;  4O6Y A;  1Q0M A;  4YT5 A;  1YDI A;  2C03 A;  5EHH A;  1OKK A;  4DOZ A;  3LUT B;  3EGX B;  5A6B D;  3CEX A;  3J06 A;  2Y3H A;  1N1C A;  4X0R A;  5BQH A;  1NFO A;  4XEK A;  3QTH A;  4LDQ A;  2KSF A;  4BG0 A;  2O9X A;  3C63 A;  3EHM A;  3LS0 A;  5AC5 A;  4NTA A;  1MMG A;  2B0J A;  2Q3T A;  3ZDL A;  5B3S C;  3B29 A;  5FZT A;  2ASR A;  2PX0 A;  2QNL A;  2EPN A;  5L0J A;  1YYX A;  1H9T A;  3K66 A;  3O39 A;  2QE9 A;  4BJ6 A;  4J7T A;  4JEA A;  3DJU B;  2H7O A;  2A68 F;  3QMK A;  4K1O A;  4MVM A;  4W8P A;  1KNY A;  1V54 C;  3V5Y A;  5L0G A;  1ST6 A;  3OEO A;  3S9O A;  1WAT A;  1HMD A;  1RJ9 A;  3DE9 A;  1NZE A;  2IXP A;  1NU9 C;  3E70 C;  1QPU A;  1LKX A;  4I1M A;  3LNR A;  4MQ9 F;  3F47 A;  2R7U A;  5AC4 A;  5HV9 A;  4JJG A;  1XZP A;  3OA1 A;  4U9D A;  2CNW A;  3OWT A;  2EPL X;  4O6N A;  4H4K C;  1I5N A;  2KNH A;  1T9K A;  3T6J A;  4YT8 A;  2E87 A;  3NG1 A;  5KYW A;  3ZTM A;  1Y6D A;  2XRH A;  3Q6N A;  4PJL A;  1SZI A;  3HTK C;  4U5D E;  3DJN B;  1GM5 A;  2PX3 A;  5F5F A;  1GGQ A;  2RD9 A;  4M63 A;  4U9E A;  4LLE A;  3NKD A;  4KC9 A;  4U5H A;  1OCO C;  2YQY A;  5E3C A;  4E0H A;  5JLI A;  1PV3 A;  4XTK A;  3WOD F;  4CJG A;  2AU5 A;  3U9M A;  3US6 A;  2LCH A;  1E83 A;  1TWH A;  3H65 A;  3UR3 C;  1CGN A;  2NUP B;  5BQI A;  5A69 A;  3PDM P;  2VAS A;  1RXQ A;  3U2M A;  1J8M F;  4AX2 A;  4CX9 A;  2J9U A;  3K7D A;  1V74 B;  3AQB A;  2BE5 F;  4MS2 A;  4MVZ A;  4FAP B;  5FCL A;  5KYX B;  1A0B A;  2OOC A;  1OCC C;  2P6V A;  3AG2 C;  3EH2 A;  4CS8 C;  5DLJ A;  3CZ6 A;  4HEA J;  2R7V A;  3RVY A;  3JZ0 A;  3O55 A;  2AP3 A;  1OW7 A;  1C03 A;  2A69 F;  2XLW A;  2GAQ A;  4JCZ A;  4EUK B;  4YJW A;  3N2Z B;  3K1I C;  2NSG A;  5DS6 A;  5L0F A;  3W4Y A;  2JPU A;  4K7B A;  4MVO A;  3FOP A;  4NTB A;  3IPM O;  3I4U A;  1GQA A;  2FFH A;  3B9Q A;  3ZQV A;  3RQG A;  3LEO A;  3U8V A;  3ECS A;  3Q7L A;  5KYU A;  1ZU4 A;  3Q6M A;  3DAG A;  5B1B C;  3NYM A;  4G0H A;  4BJT A;  4XPW A;  2L7A A;  5D92 A;  4E0I A;  2Y3D A;  4CDA A;  1EA8 A;  1OXB A;  5CI9 A;  1APC A;  3B0U X;  4YT2 A;  5GPG B;  2AWY A;  3LNM B;  4BJ5 C;  4U5E E;  1SYQ A;  1G8X A;  1ZW3 A;  2HSQ A;  1KU2 A;  3EGD B;  4JVS A;  5A6A A;  1HY5 A;  1Z6A A;  1OKK D;  1AVO B;  1LVK A;  2JD3 A;  4KBL A;  4CS8 A;  2CYD A;  3U2L A;  1ZHW A;  3C18 A;  4MW8 A;  2X51 A;  2HV7 A;  5JSL A;  2KJG A;  4RDA A;  3EZH A;  4H54 A;  2DYR C;  1BBH A;  3JSZ A;  1EQ1 A;  3K1I A;  3V5X A;  1BR1 A;  3EFO B;  3AG3 C;  4MVR A;  1O5H A;  1S05 A;  1T01 A;  3IQC A;  2I8B A;  3RF3 A;  3DI5 A;  1LIH A;  1JPN A;  1LS1 A;  3T4R A;  3T6G B;  3ZWI A;  5BQG A;  4XLP F;  2W9Y A;  2YWA A;  2WZF A;  1D1C A;  3GWN A;  4MTF A;  4P9T A;  4ULW A;  2VCA A;  4JRZ A;  3TJ6 A;  4C7O B;  3GM1 A;  3KH2 A;  4I3M A;  3S28 A;  3EQL F;  3HNI A;  5E2Q A;  3C8Z A;  2EIJ C;  2IOQ A;  3T9O A;  2R7T A;  3JRM O;  1NSG B;  4PFO A;  4ER9 A;  4JJF A;  3VRC A;  2JX0 A;  3S27 A;  4L6R A;  4NCQ A;  3GOD A;  1VLT A;  3Q7G A;  1S7Z A;  4PJJ A;  4XEV A;  3TUL A;  3T6B A;  2Q4F A;  2QLA A;  1BZ4 A;  2J9B A;  4EBK A;  1ORJ A;  5B3I A;  2Q9A A;  3ZQY A;  3K33 A;  3IQ5 A;  4MVQ A;  2G3V A;  1OQC A;  5A6J A;  1H7I A;  2H8A A;  3SXY A;  2Q00 A;  1TWG A;  2R7X A;  1VYI A;  4IAR A;  3G50 A;  3LES A;  4BJ1 A;  4LDR A;  4E7S A;  1SMY F;  1NBB A;  2YRF A;  2J7P D;  2XLE A;  4ZLD A;  3R7C A;  4G7Z F;  3L8I A;  1JAF A;  3TOM A;  1FTS A;  1ZHT A;  3C8G B;  4OD5 A;  1OXK A;  2XSE A;  3PHF 2;  2P1A A;  2WVQ A;  4JEB A;  4XEF A;  2XXA B;  1M6T A;  1SF8 A;  4PFP A;  3GAN A;  1QZX A;  5JUA A;  3QVZ A;  1T6Q A;  3QW0 A;  4GQH A;  4NC3 A;  4MND A;  4U5C E;  3V5Z A;  2J8W A;  1T5O A;  2WVN A;  1FFH A;  3ABL C;  4UDV A;  1A41 A;  3DMD A;  5B1A C;  2IBF A;  3U8P A;  4CDY A;  3JCU Q;  4AE4 A;  1RCP A;  3VM6 A;  3AQC A;  3VAY A;  1TKN A;  1VYK A;  4KI2 A;  3JYY A;  3O6X A;  2VB6 A;  3EG9 B;  1QLE C;  3TOL A;  4DRH B;  4PJN A;  3FAJ A;  4CS9 A;  1VB5 A;  3LJB A;  3FMS A;  4J32 B;  2XL4 A;  4LER A;  2XS1 A;  2HFI A;  5D91 A;  4PR9 A;  2L9J A;  3RKO F;  2UUI A;  2QUP A;  1MNE A;  1RKE B;  1WGW A;  4IJJ A;  4EIY A;  3RVZ A;  3KYJ A;  3AOU A;  4O79 A;  2IM8 A;  4IWB A;  2PP4 A;  3GWL A;  4CBE A;  3L1M A;  4J30 B;  3RH3 A;  1SR2 A;  1DOV A;  3ABM C;  4D4X A;  2IYL D;  5EK0 A;  3C8G D;  2R7W A;  3FOO A;  1E86 A;  3GOR A;  2OEV A;  4JCH A;  1WWP A;  2ZXO A;  3NRH A;  4J7Y A;  3W2W A;  2KK1 A;  2PNO A;  3PMR A;  3FVY A;  1U89 A;  3W8H A;  2BC5 A;  1Q0G A;  4EKW A;  4E17 A;  3U9J A;  2EPO A;  1I4Y A;  2HS5 A;  3WAQ A;  4YL1 A;  2VC9 A;  2IXM A;  3ZVR A;  4Q5S F;  5KYN A;  2Q9C A;  3NMI A;  4MVS A;  1F1M A;  2A1D D;  2PBE A;  2R03 A;  3M15 A;  3MBG A;  4O6M A;  3HNJ A;  1E85 A;  2A6H F;  2LSE A;  2VCC A;  3BRJ A;  2XLH A;  3L34 A;  1D0X A;  2EIM C;  4OIN F;  4N6C A;  4MTG A;  2NG1 A;  2FAP B;  3RIP A;  2AWC A;  1QKR A;  1ZVZ A;  2XM0 A;  2WZL A;  4DBR A;  3FXH A;  2ZXP A;  1UFB A;  1LM3 B;  1JPJ A;  1WN0 A;  2LFF A;  1YA9 A;  4HFK B;  4WAB A;  5K0I A;  3M1C B;  5EGY A;  2NSF A;  3PCV A;  1LI5 A;  2G62 A;  2HJ3 A;  4IAO A;  3GEI A;  3R2P A;  4PAC A;  5AGF A;  1OW6 A;  1MQV A;  2A0U A;  1RJ9 B;  2MYS A;  2MHR A;  3RQE A;  1H9G A;  3WG7 C;  1JRA A;  3ZTZ A;  2GFH A;  1IZM A;  2CW0 F;  2ZPA A;  2M4E A;  3G4X A;  5COG A;  5HSW A;  1FMW A;  1A7V A;  2DB4 A;  1RKC A;  3KYI A;  2Y69 C;  3SEO A;  2LIG A;  1FMV A;  1GS9 A;  1IW7 F;  2I15 A;  1OR3 A;  3U5S A;  4DVZ A;  5JVE A;  1A7D A;  1QVX A;  3MLG A;  3SXK A;  3S84 A;  2Y3G A;  2BL2 A;  4U5F E;  3L0I A;  5KYW B;  3HLZ A;  3DM9 B;  4Q4Z F;  3U3B A;  1M57 C;  2RSE B;  3GEH A;  3LAY A;  3UNG C;  4XPX A;  2V3C C;  2HJM A;  2IXO A;  2L6F A;  5F28 E;  4LAC B;  4YT4 A;  1JR8 A;  5A6B A;  3DD7 A;  2XLM A;  3I5Q A;  3C7J A;  4HE8 D;  2R02 A;  1YZC A;  2YLI A;  3JT1 A;  1TR2 A;  3ASO C;  1Y4C A;  4IB4 A;  3VYW A;  3CSK A;  4JW1 A;  2F22 A;  3ZC4 A;  1LPE A;  4G7O F;  1YZA A;  2P0N A;  3N0T A;  1TFK B;  5COF A;  2XL6 A;  2Y3B A;  5COM A;  3DKA A;  1AUE A;  4AK9 A;  4GYT A;  4NY3 A;  4EHP A;  2YL7 A;  1M2V A;  4NQF A;  1OCR C;  1VLS A;  2AVK A;  2YLG A;  2ZXR A;  2R25 A;  2PF4 E;  3AJM A;  3B71 A;  2R7O A;  3SNH A;  3DM5 A;  4EBJ A;  2A0B A;  1K40 A;  3K1H A;  3SXZ A;  2DGJ A;  5KYY A;  4OIQ F;  3RFY A;  2WVO A;  1UG7 A;  3BEH A;  4YK5 A;  4CJO A;  2KGO A;  4E7Z A;  1A7E A;  5L3Q A;  1PCX A;  3UMI A;  2CNW D;  2NUT A;  5KYU B;  1XWJ A;  1FR0 A;  1MMA A;  3GEE A;  4MW3 A;  2VCB A;  4BJ5 A;  2R05 A;  2VH3 A;  3DWW A;  3W8I A;  1L3P A;  1VOM A;  4ONS A;  5T3T A;  4XLN F;  2J46 A;  2EIN C;  3EGX A;  4JTD B;  1O3U A;  2YZS A;  1BDJ B;  1ZHZ A;  2EPM X;  4WGY A;  3ZSU A;  3VF0 A;  2D4U A;  4CSA C;  4JUR I;  4QI0 A;  1HW1 A;  2D5R B;  4BEJ A;  1K05 A;  3GM2 A;  4CDV A;  1FNT c;  1WAS A;  4JC7 A;  1CGM E;  4QI2 A;  1HE1 A;  5TJ5 E;  3NYL A;  4G7H F;  4PK4 A;  1JOG A;  3FAP B;  2PFD A;  1FFT C;  4G78 A;  3MFN A;  4DJ9 A;  3JRT A;  1Z63 A;  1PD1 A;  2XLO A;  2TMV P;  3EJN A;  5DQT A;  2YEV A;  4P9F A;  1ORS C;  3AGT A;  1AEP A;  2L6G A;  4IGG A;  4AL0 A;  2ZD9 A;  1MND A;  4B6I A;  4PJM A;  2YKZ A;  4JTA B;  4BJ6 C;  1C02 A;  5A6K A;  3E9V A;  1KTM A;  3ATP A;  1H6G A;  2V26 A;  1YJG A;  2A6E F;  2HUJ A;  4HFF B;  1PD0 A;  3SXM A;  3CAX A;  3I5P A;  3B0P A;  1O87 A;  2EIK C;  3LLK A;  3M79 A;  1V4A A;  4EWC A;  3M4C A;  2R7R A;  1YA7 O;  2HSB A;  4CIH A;  2Q9B A;  1NLX A;  2HMQ A;  2WZG A;  1G5Z A;  2DI3 A;  2H7V C;  1ZHY A;  3K6B A;  3KMI A;  2Q7R A;  2M64 A;  4OD4 A; 
#chains in the Genus database with same CATH homology
 4G78 A;  3IQT A;  1A0B A;  2A0B A;  1QSP A;  2OOC A;  3MYF A;  3U3B A;  1OXK A;  3KYJ A;  2LP4 A;  1C03 A;  1I5N A;  4EUK B;  2Q4F A;  1FR0 A;  1Y6D A;  1SR2 A;  1WN0 A;  1C02 A;  4PAC A;  1BDJ B;  3US6 A;  2LCH A;  2LD6 A;  2R25 A;  3KYI A;  1YVI A;  1TQG A;  1OXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...