3KYOA

Crystal structure of hla-g presenting klpaqfyil peptide
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
273
structure length
273
Chain Sequence
b'SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSASPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLIRGYERYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class I antigen
publication title The structure and stability of the monomorphic HLA-G are influenced by the nature of the bound peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 76
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3kyoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3kyoA01
5HI5C 5E4IA 4GBXD 2R2HB 5E8OA 4Y5XA 2KH2B 4UBDD 2J2ZA 5IMOB 4Z0XA 1CICA 2VZSA 3GJFB 4NQSA 4ODXA 3MJ9A 1OW0C 1EGJA 1PVHA 1JPGA 4QRUA 3AU1A 3VWKC 2QHRH 3FFDB 1VDGA 1CR9H 2VXTL 1SVCP 5ESQA 4KV5E 2JCCA 4YH6A 2I9TA 5LBSL 4S1SL 4JZNA 5IK3A 4M61A 5DQDH 4PG9A 3HZKB 1T66D 3ARBA 4F3FA 2WANA 2HRPL 4FMFA 2VQ1B 5DTFA 5GSVB 2R2HA 4NQEE 5E8DH 1SQ2N 5IMOA 2MCG1 4MA7H 5HHXL 1Y0LB 3K1KC 4GRWF 3CAFA 1OAKH 3AREB 3QDME 2NY3B 5B4MD 5F44A 3SGEI 3TPUA 2L4OA 3OV6A 3MCKB 4FTVD 4PGEB 1OP9A 1QLEL 4PR5B 4N8VB 5CCKL 4MDIB 3RZCC 5CGYC 5GS0D 1KACB 2NR6D 1UM6L 3HZKA 2BFVH 1RMFL 1L7TL 3VD5A 2X4TA 4X98A 4LSDA 4MXQD 1MEXH 1OTSC 4QHNB 3BWAB 4JFFD 3DURA 1A0QL 1FDLL 5DMJB 5B39A 3VGHA 3EFFA 4XX1E 2BCKB 3FMGL 3GHEH 2FX9H 2DIBA 2DQJH 3MBEC 4HGWA 1HHJB 4X9GA 5H94B 3RY5A 2BXZA 1Y0LA 2FX7H 4HJJH 3CC5B 4XMKL 5D2NE 3LQAH 3AREA 4FOMA 3QXVA 3QO0B 4YXHH 3BWUC 3EZJB 1QLFB 5E03A 2RGSA 3E8UH 2EZ0C 5EZLA 3MCKA 4NQCE 2CGRH 4JFDB 3BDXA 3VXMD 3HKFA 4N8VA 4MDIA 4OLWL 4PJ9D 3MGTB 1I85C 4H8WC 1MVUA 3GO1L 2D03H 1BOGB 5HI4D 4DQOL 4GLRI 3H9HA 5F6HI 4POUB 1CLYL 5E2WH 2YK1H 2BCKA 2PNDA 1G1CA 5H94A 1DCLA 3OKNB 1LE5B 3ME0A 1WFOA 1FL6A 1IFHL 3CC5A 1FZKA 4QRTB 2EDLA 2HFFB 4TVPH 1SBSL 2O5YH 3QO0A 1FYHB 3BPNC 1CLOH 4ZFOA 1OM3L 5I71C 4ODVL 4OD3H 2R0ZL 1CLCA 1N0XL 1H5BB 4P2RA 5L2KA 1HNFA 5GXBB 2OQJB 4CVUA 1ZHKA 5C0RH 4F80A 3V2AR 1G9MH 3ZKXC 3V8CA 3UTTB 2JELL 3PQYE 1GC1L 5BRZB 3X12B 1ETZA 4R0LC 5T3ZD 1IGIL 5C08D 5I15L 1YQ2A 4TNWK 4XPGL 1FYTB 2VXSH 4Z5RB 5F6IC 3OKNA 1I3GH 1OTTD 3C60C 4JRYB 4QRTA 3JVGA 2NR6C 3PUCA 5HDLA 4XPFL 3EYQD 2HFFA 4UNUA 2W0PA 3QZWB 1LILA 3V8OA 3QDJB 3P3YA 5C07E 5T5NG 5E08L 3DV4B 1X5HA 4YBLC 3P9WB 5JW3H 2LV4A 5T5FL 2Z35B 1H5BA 4LEOB 4HCRA 2DJ4A 1G9NH 1I1CA 2DWDB 4HG4K 1EAPA 1DL7H 4JRWA 3BIBX 1IKFH 1KSRA 1LEIB 4S1DD 2E7LA 1CFVL 1KJMB 3X12A 3I50L 3NIDE 2I07B 1E4XI 3RU8L 2OR7A 3UC0H 4Y5XC 5JQ6H 3G04B 3QUML 4XNQA 2JJSC 2P48B 3OB0H 2GTWB 3MOBL 4WY7H 2J5LC 4JRYA 4FQPA 3QZWA 5HI4C 3I3EA 1RZ7H 3QDJA 4K7FB 1IAII 1WZKA 3M07A 3D85D 4UQ3B 1AXSB 3DV4A 2EDFA 4K3EL 5HHOB 4M6NL 4YEEA 2Z35A 2VUYA 3T4YA 4LEOA 1ZT4B 1HINH 4FQJH 4HK3J 2AJZA 2DWDA 4OSUH 3ARBC 3MLSH 4Y2OA 1LEIA 5FYLE 4UV7L 5DRWB 3D2UD 2PKDA 4YNYB 4DAGH 2I07A 4EXPX 2IQAB 5EWIH 5L9DL 2WQ8A 3O3UN 1IQWH 4JFDD 5F8QC 2GTWA 3AROA 1KYOK 2YWYA 4UOW0 1HQ4A 3U9UB 5SV3A 1CVSC 2QTEA 4UQ3A 4W81A 3RTQA 1MCWM 4XMPH 3R1GL 4Z7UE 1QRNB 3EFDL 4QO1A 5F7HA 1FP5A 2NY1B 5H2BB 3X14B 5GJTH 3LDBB 5JHDD 4UIMB 2APTA 3VRIB 5SWZE 4XMLH 1NL0L 3O3AB 3ZTJH 2FHCA 2GEEA 4WW2A 1KJ2B 3CIQA 4NZDA 3P0GB 3EJYC 3QQNA 5DRWA 2IQAA 5HVWA 1QBBA 5CP7B 1NAMH 1X5IA 3RPIA 3ZE2E 4BKLB 4ELKA 1AJ7H 5ID1B 1CZ8L 4NN6B 3AREC 4HT1H 1YN7B 4S1DC 5IVXE 1U8PB 2NY3C 4XC3H 5JPMB 2NY6D 5BRZD 1F4WH 4K3GA 2AQ3A 2YC1A 3PDDA 4ODHL 1VERA 5D7SH 2C1PA 2A6IA 3ZMRA 4PRHD 3V6OE 3X14A 1TZGH 2BVQB 1H3VA 5DEGB 4UIMA 3KHOA 5A2JH 1BIIA 5E2TL 4Y2DD 3VRIA 4GAGL 3O3AA 2MKWA 3RNKA 1JBJA 1PG7L 4ZFGL 2RB8A 4XCCL 2Z8RA 1FL3A 1IEAB 1TNNA 2F5AL 1HNGA 4M7JL 3CFBA 2VDKL 5IFJA 2DL2A 2WSKA 5D70L 5GZNC 3H0TB 2D4DA 4LPUA 1S7XB 1XAUA 2DTMH 5HPMB 5ILTH 2AGJH 4X8JB 3P4LA 3BYTA 3BH8A 1U93B 1MFAH 4PV8A 1QSFD 1I1RA 1UH2A 3BVNA 1QACA 1E6JH 1Z9SA 3HMWH 1AXTL 4OGXH 3HNSL 5FUOL 4KK8D 4L4TA 1Q72H 4PBXA 3REVA 3SQOL 5D7JB 3B5TA 3C5ZB 1IGYB 3TCXA 7FABL 3V6ZB 3A0OA 3FHAA 5AG8A 1TVHA 2EIDA 2XFXB 4OLVH 4GMTH 2Q86B 3JVGC 3K4ZA 2DWEB 1S7XA 1UACH 5BJTB 1DBMH 2IG2H 2HAZA 4LLQB 1UKQA 3RVTD 5HPOA 1HN1A 1AGCB 3IDJB 4Y4FA 3KYAA 4LDOB 1H5BC 4FG6D 3SKOA 5FYKE 1T2JA 1PBYA 4NWUH 1ACZA 1BEYH 2E7LC 5D7JA 5FDWB 5F9JB 2F53D 1IGYA 2OS7A 3MNWB 3V6ZA 3F5WB 3O45B 5C7XH 4P2OA 5EU5A 5I76A 2X1PA 4LLYB 1VFOA 5GS2D 2YOCA 2XFXA 3CU7A 1ZT1A 2Q86A 3TBYA 1GGIL 5FYJL 4DKEL 3QFJB 5BJTA 3SJVB 1NCDL 4LLQA 3CUPB 1PQZB 4X4MA 4YXLL 1AGCA 1MCLA 4AEHL 3DX8A 1RUKH 2KZ1B 4WI9A 1MH5B 2PCPA 4OCWH 5JW5A 4IMKA 4OT1H 1MJUL 5E8EB 2ATPA 4L9LB 5FDWA 1OD7A 2Y6SD 4ZO9A 2LU3A 5I30H 2HKFL 1MCKA 4MD0B 3F5WA 3O45A 4DGVH 4NHCL 2JCCE 5JXAL 2AK4B 1DLHA 3HNVH 4LSSH 1CD1A 4PJHB 6FABH 5MERA 3QFJA 4HC1L 4YDIL 4XX1G 5HBBA 1V7NL 5C0FB 5I74B 3NH7H 3V7MA 3CVIH 3GIVB 3SKJL 2VN4A 5E8EA 3P11H 3ZZ1A 2XTJD 2D7PA 4OLZH 3CFKA 4QRSB 4NRYA 4GG6F 4O5LL 4HZAA 2FNBA 1E27A 3TPUE 2CD0A 1E4WH 5CUSH 5EO1B 4JO4H 1W72H 4FP8H 3MRDB 4H5SA 1YJDC 3JTCA 1YNLL 4RFOH 1IAKA 5C0FA 1JF1B 4IBLT 4KHXH 2NY1C 2W65B 4F9LA 4LPCA 3LDBC 1CGTA 3SEPA 1V3JA 1CCZA 5C2BL 5JW4R 4GQ9H 2R2EB 5KSBB 4QRSA 3STZA 1F3DJ 3QIBA 5CWSB 1DQTA 1IBGH 4ZO8A 5DR5H 5T5NF 3WFEH 3VDBA 3P4NB 2EE2A 1NGYA 4F2MB 3CDFA 4CVXB 3TN0B 1BFVH 4LAQL 4ETQB 5D8JH 2R9HD 5J1AB 4NN6C 3IFOB 1A5FL 2Y6SC 1Q1JL 1F4YL 5I9QB 4E41B 5GISH 3UBXI 4PRDA 1JF1A 3W5MA 3ULUH 4OM0L 4ISVB 1P1ZB 1JGVL 4HPYH 1X6LA 5EIVA 5I1DA 1AGBB 1NGWB 3KS0H 2E6QA 1HSBB 4JQXA 2FL5B 2R2EA 5KSBA 4M9PA 2DS4A 3BP5A 4Z0BH 4Z7WB 5HHPB 3P4NA 4PTUA 1HHHB 1IAIL 4P2RE 5L2KE 2VDQL 2ZPKL 4P23D 1CK0L 3B9AA 4DZBA 1LP9B 1AO7A 3IFOA 1WT5A 3OB0K 4W70A 3KLHD 3NZHL 2MKLC 5GGQH 3N1GC 1HKLL 1OGAB 2N1KA 3HE7B 2QQKL 4HUMB 2M2DA 4XP4H 4E41A 4CJ0A 3WUWG 4NO0A 3VFNB 4HS3B 5F70A 3UTSB 3S96B 4ODWA 4G6KH 1P1ZA 4R7DB 1F5WA 3WO4B 4GKZB 2YPLB 3DX7B 2Y07H 2AJ3B 3WIIH 2FL5A 1TVBB 2HTLC 1CLZH 5D7JC 3ZDXF 3C5ZC 3GSOB 5HHPA 3MLYL 4HXBH 3VW3H 1INDL 4MQ7B 1HHHA 1AQDB 5H8DA 5LG1A 4OZFB 1JTOA 4NC2B 4L4VD 2CKBL 3SO3B 3U4BH 1NDGB 1SMOA 1LP9A 5KVGL 2G2RA 5ACZB 1BFTA 4CBPA 1A6UL 1OGAA 1N3NB 2E7LE 3HE7A 2YSSB 1PZUB 1J0YA 3Q1SL 1I9IH 1RSFA 2ICEA 3CK0L 4MS8D 4P4KB 5GGSB 3VFNA 3UTSA 3S96A 4BUGA 5HHQA 1DSFH 1IGJB 2A1WH 4JQIH 4R7DA 2R2BB 4KQ4H 4IRZL 5K9JL 2R9HC 4IMKC 3IYLW 5EOCL 3SY0A 1D6VL 3DX7A 4JRYE 5CIPA 1AC0A 3QDJE 3GSOA 3BI9X 2P8PB 3GRWA 4HBCL 1PG7W 3LB6D 1FORL 2LE9A 1SEQL 3CLFH 3FT3B 3QP3A 4JRXA 1ZHBB 2AXFA 3CXDH 5L8KB 3DI3B 4XAWH 4CDGC 5J0BA 2ZWLT 1NBQA 3L5IA 3LQZB 4C56B 1NDGA 3RHWK 1CTNA 1F3JB 1F45A 2VZOA 1A7RL 4PY8I 3E6HB 4U1LB 1RVFL 1N3NA 3TBWB 2VLKD 2A83B 2YSSA 43CAA 4CVZA 2IMNA 1MCQA 1A6TA 4P4KA 5B8CA 3QEGH 4PIRF 4MB5A 4OQTA 3KVQA 3OKKA 1MCJA 2R2BA 3TN0D 3VFPB 4L9LC 2VN7A 3LKQA 1VACB 4MJIB 3IRPX 1XR9B 1W0YT 1X7QA 1B4JH 2Z0BA 2DQFB 2P8PA 3GMRA 3MA9L 3ULVH 1IGFL 3NCMA 1NGZB 4L8DA 4HAGA 1ZHBA 3QCTL 5DA4A 5H35A 3C5JB 1A9EA 3LQZA 3E6HA 4NFBA 4AEIH 4U1JA 3TBWA 5I74C 2A83A 4D9QD 3FOLB 4KK5C 4LSRH 4WEMB 5DJZB 3LKOB 3ARQA 1X4ZA 3VFPA 1NGPL 3ABZA 4FZEH 4OFIA 3SKMB 4ZUSA 1YN6B 4NUJB 1XR9A 2J6EL 3IU4H 3MFGB 4JDTL 1HZHL 2AJUL 1NGZA 4JPVH 4OFYA 3HZYB 1JK8B 4BQ9A 5JR1H 1IEHA 1P7KB 3VI4E 1M05A 1U3JA 2YPLD 3C5JA 2A2QT 2VXUH 1M7IB 2FJFB 3FOMB 1T1YB 3QUZB 1CE1H 4KV5F 2J7LA 2R8SH 1OTUD 4QWWD 4HX1B 4NJ9L 3L3HA 2HJFA 2NY7H 3A67L 5DJZA 2G60H 4W4OA 2X89D 5I1IL 1XGRB 1YEIH 4JQXC 4TNVF 3ALWA 5HHVL 3SKMA 1YN6A 2O61A 1C08B 1WEJH 4A6YL 3SBWA 4LEXL 1HXYB 1U42A 1K8DA 3HZYA 3QAZB 3TN0C 1CD9B 1JK8A 2HWZH 2OTWB 2QV2A 4JM2F 1KULA 1P7KA 3DBXB 5DS8A 1ADQA 1WT5C 3V5HA 2FJFA 3V0AC 3FOMA 4L4TE 1T1YA 1G7QA 2MFNA 3QUZA 3VFVB 1MLBB 4X8XA 5I9QC 4HX1A 4WTZG 4X6CB 4BQCA 4HIHB 3HAEH 4LQ1A 2QHRL 2R1WA 1CR9L 2YS4A 1SYVB 5GGRY 4FFVC 2F5BH 4C56D 4TTDC 2OBGA 5DQDL 4MA3B 3D0LB 4D3CH 2YZ8A 3WFCH 2LAAA 1UB5B 2B1AH 2W60A 4HS6B 3TWCH 1UFUA 3V4VH 1F2XK 2PF6A 2NCMA 3JTSA 1CFQB 1XGTB 2OTWA 3DBXA 5E8DL 4JVPA 3CSBA 4MA7L 1Z0MA 4FQ1H 1TFHA 4MJID 3HE7C 3RWGB 1OAKL 2HH0H 1S7VA 3O11A 4GW4B 3BN9D 3GDBA 4OZHA 3WO4C 1HSAB 1SYVA 4ZUWB 3DIFA 2NNAB 5JUEH 1OARH 4LNRA 4JJ5B 3TA3D 3BN3B 4O58H 4MA3A 3D0LA 4AQ1B 5SWQB 3SE4C 4WNQB 2BFVL 1UB5A 4HS6A 3MREB 1KCUH 4X4ME 1MEXL 4QKXB 5EZJA 4U6XB 4PLKD 5FFLA 3MCG1 1CFQA 1XGTA 4OD2B 1QFUH 2GJZB 1TETH 1NC2D 5AG9A 3SO3C 3GHEL 2FX9L 2DQJL 4K71B 2FX7L 4HJJL 4S0UC 1FNGB 2EIZB 5JNYA 4LMQI 3LQAL 3RWGA 4P4KC 4YXHL 4S1QH 4LOUC 3E8UL 2QSTA 2QKIB 1HSAA 1DQQA 2CGRL 4ZUWA 4TRPH 5DHXB 4R8WH 2B1HH 3QFJE 5B39G 3N9GH 1LHZA 3B8YA 2WINB 4JM2D 2D03L 3MREA 3MX0A 4PJBB 4U6XA 1BLNB 1N5AA 2CK2A 3C2AH 5E2WL 4IS6B 1MIEH 2GJZA 2R56H 2YK1L 4LCUA 1JZ3A 2P5WA 1X5AA 4OCRH 2H32B 2FJHB 4H8WH 1KB5B 1FNGA 2EIZA 4TVPL 1FGVH 1LD9B 4I13B 2O5YL 4N8VG 4UNVA 1PKOA 2E8ZA 5ACLA 1JNLH 4N0FA 1CLOL 1CGUA 4QT5A 4LSTH 1OAYH 4NQXB 2QKIA 4OD3L 4AIZB 5E7FA 1T20A 1NBYA 4N0YH 4F15B 3W0WA 1FC2D 1ZKAA 4OFKA 4WFGE 2H41A 2FECL 3NIDF 4LPVA 2X7LB 5C0RL 2AK1H 1AY1H 4CGTA 1DQMH 1N2RA 3OJ2C 1G9ML 1NFDA 1QFWM 1PYWB 3W9EB 4FXGA 2NW3A 3QXAA 1P2CA 4PJBA 1BLNA 1EXUA 1MRDH 1T2XA 4IS6A 1O7SA 1N5YH 2VXSL 1JZ5A 4I0PD 3U2SB 3D6GA 5ICYA 1BZQK 1T5XB 1I3GL 2H32A 1U92A 1KB5A 3OXRA 4RMWA 1I3VA 4YBQD 5LAXB 1JPST 4HULB 4KK9D 3SPVA 3WNLA 2OSLB 2WV3A 1UYWH 3V4UH 4KZEH 1ZK9A 1JTPA 1SM3H 5ALCH 5I73B 5JW3L 4W4OC 4KKLD 5GS0H 5ECJE 4KDVA 1HI6B 5D2LF 1BIHA 5C0CD 5LGJA 1G9NL 1MAKA 1DL7L 1WTGT 3DRQB 1IKFL 1S7RA 3KPNB 4O2EB 5KSUA 3W9EA 3HFMH 4LIQH 1VCAA 2CDEA 2VNCA 3ZKQD 1WFUA 2ID5A 3UC0L 5JQ6L 3EO0B 2FH8A 3U2SA 2NY2B 1T5XA 3QUZC 4Z7UF 4WY7L 2W38A 5KSBE 4HK3N 4RNRB 3MJ6A 1RZGB 3TF7C 4KGLA 4PGCA 1RZ7L 1BJMA 2I60H 2OSLA 4FQLH 1BWWA 2ILLA 1Q9LB 3GSXB 3MV9B 1I9RH 3CFDB 2X10A 5IWLA 4RQQB 1HI6A 3MNZA 1HINL 1JHKH 4FQJL 5KBNC 1AO7E 4MD4B 3ELAT 5M94B 1NKRA 1SJXA 3DRQA 4OSUL 3MLSL 3GBLA 4H88H 4KROB 4O2EA 3ZE2F 4E41E 4J23A 4LCIH 3OF6D 2B2XH 3QAZC 1XR8B 4WI8A 4DAGL 1JPTH 3QZWG 5EWIL 5IVXF 4M6OH 1XF4B 4R6UA 2VMFA 3OKLB 1IQWL 4PREB 2OCFD 3RWCB 2WWKO 1BBDH 1X5GA 4RNRA 4JZOA 4J8RA 1RZGA 1RUQH 4KJPD 1F3RB 3T04D 4XI5C 4HG4J 4ZXBA 4G6JH 4XMPL 1HYRC 3MRBA 1Q9LA 1WBZA 3GSXA 3GJFH 3WIHH 5GJTL 1FRGH 5EIQA 3O41B 4P9HH 1LP9E 4MD4A 3V0VB 5IBTH 4G8IB 3KHQA 3W39A 3DXAB 3KPMA 4XMLL 1OGAE 5T3ZH 5TDNB 4GRMB 3UTSE 4XP9H 1XR8A 1LDSA 4KKLC 2YD7A 1XF4A 3OKLA 3NCEB 1NAML 5K59E 3QUXD 3ISWA 5DVNA 1AJ7L 3W11C 1PLGH 4HT1L 1KCLA 4XC3L 4KJWD 5FYLD 1F4WL 5EOCJ 5D7SL 1ERNA 1BQSA 4JRXE 4U6TA 2ITCB 1TZGL 2YD2A 2AAVA 3O41A 4EUPB 1YEEH 3DGGB 3O2WH 3V0VA 4G8IA 3DXAA 4R3SB 4GRMA 5HYQB 1KYOJ 1EFXA 3DARA 3P9LA 4M1CD 2OJZL 3LRGA 3ZT7A 3C08H 2F74A 4K71C 4WHYG 5BMFH 3N50A 2OX5A 3TT1H 2D7NA 2C5DC 2DKMA 2DTML 4YHIA 5ILTL 2AGJL 4POZD 3HNTH 4LK4A 1BX2B 5DC4B 4MNHA 1MFAL 2ITCA 1F97A 3ZYIA 1E6JL 3B9KD 3HMWL 4RAUB 5E5RB 4OGXL 4EUPA 3UJJH 1I3RB 1GXEA 1Q72L 3T2QA 4HLJA 4R3SA 5EOTA 2BNRD 2Z31B 5HYQA 2DBLH 4AL8H 1KNOA 3DOSA 3K3QA 2YEZB 2A73A 1NPUA 3MV9D 2CJUH 2D0FA 1A6WH 1L0YA 3WFDH 3L7FB 2CRMA 3EDFA 4OLVL 4GMTL 3RVWC 3C8KA 2IALB 2VDOH 1UACL 1IL1B 2IG2L 3QPQC 3QT2A 3TLRA 1XEDA 1BX2A 2YBRB 4N90E 4KRLB 4QHUA 3ZHKA 4F15C 3VXRD 1WZ1H 1ZA6A 3CPLB 2XN9B 4NWUL 5DC9B 3T0EA 2JCCF 1BEYL 4N0CA 1Q9OA 3IETA 1ZLSH 5JZ7C 4ETYA 3PWLB 4U49A 4P0DA 4TN9A 3OXSB 1K5NB 4DFHA 5C7XL 3DV6B 3L7FA 2ATKB 4KUZH 5ITFB 5J1TC 5GZOD 4NOBA 3BHBB 5HVFB 5E7BA 4JO3H 1IL1A 2YD8A 3ECBB 2VKWA 2X4OB 1JVKA 5I73C 1NGXA 2YBRA 3GM8A 4ZDHB 5IWLC 1RUKL 4JFQB 4XCNB 4C83B 4OCWL 3DUUB 4OT1L 4EN3A 2FLBT 3CPLA 2XN9A 2E8YA 4NT6B 2A77H 5E9DB 3K8MA 4LVOB 2UY6A 3GSNB 4N1CA 1UADC 4PLOB 5I30L 3OXSA 1K5NA 4DGVL 5A1AA 2JKXA 4DJMA 3IDIA 2NY2C 3HG1D 5FYKD 4H1LA 5DFVC 3BE1H 3HNVL 4LSSL 2ATKA 3FT2A 6FABL 1F11A 5F72S 5IV2B 2P46B 1UCTA 3ECBA 1N6VA 3C8HA 3UROR 3O8XD 4PB9H 3NH7L 2Y06H 3CVIL 4JFQA 3DUUA 3E3QA 3LN9A 3KPQB 4DOHE 4U7KA 4JEGB 3P11L 4MNQD 4OLZL 4KROC 4NT6A 3IJHA 3VXPB 5EC2B 1NJ9B 4KRPD 1X5YA 4MAUH 4OZHE 5FYJU 4Z78A 1E4WL 2WW8A 5CUSL 4QXGH 3VGEA 4JO4L 1W72L 2HT2D 2WZPD 4FP8L 4Z7OE 2GJ6D 1CE6B 1D5BB 2EDYA 3W5NA 4FQQA 4F37K 3L5WB 4RFOL 4ZSOB 2YD9A 2DJUA 1MCWW 5DI8A 2ARJQ 4KHXL 3WV0A 4JDVA 3PWNB 3VDAA 1GOFA 5DT1H 1LNUA 3KPQA 5GZOC 43C9B 3VFMB 3NIGE 4GQ9L 1SJEB 4Y88A 4X9BA 5IQ9A 3DECA 4CL7A 4MZ3A 3PWVB 5EC2A 4KTDH 1IBGL 5DR5L 3WFEL 3GKWH 5JORA 1OPGH 1A6AB 2V5YA 5GS2H 1OF2B 2GCYA 2Q7YB 1BFVL 1HILB 2RFXA 4I0CC 5D8JL 1RZJC 1T6WA 3QEHA 1D5BA 2GW5A 3AAZA 1MQKH 4JG0H 4ZSOA 3U30B 4XXCC 5GISL 4DUWA 3IDMA 3BZEB 3ULUL 4G6FD 2KKQA 5GRYA 4HPYL 1AFVH 3MRIB 2P5WE 3VFMA 1SJEA 3GKZA 5JIHA 1GH7A 1PDKA 4D8PB 4Z0BL 3K8LA 5E6IA 4RBPH 3PWVA 5C6TH 2H2PD 2D2OA 2P5ED 2MJWA 5MENB 3CXHK 3QUMB 3W0WE 1GZQB 3U7YH 5ADPH 2Q7YA 1HILA 1M71B 2K3TA 3CFJA 5KOMC 5IJKA 3VXNA 1WVZA 4BFGA 5BO1H 1HHGB 1NFDE 1FN4B 2I9LB 5DJ6A 3NMEA 5GGQL 3FN0H 1LEGA 4XP4L 4PJBE 1OP3H 3BZEA 5I8KH 1XCTB 4XCYA 4G6KL 2HT2C 1RI8A 1X5JA 3BX7C 3LKSA 4FABH 3VJ6B 4KAQH 3VFOB 2CK0H 1J05A 2UZXB 1U8HB 2Y07L 2Z91A 3WIIL 2Z31C 3MC0A 4N0CC 5DC0A 3PHQB 1CLZL 2BRQA 3OSKA 2RCSH 4HXBL 3VW3L 3GSRB 3FO2A 3DHJA 4Z6AT 1JNHB 4I1NB 1GZQA 5JOEA 2XYCA 5GS1B 1M71A 4K3JH 2A6KB 2HFTA 3U4BL 1QNZH 1FFOA 1ZV5A 5E2JA 1FN4A 5D9SB 2I9LA 5FUZH 1NEZB 4MWFB 1P5UA 5T1MB 3TVMA 2VH5H 1I9IL 3RL1B 4WJ5A 3MJ7B 4BSWB 4PJGA 2EDTA 1DSFL 1XCTA 1IM9B 1KV3A 4TUJA 3V5DB 5IBUG 2A1WL 4ZUUA 4JQIL 1TITA 4KQ4L 4P2RD 4LCWA 3VFOA 1H3WM 2LU4A 1U8HA 3MRJA 3GJFK 3UMTA 3OKEA 5DVMA 2NXZD 2PN5A 2Y5EA 1RAMA 4S10A 4YPGB 4DFIA 4MGXA 3GSRA 1RJYA 3DHMA 1JNHA 3CLFL 4WW2F 4MJ4A 1WWAX 4QLRA 3CXDL 4XAWL 5GS1A 3ZKMD 2A6KA 3RIAK 5EO0B 1J1PH 2MQ0A 5D9SA 4HUVB 1NEZA 5T1MA 4DWHA 4GQPH 3QEGL 2CRYA 4FQXA 5HGBB 5FECB 2BP3A 3S98A 1DUYA 1ZVSA 3WSQH 4BSWA 4X4XB 5E1HB 3V5DA 2W9LA 3I6KB 5DQJB 3E3QC 1GYAA 5MEOB 5DXWA 1CDHA 4RGNE 4PY8J 5I1LA 3F7QA 1BVKB 3EIFA 4U1MB 3RVVD 3VI4F 3D87B 4LVOC 5IHZA 4JG1H 1B4JL 4PJAB 3ULVL 2WAHA 1UM4H 4BSJA 3QNYB 3NFSH 2XICA 4RZCB 2NX5B 3SGKA 3L9RB 1YYMH 1CBVL 1DEEA 3IDYB 1JGUH 1CL7H 3FFCB 3O2VH 5HGDB 4AEIL 1XF5B 4KJYA 5MP6H 4I3GA 1TVDA 3B5GA 1OAZH 1NSNH 4KU1A 5FECA 1A3QA 4ZUTB 4LSRL 4MHHG 1KPRA 4X4XA 3WLWD 3QA3B 2BJMH 5MEND 5CINH 3I6KA 5AD0B 1A1MB 2HYMA 5MEOA 3W2DH 1RHHB 2ICES 1MCCA 4GG8B 4X6DB 1MCBA 5C0EA 1AQKH 2DQDH 4Z18A 1L4IA 3P77A 5KAQG 3CSYA 4FZEL 2XQBH 3WMSA 3L3DB 1KCGC 3SCMB 3IU4L 5C09D 1U9KA 4GKNB 3OR6B 4RZCA 4JPVL 1OB1B 2NX5A 4JGJA 5JR1L 5CFHA 3L9RA 2BZDA 3QIUB 3AGVA 2VXUL 4YZFF 5DVKA 5D7KD 4IRJB 2ARJB 3DXAE 3U4EB 5HGDA 1CE1L 1XF5A 1DP0A 2R8SL 3TZVA 1CD8A 4FQIH 3CJJA 5FV2A 1JN6A 4WO4D 3U0PA 2NY7L 4JN1H 1A1MA 2G60L 1RHHA 4BH8B 4LL9A 4X6DA 1FJ1B 1YEIL 2H9GB 1V05A 3B9VA 7CGTA 1A1NB 3L3DA 1DDHA 1FGNH 3SCMA 1GC1C 1WEJL 3RX7A 5A3ID 3QO1A 3WD5H 4GSDH 5IOPB 4Q9RH 3WIFA 1IM9D 1OB1A 4Z7VB 2HWZL 5L88H 2VL4A 3OWEA 3KLAB 1MFNA 4K2UH 3DX6B 4NKDB 2DN7A 5BZDA 3RFZC 4IRJA 4PRPD 2ARJA 5HI3C 3LN5B 3U30C 3NPZB 1TMCB 4H26B 2VZ1A 1WIUA 4JJHA 1T1ZB 4BH8A 2F5BL 4MA1B 1LK2B 3QYCA 3DO7B 1KUMA 2FIKB 5IHUH 3MPCA 4NQDB 3BMVA 4U05A 1A1NA 3U0TA 4D3CL 3WFCL 3HTLX 1WAAA 2CUIA 5IOPA 3TWCL 1QZ1A 4XCEA 3RWFB 3WLWC 5EH1A 2OXGA 2N7AA 3LEVH 3V4VL 3QNZB 4Z7VA 4P59H 2X70B 1PZ5A 3GSUB 4NZJA 4WFEE 1DANU 1HOCB 4PYGA 5IW3A 3D25B 2IPTH 1VFMA 2BSTB 3U0WH 3C8DA 3T0EE 4FQ1L 2WWMD 3QUKB 4G8GA 2DB8A 1G7JB 1KIQA 4N8PA 3TBTA 1TTUA 5B38A 3MUZ1 2HH0L 5J6HB 1TMCA 4H26A 3UAJD 4JO1H 2PR4H 1I8LC 1T1ZA 1Y6MR 5TDPA 1LK2A 4LHUB 4NQDA 5B22A 5JUEL 1OARL 1JFQH 5IKCA 1C5DB 3GEWB 4O58L 1BF8A 4L4TD 2Z8VC 2JIXA 1U91B 2SEBB 1FZJA 1NCTA 4NC1E 1KCUL 4XB8A 5GIRB 3MODH 3QNZA 1ODAA 3H7LA 5F88A 5IF0B 5GS1C 3GSUA 2UYLB 1QFUL 4M43H 1S7TB 1TETL 3D25A 4HGKC 2WY3A 1MFCH 1UJ3B 2BSTA 2A74A 2XN9E 3ARDB 3WKMH 2VLME 4HC1A 1BFSA 3IFLH 4R2GD 4F7TB 1K3ZA 5J6HA 4S1QL 1FNHA 3HE6D 5CBAB 4AG4H 3KJ6H 4NHUB 4OZFH 4Y4FD 2X44D 3MUHL 1PFCA 3S5LB 4PJFB 4XP6H 1CS6A 3ES6B 3QIUD 5GGSY 3RI5F 4B53A 4PBVC 4TRPL 4P2QA 4R8WL 2B1HL 5CSZB 3IRZA 3N9GL 3G5YB 4Y7MA 3UO1H 3T3MF 2DKSA 2SEBA 3M8OH 4WDIA 4U6HA 1WGOA 1DBBH 4LSVH 3RNQB 4L3CB 5F1KC 3B3IB 3FO1B 1KPUA 3SGKC 2EO1A 3C2AL 5IF0A 4P2OD 1YYLH 1K8IA 1MIEL 2R56L 1S7TA 3E3QE 3D18B 5C9JB 1PEWA 1UJ3A 1ONQB 3ARDA 2I27N 4OCRL 2NW2B 4H8WL 1OAUH 4QTHA 5JDSB 4K94H 4CU6A 1FGVL 5E9DE 5EPMB 3MFFB 3WNOA 5CBAA 1JNLL 4NHUA 5HDOA 4LSTL 1OAYL 4MB3A 3S5LA 1EUUA 4J3WA 4N0YL 2HJLB 4PJFA 2R4RH 4P3WA 5F9OH 2WWMC 2GFBB 2AV7B 2AK1L 1AY1L 4MVBD 1DQML 1MLCB 1EFQA 1U95B 2GIYA 3KYMB 3RNQA 4L3CA 5KSBF 2ICCA 3FO1A 5J3HD 1KJ3H 4RBPK 5C0GB 1MRDL 3EDJA 3IDYC 5I1CH 5JXEA 1N5YL 3D18A 5DDHB 1OAQH 3BESR 2NW2A 4D2NA 2OP4H 5JDSA 1RIVH 4I4WB 5EPMA 3MFFA 1ED3B 4LHQB 1T83A 1KEMH 5DQ9B 4JHWH 4EKXA 1F4AA 1UYWL 4KJQC 1S5HB 1J10A 5CGTA 3V4UL 4KZEL 2XWBB 1Z0NA 1SM3L 5ALCL 1Z9MA 4L8BA 2HJLA 4XB7A 5GS0L 1FL5B 3PXJA 2AV7A 2QLVB 5EU7E 3ARFD 3SCMC 1MLCA 4ZSOE 2IPUG 3KYMA 3HFML 4LIQL 4OCMC 3P30H 1CYGA 4OTXH 5C0GA 4KUCF 5DO2D 3QIUC 1J1OH 5DDHA 2CKBB 3WFHB 4IRJC 3L3IB 4I4WA 3BXNA 1KIPB 2QSQA 3LS5H 1ED3A 3WCYA 3P0YH 2AV1B 2I60L 5DQ9A 2LU7A 2Y9RT 2YD5A 4FQLL 3KS0J 3FT4B 4X5LA 5ESAB 2XWBA 5IR1B 4U1HB 1I9RL 2D3VA 4X0KB 4I48A 1P4LA 2DDQH 5IIEB 1KTDA 2DQGH 1JHKL 5D1XB 4M3KB 4OI8A 1MWAH 4OAWB 2VDRH 4YHKH 4N5ED 1QVOB 4OF8A 4XHJC 1T0MA 2YUXA 3LZFH 4DN4H 2YD3A 1KLFA 2GI7A 3QIBD 4H88L 5K59F 4LCIL 3P9MB 1YY9D 3EZ8A 2B2XL 2HLAB 4JKPH 3K2MC 1JPTL 4XNMB 4M48H 4Z9KB 1W0VA 4M6OL 3VH8B 3MRLB 5BV7H 2FHFA 3WFHA 3QDGB 3L3IA 3GB7B 4MVBC 1CDGA 1BBDL 2FYYB 2ED8A 1KIPA 1S78D 2D9QB 1RUQL 2AV1A 5J3HC 1ZT7A 2E9WA 2EDHA 4G6JL 3FT4A 5ESAA 1JMXA 4MA1C 2V9TA 1MOEA 2FSEB 3WIHL 1FVEB 1FRGL 4P9HL 5IBTL 1JRHH 5T3ZL 3ZYZA 2VLRD 1H0DA 4XBGB 3P9MA 2D7MA 4XP9L 4PJGE 4XNMA 2C1OA 3S34H 3X3GH 1K3IA 4U6YB 4LCWE 3VH8A 3MRLA 3IFPB 3QDGA 4F7CA 3GB7A 3O3EA 3RY6A 1PLGL 1MCDA 3CLEH 3KDMB 3IFNH 4QTIH 2NY5H 2BMKB 3UTPD 1KCRH 1S8DA 1EDQA 1S3KH 4JLRB 4Z95H 5E2VH 1GPOH 1FVEA 2VZVA 3WO3B 4ZUVB 1WC7B 4HH9B 5CEXB 4OCYH 1YEEL 3O2WL 1MFBH 3FQRA 4P3DB 2EC9T 1QFOA 4K9EH 5FKPB 1MPAH 5SX4H 3EO1B 2KZWA 3PL6D 1B88A 3C08L 5E5UB 1UJ3C 4GXVH 3ARDC 5BMFL 5EUOB 3TT1L 3N1PC 4N5EC 2XWTA 4X80H 1MHPH 2AQ1A 1U8KB 1KXQE 1MJJB 3EGSB 4YE4H 4RISH 3HNTL 2BNQB 4JFPB 4NQVB 1QYGH 1W0WA 4K3HA 2BMKA 4BQBA 2X1QA 3HB3D 1VGEH 3L5XH 3TNNB 3E0GA 4LLUB 2VERN 3RVUD 1ZA3A 4C57C 1WC7A 5CEXA 5DJ8B 2XNAB 3UJJL 3BKYH 4P3DA 1BGXH 2J6EA 1U8LB 4WWKD 3BEWB 2DBLL 1HH9A 4AL8L 2XZCH 5FKPA 4QY8B 4PFEA 1RJLB 5JXEC 5GRJH 2PW2B 2CJUL 2HLFD 1A6WL 4R4NC 1UT9A 3WFDL 2B4CH 1S9XB 4MXVE 1WV7T 3FAWA 5I1AB 2EDJA 5GRWA 2VDOL 5JLZA 1ZSDA 2BY3A 1T83C 1U8KA 5T1LD 3PF2A 2UY7A 3H3KA 4QRPD 4ZOBA 4EUPG 2IPKB 2MHAB 2NX5E 5DMGD 1ORQA 2ENSA 4LLUA 3AXLB 2EXWC 1VSCA 1WZ1L 5DJ8A 2XNAA 1KOAA 4WU7B 2CR6A 4OZ4A 4LU5H 1A1OA 1U8LA 2P7TA 2AKRA 3JWOH 4OFDA 4A6YA 4DVBB 3BEWA 3SDCB 2VUOA 3ILPB 3MV7B 3JWNC 2DQUH 2XZZA 3SDAB 4WV1B 2PW2A 3PDOA 1NEUA 1QFHA 3MXWH 4X6DE 2DICA 2E9JA 5HGHB 1UZ8B 5FA4B 3QBTB 1CF8H 4R4FH 1S9XA 4KUZL 5I1AA 5E2UH 1B0RB 5FYLH 1U8JB 1XGQA 2YXMA 2DQHH 3I75B 2HN7B 1B3JA 4JO3L 5MHSD 1LWRA 3U48A 5HY9B 2IPKA 3MNVB 2WLZA 4MD5B 2MHAA 4P5KA 4Y4HB 1A2YB 2Y5TB 1P69B 4QF1B 3AXLA 2IEPA 4OZHF 1YMMB 3D0VA 4KGJA 5M95B 3U7WH 3KYNA 2BNUA 2A77L 3S4SB 2WBJD 4Z7OF 1RJZB 3ILPA 3IAPA 3W81A 5CZXD 3T2NH 1R5IB 1UZ8A 3BE1L 3G9VA 3G5VB 1INEH 5EBMA 2APWA 3O2DH 2GSIA 2A9MH 4O02L 5T1DH 2HN7A 1WAAE 2HTKC 5DMIH 4X99B 3LPWA 3NAAH 3NIGF 3SDDD 3SGDH 4PB9L 1T7XA 3MNVA 2Y06L 4MD5A 4Z7VE 1A2YA 1YMHB 2Y5TA 3CSPA 5D1XC 1KF9B 1DR9A 5DUPH 5FYJE 4TUOB 4G8GE 4Y16B 1XIWD 4OFVA 4H1LG 1RJZA 5DJXB 2B39A 4MAUL 4HKBA 4BSVA 4Y5VB 3N1QC 4QXGL 3UBXB 3IVKB 2Y72A 3DVGB 3MV8B 4NQDE 3RY6C 3RJQB 1OQOA 2WIIA 3A6OA 2X4PB 4X99A 3MRFB 4P5TA 2B5IB 1WQVT 1YMHA 1U8QA 1SEBA 1MI5D 5JIKA 5DT1L 1CDYA 2VDNH 4TUOA 4Y16A 1Q94A 2GY7B 3B2UD 4Y19D 2ENYA 4NFDA 2P24B 5C6PB 4KTDL 3GKWL 4Z7NE 1Q8MA 1OPGL 4GT7A 1NFDF 5DK0B 4D9RD 3DVGA 3RL2B 3KJ4B 2EKJA 4P2QE 5F1NA 4D9LH 5HHMA 1MQKL 2X4PA 4JG0L 3R8QA 5E6ZA 5BXFB 4YDKH 5T33H 1IM3A 4M62H 2VAAA 1AFVL 3LRSB 4JFOA 2RIKA 1AGDB 2APBA 2P24A 2YXFA 5C6TL 2VXQH 4NHUE 3LOWA 5FYKH 4Y4HD 4L29B 4P48A 3HPJB 4X5WB 1FSKB 5ADPL 4PJFE 3U7YL 1I1AD 3TM6A 1YMMD 1JHTA 3WS6A 3BH9B 3VWJB 5BO1L 1VFUA 5E99H 2IFFH 3FN0L 1H15B 3X13A 5GGVY 5I1KH 4ZYKB 5I8KL 3UJTH 1CDCA 4FABL 5CZKA 3I6GA 4KAQL 4P2YA 2CK0L 4PJIA 4P57B 3FO0H 3O6MH 3LRSA 4OCSH 3DETC 3TYFB 3C9NA 1AGDA 4M02A 4LLVA 2RCSL 5CD3A 3RUGB 2V5MA 4X5WA 1PY4A 3V79C 5MEPA 5K9OB 4DVRH 5IMKB 2Y25A 3K1DA 4LF3B 4K3JL 3MJ9H 2P5WD 3BH9A 3B2UC 1QNZL 4UOJA 1N64H 1DQJB 5FUZL 4YDJB 1WBXA 2EE3A 1H15A 4AT6A 5E6YA 2VH5L 3D39B 1TZIA 2P4AB 4PJ8D 4WUUB 3N1MC 2KDGA 5D71H 5BVPL 5ETUA 3Q48A 4P57A 4P46A 4F58H 3CXHJ 1J11A 1J18A 3SKNB 3X3FH 5C0ND 3TYFA 2PO6B 1JZ4A 3SDCC 5CEZD 5EG6C 2Q7NA 2JJTC 4WV1C 3SDAC 4AH2B 3RUGA 1WIPA 1NMAH 3KR3H 1WLHA 1CXHA 3REWB 4RIRA 5IMKA 5INDB 2ADIB 5IFHH 1J1PL 1WIOA 2ERJB 2R0LH 2OZ4H 2OJEB 4X9IA 1Z6JT 3OAUH 5INCB 1DQJA 4BK5A 5JOFB 1N8ZB 4CAGA 4Y4HC 3WSQL 4EVNB 4UDTB 4WUUA 2G5BB 3O3BA 4OLYH 3MMEA 3BPCB 3AMLA 4LCCB 3KPRD 3MLWH 5CEYA 2R2CA 4JG1L 3L3KB 4IEFB 1FH5H 1UM4L 1MJ7H 3NFSL 2E7CA 1NEZG 1NAMA 1YYML 3TO2B 1JGUL 5F7WC 2F54B 4DEPB 3GJEB 1CL7L 3GSNH 2H8PB 4P2CG 1AKJB 3LQAC 1T03H 2OJEA 5INCA 3O2VL 4EI5B 5MP6L 5F7KC 1C7TA 1N8ZA 3P4MA 1P7HL 2AVGA 1OAZL 1NSNL 4EVNA 4UDTA 1S9WA 4GW5B 2BJML 2G5BA 5CINL 1V3LA 5I1JH 4Q97A 3FONA 3W2DL 4N9OB 4BH7B 2E7BA 2DMBA 3QDGE 2H2SC 1AQKL 2DQDL 4Y16C 4OZGB 1FZOB 4HLZH 4LCCA 2XQBL 3NN8A 1FV1B 2Q8AL 4Y5VC 3K0WA 3LSOB 1P6AB 1HIMH 2F54A 1X3DA 3ARVA 3GJEA 1GGTA 2HFEA 2H8PA 2YA2A 1AKJA 4H25A 32C2A 3MCLH 3LMJH 4EI5A 1T2QH 2B5IC 5SX4I 4FQIL 4ZXBD 4D94A 4GW5A 1BZ7B 4JN1L 4A2MA 3WJLA 4BH7A 3RDTB 4OGYH 3OGCB 1G9MC 1KGCE 2W92A 3MRKA 2PTUA 4N5UA 1FGNL 1FV1A 2EXYC 1MUJB 4UQ2A 4M7LT 3WD5L 4HWZB 2C3HA 3D39D 4E0RB 1YNTA 1U8MA 2GAZB 5EBWB 2EE9A 3LSOA 8FABB 3STLB 3KJ4C 5L88L 4G9FA 1R3IH 4K2UL 3IXTA 2ZSWB 2BVYA 2PO6D 5DHYB 1OY3B 1I1YA 5C0BB 2Z92A 4X6FA 1RK0B 4UT9H 4HCRH 4JFXB 1GVIA 1J12A 4KI5D 1NFIB 4QRQB 1I75A 1PKQB 1G9NC 3KYOB 4OGAD 1I7RB 5IHUL 1NLDH 4WVRA 1IZJA 5F21B 3O4OB 4L3ED 1EFXD 5ERWB 4QRRA 4HWZA 3QXUA 4E0RA 3LEVL 1FSKC 3KPLB 2GAZA 4Y89A 4P59L 4PGBB 1TCMA 5F3BA 4JFEB 3VWJC 2IPTL 3NTCH 3U0WL 4F7EB 2ZSWA 3EJZC 2CXGA 4QNPE 2V9QA 5C0BA 3CVHH 3UJIH 5B3NA 3BIKA 1RK0A 2H3NA 2FR4A 4JFXA 1TQCB 4JO1L 2PR4L 3O4LB 1NFIA 5DJCB 1CFSB 4HUUB 1I7RA 1F8TH 1I8MB 3NCCB 4OIBA 2ZJSH 1JFQL 3LKPB 1G7HB 4WU5B 1FFQA 2AP2A 3MODL 1XF1A 4JPIB 4NRZB 4G6MH 2V9RA 5B38G 3QG6B 1W72B 1UB6A 4M43L 4NFCA 4KKAD 3BP7B 1U8NB 1MFCL 3WKML 5I8CB 3IFLL 3HC4H 2CUMA 2PW1B 2X1XR 4AG4L 3KJ6L 4U2YA 3IGAB 4NRXA 1YY8B 5DJCA 4XP6L 1F58H 4HUUA 2FZ3B 4LVEA 1I8MA 4R90H 1UKSA 2OI9B 3LKPA 3EAKA 2PO6C 2WP3O 3UO1L 3M8OL 4V1DB 1DBBL 4LSVL 1VKXB 1EJOH 5E8PB 3QG6A 4P4RB 1YYLL 1W72A 1T3FB 3BP6B 3EOYG 5F89B 1U8NA 4Y1AB 2ERJC 1S9YB 2VLJD 3HR6A 2XPGB 2HT3C 5I8CA 1Y18B 1OAUL 2FWOB 4K94L 3GMOA 4OJFH 5DRXB 1U6AH 2NTSP 3M17B 2PW1A 3T3PE 3VE0A 4YHZL 1VB9A 5ANMB 1YY8A 2R4RL 3IF1B 2FZ3A 2VB5A 4EN3D 4LCCC 5F9OL 1YEHH 3QR2A 2VLMD 4O51B 3IJYA 2NXYD 3MGAA 4U0QB 4V1DA 1VKXA 3QI9B 3FTGA 5E8PA 3UTZB 5IVOA 1HYSD 1X5LA 1KJVB 1T3FA 5I1CL 1QSED 4P9MH 1A6PA 2DBJA 3QIWA 1OAQL 2DYPB 3KXFA 4U1KB 4CN6A 4DEPC 3K8KA 1S9YA 4CNIB 3S5LG 2OP4L 1TZHA 1Y18A 2FWOA 3C6LA 4QHLB 3TC9A 1RIVL 3P0VH 3X17A 1YEKH 4EI5C 1MCPH 4XWOD 3M17A 1KEML 3ZDYE 4YGVA 4JHWL 1I7ZB 1U0QA 3WJLC 2BK8A 1QO3B 5ANMA 1KLGB 4HEME 4H0IA 3KPSA 4JFED 2R1XB 5HHME 4TVPE 2WBKA 3DMMB 1K4DA 4EIGB 1CQYA 3HS0A 2X4RA 4OTXL 3UTZA 4Y8DC 2QBWA 1G9EA 3RWEA 1J1OL 2DYPA 4PLJC 4XP1L 5CHNB 2BSED 3L6FB 5EN2A 1FFNB 3NVQA 2XXMB 3GI9H 3LS5L 3BW9A 3P0YL 5MI0B 2BY1A 3JUYA 3OKDB 1ZXQA 3QQ9D 4PBWD 5BS0B 3O6FB 3RDTC 1KLGA 4LCYB 4PJXA 2DDQL 5ESVA 2M26A 2Y1VA 4M00A 2DQGL 1XGUA 3PJSB 3FQWB 3EOTH 4PJGF 4ALAH 1MWAL 4YHKL 2VDRL 4JHZA 2NZ9C 4I9WD 3LZFL 4DN4L 1UWGH 1GCFA 3ARRA 1LQVA 4KY1H 5TH2A 2NPLX 4JKPL 1SJVA 4B5EA 3B9DA 4PJIE 5BV7L 4GS7B 5C8JB 4JFHE 3BD5A 4FFWD 4JDZB 2J8UB 1D6EA 3ZSSA 3FQNB 1AC6A 3BGFB 5FCUH 3VD4A 2MSPA 2DMKA 5HHNB 3MYJA 3O9WB 1HYSC 4BELD 1MRFH 1MF2H 5ISZA 4LCYA 1JUFB 3T09A 2CO7B 3PJSA 3FQWA 4Y1AD 4ZOAA 2DIJA 3U7AA 3O4OC 4WWID 1JRHL 5E6ID 4FQCH 5CJOH 3HI5H 3S34L 3X3GL 4NQTA 1L6ZA 3DROB 1H8OA 2QJDA 3S97C 1DUZB 5FO7A 5C0JA 4JDZA 2J8UA 1I7UB 3CLEL 2WUCH 5HHNA 3IFNL 3PWPA 2Z4QA 4QTIL 1TQCC 1A7PH 3RUGE 2NY5L 1MCNA 1KCRL 2ZUUA 5IB2A 2EECA 2P42B 4GAFB 4NO2A 4KQ3H 1S3KL 4NN7B 3QJFB 4Z95L 5E2VL 1GPOL 3FCTB 1OCWH 1MAJA 5LWYH 2WLYA 2ZUXA 4OCYL 4HZLA 2F58H 1MFBL 3IDGA 3IU3B 3VH8G 5DFWH 2DI8A 3G6AB 4ODUA 4MXVF 1NLBH 3N1FC 3ARUA 1U58A 2YRLA 4WUUE 4K9EL 1MPAL 3EYSH 4DZ8B 4PGDB 3DYMA 4NZTH 5J1SC 2YPKA 4GXVL 4HMCA 1OD9A 1QSZA 4X80L 1MHPL 3LY6A 1R5VA 3DMMD 1CDBA 4YE4L 3TV3H 1N59B 3QEQD 3TVMD 4RISL 4L4JA 1QYGL 2X2YA 1VGEL 3L5XL 4LCWD 3QJFA 3FCTA 2OI9C 1NC4B 3TO4D 4DGIH 2XV6B 1IGTB 1MHCB 4JKWA 5SWSD 3SKUD 3BKYL 3IU3A 1T0PB 3QWOB 1BGXL 4EBQH 5I8EA 1FC1A 1HDMB 1O0VA 2XG5A 3GFUA 2XZCL 4JZJB 3O6FD 4DZ8A 4PGDA 1G7LB 1AR1D 5KSVB 2Z8SA 2B4CL 3VGFA 2IH1B 5KSAB 2VL5A 2F8VA 2HJKA 3MZTA 1CG9B 3DVNB 1N59A 3HUJB 4E5XA 4FQXD 5HGGS 3ULUC 3S37X 3N06B 3VXUA 4ENEC 3D3VB 2FBOJ 3KWWB 4KRMB 2F54E 3WNPA 5GGRB 1MHCA 4WHTB 3QWOA 1P4BH 4LU5L 1B0WA 3JWOL 3QI9C 1TPXB 3RKPA 1EHXA 3O9WD 2PYEA 1E4XH 2DQUL 2WIMA 5C0AB 1WAAF 1CXEA 2GY5A 1EEYB 1G7LA 3MXWL 4HKJB 1CF8L 4R4FL 3DSNA 2CDGA 4Y5YA 5DGRA 1OOAA 3G5ZB 5E2UL 5FYLL 5KSAA 5IW6B 2DQHL 2ICWI 4M5YH 4S1RH 3DVNA 5ADOH 5D7LB 3HAEA 3ZL4L 3BAEH 4HPOH 5FM8A 1GAFH 5C6WH 3RP1A 4G9FE 3ESVF 3KWWA 3QXDB 4JQVA 1OW0A 4RFNB 3DMMC 1CI5A 1OL0A 4WHTA 3U7WL 2WBWB 3HZVA 1UWXH 3ET9F 4XTRC 1J87A 3PWJA 2IFGA 5LQBH 3GUTB 4OZIA 4GRLB 2V2XB 1EEYA 3T2NL 5D5MA 2VXVH 4NM4H 4HKJA 1CWVA 4CMMB 3KPPB 5GGUB 5JOPE 1J1XH 1INEL 3G5ZA 3O2DL 4J3XA 4MAYB 4MX7B 5IW6A 5DJAB 2W0FB 1C1EH 2A9ML 2EYTB 5T1DL 3BRGC 5DMIL 5IB4A 1AD0A 1SJHB 4QRRE 5I17A 5MI0C 5FHAH 5D7LA 3NAAL 3O6FC 1G0DA 2IBGA 1UVQB 3VXSB 3BJ91 3G6JF 3UEZA 4LHJB 1JZ7A 1JV5B 5FO9B 3PWUB 4Z7NF 5DUPL 1Q9KB 3GRWH 3F65A 2E6PA 5KOVC 5C0BE 3DUSB 4GBXB 2DLFH 4HFWB 5JQHC 1HHKA 3MRHB 3GUTA 5JTWA 2V2XA 5F3HA 2GK2A 4CU7A 1PKQE 1R3HB 3RZCA 5FGRA 4GS7C 4CMMA 5GGUA 3GSVA 2C7UB 3VFWB 4MAYA 1JF6A 4MX7A 1C7SA 5DJAA 2W0FA 3BGFC 2EYTA 2X4UB 1CN4A 3O9WC 5JW4Q 4Z77B 5C3TA 3OAZH 1IAIM 3VXSA 4XH2B 1XCQB 2DM3A 1BD2A 1ZHNB 2EDXA 4RX4A 3IKKA 3PWUA 2Z93A 3ZHDA 4PJ5D 2VDNL 1HEZB 3BPOB 4PJFF 4YDVB 3FRUA 3ULVC 4L3AA 4LPTA 2ADJB 3DYPA 4GBXA 3PV7A 4OV5B 3VFUB 3H9SA 3MRHA 2VIRA 1VEMA 3FB5A 1A4KB 1R3HA 1TCRA 4PJ7A 4DUXA 2EKSB 3ARWA 4NP4H 3VFWA 1QHPA 1RFDH 4D9LL 5C1MB 4NN5B 1FE8H 4QCIB 2X4UA 4FTVB 3CH8A 3F7YA 4U33A 3BISA 5J11B 4YDKL 5IROC 5C0AD 4NKOB 4M62L 5T33L 4D0BB 4NN7C 1XCQA 1J5OH 1A21A 3BUYB 1ZHNA 4NIKB 1EZVX 2JJWA 2ESVD 5JMOC 4JFFB 3DO3A 2ADJA 4JKLA 2VXQL 4OV5A 1A6ZB 4HF5H 5FYKL 2CLVB 2IANB 1XF3A 1UH3A 1EEQA 2QR0A 3TBVB 2EKSA 4JAMB 1QBLH 1NMBH 2DQEH 2A6JB 1U3HB 4TSAH 4R0LA 5E99L 4V1DE 5EU6B 2IFFL 4FTVA 4XRCA 5E5MB 5I1KL 1H3XA 4KWUA 3VXMB 4GRLD 1T4KB 2HG5B 4LLWB 5GGVL 1EPFA 4M7LH 4HIEB 4PJ9B 3UJTL 4D0CB 3BUYA 4KTEH 4QXUH 3KXFE 5AZ2H 3GGWB 3FO0L 3O6ML 3B43A 4OCSL 1NGQH 4J3TA 3U36B 1IRAY 4GW1B 4OUUA 2GK0A 2GITB 1G7PB 1ADQH 4JZJC 3ULUE 1D5IH 1OAXH 2CLVA 2FO1A 5ANME 1DVFB 2DIAA 3EDEA 4DVRL 4HIJB 3KPSE 5EB9A 4JAMA 4X7TB 4CU8A 3IJSA 5KSAC 4PY7A 1LO4H 2A6JA 1N64L 3PGCB 4XBPB 3RAJH 5FM4A 4U1SB 2BOCA 1KT2B 5E5MA 4TULH 1F42A 4HBQA 2FJGB 3VXMA 2JJSA 1T4KA 2HG5A 4LLWA 3RKDD 1D3CA 4PJ9A 4HIEA 4KK6D 1JWSB 2V2WA 4JY4B 4JQVC 5D71L 4Q9CA 3RVXC 2NYYD 3O6KL 3X3FL 3C2SA 5FAAA 4HKXB 5C08B 1TPXC 3MRGB 3QCVH 2GITA 3U82B 2GT9A 4F9PC 5A2IH 2HVJB 4Q9BA 1NMAL 4HUXA 3KR3L 4PJXE 4G8FA 4HIJA 4L5FH 2VABA 3C09B 1F02I 1WSST 2VZUA 5AWNH 5IFHL 4X4YB 4XPTH 3I6LE 2R0LL 2OZ4L 2GTZB 3OAUL 4XBPA 1JGEB 2Y36H 4UT6H 5J56B 4U1SA 1KT2A 2OMBA 4DK6A 2FJGA 3FZUC 4L8CB 2DOCA 1J0HA 1T7ZA 5E00B 1KENH 5CKGA 1JWSA 1GGBH 3GJFA 4OLYL 1P53A 4RFNC 4W6WB 3ZYOA 5CBEB 4FHBD 2JF1A 3MLWL 3GNMH 4O2CB 3WHE1 2KQNA 3FFDA 3F7PC 5C08A 1FH5L 3JUZA 3GHBH 4YIQB 4GRLC 1MJ7L 1JYNA 4NNPH 5ISZE 2J88H 3U1SH 3ILQD 5IVZB 4MAYC 2X1OA 4X4YA 3GSNL 3D85B 1CDIA 4PV9B 2CSPA 2GTZA 1T03L 5C0IB 1RZ8B 2VQ1A 2XQYK 5GSVA 1ZWIB 1DE4B 3RI5K 5FOBB 4L8CA 3ZTJG 2R23B 4ZS7H 2IAND 5E00A 5I1JL 4O00A 2HP4A 4UTAH 5CLWA 4O2CA 2YA1A 2J8UE 3D2UB 1U3HD 4WI3A 4GBXC 3SGJA 5EU6D 1DQDH 3PWPE 4PGEA 1MAMH 3MYZA 1EAJA 4UBDC 4YIQA 5KS9B 1MHEB 4PR5A 3BZFB 3H9YA 1XH3B 4C4KO 4L9DA 1HIML 1SMAA 4YXKH 5IVZA 5KVFH 2NYYC 3T8XB 4LARH 4QHNA 3BWAA 4LLDB 4PV9A 4ONGH 4ZFOL 2WWKT 3L3JB 2DMCA 3MCLL 4WEUD 3LMJL 5BOZG 3ULVE 1QHOA 1T2QL 1ZWIA 1DE4A 2R23A 1HHJA 5E8NB 4UV4H 5JHDB 1DVFD 2I25N 1S7UB 1T66C 5IGXH 5I0ZA 4OGYL 3T0DA 4BYHA 1HCVA 1QLFA 5CEZH 1BP3B 2AS5M 1HK6A 3D2UA 3KPOB 1PG7X 3LN4B 5BW7A 3ZE1E 3MRCB 5KS9A 4JFDA 2P43B 1JWMB 2QQNH 4QNPF 3EJJX 4JPWH 3MGTA 1R3IL 3MRMB 3QQ4B 4LFHG 3MTRA 3AVEA 1BOGA 5B4MC 4NN5C 2NY6B 3PHSA 4IM8A 4NDMB 3JSSA 1WWCA 5DVOA 5J11C 1VEOA 4PRHB 4KFZC 1W8NA 1X44A 1IC5H 4HCRL 4UT9L 5E8NA 4CMHB 5JHDA 1LE5A 5GS0C 4MQTB 4Y2DB 1S7UA 4AQOA 5JW4N 4MXQC 4PYHA 1NLDL 1D9KD 1TJGH 3KPOA 1DN0B 1H3UA 3QG7H 3DPBA 2GSGB 2K7PA 3UPRB 1JWMA 3VXUE 1KELH 2OQJA 2R0WH 2IAMB 3MRMA 1MCFA 4BZYA 3NTCL 3UTTA 5I16B 2PXYD 4XC1H 1U3HC 2C9AA 5BRZA 1DFBH 4NDMA 3MUGB 3LKNB 5TPWH 1QSFB 1W2KT 4PRHA 3CVHL 1FYTA 2NY0B 2PYEE 4Z5RA 1A22B 3UJIL 3BDBA 5ID0B 1EIBA 4PJ9C 4Q0XH 3MGOB 4Y2DA 3CZFB 1F8TL 1M1SA 3H6JA 12E8H 2AI0H 2ZJSL 4FNLH 3U46B 3VGGA 1CT8B 1DN0A 3W82A 3QEUB 1KIRB 3HI1B 2YRPA 1L7IH 2GSGA 3UPRA 1DVFC 1CFTB 4G6ML 3D3VE 3RQ3A 3UDWA 4M9OA 3BZ4B 4YBHA 3T3PF 5IB3B 1KJMA 1RPQA 1U2CA 3QNXB 4Q6YA 3HC4L 3MUGA 3LKNA 3G04A 1BQLH 1QSFA 1UEYA 3V95A 4OZIE 5ID0A 3GMMB 4X5XB 5D5ME 4P9HC 2BC4B 2A38A 4R90L 4K7FA 4MNGB 2RJMA 3QPXH 2F53B 1CT8A 1AXSA 1BQUA 2AJXH 5HHOA 5KVDH 3HI1A 5D7LE 1OWWA 3QJHB 5FKAB 1FO0H 1FQ9C 4ZPTB 1ZT4A 1CFTA 1OTTC 2YHGA 5JMRA 1EJOL 3A6CH 1MCOH 4CW1B 3EYQC 3C09C 4UUJB 3BZ4A 5IB3A 4KKCD 2P45B 4YNYA 4OJFL 1U6AL 3AM8A 3OL2A 4X5XA 4UINH 2Q87A 2PYFB 1FG9C 4OF6A 4XVUD 2BC4A 3U79A 3U9UA 1PW3A 3SE3C 4MNGA 1YEHL 4HIIB 2AEPH 2F53A 3SGJC 1ITBB 1MCEA 1QRNA 2E9BA 1FIEA 2LVEA 5FKAA 5H2BA 5DRZB 1JYXA 3T77B 3PABB 4MHHI 3VXSE 3P73B 3RZWA 4CW1A 1BD2E 4UUJA 4P9ML 4ZNCD 1KJ2A 3P0VL 5IJVB 1YEKL 3S37H 1NCAH 1MCPL 2WUBH 5CP7A 3H9SE 3WE6B 4YFDB 4BKLA 5HYEA 1JNNH 4CKVX 4NZRH 3C87A 2IAMD 2XTJB 4PJ7E 5ID1A 2ZZUT 1YN7A 1P6FA 4L8SB 1FNFA 1U8PA 4N9GB 5JPMA 4PUBH 4LP4A 4ZAKD 1XZ0B 4WFFD 5HYSB 5J4MA 5BW7C 4PJIF 5J12B 2IF7A 2NY0D 3PABA 2BVQA 3VGBA 5DEGA 2V2TB 3P73A 1YC7A 5GJSH 1P7QD 2ZG2A 2DLHA 3BQUD 3GK8H 2E5EA 5TE6H 5IJVA 4HKZB 1C5CH 1IEAA 3GI9L 5DHVH 1JE6A 1IEBB 4P5TD 1QLRB 1UH4A 1J0ZA 3H0TA 1VGKB 2VRAA 5HPMA 4L8SA 5CS7A 4N9GA 3ARPA 3OG6B 3GIZH 1ULVA 3EOTL 4ALAL 3FQXB 4X8JA 5HYSA 4YHLH 1U93A 1UWGL 3H3PH 4FTVE 3BP4B 4KY1L 1ORSB 3H8NA 4I3SH 5SV4A 2IMMA 1M7XA 1FVCB 3NCFB 1EBAA 4HMDA 4OBRA 35C8H 2NY6C 2ADGB 3RUGF 3EYUH 4AZ8A 2HVKB 3BGMB 1FAKT 3C5ZA 5JA9A 4HKZA 3FKUS 4LIQE 5FCUL 1IEBA 3TCLB 4CMHC 1QLRA 3OX8B 3F62A 4Y2DC 1MRFL 1MF2L 3CZJA 2DWEA 1NDMB 4U1NB 3IDJA 1CXLA 2APFA 4FQCL 5A2KH 5CJOL 4P23B 3VXME 3HI5L 1FVCA 3UDWC 2IAMC 4JGUA 2AJYH 2ZCLH 2O93L 4PDCE 2IQ9H 1EO8H 2K9UA 3JV6B 3RHWF 5F9JA 3MNWA 1Z3GH 2NY0C 3TJHD 2WUCL 4LLYA 5EU3B 1EJ6A 3DGCR 4OUOA 3OX8A 1A7PL 4KK8C 4NKIH 4GG6B 4MQXD 5CMAB 4IIQB 1YECH 4BFIB 3MRPB 1OCWL 3SJVA 5LWYL 3CCHB 3CUPA 1S7WB 1PQZA 2XKUA 1NDMA 4JFHD 1N7MH 1R3LB 2F58L 4XNYH 4Q7DA 4U1NA 3FRPA 5AYUH 1QA9B 3ALPA 1MH5A 3THMH 5GRUH 5A16B 1NLBL 3FQTB 3RX5A 4A2LA 4KKBD 4L4VB 1QUNA 3EYSL 5LJYH 4L9LA 1JJUA 4NZTL 4UOW1 4GUPB 3VXQB 4LLAA 3RVTC 4OI7A 4G42B 2XZAH 4K23H 5C08E 5BOPA 5HYJB 3K7UA 4GAYB 2LFGA 4FG6C 4MD0A 1EZVY 3AM8C 3TV3L 3U9PH 4ACPA 5EU3A 2AK4A 2N56A 4PJHA 3MA7B 1KPVB 3SDXF 2AQ2A 1LQSR 3LS4H 4K3DH 3EW3B 4GH7B 4BFIA 3GO1H 4P46D 1NCNA 3CCHA 4DGIL 1S7WA 2OL3B 2B0SH 2XWJB 1R3LA 4K7PX 1RURH 3GIVA 3QH3B 4HK0B 4EBQL 5A16A 5TE7H 5J06A 4JGMA 5D72H 4L4VA 4MA8H 3VXQA 5D6DC 2YMXH 3F58H 4XWGL 2VO5A 4G42A 2VLKB 2ED9A 1ACYH 4J1UB 4WGWB 4GAYA 2VITB 5EO1A 1RULH 4RMVA 3NACH 2FRGP 3MRDA 1KPVA 4WI7A 2F9BT 3OAYH 2OTUB 2FX8H 4EJ1C 1FIGH 1P9MA 1NFKA 4NNYB 1P4BL 1E6OH 2W65A 5GRVK 2VDMH 1JL8A 3OPZH 4MQXC 4JM4H 1E4XL 1BAFH 3FB8B 4QOKD 2DKUA 5EDXA 4LKXB 4N1EA 4V3EB 5CWSA 1OHQA 2CLRB 1XGPB 4M5YL 4S1RL 2I5YH 1U8OB 3BD3A 4F2MA 5ADOL 5D1ZB 4CVXA 5KS9E 3TN0A 1QG3A 4JFDE 4KKBC 3BAEL 4HPOL 4AM0B 3KYKH 4OQ1A 4ETQA 1GAFL 2BHUA 2XTJC 5J1AA 4L8SC 5K9QG 3CMOH 1LMKA 3ARGD 3TPKA 1R24B 2ICWJ 4NNYA 4PRID 5J12C 1KLUB 1JIBA 5DSCB 4ISVA 4M4RA 3OTTA 4NSKB 5HDQH 4RCAA 4NCC1 5JHDE 5LQBL 1AGBA 1NGWA 3QUYD 1HSBA 1ZE3C 2VXVL 4NM4L 4LKXA 5E95B 3HAEG 1RV6X 1J1XL 4Z7WA 3KLSA 3RWIB 2CLRA 3UZEA 1C1EL 1DEDA 3MO1B 3PGDB 1BF2A 5FHAL 4F7MB 1J8HD 3NPSB 5E24E 4JFYB 1J0JA 2NY4D 4L1HA 3UTTE 4OV6F 3GRWL 5BRZE 2ORBH 4HS3A 1KLUA 5HYJD 3JTTB 4UU9B 4PRAB 3GBNH 4PRHE 1FYTE 3TFKD 2DLFL 4FFZH 4NSKA 4GKZA 2YPLA 4IOSD 4PS4H 5J8OA 1UXSB 2AJ3A 1SYSB 1TVBA 1C16B 5DK2B 3SE4A 2Q8BH 3AS2A 1CTOA 2UWEF 4MQ7A 4CRPA 1AQDA 1WCBB 3MO1A 3PGDA 4F7MA 4OZFA 4WI6A 2X89A 3JXAA 3ZSTA 5D1QD 4P99A 1M7DB 4C59B 5ACZA 5DJDB 3CDGB 3GI8H 1ND0B 3V0WH 3T1FB 5GGSA 1JP5A 5LCVH 3EOBB 5I8OH 4UU9A 3QISA 1QSFE 4QGYA 1IGJA 4QRRD 4P23C 2CLZB 3KLHC 2AEQH 3ARYA 5GRXG 5F97E 4NP4L 1RFDL 3HZMB 1A4JB 1FE8L 2JE8A 5HHOE 3FT3A 4YUEH 4J3VA 4APQD 4F33B 4MZ2A 5TQ0H 3WS3B 4IIQC 4C56A 2R1YB 1F3JA 1M7DA 2BY0A 3TA3B 1J5OL 2XA8H 5DJDA 3CDGA 3I02B 4U1LA 1ND0A 4WGVB 4K8RD 3ULUF 1PG7H 1N26A 3UCRA 2ZCKH 4GFTB 3NGBB 2MCPH 4CVWA 1T0NB 1DBJH 5F7FA 5D1ZD 3RJDA 4V3DB 3VXTB 1NC2B 2ZUWA 4HF5L 4X6BB 5DZOA 2VC2H 3RGVD 4GXUN 1MFEH 1VACA 4MJIA 1ITCA 3VRLE 4MNGE 1QBLL 2DQFA 2CIIB 4MS8C 1NMBL 2F53E 2DQEL 2H6PB 3FAXA 1A4JA 4URTB 1QRNE 1Z9LA 4TSAL 3LEYH 4HGMA 4NQEB 3WS3A 2R1YA 1E4KA 3TA3A 2COQA 4M7LL 3PIQB 2CRIA 4KTEL 1HH6B 3I02A 2X4SB 4QXUL 5AZ2L 5T3XD 1P9MC 3LB6C 4JM2B 1MWAB 5I75B 4PJXF 1NGQL 1T0NA 3FOLA 3K4AA 4MMXC 3T2OA 3LKOA 4WHCA 3VXTA 4XP5H 1NC2A 1ADQL 4NWTH 3MLZH 1D5IL 1OAXL 3G9AB 4X6BA 4KH2A 5IM7B 1I8IB 5EU4B 4G5ZH 4MB4A 4NUJA 5BV7B 2R39A 3E6FB 1LO4L 3PE9A 2H6PA 2ZUVA 4NPYB 3RAJL 1CXIA 1UA6H 5AUMB 4TULL 1M7IA 2H45A 2ZOLB 3CX2A 5DYOB 1A3LH 3PIQA 2R69H 2ZCHH 4Y4KD 5D2NB 5F7DB 3MACH 4JM2A 1MWAA 3TF7A 5FIEA 4YFLF 1NBZB 3QCVL 2O5ZH 3UPAA 4I0PB 1XGRA 2XTJE 1I8IA 1UC6A 5EU4A 4L5FL 5DURD 1T7WA 3KXFD 1C08A 3MRRB 5AWNL 4N0UB 4YXLH 1HXYA 4WENB 4DW2H 3BJLA 2AW2A 2Y36L 4UT6L 1ES0B 3DTXB 5E1AB 2J8UF 2ZOLA 5DYOA 5C0CB 1KENL 3IAGC 3VFVA 1MJ8H 4X7FC 1GGBL 3KPSD 1MLBA 5F7EH 5F7DA 4X6CA 1SHMA 3GNML 4HIHA 4JY5H 4OM1H 3MOQA 3GHBL 1ZLVH 4I0PA 4MSWB 5L2JB 4U6VH 4HHAB 4NNPL 4DUVA 2J88L 3ULVF 3U1SL 3VMNA 4WTWA 4FQHB 4XVSH 3VFTB 5KN5B 4W68A 1OTUC 3MRRA 4QWWC 1WBYB 2BVEA 4N0UA 4MJ5B 2W0LA 4ZQKB 1K4CB 1ES0A 3NPSC 4CDHA 1KC5H 2OMNA 3DTXA 1BQHB 2E9IA 4ZS7L 5C0CA 4IOFD 4IRSD 1CD0A 3ZE1F 4GW4A 4UTAL 1YPZB 5C07B 2DM2A 1DQDL 1MAML 4M3JA 4MSWA 2JK5B 3BO8B 4NQED 5L2JA 2NNAA 1YNKH 4BFBD 3ARXA 4JJ5A 4O2FB 4M4PA 4FQHA 5SWQA 4GMSH 3SJVE 1W8OA 4YXKL 4WNQA 5KVFL 1WBYA 2PUQT 3BDYH 4K94C 4LARL 5IG7B 3QDMD 2BOBB 4ONGL 4OCNC 4ZQKA 4RGOH 5DEFB 3F7VB 2EE6A 4OD2A 3V5KB 1VPOH 1BQHA 2YRZA 1KB9K 3ROLB 4UV4L 4TTGA 4OD1H 5EA0H 4ONHB 2QHLA 3CH1B 5KTEH 5IGXL 5IESH 2DJSA 1KN4H 5CEZL 3OF6A 1YPZA 3OAYK 5F6HJ 2M1KA 2C3VB 1AP2B 4R4BB 1A7QH 2AK4E 3BO8A 4PJHE 3QUXB 1LGVA 2QQNL 1QSVA 4JPWL 1BJ1H 3E2HB 3BN9C 2WINA 2ARWA 4YGAB 5IG7A 5ICXB 2BOBA 1EUTA 5D2LB 2ZOKB 3S7GA 5DEFA 2P47B 4NQCD 4L4VE 1IC5L 1E4KC 3TA3C 1N6QH 2FJHA 3O81A 3QDHA 4NOFA 4ONHA 3CH1A 3HMXH 1LD9A 3WN5B 5IMMB 3NGBC 5GRVL 1TJGL 4PLKC 1TIUA 4HWBH 3RWDB 2ZNWA 5CILH 4G9DB 4NQXA 4Z7UB 2C3VA 1AP2A 4AIZA 4JKMA 1GGCH 3QUXA 3U6RB 2X7LA 1KELL 1J7VR 2R0WL 3RPKA 3TH2T 5SWZB 1S9KC 5JO5B 1WJ3A 1PYWA 4OZIF 4W6XB 3NCYP 4XC1L 1HXMB 5D5MF 1MCHA 5D2LA 5DUMH 1DFBL 2E7HA 5EFIB 4UILH 1T22B 5TPWL 1FLRH 1IVLA 4J4PD 4I8DA 4RMTA 3B9KB 1B0GB 4Q0XL 3O3DB 3WN5A 4JM2C 5LAXA 2BNRB 4DCQB 5I75C 12E8L 2AI0L 4FNLL 2NMSA 3PQYD 1S7SB 3IXAB 4G9DA 6CGTA 2C3GA 1AHWB 1L7IL 4ODTH 1T1WB 3U6RA 4U31A 5KVGH 5BV7C 1ZLUH 4FXKB 5JO5A 3SE9H 1NCCH 3LEXB 2R29H 3KPNA 3O2DA 1BVZA 1BVLB 1UENA 2WMPA 5C07D 2APXA 5EFIA 1T22A 4YHMH 3GMLB 1BQLL 3EO0A 4XGZB 3VXRB 3ROOB 1B0GA 3TIDB 3VXUD 4PTTB 1F13A 2AXJA 2G5RA 2EYSB 5D2NC 1WCQA 2BNRA 4DCQA 4Z7WE 4D9QE 3G5XB 1S7SA 3QPXL 3IXAA 2AJXL 4V2BA 5KVDL 2YUZA 3CFDA 3MV9A 4I0PC 1T1WA 1FO0L 4RQQA 3OBAA 3A6CL 1MCOL 4YBQC 4FXKA 2IJ0C 4KK9C 4NO5B 3GM0A 1XT5A 2K7QA 1BVLA 4S0SD 2X9XA 4PJ7F 4GRWH 4ORGB 5GRZA 3LKRB 1RUAH 4JO2H 4HH8A 5HI5D 4XGZA 2NY5C 2YD6A 3VXRA 3ROOA 1CU4H 2YPLE 4PREA 2YN5A 1DQLH 3RWCA 3TIDA 4PTTA 1Q0XH 3VFSB 1HWGB 4K7PY 4UINL 2EYSA 1EK3A 2Q76B 4K7PH 4F8QA 5DLMH 2AEPL 5I2IB 4ZTPH 3VWKD 4K9EC 3RWJB 3HG1B 3EO9H 3O6LH 3HR5B 1CXKA 3VA2C 2AJVH 1P4IH 3X11B 4RDQG 2YKLH 4Q9QH 5TDNA 4XCFH 5GQBA 4YO0B 3WFZA 3EYFB 2LTQB 3O8XB 1F2QA 3HRZB 5EC1B 3IT8D 3MSPA 4ORGA 3LKRA 3S37L 2WUBL 5H37H 4F7PB 5KVEH 4NNXB 1JNNL 2AXGB 4JKKA 2JTDA 1FFRA 1UKTA 4MNQB 4NZRL 5SWZD 3VA6A 3MLVH 4DN3H 4KXZH 4PUBL 3MLXH 4KRPB 1U3YA 3QEHB 5I2IA 4XXCA 3PNWB 5E8OB 5F93C 3RWJA 3HG1A 2EDOA 5T1KD 2GJ6B 4C56E 4LSQH 4Z0XB 1CICB 4LPXA 2CUHA 5GJSL 1KTRL 3IB4A 2J4WH 3DGGA 4YPJA 3X11A 3RZCD 2B4CC 1D5ZB 4ODXB 4KJPC 4U7SA 4YO0A 3EYFA 2EC9U 1DZBA 3GK8L 3O8XA 3HRZA 1IKNC 4JB9H 5TE6L 4QRUB 3AU1B 3WYRA 1C5CL 4CJ1A 4S0TD 4F7PA 3UYRH 4OB5H 2JCCB 4MQSB 3MBED 4JFZH 3NABH 4MNQA 1WWWX 4MJIE 4J2XA 1Y6NR 1DBML 3L1OH 3AC0A 3GIZL 8CGTA 4F3FB 4NYLB 1VESA 4YHLL 4QEGA 3JWOC 4UB0H 3B83A 5DTFB 3H3PL 3ALXA 3PNWA 5TDOB 2EZ0D 2K1MA 3QUXC 4I3SL 2J3SA 3H9SD 3HRPA 2GJ6A 4RAUA 2JJVA 1I3RA 1CGVA 1QR4A 1D5ZA 3E2HC 3QHFH 35C8L 4KJWC 2Z31A 3EYUL 3TPUB 1N4XH 3I85A 2YEZA 4G6FB 3WKNA 3S6CA 1X5ZA 3QWRD 4I0KA 3IDUA 5HYSG 5F1IB 2IALA 3WN5C 3LD8B 2X4TB 4X98B 4M1CC 5K9KB 1H3TA 2CPCA 4NYLA 2P5EB 3DURB 5TDOA 5B39B 3Q3GB 3EFFB 2VR5A 4HGWB 3S8WA 3T0VA 4ZODA 1ZLVK 2AJYL 3UX9B 2ZCLL 5TF1H 2IQ9L 4HS8H 1EO8L 4POZC 5SX5H 3RIAF 1JGDB 3PWLA 2OZ4A 4FFYH 1Z3GL 5IHLB 3FL7A 5EZLB 3B9KC 1DBAH 3EHBD 3DV6A 25C8H 1DTUA 4NKIL 5F1IA 5ITFA 3VG0H 3C60D 3BHBA 1YECL 5JW4M 5FM5M 1MVUB 5K9KA 2X4OA 1N7ML 4XNYL 2P5EA 3H9HB 1AHWC 5AYUL 4ZDHA 3Q3GA 3V6OC 3THML 5GRUL 4XCNA 4C83A 1CGSH 4TUKH 2J1KA 1FL6B 1FZKB 5F9WB 1GGYA 3UTOA 4NC0B 5E9DA 1K9TA 5I18H 4HJGB 1AD9B 2XZAL 3BKCH 3GSNA 4X6CE 5DA0B 1JGDA 4ZFOB 4K23L 2I24N 5M7QA 4AIOA 2J8HA 3U9PL 3NCJH 2ZP0T 4P2RB 5L2KB 1AI1H 1CICD 3FRPG 1ZHKB 1KXVC 4K3DL 3LS4L 5IV2A 3C5SB 2NXZB 4N0UE 2B0SL 4GO6B 1ETZB 1RURL 5F7LB 2B7DT 1S5IH 2R4SH 2ICWB 3OZ9H 5TE4H 5TE7L 5D72L 5C0CE 4MA8L 2KUTA 5CJBA 1BZ9B 2YR3A 5KS9F 2YMXL 3BIAX 3F58L 1X9QA 2Y4SA 3VXPA 3ARBD 4HJGA 1AD9A 3D5OF 1NJ9A 3RX8A 1ACYL 4Q2ZB 2EO9A 3KNBB 5HDBE 4WI2A 3CD4A 1RULL 2MQCA 5LGKA 3NACL 3V4PH 1CE6A 3R4DA 4ZMAT 1EAPB 3EDKA 3L5WA 3C5SA 2FX8L 1FIGL 4LAJH 1E6OL 4FMKA 3EHBC 3PWNA 2VDML 4XNQB 2ICWA 3V6FB 4MDJB 3OPZL 4POYA 4JM4L 43C9A 1BAFL 3IKCB 1BZ9A 4HWUA 2Q6WB 2LTQC 3O8XC 2VZTA 1YPZE 3EJYD 4Q2ZA 1A6AA 4NBZB 3KNBA 1OF2A 2I5YL 1G6RH 3CVHB 3T4YB 1NQBA 3LQMA 3KYKL 4G80B 3D1MC 2AJZB 1NBVH 5F1SA 2XRAH 3CMOL 3ARED 2BVPB 4KRPC 2NY3D 1JHLH 4WTXA 5C09B 2QQLH 2D0HA 5ALBH 3RY4A 2V5SA 4HMEA 3V6FA 4MDJA 4WUKH 1CICC 5HDQL 3MRIA 4X4ZA 3IKCA 4H20H 4QXTB 1QQDB 4D8PA 2Q6WA 1HQ4B 2ZUYA 1ZLUK 3RTQB 3QSKB 4WO4B 3R0MA 5MENA 1LO0H 3QUMA 3CVHA 5F9AC 4G80A 3HI6H 5GZND 1HHGA 2BVPA 4WW2B 5DGQA 5C09A 2X9WA 1LEKB 5D2LE 2ORBL 4E42B 1QR1B 3GBNL 3A6BH 1I8LA 3VJ6A 4FFZL 5L2KD 3RPIB 3ZLQC 4ELKB 4PS4L 2EDEA 4QXTA 4PRPB 1QQDA 3PHQA 1TTGA 3GSWB 2Q8BL 4WO4A 2YC1B 4X7CC 1VADB 2C1PB 2A6IB 4NO3B 2JB5H 2I26N 3MJGX 3LD8C 1BIIB 2CIKB 2IC2A 4RDQF 1BOYA 5CSBA 3RNKB 2GQHA 3GI8L 2H2PC 3V0WL 4MWFA 1LEKA 4B0MM 3RL1A 1NUNB 1FL3B 3MJ7A 1T21B 5LCVL 4E42A 5I8OL 1IM9A 1QR1A 3VRLF 4OFPA 3CFBB 5IFJB 2ITDB 1BREA 4P49A 2VKXA 4PRPA 2AEQL 1G0XA 2BNRE 4ONOA 4M7KH 4OZFG 3UTTD 1F4HA 4YPGA 4NJAH 1I9EA 1T6VN 3GSWA 2YA0A 3QFDB 4BZ2H 3BH8B 4NKMB 3OB8A 1VADA 3MV9E 4NO3A 4PV8B 4YUEL 2L7UA 1J86A 1FYTD 3BVNB 1R3KB 1MCIA 5TQ0L 4BK4A 5EO0A 4JRYD 2CIKA 4L4TB 2XA8L 3VMPA 5JPNB 5KG9B 2MOVA 4LRNH 4HUVA 3REVB 2KQMA 3QDJD 2EEBA 2ZCKL 2MCPL 3MLUH 5HGBA 1T21A 2N4IA 2OJZH 1HCFX 1DBJL 1MRCH 5DQJA 1TVHB 3VXRE 2ITDA 3D9AH 2VC2L 2C4FT 5F9WC 1MFEL 2EDQA 2X05A 2XXCB 3S3SA 1BVKA 4U1MA 4R2GB 5D7IB 1NMCB 2C26A 4PJAA 4YHPB 3QFDA 3HE6B 3MRQB 3QNYA 1KTKE 4NKMA 4EQ2A 2R15A 4Y4FB 3LEYL 3QRGH 2XIDA 3TBSB 1LDPH 3SKOB 3WFBH 1R3KA 1QBMH 2MNUA 3EKCA 1L8JA 2DQIH 3FFCA 5JPNA 2NXZC 5KG9A 5DD0H 3RTQD 4U1IB 4UAOB 4ZUTA 4GJTB 5HHOD 3QA3A 5AD0A 2BX5A 3MXVH 2BVOB 5EBLB 4P2OB 5EU5B 3ZKMC 5I76B 4XP5L 2WP3T 4BFEA 4GG8A 2D4FA 4IJ3B 4NWTL 3MLZL 1ZT1B 1YDPB 3TBYB 4KXZI 1CVRA 2OL3H 4G5ZL 5D7IA 5C2UB 4PRNB 4YHPA 3HE6A 3MRQA 3QQ3B 4GKNA 1WISA 3GMQB 1WFTA 3OR6A 3DX8B 3TBSA 3HG1E 1UA6L 2PCPB 5JW5B 5DZNA 3QIUA 3DX9B 4JE4B 1L6XA 2ATPB 3RVVC 1A3LL 4KDTA 3U4EA 2R69L 1H3GA 2ZCHL 1NUDA 4KRNA 2LQRA 3LPFA 5KZCB 1KCKA 3MACL 4U1IA 1RUMH 1QRND 1R0AH 5EBLA 2BVOA 2NY1D 3VRJB 3SO5A 2O5ZL 4XNZB 1DLHB 1CD1B 1FJ1A 4LVNB 4EI6B 1YDPA 2QSVA 4MNQE 2H9GA 5MERB 4ZPVB 3RWHB 3PDGA 1EHNA 3KGRA 4PRNA 3QWQB 1ZEAH 2B1AL 5I0DA 1IMHC 4DGYH 3QQ3A 1RD6A 4DW2L 3GMQA 3HPLB 5SX5K 5IHBA 5LVEA 2GJ6E 3DX9A 3KLAA 3DX6A 4NKDA 4K8RH 2FDBP 3ARFB 1MJ8L 3CFKB 3LN5A 4MVBA 5F7EL 3S9DB 4NRYB 2V17H 1AIFB 3ARSA 1E27B 4RSVA 5AYQA