3KYXA

Joint xray/neutron crystal structure determination of fully perdeuterated rubredoxin at 295k
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3kyxA00
1CAAA 1RDVA 1IU6A 1C09A 1YV1A 8RXNA 1SMMA 2PYAA 3RZ6A 3KYWA 2QL0A 1SMWA 2MS3A 5IY0A 4POGA 1SMUA 1YUZA 2DSXA 6RXNA 1FHHA 1S24A 1BE7A 4K9FA 2RDVA 5AI2A 1RYTA 4YWLA 2K2DA 1LKOA 2KN9A 1BFYA 1E8JA 4AR4A 1LTLA 1RDGA 3KYUA 4POFA 1B71A 1R0JA 4ME3A 1IROA 1NNQA 2PVXA 4AR5A 1IRNA 1FHMA 4AR3A 4YWMA 5RXNA 1VCXA 1DX8A 1H7VA 2KKDA 1RB9A 4RXNA 2GMGA 1IU5A 1S2ZA 3MPSA 3KYXA 1CADA 2V3BB 1T9OA 1YUXA 4AR6A 3KYYA 1BRFA 1BQ8A 4TPUA 1R0GA 1LKMA 1QCVA 1R0IA 5AI3A 1S30A 1LKPA 3A44A 2HR5A 2M4YA 2LCQA 1JYBA 1BQ9A 2VL6A 1QYBA 1R0HA 1RWDA 1R0FA 1B2JA 3PZAA 3KYVA 3PWFA 1DVBA 2PVEA 3SS2A 1YK5A 1T9PA 1B2OA 3RYGA 1ZRPA 7RXNA 1B13A 1T9QA 1YK4A 3QVDA 3RZTA
chains in the Genus database with same CATH superfamily
1RDVA 1IU6A 3J7Y1 1YV1A 8RXNA 2PMZP 2PYAA 3RZ6A 5IYBL 2JA5L 4A3IL 3GTGL 3H0GL 3PKIA 1I3QL 5DM61 1YUZA 5MFZA 2H12A 2L0ZA 5DM71 4K9FA 3P2AA 1PFYA 1I50L 5M5XL 2HVYC 2C6BA 1LKOA 2A6HD 5GADc 2A69D 1PFVA 3MSUA 3KYUA 2E2JL 4POFA 1NNQA 4AYBP 2AQCA 3PO3L 4C3JL 5RXNA 1VCXA 4C2M1 1DX8A 1H7VA 2ZIXA 1S2ZA 3JR7A 4XGHA 2CR8A 3MPSA 4G6BA 3GTQL 3H9BA 4Y52L 2E2HL 1TWGL 1T9OA 1YUXA 3M4OL 3S15L 3I4ML 4TPUA 1R0GA 5K2ME 3H3VM 1QCVA 4AHYA 5MF6A 3HJYB 5GAGc 3HOWL 4AI3A 3PO2L 5MFPA 1LKPA 2A6ED 2HR5A 2M4YA 1JYBA 3S2HL 2VL6A 2JI2A 4UY81 2M6OA 2XJSA 1TWCL 1IW7D 5AN9H 3WWNB 1PFUA 3HOZL 1DVBA 2NVYL 5C4JL 1T9PA 2PPTA 1B2OA 5FJ8L 1ZRPA 1B13A 1T9QA 3RZOL 4ZN3B 1NXEA 3GTLL 4AHXA 1PFWA 2M4VA 3S16L 4LHLA 4JAFA 2MS3A 5MLC3 1SMUA 2DSXA 6RXNA 1BE7A 5JVG1 3B08B 3GTPL 2J9UB 4Y7NL 3LWOB 2RDVA 3S1QL 1RYTA 4YWLA 3PKJA 2KN9A 3HOXL 4AR4A 3HKZP 4A3JL 1TWHL 1RDGA 3S17L 5JVH1 4QIWP 2PSMC 5IYCL 4ME3A 3GTML 4A3GL 1I6HL 3FKIL 2PVXA 5C4XL 5M3ML 4A3KL 1FHMA 4TVMA 1TWFL 1RB9A 3LPEB 4RXNA 4A3FL 5GAEc 1CADA 4ZN1B 2V0EA 3S2DL 3PIO1 3VPBE 3HOYL 4AR6A 3KYYA 1BQ8A 2B63L 1K83L 2O5JD 2VUML 3A44A 1BQ9A 2AUSB 1Y1VL 2B5ID 1B2JA 5C44L 3SS2A 4JAEA 2JI1A 5FLML 1C09A 1SMMA 3KYWA 3FDJA 1Y1WL 3I4NL 2QL0A 1SMWA 4POGA 3GTOL 3MQKB 3S14L 5GAHc 3M3YL 3LWQB 2R92L 2YU9L 4AHZA 2XJQA 4JAGA 3J7Z1 3B0AB 1OWBA 2XJRA 5EINC 1E8JA 4BY1L 3RZDL 5IYDL 2JI3A 2NVQL 1B71A 3LWRB 4E6YA 3H9CA 4AR5A 1IRNA 3HJWB 2APOB 4XXBB 4YWMA 4V196 2KKDA 2M6PA 2GMGA 2WAQP 1IU5A 4X6AL 4AI2A 3KYXA 2V0FA 4BBSL 3LWPB 1BRFA 2Z3RB 2JA7L 1LKMA 3K7AL 4A93L 4LHNA 5IP7L 2E2IL 4C3HL 3QQCE 2BE5D 1NXGA 1VZHA 1R9TL 3LWVB 2NVXL 1PZXA 4A3ML 5C3EL 1RWDA 3PZAA 2EY4E 3KYVA 5M5YL 2PVEA 5EIOC 2AYJA 1YK5A 3RYGA 3HOUL 2NVTL 4C3IL 2NYDA 2ERJA 1YK4A 1CAAA 4A3BL 1WCML 3HOVL 2C6AA 4B8CD 5IY0A 4AHWA 4A3DL 3LNLA 2JA8L 1FHHA 1S24A 4U671 3IU3I 4WFN1 1SFOL 2XJPA 3H99A 3GTKL 4BXXL 4BY7L 5AI2A 2CKAA 3CQZL 2K2DA 2A68D 3S1RL 1BFYA 5H1Sc 3S1ML 5MGNA 1LTLA 4AI1A 5IP9L 3K35A 1R0JA 1IROA 5M5WL 2ERSA 3H97A 4AR3A 4JADA 2Z3QB 3PL5A 1VZGA 3S1NL 1RYQA 3NFPI 2Y0SP 1Z92B 2V3BB 5M3FL 1QQTA 3HAXC 1WJVA 4AI0A 1VZIA 3ZG6A 2JA6L 1P7PA 2R93L 1R0IA 2XJVA 4A3LL 5AI3A 1S30A 4A3EL 2LCQA 1TWAL 2CKCA 4BBRL 1QYBA 2XJTA 1R0HA 1OWCA 3GTJL 2WB1P 1R0FA 3PIP1 3PWFA 2RFKB 3WWLA 2XJUA 1F4LA 2R7ZL 7RXNA 4A3CL 1ODHA 4GS7D 3P8BA 3QVDA 3RZTA
chains in the Genus database with same CATH topology
1CAAA 1RDVA 1IU6A 1C09A 1YV1A 4AHXA 8RXNA 3J7Y1 1SMMA 2M4VA 2PYAA 3RZ6A 3KYWA 4LHLA 4JAFA 2QL0A 1SMWA 2C6AA 2MS3A 3PKIA 4B8CD 5IY0A 5MLC3 4AHWA 5DM61 4POGA 4ZN3B 1SMUA 1YUZA 2DSXA 6RXNA 3LNLA 1FHHA 5MFZA 1S24A 4U671 1BE7A 3IU3I 4WFN1 5JVG1 3B08B 2H12A 2XJPA 2J9UB 2L0ZA 5GAHc 5DM71 4K9FA 3P2AA 2RDVA 5AI2A 4AHZA 1RYTA 2CKAA 4YWLA 2K2DA 2C6BA 3PKJA 1LKOA 2A68D 2A6HD 2XJQA 3B0AB 4JAGA 1OWBA 2XJRA 5GADc 3J7Z1 2KN9A 5EINC 1BFYA 5H1Sc 1E8JA 5MGNA 2A69D 4AR4A 1LTLA 1RDGA 4AI1A 2JI3A 3MSUA 3KYUA 5JVH1 3K35A 4POFA 2PSMC 1B71A 1R0JA 4ME3A 4E6YA 1IROA 1NNQA 2PVXA 2ERSA 4AR5A 1IRNA 1FHMA 4AR3A 4JADA 2Z3QB 4XXBB 4YWMA 4TVMA 1VCXA 5RXNA 4V196 1DX8A 1H7VA 2KKDA 2M6PA 2ZIXA 1RB9A 3LPEB 4RXNA 1VZGA 2GMGA 1RYQA 1IU5A 5GAEc 1S2ZA 4XGHA 2CR8A 3MPSA 3NFPI 4G6BA 3KYXA 1Z92B 4AI2A 1CADA 4ZN1B 2V0FA 2V3BB 2V0EA 1T9OA 3PIO1 1YUXA 3VPBE 1WJVA 4AR6A 3KYYA 1BRFA 1BQ8A 2Z3RB 1VZIA 4TPUA 1R0GA 4AI0A 1LKMA 3ZG6A 5K2ME 1QCVA 1R0IA 4AHYA 2O5JD 2XJVA 4LHNA 5MF6A 5GAGc 5AI3A 4AI3A 1S30A 5MFPA 1LKPA 2A6ED 3A44A 2HR5A 2M4YA 3QQCE 2LCQA 1JYBA 2BE5D 1BQ9A 1NXGA 1VZHA 2CKCA 2VL6A 1QYBA 2JI2A 2XJTA 1OWCA 1R0HA 4UY81 2M6OA 2XJSA 1RWDA 1R0FA 1IW7D 3PIP1 5AN9H 3WWNB 2B5ID 1B2JA 3PZAA 3KYVA 3PWFA 3WWLA 1DVBA 2PVEA 2XJUA 3SS2A 2AYJA 5EIOC 1YK5A 1T9PA 2PPTA 1B2OA 3RYGA 1ZRPA 4JAEA 7RXNA 1B13A 1T9QA 2JI1A 2NYDA 2ERJA 4GS7D 1ODHA 1YK4A 3P8BA 3QVDA 1NXEA 3RZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CAA A;  1RDV A;  1IU6 A;  1C09 A;  1YV1 A;  8RXN A;  1SMM A;  2PYA A;  3RZ6 A;  3KYW A;  2QL0 A;  1SMW A;  2MS3 A;  5IY0 A;  4POG A;  1SMU A;  1YUZ A;  2DSX A;  6RXN A;  1FHH A;  1S24 A;  1BE7 A;  4K9F A;  2RDV A;  5AI2 A;  1RYT A;  4YWL A;  2K2D A;  1LKO A;  2KN9 A;  1BFY A;  1E8J A;  4AR4 A;  1LTL A;  1RDG A;  3KYU A;  4POF A;  1B71 A;  1R0J A;  4ME3 A;  1IRO A;  1NNQ A;  2PVX A;  4AR5 A;  1IRN A;  1FHM A;  4AR3 A;  4YWM A;  5RXN A;  1VCX A;  1DX8 A;  1H7V A;  2KKD A;  1RB9 A;  4RXN A;  2GMG A;  1IU5 A;  1S2Z A;  3MPS A;  3KYX A;  1CAD A;  2V3B B;  1T9O A;  1YUX A;  4AR6 A;  3KYY A;  1BRF A;  1BQ8 A;  4TPU A;  1R0G A;  1LKM A;  1QCV A;  1R0I A;  5AI3 A;  1S30 A;  1LKP A;  3A44 A;  2HR5 A;  2M4Y A;  2LCQ A;  1JYB A;  1BQ9 A;  2VL6 A;  1QYB A;  1R0H A;  1RWD A;  1R0F A;  1B2J A;  3PZA A;  3KYV A;  3PWF A;  1DVB A;  2PVE A;  3SS2 A;  1YK5 A;  1T9P A;  1B2O A;  3RYG A;  1ZRP A;  7RXN A;  1B13 A;  1T9Q A;  1YK4 A;  3QVD A;  3RZT A; 
#chains in the Genus database with same CATH topology
 1RDV A;  1IU6 A;  3J7Y 1;  1YV1 A;  8RXN A;  2PMZ P;  2PYA A;  3RZ6 A;  5IYB L;  2JA5 L;  4A3I L;  3GTG L;  3H0G L;  3PKI A;  1I3Q L;  5DM6 1;  1YUZ A;  5MFZ A;  2H12 A;  2L0Z A;  5DM7 1;  4K9F A;  3P2A A;  1PFY A;  1I50 L;  5M5X L;  2HVY C;  2C6B A;  1LKO A;  2A6H D;  5GAD c;  2A69 D;  1PFV A;  3MSU A;  3KYU A;  2E2J L;  4POF A;  1NNQ A;  4AYB P;  2AQC A;  3PO3 L;  4C3J L;  5RXN A;  1VCX A;  4C2M 1;  1DX8 A;  1H7V A;  2ZIX A;  1S2Z A;  3JR7 A;  4XGH A;  2CR8 A;  3MPS A;  4G6B A;  3GTQ L;  3H9B A;  4Y52 L;  2E2H L;  1TWG L;  1T9O A;  1YUX A;  3M4O L;  3S15 L;  3I4M L;  4TPU A;  1R0G A;  5K2M E;  3H3V M;  1QCV A;  4AHY A;  5MF6 A;  3HJY B;  5GAG c;  3HOW L;  4AI3 A;  3PO2 L;  5MFP A;  1LKP A;  2A6E D;  2HR5 A;  2M4Y A;  1JYB A;  3S2H L;  2VL6 A;  2JI2 A;  4UY8 1;  2M6O A;  2XJS A;  1TWC L;  1IW7 D;  5AN9 H;  3WWN B;  1PFU A;  3HOZ L;  1DVB A;  2NVY L;  5C4J L;  1T9P A;  2PPT A;  1B2O A;  5FJ8 L;  1ZRP A;  1B13 A;  1T9Q A;  3RZO L;  4ZN3 B;  1NXE A;  3GTL L;  4AHX A;  1PFW A;  2M4V A;  3S16 L;  4LHL A;  4JAF A;  2MS3 A;  5MLC 3;  1SMU A;  2DSX A;  6RXN A;  1BE7 A;  5JVG 1;  3B08 B;  3GTP L;  2J9U B;  4Y7N L;  3LWO B;  2RDV A;  3S1Q L;  1RYT A;  4YWL A;  3PKJ A;  2KN9 A;  3HOX L;  4AR4 A;  3HKZ P;  4A3J L;  1TWH L;  1RDG A;  3S17 L;  5JVH 1;  4QIW P;  2PSM C;  5IYC L;  4ME3 A;  3GTM L;  4A3G L;  1I6H L;  3FKI L;  2PVX A;  5C4X L;  5M3M L;  4A3K L;  1FHM A;  4TVM A;  1TWF L;  1RB9 A;  3LPE B;  4RXN A;  4A3F L;  5GAE c;  1CAD A;  4ZN1 B;  2V0E A;  3S2D L;  3PIO 1;  3VPB E;  3HOY L;  4AR6 A;  3KYY A;  1BQ8 A;  2B63 L;  1K83 L;  2O5J D;  2VUM L;  3A44 A;  1BQ9 A;  2AUS B;  1Y1V L;  2B5I D;  1B2J A;  5C44 L;  3SS2 A;  4JAE A;  2JI1 A;  5FLM L;  1C09 A;  1SMM A;  3KYW A;  3FDJ A;  1Y1W L;  3I4N L;  2QL0 A;  1SMW A;  4POG A;  3GTO L;  3MQK B;  3S14 L;  5GAH c;  3M3Y L;  3LWQ B;  2R92 L;  2YU9 L;  4AHZ A;  2XJQ A;  4JAG A;  3J7Z 1;  3B0A B;  1OWB A;  2XJR A;  5EIN C;  1E8J A;  4BY1 L;  3RZD L;  5IYD L;  2JI3 A;  2NVQ L;  1B71 A;  3LWR B;  4E6Y A;  3H9C A;  4AR5 A;  1IRN A;  3HJW B;  2APO B;  4XXB B;  4YWM A;  4V19 6;  2KKD A;  2M6P A;  2GMG A;  2WAQ P;  1IU5 A;  4X6A L;  4AI2 A;  3KYX A;  2V0F A;  4BBS L;  3LWP B;  1BRF A;  2Z3R B;  2JA7 L;  1LKM A;  3K7A L;  4A93 L;  4LHN A;  5IP7 L;  2E2I L;  4C3H L;  3QQC E;  2BE5 D;  1NXG A;  1VZH A;  1R9T L;  3LWV B;  2NVX L;  1PZX A;  4A3M L;  5C3E L;  1RWD A;  3PZA A;  2EY4 E;  3KYV A;  5M5Y L;  2PVE A;  5EIO C;  2AYJ A;  1YK5 A;  3RYG A;  3HOU L;  2NVT L;  4C3I L;  2NYD A;  2ERJ A;  1YK4 A;  1CAA A;  4A3B L;  1WCM L;  3HOV L;  2C6A A;  4B8C D;  5IY0 A;  4AHW A;  4A3D L;  3LNL A;  2JA8 L;  1FHH A;  1S24 A;  4U67 1;  3IU3 I;  4WFN 1;  1SFO L;  2XJP A;  3H99 A;  3GTK L;  4BXX L;  4BY7 L;  5AI2 A;  2CKA A;  3CQZ L;  2K2D A;  2A68 D;  3S1R L;  1BFY A;  5H1S c;  3S1M L;  5MGN A;  1LTL A;  4AI1 A;  5IP9 L;  3K35 A;  1R0J A;  1IRO A;  5M5W L;  2ERS A;  3H97 A;  4AR3 A;  4JAD A;  2Z3Q B;  3PL5 A;  1VZG A;  3S1N L;  1RYQ A;  3NFP I;  2Y0S P;  1Z92 B;  2V3B B;  5M3F L;  1QQT A;  3HAX C;  1WJV A;  4AI0 A;  1VZI A;  3ZG6 A;  2JA6 L;  1P7P A;  2R93 L;  1R0I A;  2XJV A;  4A3L L;  5AI3 A;  1S30 A;  4A3E L;  2LCQ A;  1TWA L;  2CKC A;  4BBR L;  1QYB A;  2XJT A;  1R0H A;  1OWC A;  3GTJ L;  2WB1 P;  1R0F A;  3PIP 1;  3PWF A;  2RFK B;  3WWL A;  2XJU A;  1F4L A;  2R7Z L;  7RXN A;  4A3C L;  1ODH A;  4GS7 D;  3P8B A;  3QVD A;  3RZT A; 
#chains in the Genus database with same CATH homology
 1CAA A;  1RDV A;  1IU6 A;  1C09 A;  1YV1 A;  4AHX A;  8RXN A;  3J7Y 1;  1SMM A;  2M4V A;  2PYA A;  3RZ6 A;  3KYW A;  4LHL A;  4JAF A;  2QL0 A;  1SMW A;  2C6A A;  2MS3 A;  3PKI A;  4B8C D;  5IY0 A;  5MLC 3;  4AHW A;  5DM6 1;  4POG A;  4ZN3 B;  1SMU A;  1YUZ A;  2DSX A;  6RXN A;  3LNL A;  1FHH A;  5MFZ A;  1S24 A;  4U67 1;  1BE7 A;  3IU3 I;  4WFN 1;  5JVG 1;  3B08 B;  2H12 A;  2XJP A;  2J9U B;  2L0Z A;  5GAH c;  5DM7 1;  4K9F A;  3P2A A;  2RDV A;  5AI2 A;  4AHZ A;  1RYT A;  2CKA A;  4YWL A;  2K2D A;  2C6B A;  3PKJ A;  1LKO A;  2A68 D;  2A6H D;  2XJQ A;  3B0A B;  4JAG A;  1OWB A;  2XJR A;  5GAD c;  3J7Z 1;  2KN9 A;  5EIN C;  1BFY A;  5H1S c;  1E8J A;  5MGN A;  2A69 D;  4AR4 A;  1LTL A;  1RDG A;  4AI1 A;  2JI3 A;  3MSU A;  3KYU A;  5JVH 1;  3K35 A;  4POF A;  2PSM C;  1B71 A;  1R0J A;  4ME3 A;  4E6Y A;  1IRO A;  1NNQ A;  2PVX A;  2ERS A;  4AR5 A;  1IRN A;  1FHM A;  4AR3 A;  4JAD A;  2Z3Q B;  4XXB B;  4YWM A;  4TVM A;  1VCX A;  5RXN A;  4V19 6;  1DX8 A;  1H7V A;  2KKD A;  2M6P A;  2ZIX A;  1RB9 A;  3LPE B;  4RXN A;  1VZG A;  2GMG A;  1RYQ A;  1IU5 A;  5GAE c;  1S2Z A;  4XGH A;  2CR8 A;  3MPS A;  3NFP I;  4G6B A;  3KYX A;  1Z92 B;  4AI2 A;  1CAD A;  4ZN1 B;  2V0F A;  2V3B B;  2V0E A;  1T9O A;  3PIO 1;  1YUX A;  3VPB E;  1WJV A;  4AR6 A;  3KYY A;  1BRF A;  1BQ8 A;  2Z3R B;  1VZI A;  4TPU A;  1R0G A;  4AI0 A;  1LKM A;  3ZG6 A;  5K2M E;  1QCV A;  1R0I A;  4AHY A;  2O5J D;  2XJV A;  4LHN A;  5MF6 A;  5GAG c;  5AI3 A;  4AI3 A;  1S30 A;  5MFP A;  1LKP A;  2A6E D;  3A44 A;  2HR5 A;  2M4Y A;  3QQC E;  2LCQ A;  1JYB A;  2BE5 D;  1BQ9 A;  1NXG A;  1VZH A;  2CKC A;  2VL6 A;  1QYB A;  2JI2 A;  2XJT A;  1OWC A;  1R0H A;  4UY8 1;  2M6O A;  2XJS A;  1RWD A;  1R0F A;  1IW7 D;  3PIP 1;  5AN9 H;  3WWN B;  2B5I D;  1B2J A;  3PZA A;  3KYV A;  3PWF A;  3WWL A;  1DVB A;  2PVE A;  2XJU A;  3SS2 A;  2AYJ A;  5EIO C;  1YK5 A;  1T9P A;  2PPT A;  1B2O A;  3RYG A;  1ZRP A;  4JAE A;  7RXN A;  1B13 A;  1T9Q A;  2JI1 A;  2NYD A;  2ERJ A;  4GS7 D;  1ODH A;  1YK4 A;  3P8B A;  3QVD A;  1NXE A;  3RZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...