3KYXA

Joint xray/neutron crystal structure determination of fully perdeuterated rubredoxin at 295k
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
52
structure length
52
Chain Sequence
b'MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 10
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3kyxA00
1FHHA 1R0IA 1B2OA 2DSXA 3PWFA 4RXNA 1H7VA 1S30A 4YWMA 3QVDA 1DX8A 1QCVA 2K2DA 2LCQA 1QYBA 1S2ZA 3MPSA 1T9OA 1YK4A 1B71A 1LKPA 3A44A 1SMWA 1RDVA 1R0JA 1B13A 1BQ9A 4AR4A 3SS2A 2RDVA 1R0HA 2KKDA 7RXNA 1LKMA 1CAAA 1CADA 5AI2A 2VL6A 1C09A 4AR5A 2GMGA 1YUZA 5RXNA 3KYXA 1R0GA 4POGA 1RB9A 1E8JA 3RYGA 1BE7A 1NNQA 1IRNA 2HR5A 3RZ6A 1LKOA 1DVBA 1T9PA 1R0FA 1JYBA 1B2JA 1VCXA 3KYYA 6RXNA 2PYAA 2KN9A 1YUXA 2PVXA 5IY0A 1LTLA 4TPUA 3KYVA 4ME3A 5AI3A 4POFA 1IU6A 1SMMA 1ZRPA 1YK5A 4AR6A 2V3BB 8RXNA 3RZTA 4K9FA 4AR3A 2M4YA 3KYUA 3KYWA 1IROA 2PVEA 1YV1A 1BFYA 1S24A 1RDGA 1T9QA 1BRFA 1IU5A 1FHMA 3PZAA 1RWDA 1SMUA 1BQ8A 4YWLA 2MS3A 1RYTA 2QL0A
chains in the Genus database with same CATH superfamily
4TVMA 5MGNA 5EIOC 1R0IA 2E2HL 4LHLA 2APOB 3PIO1 5M5XL 1OWBA 2J9UB 2XJSA 3J7Z1 4GS7D 4ZN3B 5GAEc 5C3EL 2ERJA 2A69D 3LPEB 3PO3L 5DM61 5JVH1 2PMZP 1I6HL 2EY4E 3H3VM 7RXNA 2VL6A 4C3HL 1C09A 1WJVA 4AR5A 4A3CL 2VUML 1E8JA 1R0GA 1TWGL 2NVXL 1VZGA 2V0FA 1DVBA 3S2HL 1NXEA 3WWLA 1B2JA 3GTKL 2E2IL 4BY1L 1P7PA 3JR7A 2KN9A 1F4LA 1R9TL 3HOWL 1LTLA 2HVYC 4V196 2NVQL 2XJTA 3PIP1 2C6BA 2A68D 3LWRB 1IROA 2PVEA 1BFYA 5GADc 1S24A 2A6ED 3S15L 3LWVB 3PZAA 3LWPB 3LNLA 5K2ME 1WCML 2JI2A 1RYTA 2QL0A 2V0EA 1H7VA 1S30A 4YWMA 3H97A 3S14L 1DX8A 3HOVL 2K2DA 3NFPI 2O5JD 5MLC3 2Z3QB 1T9OA 4Y52L 2JA5L 1QQTA 3S1QL 3A44A 5MF6A 1SMWA 4X6AL 1RDVA 3M4OL 5GAGc 3FDJA 5EINC 2M6OA 4Y7NL 3B0AB 5M5WL 2AYJA 4C2M1 3PL5A 2XJVA 2R93L 2JA8L 5RXNA 3VPBE 3ZG6A 4A3IL 2JI3A 2HR5A 3RZ6A 1LKOA 2JI1A 2CKCA 3WWNB 1OWCA 1JYBA 3FKIL 4A93L 3PKIA 5MFZA 3HOUL 3S1ML 1TWAL 1VCXA 2JA7L 2YU9L 2PYAA 2CR8A 1YUXA 5IY0A 4ME3A 3S16L 3PKJA 1IU6A 1SMMA 3I4ML 1TWHL 1YK5A 4AI0A 4AR6A 1RYQA 4K9FA 4AR3A 4BXXL 2M4YA 2R92L 2B5ID 1YV1A 2H12A 2Y0SP 1IU5A 5H1Sc 1PFVA 3H99A 3GTGL 3CQZL 1Y1WL 4AHXA 3MSUA 3S17L 1BQ8A 4YWLA 3HJWB 2NYDA 4JAEA 4A3ML 4JAFA 2M6PA 4AI1A 3PO2L 2DSXA 3PWFA 3H9CA 5C44L 2XJRA 2JA6L 1PFUA 3QVDA 1QCVA 2ZIXA 1Y1VL 2LCQA 3HAXC 3MPSA 3GTLL 3HKZP 1LKPA 3MQKB 4AHZA 1BQ9A 4AR4A 1TWCL 3S2DL 2RDVA 1R0HA 2KKDA 1LKMA 1CAAA 3LWQB 5AI2A 1ODHA 4WFN1 3K35A 2BE5D 4AHYA 1RB9A 5M3FL 4A3LL 1BE7A 1VZIA 2NVTL 2XJUA 1T9PA 1R0FA 5IP7L 1SFOL 3J7Y1 6RXNA 1I50L 2AQCA 4C3IL 2PVXA 4U671 4BBRL 4TPUA 3KYVA 4POFA 4AI2A 2V3BB 4JAGA 4LHNA 2Z3RB 4C3JL 8RXNA 3RZTA 3I4NL 5IYDL 5C4XL 5JVG1 4UY81 3H0GL 3HOZL 3IU3I 3KYWA 2E2JL 3P8BA 3GTJL 2WB1P 1RDGA 2CKAA 2M4VA 3H9BA 4A3FL 1RWDA 5GAHc 2WAQP 2AUSB 4BBSL 3GTPL 3M3YL 4A3BL 3QQCE 3HJYB 4B8CD 1VZHA 1FHHA 3RZDL 1B2OA 4RXNA 2PSMC 5C4JL 4A3JL 5DM71 1K83L 2PPTA 2ERSA 1QYBA 1S2ZA 4QIWP 1TWFL 3P2AA 1YK4A 3RZOL 1B71A 4JADA 1I3QL 3S1NL 1R0JA 1B13A 4G6BA 4A3GL 1PFWA 4A3DL 1PZXA 3SS2A 4AYBP 2C6AA 4BY7L 1Z92B 5MFPA 4ZN1B 3GTQL 1CADA 5FJ8L 2B63L 4XGHA 5FLML 2GMGA 1YUZA 5IYCL 3KYXA 4POGA 3RYGA 1NNQA 1IRNA 3HOYL 3HOXL 4E6YA 2L0ZA 2NVYL 3KYYA 3B08B 2R7ZL 1PFYA 5AI3A 5M3ML 2A6HD 4AI3A 3K7AL 3GTOL 1ZRPA 2RFKB 4A3EL 2XJPA 4A3KL 3LWOB 5IP9L 1NXGA 3KYUA 5AN9H 1T9QA 1BRFA 1FHMA 5M5YL 2XJQA 1IW7D 3S1RL 1SMUA 3GTML 4XXBB 4AHWA 5IYBL 2MS3A
chains in the Genus database with same CATH topology
2V0EA 4TVMA 5MGNA 1FHHA 4AI1A 5EIOC 1R0IA 1B2OA 2DSXA 3PWFA 4LHLA 4RXNA 1H7VA 3PIO1 2PSMC 2XJRA 1S30A 4YWMA 5DM71 1OWBA 3QVDA 1DX8A 1QCVA 2K2DA 2ERSA 2J9UB 2PPTA 2ZIXA 3NFPI 2LCQA 2XJSA 1QYBA 2O5JD 1S2ZA 5MLC3 3MPSA 2Z3QB 4GS7D 4ZN3B 3J7Z1 1T9OA 5GAEc 3P2AA 1YK4A 2ERJA 1B71A 1LKPA 2A69D 3LPEB 4JADA 3A44A 5MF6A 1SMWA 1RDVA 1R0JA 1B13A 4G6BA 5DM61 5JVH1 4AHZA 1BQ9A 5GAGc 4JAFA 4AR4A 3SS2A 5EINC 2C6AA 2M6OA 1Z92B 1RYTA 2RDVA 3B0AB 1R0HA 2KKDA 4ZN1B 7RXNA 1LKMA 5MFPA 1CAAA 1CADA 2AYJA 5AI2A 2VL6A 1ODHA 2XJVA 4XGHA 1C09A 1WJVA 4AR5A 4WFN1 2GMGA 1YUZA 3K35A 2BE5D 3KYXA 1R0GA 1RB9A 4AHYA 5RXNA 4POGA 3RYGA 1BE7A 3VPBE 3ZG6A 1VZIA 1VZGA 1NNQA 1IRNA 2V0FA 2XJUA 2JI3A 2HR5A 3RZ6A 1LKOA 2JI1A 1DVBA 1T9PA 4JAEA 2CKCA 1NXEA 3WWNB 1OWCA 1R0FA 1JYBA 3WWLA 1B2JA 3PKIA 4E6YA 2L0ZA 5MFZA 3J7Y1 1VCXA 3KYYA 6RXNA 2PYAA 2KN9A 2CR8A 3B08B 1YUXA 2PVXA 5IY0A 4U671 1LTLA 4TPUA 3KYVA 4ME3A 5AI3A 4POFA 4AI2A 2A6HD 3PKJA 1IU6A 4AI3A 1SMMA 1ZRPA 1YK5A 2XJPA 4AI0A 4AR6A 2V3BB 4JAGA 4LHNA 4V196 2Z3RB 8RXNA 1E8JA 2XJTA 3RZTA 3PIP1 1RYQA 1NXGA 5JVG1 4K9FA 4UY81 2C6BA 4AR3A 2M4YA 3IU3I 2A68D 3KYUA 3KYWA 5AN9H 1IROA 2B5ID 2PVEA 1YV1A 1BFYA 5GADc 1S24A 3P8BA 2A6ED 2H12A 1RDGA 1T9QA 2CKAA 2M4VA 1BRFA 1IU5A 1FHMA 3PZAA 5H1Sc 1RWDA 2XJQA 1IW7D 5GAHc 1SMUA 3LNLA 4AHXA 5K2ME 3MSUA 3QQCE 1BQ8A 2JI2A 4XXBB 4YWLA 4B8CD 4AHWA 2NYDA 2MS3A 1VZHA 2QL0A 2M6PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FHH A;  1R0I A;  1B2O A;  2DSX A;  3PWF A;  4RXN A;  1H7V A;  1S30 A;  4YWM A;  3QVD A;  1DX8 A;  1QCV A;  2K2D A;  2LCQ A;  1QYB A;  1S2Z A;  3MPS A;  1T9O A;  1YK4 A;  1B71 A;  1LKP A;  3A44 A;  1SMW A;  1RDV A;  1R0J A;  1B13 A;  1BQ9 A;  4AR4 A;  3SS2 A;  2RDV A;  1R0H A;  2KKD A;  7RXN A;  1LKM A;  1CAA A;  1CAD A;  5AI2 A;  2VL6 A;  1C09 A;  4AR5 A;  2GMG A;  1YUZ A;  5RXN A;  3KYX A;  1R0G A;  4POG A;  1RB9 A;  1E8J A;  3RYG A;  1BE7 A;  1NNQ A;  1IRN A;  2HR5 A;  3RZ6 A;  1LKO A;  1DVB A;  1T9P A;  1R0F A;  1JYB A;  1B2J A;  1VCX A;  3KYY A;  6RXN A;  2PYA A;  2KN9 A;  1YUX A;  2PVX A;  5IY0 A;  1LTL A;  4TPU A;  3KYV A;  4ME3 A;  5AI3 A;  4POF A;  1IU6 A;  1SMM A;  1ZRP A;  1YK5 A;  4AR6 A;  2V3B B;  8RXN A;  3RZT A;  4K9F A;  4AR3 A;  2M4Y A;  3KYU A;  3KYW A;  1IRO A;  2PVE A;  1YV1 A;  1BFY A;  1S24 A;  1RDG A;  1T9Q A;  1BRF A;  1IU5 A;  1FHM A;  3PZA A;  1RWD A;  1SMU A;  1BQ8 A;  4YWL A;  2MS3 A;  1RYT A;  2QL0 A; 
#chains in the Genus database with same CATH topology
 4TVM A;  5MGN A;  5EIO C;  1R0I A;  2E2H L;  4LHL A;  2APO B;  3PIO 1;  5M5X L;  1OWB A;  2J9U B;  2XJS A;  3J7Z 1;  4GS7 D;  4ZN3 B;  5GAE c;  5C3E L;  2ERJ A;  2A69 D;  3LPE B;  3PO3 L;  5DM6 1;  5JVH 1;  2PMZ P;  1I6H L;  2EY4 E;  3H3V M;  7RXN A;  2VL6 A;  4C3H L;  1C09 A;  1WJV A;  4AR5 A;  4A3C L;  2VUM L;  1E8J A;  1R0G A;  1TWG L;  2NVX L;  1VZG A;  2V0F A;  1DVB A;  3S2H L;  1NXE A;  3WWL A;  1B2J A;  3GTK L;  2E2I L;  4BY1 L;  1P7P A;  3JR7 A;  2KN9 A;  1F4L A;  1R9T L;  3HOW L;  1LTL A;  2HVY C;  4V19 6;  2NVQ L;  2XJT A;  3PIP 1;  2C6B A;  2A68 D;  3LWR B;  1IRO A;  2PVE A;  1BFY A;  5GAD c;  1S24 A;  2A6E D;  3S15 L;  3LWV B;  3PZA A;  3LWP B;  3LNL A;  5K2M E;  1WCM L;  2JI2 A;  1RYT A;  2QL0 A;  2V0E A;  1H7V A;  1S30 A;  4YWM A;  3H97 A;  3S14 L;  1DX8 A;  3HOV L;  2K2D A;  3NFP I;  2O5J D;  5MLC 3;  2Z3Q B;  1T9O A;  4Y52 L;  2JA5 L;  1QQT A;  3S1Q L;  3A44 A;  5MF6 A;  1SMW A;  4X6A L;  1RDV A;  3M4O L;  5GAG c;  3FDJ A;  5EIN C;  2M6O A;  4Y7N L;  3B0A B;  5M5W L;  2AYJ A;  4C2M 1;  3PL5 A;  2XJV A;  2R93 L;  2JA8 L;  5RXN A;  3VPB E;  3ZG6 A;  4A3I L;  2JI3 A;  2HR5 A;  3RZ6 A;  1LKO A;  2JI1 A;  2CKC A;  3WWN B;  1OWC A;  1JYB A;  3FKI L;  4A93 L;  3PKI A;  5MFZ A;  3HOU L;  3S1M L;  1TWA L;  1VCX A;  2JA7 L;  2YU9 L;  2PYA A;  2CR8 A;  1YUX A;  5IY0 A;  4ME3 A;  3S16 L;  3PKJ A;  1IU6 A;  1SMM A;  3I4M L;  1TWH L;  1YK5 A;  4AI0 A;  4AR6 A;  1RYQ A;  4K9F A;  4AR3 A;  4BXX L;  2M4Y A;  2R92 L;  2B5I D;  1YV1 A;  2H12 A;  2Y0S P;  1IU5 A;  5H1S c;  1PFV A;  3H99 A;  3GTG L;  3CQZ L;  1Y1W L;  4AHX A;  3MSU A;  3S17 L;  1BQ8 A;  4YWL A;  3HJW B;  2NYD A;  4JAE A;  4A3M L;  4JAF A;  2M6P A;  4AI1 A;  3PO2 L;  2DSX A;  3PWF A;  3H9C A;  5C44 L;  2XJR A;  2JA6 L;  1PFU A;  3QVD A;  1QCV A;  2ZIX A;  1Y1V L;  2LCQ A;  3HAX C;  3MPS A;  3GTL L;  3HKZ P;  1LKP A;  3MQK B;  4AHZ A;  1BQ9 A;  4AR4 A;  1TWC L;  3S2D L;  2RDV A;  1R0H A;  2KKD A;  1LKM A;  1CAA A;  3LWQ B;  5AI2 A;  1ODH A;  4WFN 1;  3K35 A;  2BE5 D;  4AHY A;  1RB9 A;  5M3F L;  4A3L L;  1BE7 A;  1VZI A;  2NVT L;  2XJU A;  1T9P A;  1R0F A;  5IP7 L;  1SFO L;  3J7Y 1;  6RXN A;  1I50 L;  2AQC A;  4C3I L;  2PVX A;  4U67 1;  4BBR L;  4TPU A;  3KYV A;  4POF A;  4AI2 A;  2V3B B;  4JAG A;  4LHN A;  2Z3R B;  4C3J L;  8RXN A;  3RZT A;  3I4N L;  5IYD L;  5C4X L;  5JVG 1;  4UY8 1;  3H0G L;  3HOZ L;  3IU3 I;  3KYW A;  2E2J L;  3P8B A;  3GTJ L;  2WB1 P;  1RDG A;  2CKA A;  2M4V A;  3H9B A;  4A3F L;  1RWD A;  5GAH c;  2WAQ P;  2AUS B;  4BBS L;  3GTP L;  3M3Y L;  4A3B L;  3QQC E;  3HJY B;  4B8C D;  1VZH A;  1FHH A;  3RZD L;  1B2O A;  4RXN A;  2PSM C;  5C4J L;  4A3J L;  5DM7 1;  1K83 L;  2PPT A;  2ERS A;  1QYB A;  1S2Z A;  4QIW P;  1TWF L;  3P2A A;  1YK4 A;  3RZO L;  1B71 A;  4JAD A;  1I3Q L;  3S1N L;  1R0J A;  1B13 A;  4G6B A;  4A3G L;  1PFW A;  4A3D L;  1PZX A;  3SS2 A;  4AYB P;  2C6A A;  4BY7 L;  1Z92 B;  5MFP A;  4ZN1 B;  3GTQ L;  1CAD A;  5FJ8 L;  2B63 L;  4XGH A;  5FLM L;  2GMG A;  1YUZ A;  5IYC L;  3KYX A;  4POG A;  3RYG A;  1NNQ A;  1IRN A;  3HOY L;  3HOX L;  4E6Y A;  2L0Z A;  2NVY L;  3KYY A;  3B08 B;  2R7Z L;  1PFY A;  5AI3 A;  5M3M L;  2A6H D;  4AI3 A;  3K7A L;  3GTO L;  1ZRP A;  2RFK B;  4A3E L;  2XJP A;  4A3K L;  3LWO B;  5IP9 L;  1NXG A;  3KYU A;  5AN9 H;  1T9Q A;  1BRF A;  1FHM A;  5M5Y L;  2XJQ A;  1IW7 D;  3S1R L;  1SMU A;  3GTM L;  4XXB B;  4AHW A;  5IYB L;  2MS3 A; 
#chains in the Genus database with same CATH homology
 2V0E A;  4TVM A;  5MGN A;  1FHH A;  4AI1 A;  5EIO C;  1R0I A;  1B2O A;  2DSX A;  3PWF A;  4LHL A;  4RXN A;  1H7V A;  3PIO 1;  2PSM C;  2XJR A;  1S30 A;  4YWM A;  5DM7 1;  1OWB A;  3QVD A;  1DX8 A;  1QCV A;  2K2D A;  2ERS A;  2J9U B;  2PPT A;  2ZIX A;  3NFP I;  2LCQ A;  2XJS A;  1QYB A;  2O5J D;  1S2Z A;  5MLC 3;  3MPS A;  2Z3Q B;  4GS7 D;  4ZN3 B;  3J7Z 1;  1T9O A;  5GAE c;  3P2A A;  1YK4 A;  2ERJ A;  1B71 A;  1LKP A;  2A69 D;  3LPE B;  4JAD A;  3A44 A;  5MF6 A;  1SMW A;  1RDV A;  1R0J A;  1B13 A;  4G6B A;  5DM6 1;  5JVH 1;  4AHZ A;  1BQ9 A;  5GAG c;  4JAF A;  4AR4 A;  3SS2 A;  5EIN C;  2C6A A;  2M6O A;  1Z92 B;  1RYT A;  2RDV A;  3B0A B;  1R0H A;  2KKD A;  4ZN1 B;  7RXN A;  1LKM A;  5MFP A;  1CAA A;  1CAD A;  2AYJ A;  5AI2 A;  2VL6 A;  1ODH A;  2XJV A;  4XGH A;  1C09 A;  1WJV A;  4AR5 A;  4WFN 1;  2GMG A;  1YUZ A;  3K35 A;  2BE5 D;  3KYX A;  1R0G A;  1RB9 A;  4AHY A;  5RXN A;  4POG A;  3RYG A;  1BE7 A;  3VPB E;  3ZG6 A;  1VZI A;  1VZG A;  1NNQ A;  1IRN A;  2V0F A;  2XJU A;  2JI3 A;  2HR5 A;  3RZ6 A;  1LKO A;  2JI1 A;  1DVB A;  1T9P A;  4JAE A;  2CKC A;  1NXE A;  3WWN B;  1OWC A;  1R0F A;  1JYB A;  3WWL A;  1B2J A;  3PKI A;  4E6Y A;  2L0Z A;  5MFZ A;  3J7Y 1;  1VCX A;  3KYY A;  6RXN A;  2PYA A;  2KN9 A;  2CR8 A;  3B08 B;  1YUX A;  2PVX A;  5IY0 A;  4U67 1;  1LTL A;  4TPU A;  3KYV A;  4ME3 A;  5AI3 A;  4POF A;  4AI2 A;  2A6H D;  3PKJ A;  1IU6 A;  4AI3 A;  1SMM A;  1ZRP A;  1YK5 A;  2XJP A;  4AI0 A;  4AR6 A;  2V3B B;  4JAG A;  4LHN A;  4V19 6;  2Z3R B;  8RXN A;  1E8J A;  2XJT A;  3RZT A;  3PIP 1;  1RYQ A;  1NXG A;  5JVG 1;  4K9F A;  4UY8 1;  2C6B A;  4AR3 A;  2M4Y A;  3IU3 I;  2A68 D;  3KYU A;  3KYW A;  5AN9 H;  1IRO A;  2B5I D;  2PVE A;  1YV1 A;  1BFY A;  5GAD c;  1S24 A;  3P8B A;  2A6E D;  2H12 A;  1RDG A;  1T9Q A;  2CKA A;  2M4V A;  1BRF A;  1IU5 A;  1FHM A;  3PZA A;  5H1S c;  1RWD A;  2XJQ A;  1IW7 D;  5GAH c;  1SMU A;  3LNL A;  4AHX A;  5K2M E;  3MSU A;  3QQC E;  1BQ8 A;  2JI2 A;  4XXB B;  4YWL A;  4B8C D;  4AHW A;  2NYD A;  2MS3 A;  1VZH A;  2QL0 A;  2M6P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...