3KYYA

Joint xray/neutron crystal structure determination of h-labeled perdeuterated rubredoxin at 295k
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3kyyA00
2HR5A 1B71A 1LKMA 7RXNA 1R0FA 4K9FA 4YWMA 3PWFA 5RXNA 1B13A 4AR5A 1IRNA 1C09A 4AR3A 1FHMA 4AR4A 3KYXA 5IY0A 2RDVA 1LTLA 4RXNA 2KKDA 1BE7A 3A44A 3KYVA 2GMGA 3RZ6A 1E8JA 1YUXA 1T9PA 2K2DA 1R0HA 1YK5A 3RYGA 2PVEA 1SMWA 6RXNA 4ME3A 2DSXA 2QL0A 4AR6A 1CAAA 2PVXA 3KYUA 1RYTA 3KYWA 1QYBA 1T9OA 1IROA 1B2JA 2MS3A 3SS2A 2M4YA 5AI3A 1H7VA 1R0GA 1IU6A 1T9QA 5AI2A 1R0IA 1BQ8A 1BQ9A 1B2OA 1FHHA 1JYBA 1NNQA 2VL6A 1ZRPA 1LKOA 1RDGA 1S2ZA 1R0JA 1YV1A 1CADA 1YK4A 1QCVA 3RZTA 1S24A 1IU5A 1DVBA 2KN9A 1RDVA 3PZAA 1SMUA 2PYAA 4YWLA 1RB9A 3KYYA 4POFA 1BRFA 1RWDA 1S30A 1VCXA 8RXNA 1LKPA 4POGA 3QVDA 1BFYA 1SMMA 3MPSA 1DX8A 1YUZA 2LCQA 4TPUA 2V3BB
chains in the Genus database with same CATH superfamily
7RXNA 1LKMA 3NFPI 3B08B 1R0FA 3HOYL 4A3KL 1TWAL 5MFZA 4AI3A 3IU3I 2B5ID 4BY7L 4A3IL 3S15L 4TVMA 4LHLA 3J7Z1 1F4LA 4A93L 3S2HL 3HOXL 1LTLA 2JA6L 3K7AL 4C3HL 3A44A 5C3EL 3HOWL 3B0AB 5MFPA 5FLML 2CKAA 1YUXA 3QQCE 2K2DA 2JI2A 3FKIL 2M6PA 1YK5A 2PVEA 4Y52L 4ME3A 1VZHA 2ERJA 4AR6A 2A68D 3KYUA 1TWHL 3KYWA 3SS2A 5GAEc 2NVTL 4BXXL 2WB1P 2R93L 1IU6A 2JA5L 3M4OL 4A3DL 2EY4E 1R0IA 2JI3A 5GAHc 3H0GL 4A3FL 1JYBA 1NNQA 2VL6A 1ZRPA 3PIP1 2O5JD 4ZN1B 5C4JL 4AYBP 3PKIA 3LWQB 1YK4A 3PO2L 2JA8L 4AHZA 1DVBA 2KN9A 1I3QL 1QQTA 3M3YL 2R92L 4GS7D 2RFKB 5M5XL 4YWLA 2AUSB 1RB9A 2CKCA 4A3CL 8RXNA 3GTLL 1TWFL 1RYQA 2LCQA 3H3VM 4V196 3GTOL 2XJPA 1PFYA 3K35A 1B13A 1IW7D 1C09A 1NXGA 4QIWP 4AR4A 3KYXA 2YU9L 5IY0A 2RDVA 2H12A 2ZIXA 3GTQL 4BBSL 3KYVA 2L0ZA 1I50L 5IP9L 4AHYA 1SMWA 1Z92B 3GTKL 1QYBA 4JAGA 1T9OA 1IROA 1VZIA 2CR8A 3WWNB 3GTPL 3LWOB 5AI3A 1H7VA 2XJUA 2PMZP 5AI2A 1BQ8A 1B2OA 3S2DL 5GAGc 3LPEB 5MGNA 1YV1A 1CADA 2C6BA 2JA7L 2BE5D 3HOZL 3HOVL 3LWPB 4C2M1 2AYJA 1RDVA 3J7Y1 3S17L 3H99A 3P8BA 3LNLA 5IYBL 2PYAA 1RWDA 1VCXA 1OWBA 4BBRL 2V0EA 3WWLA 3MSUA 4POGA 4X6AL 2Z3QB 5MLC3 3FDJA 2E2JL 2V0FA 4TPUA 1B71A 3PL5A 2NVYL 3PWFA 5RXNA 3S1QL 4AR5A 4A3LL 2NVXL 1FHMA 4BY1L 3H9BA 1PZXA 3S1ML 4JAEA 5GADc 3LWVB 1OWCA 3GTJL 1ODHA 4A3GL 4RXNA 2KKDA 3I4ML 2GMGA 5DM61 4UY81 3RZ6A 2E2IL 5C4XL 4AHXA 1T9PA 1R0HA 1TWGL 3I4NL 6RXNA 2DSXA 2Y0SP 5EINC 2R7ZL 2MS3A 4WFN1 3PO3L 2M4YA 2XJVA 2NYDA 3GTML 1BQ9A 1Y1WL 4A3ML 2E2HL 5H1Sc 1VZGA 1PFWA 1LKOA 1RDGA 4B8CD 4A3BL 2C6AA 5M3FL 3H97A 3ZG6A 1QCVA 1S24A 1SFOL 2XJTA 5IYCL 3PZAA 3HKZP 5IYDL 5M5YL 3GTGL 2HVYC 1S30A 4C3JL 4U671 3LWRB 1LKPA 4A3EL 4C3IL 1TWCL 1BFYA 3MPSA 1YUZA 3VPBE 3HJYB 2V3BB 2A6HD 2HR5A 2XJSA 4K9FA 4YWMA 3H9CA 3MQKB 1WCML 4ZN3B 1IRNA 3S16L 4AR3A 4XGHA 2Z3RB 1I6HL 5FJ8L 4LHNA 2JI1A 2AQCA 1NXEA 3S14L 2A6ED 3RZDL 3P2AA 1BE7A 3HJWB 1E8JA 5JVH1 2J9UB 5C44L 5IP7L 3RYGA 1Y1VL 4AI1A 2APOB 2QL0A 1CAAA 2PVXA 3HAXC 1RYTA 1B2JA 4JADA 3S1RL 5K2ME 3RZOL 5DM71 2M4VA 5JVG1 4E6YA 4JAFA 1R0GA 1T9QA 4AI0A 4XXBB 1FHHA 2PPTA 3PKJA 2VUML 1S2ZA 1R0JA 2M6OA 4A3JL 3HOUL 3JR7A 1P7PA 4AI2A 3RZTA 2XJQA 2ERSA 1IU5A 1WJVA 2XJRA 4G6BA 2NVQL 3S1NL 1SMUA 2WAQP 5MF6A 1PFVA 5AN9H 3PIO1 1PFUA 3KYYA 4POFA 5M3ML 1BRFA 5EIOC 4Y7NL 2PSMC 3QVDA 1K83L 1SMMA 1R9TL 2B63L 2A69D 3CQZL 1DX8A 5M5WL 4AHWA
chains in the Genus database with same CATH topology
2A6HD 2HR5A 1B71A 1LKMA 2XJSA 3NFPI 7RXNA 3B08B 1R0FA 4K9FA 4YWMA 2XJPA 3PWFA 5MFZA 4AI3A 5RXNA 3K35A 1B13A 3IU3I 2B5ID 4AR5A 4ZN3B 1IRNA 1IW7D 1C09A 4AR3A 1FHMA 1NXGA 4XGHA 2Z3RB 4AR4A 3KYXA 4LHNA 4TVMA 4JAEA 2JI1A 4LHLA 3J7Z1 5IY0A 5GADc 2RDVA 2H12A 1NXEA 2ZIXA 1OWCA 1ODHA 1LTLA 2A6ED 4RXNA 3P2AA 2KKDA 1BE7A 3A44A 3KYVA 2GMGA 2L0ZA 5DM61 3B0AB 4UY81 3RZ6A 1E8JA 5MFPA 2CKAA 5JVH1 2J9UB 1YUXA 4AHXA 1T9PA 2K2DA 3QQCE 2JI2A 1R0HA 2M6PA 1YK5A 3RYGA 4AHYA 2PVEA 1SMWA 1Z92B 4AI1A 6RXNA 4ME3A 1VZHA 2DSXA 2ERJA 2QL0A 4AR6A 2A68D 5EINC 1CAAA 2PVXA 3KYUA 1RYTA 3KYWA 1QYBA 4JAGA 1T9OA 1IROA 1B2JA 2MS3A 4JADA 4WFN1 1VZIA 2CR8A 3SS2A 3WWNB 5GAEc 5K2ME 2M4YA 5AI3A 1H7VA 2XJUA 5DM71 2M4VA 5JVG1 4E6YA 4JAFA 1R0GA 1IU6A 2XJVA 3VPBE 1T9QA 2NYDA 5AI2A 4AI0A 1R0IA 2JI3A 5GAHc 1BQ8A 1BQ9A 1B2OA 4XXBB 1FHHA 2PPTA 5H1Sc 1JYBA 1NNQA 1VZGA 2VL6A 3PKJA 1ZRPA 4V196 5GAGc 3PIP1 1LKOA 1RDGA 2O5JD 1S2ZA 4B8CD 3LPEB 1R0JA 1YV1A 4ZN1B 5MGNA 2M6OA 2C6AA 1CADA 3PKIA 1YK4A 2C6BA 3ZG6A 2BE5D 4AI2A 1QCVA 3RZTA 1S24A 2XJQA 2ERSA 2XJTA 1IU5A 1WJVA 2XJRA 4G6BA 4AHZA 1DVBA 2AYJA 2KN9A 1RDVA 3J7Y1 3PZAA 1SMUA 3P8BA 3LNLA 4GS7D 5MF6A 5AN9H 3PIO1 2PYAA 4YWLA 1RB9A 2CKCA 3KYYA 4POFA 1BRFA 1RWDA 1S30A 1VCXA 5EIOC 1OWBA 8RXNA 2V0EA 3WWLA 4U671 1LKPA 2PSMC 3MSUA 4POGA 3QVDA 1BFYA 1SMMA 2Z3QB 1RYQA 2A69D 5MLC3 3MPSA 1DX8A 1YUZA 2LCQA 2V0FA 4AHWA 4TPUA 2V3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HR5 A;  1B71 A;  1LKM A;  7RXN A;  1R0F A;  4K9F A;  4YWM A;  3PWF A;  5RXN A;  1B13 A;  4AR5 A;  1IRN A;  1C09 A;  4AR3 A;  1FHM A;  4AR4 A;  3KYX A;  5IY0 A;  2RDV A;  1LTL A;  4RXN A;  2KKD A;  1BE7 A;  3A44 A;  3KYV A;  2GMG A;  3RZ6 A;  1E8J A;  1YUX A;  1T9P A;  2K2D A;  1R0H A;  1YK5 A;  3RYG A;  2PVE A;  1SMW A;  6RXN A;  4ME3 A;  2DSX A;  2QL0 A;  4AR6 A;  1CAA A;  2PVX A;  3KYU A;  1RYT A;  3KYW A;  1QYB A;  1T9O A;  1IRO A;  1B2J A;  2MS3 A;  3SS2 A;  2M4Y A;  5AI3 A;  1H7V A;  1R0G A;  1IU6 A;  1T9Q A;  5AI2 A;  1R0I A;  1BQ8 A;  1BQ9 A;  1B2O A;  1FHH A;  1JYB A;  1NNQ A;  2VL6 A;  1ZRP A;  1LKO A;  1RDG A;  1S2Z A;  1R0J A;  1YV1 A;  1CAD A;  1YK4 A;  1QCV A;  3RZT A;  1S24 A;  1IU5 A;  1DVB A;  2KN9 A;  1RDV A;  3PZA A;  1SMU A;  2PYA A;  4YWL A;  1RB9 A;  3KYY A;  4POF A;  1BRF A;  1RWD A;  1S30 A;  1VCX A;  8RXN A;  1LKP A;  4POG A;  3QVD A;  1BFY A;  1SMM A;  3MPS A;  1DX8 A;  1YUZ A;  2LCQ A;  4TPU A;  2V3B B; 
#chains in the Genus database with same CATH topology
 7RXN A;  1LKM A;  3NFP I;  3B08 B;  1R0F A;  3HOY L;  4A3K L;  1TWA L;  5MFZ A;  4AI3 A;  3IU3 I;  2B5I D;  4BY7 L;  4A3I L;  3S15 L;  4TVM A;  4LHL A;  3J7Z 1;  1F4L A;  4A93 L;  3S2H L;  3HOX L;  1LTL A;  2JA6 L;  3K7A L;  4C3H L;  3A44 A;  5C3E L;  3HOW L;  3B0A B;  5MFP A;  5FLM L;  2CKA A;  1YUX A;  3QQC E;  2K2D A;  2JI2 A;  3FKI L;  2M6P A;  1YK5 A;  2PVE A;  4Y52 L;  4ME3 A;  1VZH A;  2ERJ A;  4AR6 A;  2A68 D;  3KYU A;  1TWH L;  3KYW A;  3SS2 A;  5GAE c;  2NVT L;  4BXX L;  2WB1 P;  2R93 L;  1IU6 A;  2JA5 L;  3M4O L;  4A3D L;  2EY4 E;  1R0I A;  2JI3 A;  5GAH c;  3H0G L;  4A3F L;  1JYB A;  1NNQ A;  2VL6 A;  1ZRP A;  3PIP 1;  2O5J D;  4ZN1 B;  5C4J L;  4AYB P;  3PKI A;  3LWQ B;  1YK4 A;  3PO2 L;  2JA8 L;  4AHZ A;  1DVB A;  2KN9 A;  1I3Q L;  1QQT A;  3M3Y L;  2R92 L;  4GS7 D;  2RFK B;  5M5X L;  4YWL A;  2AUS B;  1RB9 A;  2CKC A;  4A3C L;  8RXN A;  3GTL L;  1TWF L;  1RYQ A;  2LCQ A;  3H3V M;  4V19 6;  3GTO L;  2XJP A;  1PFY A;  3K35 A;  1B13 A;  1IW7 D;  1C09 A;  1NXG A;  4QIW P;  4AR4 A;  3KYX A;  2YU9 L;  5IY0 A;  2RDV A;  2H12 A;  2ZIX A;  3GTQ L;  4BBS L;  3KYV A;  2L0Z A;  1I50 L;  5IP9 L;  4AHY A;  1SMW A;  1Z92 B;  3GTK L;  1QYB A;  4JAG A;  1T9O A;  1IRO A;  1VZI A;  2CR8 A;  3WWN B;  3GTP L;  3LWO B;  5AI3 A;  1H7V A;  2XJU A;  2PMZ P;  5AI2 A;  1BQ8 A;  1B2O A;  3S2D L;  5GAG c;  3LPE B;  5MGN A;  1YV1 A;  1CAD A;  2C6B A;  2JA7 L;  2BE5 D;  3HOZ L;  3HOV L;  3LWP B;  4C2M 1;  2AYJ A;  1RDV A;  3J7Y 1;  3S17 L;  3H99 A;  3P8B A;  3LNL A;  5IYB L;  2PYA A;  1RWD A;  1VCX A;  1OWB A;  4BBR L;  2V0E A;  3WWL A;  3MSU A;  4POG A;  4X6A L;  2Z3Q B;  5MLC 3;  3FDJ A;  2E2J L;  2V0F A;  4TPU A;  1B71 A;  3PL5 A;  2NVY L;  3PWF A;  5RXN A;  3S1Q L;  4AR5 A;  4A3L L;  2NVX L;  1FHM A;  4BY1 L;  3H9B A;  1PZX A;  3S1M L;  4JAE A;  5GAD c;  3LWV B;  1OWC A;  3GTJ L;  1ODH A;  4A3G L;  4RXN A;  2KKD A;  3I4M L;  2GMG A;  5DM6 1;  4UY8 1;  3RZ6 A;  2E2I L;  5C4X L;  4AHX A;  1T9P A;  1R0H A;  1TWG L;  3I4N L;  6RXN A;  2DSX A;  2Y0S P;  5EIN C;  2R7Z L;  2MS3 A;  4WFN 1;  3PO3 L;  2M4Y A;  2XJV A;  2NYD A;  3GTM L;  1BQ9 A;  1Y1W L;  4A3M L;  2E2H L;  5H1S c;  1VZG A;  1PFW A;  1LKO A;  1RDG A;  4B8C D;  4A3B L;  2C6A A;  5M3F L;  3H97 A;  3ZG6 A;  1QCV A;  1S24 A;  1SFO L;  2XJT A;  5IYC L;  3PZA A;  3HKZ P;  5IYD L;  5M5Y L;  3GTG L;  2HVY C;  1S30 A;  4C3J L;  4U67 1;  3LWR B;  1LKP A;  4A3E L;  4C3I L;  1TWC L;  1BFY A;  3MPS A;  1YUZ A;  3VPB E;  3HJY B;  2V3B B;  2A6H D;  2HR5 A;  2XJS A;  4K9F A;  4YWM A;  3H9C A;  3MQK B;  1WCM L;  4ZN3 B;  1IRN A;  3S16 L;  4AR3 A;  4XGH A;  2Z3R B;  1I6H L;  5FJ8 L;  4LHN A;  2JI1 A;  2AQC A;  1NXE A;  3S14 L;  2A6E D;  3RZD L;  3P2A A;  1BE7 A;  3HJW B;  1E8J A;  5JVH 1;  2J9U B;  5C44 L;  5IP7 L;  3RYG A;  1Y1V L;  4AI1 A;  2APO B;  2QL0 A;  1CAA A;  2PVX A;  3HAX C;  1RYT A;  1B2J A;  4JAD A;  3S1R L;  5K2M E;  3RZO L;  5DM7 1;  2M4V A;  5JVG 1;  4E6Y A;  4JAF A;  1R0G A;  1T9Q A;  4AI0 A;  4XXB B;  1FHH A;  2PPT A;  3PKJ A;  2VUM L;  1S2Z A;  1R0J A;  2M6O A;  4A3J L;  3HOU L;  3JR7 A;  1P7P A;  4AI2 A;  3RZT A;  2XJQ A;  2ERS A;  1IU5 A;  1WJV A;  2XJR A;  4G6B A;  2NVQ L;  3S1N L;  1SMU A;  2WAQ P;  5MF6 A;  1PFV A;  5AN9 H;  3PIO 1;  1PFU A;  3KYY A;  4POF A;  5M3M L;  1BRF A;  5EIO C;  4Y7N L;  2PSM C;  3QVD A;  1K83 L;  1SMM A;  1R9T L;  2B63 L;  2A69 D;  3CQZ L;  1DX8 A;  5M5W L;  4AHW A; 
#chains in the Genus database with same CATH homology
 2A6H D;  2HR5 A;  1B71 A;  1LKM A;  2XJS A;  3NFP I;  7RXN A;  3B08 B;  1R0F A;  4K9F A;  4YWM A;  2XJP A;  3PWF A;  5MFZ A;  4AI3 A;  5RXN A;  3K35 A;  1B13 A;  3IU3 I;  2B5I D;  4AR5 A;  4ZN3 B;  1IRN A;  1IW7 D;  1C09 A;  4AR3 A;  1FHM A;  1NXG A;  4XGH A;  2Z3R B;  4AR4 A;  3KYX A;  4LHN A;  4TVM A;  4JAE A;  2JI1 A;  4LHL A;  3J7Z 1;  5IY0 A;  5GAD c;  2RDV A;  2H12 A;  1NXE A;  2ZIX A;  1OWC A;  1ODH A;  1LTL A;  2A6E D;  4RXN A;  3P2A A;  2KKD A;  1BE7 A;  3A44 A;  3KYV A;  2GMG A;  2L0Z A;  5DM6 1;  3B0A B;  4UY8 1;  3RZ6 A;  1E8J A;  5MFP A;  2CKA A;  5JVH 1;  2J9U B;  1YUX A;  4AHX A;  1T9P A;  2K2D A;  3QQC E;  2JI2 A;  1R0H A;  2M6P A;  1YK5 A;  3RYG A;  4AHY A;  2PVE A;  1SMW A;  1Z92 B;  4AI1 A;  6RXN A;  4ME3 A;  1VZH A;  2DSX A;  2ERJ A;  2QL0 A;  4AR6 A;  2A68 D;  5EIN C;  1CAA A;  2PVX A;  3KYU A;  1RYT A;  3KYW A;  1QYB A;  4JAG A;  1T9O A;  1IRO A;  1B2J A;  2MS3 A;  4JAD A;  4WFN 1;  1VZI A;  2CR8 A;  3SS2 A;  3WWN B;  5GAE c;  5K2M E;  2M4Y A;  5AI3 A;  1H7V A;  2XJU A;  5DM7 1;  2M4V A;  5JVG 1;  4E6Y A;  4JAF A;  1R0G A;  1IU6 A;  2XJV A;  3VPB E;  1T9Q A;  2NYD A;  5AI2 A;  4AI0 A;  1R0I A;  2JI3 A;  5GAH c;  1BQ8 A;  1BQ9 A;  1B2O A;  4XXB B;  1FHH A;  2PPT A;  5H1S c;  1JYB A;  1NNQ A;  1VZG A;  2VL6 A;  3PKJ A;  1ZRP A;  4V19 6;  5GAG c;  3PIP 1;  1LKO A;  1RDG A;  2O5J D;  1S2Z A;  4B8C D;  3LPE B;  1R0J A;  1YV1 A;  4ZN1 B;  5MGN A;  2M6O A;  2C6A A;  1CAD A;  3PKI A;  1YK4 A;  2C6B A;  3ZG6 A;  2BE5 D;  4AI2 A;  1QCV A;  3RZT A;  1S24 A;  2XJQ A;  2ERS A;  2XJT A;  1IU5 A;  1WJV A;  2XJR A;  4G6B A;  4AHZ A;  1DVB A;  2AYJ A;  2KN9 A;  1RDV A;  3J7Y 1;  3PZA A;  1SMU A;  3P8B A;  3LNL A;  4GS7 D;  5MF6 A;  5AN9 H;  3PIO 1;  2PYA A;  4YWL A;  1RB9 A;  2CKC A;  3KYY A;  4POF A;  1BRF A;  1RWD A;  1S30 A;  1VCX A;  5EIO C;  1OWB A;  8RXN A;  2V0E A;  3WWL A;  4U67 1;  1LKP A;  2PSM C;  3MSU A;  4POG A;  3QVD A;  1BFY A;  1SMM A;  2Z3Q B;  1RYQ A;  2A69 D;  5MLC 3;  3MPS A;  1DX8 A;  1YUZ A;  2LCQ A;  2V0F A;  4AHW A;  4TPU A;  2V3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...