3KYYA

Joint xray/neutron crystal structure determination of h-labeled perdeuterated rubredoxin at 295k
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
54
structure length
54
Chain Sequence
b'MAKWVCKICGYIYDEDAGDPDNGISPGTKFEELPDDWVCPICGAPKSEFEKLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rubredoxin
publication title Unambiguous determination of H-atom positions: comparing results from neutron and high-resolution X-ray crystallography.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Electron transport
total genus 11
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 3kyyA00
3RZ6A 1B2JA 1H7VA 1R0GA 1IRNA 1YUZA 1LTLA 3KYXA 2KKDA 2K2DA 1BFYA 2V3BB 3QVDA 2GMGA 1R0IA 1IU6A 1B13A 5AI3A 1NNQA 1T9OA 2HR5A 1QCVA 1LKMA 2M4YA 2QL0A 2PVEA 4RXNA 1VCXA 2LCQA 1FHMA 2PVXA 1SMMA 1RDGA 1IROA 3SS2A 1E8JA 1BQ8A 1RWDA 1CAAA 1BE7A 4YWLA 1BRFA 2KN9A 1IU5A 8RXNA 1RB9A 3PZAA 4YWMA 3RYGA 5RXNA 1YK5A 6RXNA 1SMWA 3MPSA 2DSXA 2PYAA 7RXNA 1LKOA 3A44A 4POFA 1SMUA 1S30A 1JYBA 2MS3A 1YUXA 2VL6A 1DVBA 1R0HA 1DX8A 1BQ9A 4POGA 5IY0A 4AR6A 1B2OA 3PWFA 1RDVA 4AR3A 1S2ZA 4ME3A 4TPUA 2RDVA 1B71A 1CADA 1R0FA 1T9QA 4K9FA 3KYYA 4AR4A 4AR5A 3RZTA 1ZRPA 1YK4A 1YV1A 1S24A 3KYUA 1C09A 5AI2A 1R0JA 1FHHA 1QYBA 3KYVA 1LKPA 3KYWA 1T9PA 1RYTA
chains in the Genus database with same CATH superfamily
2JI3A 1OWBA 1B2JA 2A69D 4G6BA 2R93L 2C6AA 2JI2A 1R0GA 1IRNA 1VZHA 1LTLA 4A3GL 5MFZA 1RYQA 2JI1A 2XJUA 3PL5A 1R0IA 4LHLA 3MQKB 5AI3A 1PFUA 1T9OA 1QCVA 1LKMA 2BE5D 5DM61 2PVEA 2PMZP 1TWGL 1PFWA 1P7PA 2ZIXA 2APOB 3B0AB 3LWVB 1IROA 3H9BA 3H9CA 3S1RL 3K35A 1TWFL 2JA5L 3PO2L 4YWLA 4A93L 1BRFA 2AQCA 8RXNA 1YK5A 2ERJA 2PYAA 7RXNA 1TWCL 2AYJA 2HVYC 4A3IL 5IP9L 1JYBA 2MS3A 1YUXA 2VL6A 1DVBA 4POGA 4C2M1 4AHXA 3PWFA 3J7Y1 4E6YA 3NFPI 1RDVA 1NXGA 1T9QA 4X6AL 4B8CD 3HJWB 4AR5A 2XJQA 2Z3QB 3JR7A 4AYBP 1YK4A 1C09A 2XJRA 3K7AL 5AI2A 1QYBA 1Y1WL 3I4NL 3KYWA 3S1NL 5GAEc 5C4XL 4JAFA 4WFN1 4LHNA 3LPEB 1K83L 1TWHL 3LNLA 5M3FL 2KKDA 1B13A 2QL0A 2M4YA 4AI3A 1SFOL 1NXEA 3S2HL 5M5YL 3P8BA 1SMMA 2A6HD 2RFKB 3HOWL 3S16L 5H1Sc 3SS2A 2XJVA 4AI2A 2JA7L 2R7ZL 1PZXA 5IP7L 3GTJL 1BE7A 4A3JL 4XXBB 4AHWA 3I4ML 2KN9A 3ZG6A 4C3JL 3B08B 5DM71 3RYGA 2NVXL 4BY7L 2O5JD 2VUML 1VZIA 5FLML 3FDJA 1LKOA 4AI0A 4V196 4JAGA 3HOXL 2JA6L 4AHYA 4TVMA 3RZDL 4Y52L 5IY0A 3HOVL 4GS7D 3HJYB 2A6ED 3HKZP 3RZOL 1B2OA 1Z92B 3H0GL 3S1ML 3GTQL 1PFVA 4ZN3B 1R0FA 3LWQB 5AN9H 4BBSL 2M6PA 4A3ML 2NVTL 3RZTA 3QQCE 2EY4E 2WB1P 3PIO1 3M4OL 3KYVA 4AHZA 3RZ6A 4A3LL 2C6BA 3GTKL 2A68D 4JADA 1YUZA 3KYXA 4AI1A 5MFPA 1R9TL 3S14L 2K2DA 2V3BB 3QVDA 4A3KL 2HR5A 1OWCA 3GTGL 2Y0SP 3PO3L 2LCQA 1FHMA 2PVXA 4A3DL 1RDGA 2CKAA 2Z3RB 4BXXL 2E2JL 1E8JA 4BY1L 1BQ8A 1CAAA 3CQZL 1WCML 4C3IL 3P2AA 1IU5A 2NVYL 6RXNA 1SMWA 3MPSA 2DSXA 1QQTA 3LWRB 5MF6A 5GADc 3A44A 4A3BL 1S30A 2J9UB 2M4VA 5EIOC 2AUSB 1WJVA 5IYCL 3HOYL 1DX8A 3GTML 5JVH1 4A3CL 3H3VM 4XGHA 5M5WL 3H99A 5GAHc 1I50L 4A3FL 5MGNA 3J7Z1 4AR3A 3H97A 1S2ZA 3PKJA 4ME3A 2RDVA 5C3EL 3HOUL 1B71A 1CADA 3KYYA 1Y1VL 3PIP1 3S1QL 1I3QL 5C4JL 3HOZL 3MSUA 1R0JA 4ZN1B 2V0FA 1LKPA 2XJSA 1RYTA 3GTPL 2V0EA 1IW7D 1VZGA 1H7VA 2NYDA 2PPTA 3LWPB 1F4LA 5GAGc 2M6OA 2H12A 3LWOB 2ERSA 1BFYA 3PKIA 2GMGA 3FKIL 1IU6A 2B63L 1NNQA 3GTLL 4Y7NL 5EINC 2WAQP 2JA8L 3IU3I 4C3HL 4RXNA 1VCXA 5K2ME 2XJPA 4UY81 3WWNB 2E2IL 4U671 1ODHA 5IYBL 3GTOL 3S17L 5MLC3 3WWLA 2XJTA 1RWDA 1TWAL 4BBRL 1RB9A 3PZAA 4YWMA 5RXNA 2L0ZA 3S15L 2CR8A 2B5ID 2YU9L 2PSMC 4POFA 1SMUA 2NVQL 2R92L 2E2HL 5M3ML 5JVG1 1R0HA 3M3YL 1BQ9A 5IYDL 4AR6A 4A3EL 4JAEA 3HAXC 5FJ8L 4TPUA 4K9FA 4AR4A 2CKCA 1ZRPA 5C44L 1YV1A 1S24A 3KYUA 3VPBE 4QIWP 5M5XL 3S2DL 1FHHA 1PFYA 1I6HL 1T9PA
chains in the Genus database with same CATH topology
2JI3A 1OWBA 2V0EA 1B2JA 1IW7D 1VZGA 3RZ6A 2A69D 4G6BA 1H7VA 2NYDA 5GAEc 2C6AA 4JAFA 2JI2A 2C6BA 2PPTA 4WFN1 2A68D 4LHNA 3LPEB 1R0GA 4JADA 5GAGc 1IRNA 1VZHA 1YUZA 3LNLA 1LTLA 3KYXA 4AI1A 5MFZA 5MFPA 1RYQA 2JI1A 2M6OA 2KKDA 2XJUA 2K2DA 2H12A 2ERSA 1BFYA 2V3BB 3PKIA 2GMGA 3QVDA 1IU6A 4LHLA 1B13A 1R0IA 5AI3A 1NNQA 5EINC 1T9OA 2HR5A 1QCVA 1OWCA 1LKMA 2M4YA 2QL0A 4AI3A 1NXEA 2BE5D 5DM61 3IU3I 2PVEA 4RXNA 1VCXA 3P8BA 5K2ME 2LCQA 2XJPA 2ZIXA 1FHMA 2PVXA 1SMMA 2A6HD 1RDGA 2CKAA 2Z3RB 3WWNB 4UY81 4U671 5H1Sc 3B0AB 1ODHA 1IROA 3SS2A 5MLC3 2XJVA 1E8JA 4AI2A 3K35A 1BQ8A 3WWLA 2XJTA 1RWDA 1CAAA 1BE7A 4XXBB 4AHWA 4YWLA 1BRFA 2KN9A 3ZG6A 3B08B 3P2AA 1IU5A 8RXNA 5DM71 1RB9A 3PZAA 4YWMA 3RYGA 5RXNA 1YK5A 2L0ZA 6RXNA 1SMWA 3MPSA 2DSXA 2O5JD 2CR8A 2B5ID 2ERJA 1VZIA 2PYAA 7RXNA 2AYJA 5MF6A 2PSMC 1LKOA 3A44A 5GADc 4POFA 1SMUA 4AI0A 4V196 4JAGA 1S30A 1JYBA 2J9UB 2M4VA 4AHYA 2MS3A 4TVMA 1YUXA 5EIOC 1WJVA 1DVBA 2VL6A 5JVG1 1R0HA 1DX8A 1BQ9A 4POGA 5IY0A 4GS7D 2A6ED 4AR6A 5JVH1 4XGHA 4AHXA 1B2OA 5GAHc 1Z92B 3PWFA 3J7Y1 4E6YA 4JAEA 3NFPI 5MGNA 1RDVA 3J7Z1 4AR3A 1S2ZA 3PKJA 4ME3A 4TPUA 2RDVA 4ZN3B 1B71A 1CADA 1R0FA 1NXGA 5AN9H 1T9QA 4K9FA 3KYYA 4AR4A 2M6PA 4B8CD 3PIP1 4AR5A 2CKCA 2XJQA 2Z3QB 3RZTA 3QQCE 1ZRPA 1YK4A 1YV1A 1S24A 3KYUA 1C09A 2XJRA 3VPBE 3MSUA 5AI2A 1R0JA 1FHHA 1QYBA 3PIO1 4ZN1B 3KYVA 2V0FA 1LKPA 2XJSA 3KYWA 1T9PA 4AHZA 1RYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZ6 A;  1B2J A;  1H7V A;  1R0G A;  1IRN A;  1YUZ A;  1LTL A;  3KYX A;  2KKD A;  2K2D A;  1BFY A;  2V3B B;  3QVD A;  2GMG A;  1R0I A;  1IU6 A;  1B13 A;  5AI3 A;  1NNQ A;  1T9O A;  2HR5 A;  1QCV A;  1LKM A;  2M4Y A;  2QL0 A;  2PVE A;  4RXN A;  1VCX A;  2LCQ A;  1FHM A;  2PVX A;  1SMM A;  1RDG A;  1IRO A;  3SS2 A;  1E8J A;  1BQ8 A;  1RWD A;  1CAA A;  1BE7 A;  4YWL A;  1BRF A;  2KN9 A;  1IU5 A;  8RXN A;  1RB9 A;  3PZA A;  4YWM A;  3RYG A;  5RXN A;  1YK5 A;  6RXN A;  1SMW A;  3MPS A;  2DSX A;  2PYA A;  7RXN A;  1LKO A;  3A44 A;  4POF A;  1SMU A;  1S30 A;  1JYB A;  2MS3 A;  1YUX A;  2VL6 A;  1DVB A;  1R0H A;  1DX8 A;  1BQ9 A;  4POG A;  5IY0 A;  4AR6 A;  1B2O A;  3PWF A;  1RDV A;  4AR3 A;  1S2Z A;  4ME3 A;  4TPU A;  2RDV A;  1B71 A;  1CAD A;  1R0F A;  1T9Q A;  4K9F A;  3KYY A;  4AR4 A;  4AR5 A;  3RZT A;  1ZRP A;  1YK4 A;  1YV1 A;  1S24 A;  3KYU A;  1C09 A;  5AI2 A;  1R0J A;  1FHH A;  1QYB A;  3KYV A;  1LKP A;  3KYW A;  1T9P A;  1RYT A; 
#chains in the Genus database with same CATH topology
 2JI3 A;  1OWB A;  1B2J A;  2A69 D;  4G6B A;  2R93 L;  2C6A A;  2JI2 A;  1R0G A;  1IRN A;  1VZH A;  1LTL A;  4A3G L;  5MFZ A;  1RYQ A;  2JI1 A;  2XJU A;  3PL5 A;  1R0I A;  4LHL A;  3MQK B;  5AI3 A;  1PFU A;  1T9O A;  1QCV A;  1LKM A;  2BE5 D;  5DM6 1;  2PVE A;  2PMZ P;  1TWG L;  1PFW A;  1P7P A;  2ZIX A;  2APO B;  3B0A B;  3LWV B;  1IRO A;  3H9B A;  3H9C A;  3S1R L;  3K35 A;  1TWF L;  2JA5 L;  3PO2 L;  4YWL A;  4A93 L;  1BRF A;  2AQC A;  8RXN A;  1YK5 A;  2ERJ A;  2PYA A;  7RXN A;  1TWC L;  2AYJ A;  2HVY C;  4A3I L;  5IP9 L;  1JYB A;  2MS3 A;  1YUX A;  2VL6 A;  1DVB A;  4POG A;  4C2M 1;  4AHX A;  3PWF A;  3J7Y 1;  4E6Y A;  3NFP I;  1RDV A;  1NXG A;  1T9Q A;  4X6A L;  4B8C D;  3HJW B;  4AR5 A;  2XJQ A;  2Z3Q B;  3JR7 A;  4AYB P;  1YK4 A;  1C09 A;  2XJR A;  3K7A L;  5AI2 A;  1QYB A;  1Y1W L;  3I4N L;  3KYW A;  3S1N L;  5GAE c;  5C4X L;  4JAF A;  4WFN 1;  4LHN A;  3LPE B;  1K83 L;  1TWH L;  3LNL A;  5M3F L;  2KKD A;  1B13 A;  2QL0 A;  2M4Y A;  4AI3 A;  1SFO L;  1NXE A;  3S2H L;  5M5Y L;  3P8B A;  1SMM A;  2A6H D;  2RFK B;  3HOW L;  3S16 L;  5H1S c;  3SS2 A;  2XJV A;  4AI2 A;  2JA7 L;  2R7Z L;  1PZX A;  5IP7 L;  3GTJ L;  1BE7 A;  4A3J L;  4XXB B;  4AHW A;  3I4M L;  2KN9 A;  3ZG6 A;  4C3J L;  3B08 B;  5DM7 1;  3RYG A;  2NVX L;  4BY7 L;  2O5J D;  2VUM L;  1VZI A;  5FLM L;  3FDJ A;  1LKO A;  4AI0 A;  4V19 6;  4JAG A;  3HOX L;  2JA6 L;  4AHY A;  4TVM A;  3RZD L;  4Y52 L;  5IY0 A;  3HOV L;  4GS7 D;  3HJY B;  2A6E D;  3HKZ P;  3RZO L;  1B2O A;  1Z92 B;  3H0G L;  3S1M L;  3GTQ L;  1PFV A;  4ZN3 B;  1R0F A;  3LWQ B;  5AN9 H;  4BBS L;  2M6P A;  4A3M L;  2NVT L;  3RZT A;  3QQC E;  2EY4 E;  2WB1 P;  3PIO 1;  3M4O L;  3KYV A;  4AHZ A;  3RZ6 A;  4A3L L;  2C6B A;  3GTK L;  2A68 D;  4JAD A;  1YUZ A;  3KYX A;  4AI1 A;  5MFP A;  1R9T L;  3S14 L;  2K2D A;  2V3B B;  3QVD A;  4A3K L;  2HR5 A;  1OWC A;  3GTG L;  2Y0S P;  3PO3 L;  2LCQ A;  1FHM A;  2PVX A;  4A3D L;  1RDG A;  2CKA A;  2Z3R B;  4BXX L;  2E2J L;  1E8J A;  4BY1 L;  1BQ8 A;  1CAA A;  3CQZ L;  1WCM L;  4C3I L;  3P2A A;  1IU5 A;  2NVY L;  6RXN A;  1SMW A;  3MPS A;  2DSX A;  1QQT A;  3LWR B;  5MF6 A;  5GAD c;  3A44 A;  4A3B L;  1S30 A;  2J9U B;  2M4V A;  5EIO C;  2AUS B;  1WJV A;  5IYC L;  3HOY L;  1DX8 A;  3GTM L;  5JVH 1;  4A3C L;  3H3V M;  4XGH A;  5M5W L;  3H99 A;  5GAH c;  1I50 L;  4A3F L;  5MGN A;  3J7Z 1;  4AR3 A;  3H97 A;  1S2Z A;  3PKJ A;  4ME3 A;  2RDV A;  5C3E L;  3HOU L;  1B71 A;  1CAD A;  3KYY A;  1Y1V L;  3PIP 1;  3S1Q L;  1I3Q L;  5C4J L;  3HOZ L;  3MSU A;  1R0J A;  4ZN1 B;  2V0F A;  1LKP A;  2XJS A;  1RYT A;  3GTP L;  2V0E A;  1IW7 D;  1VZG A;  1H7V A;  2NYD A;  2PPT A;  3LWP B;  1F4L A;  5GAG c;  2M6O A;  2H12 A;  3LWO B;  2ERS A;  1BFY A;  3PKI A;  2GMG A;  3FKI L;  1IU6 A;  2B63 L;  1NNQ A;  3GTL L;  4Y7N L;  5EIN C;  2WAQ P;  2JA8 L;  3IU3 I;  4C3H L;  4RXN A;  1VCX A;  5K2M E;  2XJP A;  4UY8 1;  3WWN B;  2E2I L;  4U67 1;  1ODH A;  5IYB L;  3GTO L;  3S17 L;  5MLC 3;  3WWL A;  2XJT A;  1RWD A;  1TWA L;  4BBR L;  1RB9 A;  3PZA A;  4YWM A;  5RXN A;  2L0Z A;  3S15 L;  2CR8 A;  2B5I D;  2YU9 L;  2PSM C;  4POF A;  1SMU A;  2NVQ L;  2R92 L;  2E2H L;  5M3M L;  5JVG 1;  1R0H A;  3M3Y L;  1BQ9 A;  5IYD L;  4AR6 A;  4A3E L;  4JAE A;  3HAX C;  5FJ8 L;  4TPU A;  4K9F A;  4AR4 A;  2CKC A;  1ZRP A;  5C44 L;  1YV1 A;  1S24 A;  3KYU A;  3VPB E;  4QIW P;  5M5X L;  3S2D L;  1FHH A;  1PFY A;  1I6H L;  1T9P A; 
#chains in the Genus database with same CATH homology
 2JI3 A;  1OWB A;  2V0E A;  1B2J A;  1IW7 D;  1VZG A;  3RZ6 A;  2A69 D;  4G6B A;  1H7V A;  2NYD A;  5GAE c;  2C6A A;  4JAF A;  2JI2 A;  2C6B A;  2PPT A;  4WFN 1;  2A68 D;  4LHN A;  3LPE B;  1R0G A;  4JAD A;  5GAG c;  1IRN A;  1VZH A;  1YUZ A;  3LNL A;  1LTL A;  3KYX A;  4AI1 A;  5MFZ A;  5MFP A;  1RYQ A;  2JI1 A;  2M6O A;  2KKD A;  2XJU A;  2K2D A;  2H12 A;  2ERS A;  1BFY A;  2V3B B;  3PKI A;  2GMG A;  3QVD A;  1IU6 A;  4LHL A;  1B13 A;  1R0I A;  5AI3 A;  1NNQ A;  5EIN C;  1T9O A;  2HR5 A;  1QCV A;  1OWC A;  1LKM A;  2M4Y A;  2QL0 A;  4AI3 A;  1NXE A;  2BE5 D;  5DM6 1;  3IU3 I;  2PVE A;  4RXN A;  1VCX A;  3P8B A;  5K2M E;  2LCQ A;  2XJP A;  2ZIX A;  1FHM A;  2PVX A;  1SMM A;  2A6H D;  1RDG A;  2CKA A;  2Z3R B;  3WWN B;  4UY8 1;  4U67 1;  5H1S c;  3B0A B;  1ODH A;  1IRO A;  3SS2 A;  5MLC 3;  2XJV A;  1E8J A;  4AI2 A;  3K35 A;  1BQ8 A;  3WWL A;  2XJT A;  1RWD A;  1CAA A;  1BE7 A;  4XXB B;  4AHW A;  4YWL A;  1BRF A;  2KN9 A;  3ZG6 A;  3B08 B;  3P2A A;  1IU5 A;  8RXN A;  5DM7 1;  1RB9 A;  3PZA A;  4YWM A;  3RYG A;  5RXN A;  1YK5 A;  2L0Z A;  6RXN A;  1SMW A;  3MPS A;  2DSX A;  2O5J D;  2CR8 A;  2B5I D;  2ERJ A;  1VZI A;  2PYA A;  7RXN A;  2AYJ A;  5MF6 A;  2PSM C;  1LKO A;  3A44 A;  5GAD c;  4POF A;  1SMU A;  4AI0 A;  4V19 6;  4JAG A;  1S30 A;  1JYB A;  2J9U B;  2M4V A;  4AHY A;  2MS3 A;  4TVM A;  1YUX A;  5EIO C;  1WJV A;  1DVB A;  2VL6 A;  5JVG 1;  1R0H A;  1DX8 A;  1BQ9 A;  4POG A;  5IY0 A;  4GS7 D;  2A6E D;  4AR6 A;  5JVH 1;  4XGH A;  4AHX A;  1B2O A;  5GAH c;  1Z92 B;  3PWF A;  3J7Y 1;  4E6Y A;  4JAE A;  3NFP I;  5MGN A;  1RDV A;  3J7Z 1;  4AR3 A;  1S2Z A;  3PKJ A;  4ME3 A;  4TPU A;  2RDV A;  4ZN3 B;  1B71 A;  1CAD A;  1R0F A;  1NXG A;  5AN9 H;  1T9Q A;  4K9F A;  3KYY A;  4AR4 A;  2M6P A;  4B8C D;  3PIP 1;  4AR5 A;  2CKC A;  2XJQ A;  2Z3Q B;  3RZT A;  3QQC E;  1ZRP A;  1YK4 A;  1YV1 A;  1S24 A;  3KYU A;  1C09 A;  2XJR A;  3VPB E;  3MSU A;  5AI2 A;  1R0J A;  1FHH A;  1QYB A;  3PIO 1;  4ZN1 B;  3KYV A;  2V0F A;  1LKP A;  2XJS A;  3KYW A;  1T9P A;  4AHZ A;  1RYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...