3KYZA

The crystal structure of the sensor domain of two-component sensor pfes from pseudomonas aeruginosa pa01
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
112
structure length
112
Chain Sequence
YFLAPADRHYLADYARQAEDAWRREGAAGAERFRKELSAKEDTWVALVGPHLESLGSTPLSAEESSHLTFMRKLDWPMSRRLQDELPYVSIEFPGHPEQGRLVIQLPERLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sensor protein pfeS
publication title The crystal structure of the sensor domain of two-component sensor PfeS from Pseudomonas aeruginosa PA01
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
total genus 34
structure length 112
sequence length 112
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16750 HK_sensor Sensor domain of 2-component histidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.170 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3kyzA00
3KYZA
chains in the Genus database with same CATH superfamily
4OLDA 1FCNA 2C6WB 5DVAA 1PW8A 2ZL1B 5IT5A 3DWZA 2M7VA 3W4QA 2J7VA 3IF6A 1NRJA 4UQIM 3UDIA 3MF0A 1RP5A 1YLYA 3LR3A 3KO6A 5A93A 3QP1A 3ZFZA 3F1OA 3VE3A 1CI8A 3VV4A 4CPKA 4ZJ1A 3U4LP 4FSFA 3E4OA 5CTMA 1ZHHB 2OLUA 1OT9A 3TSGA 3MS6A 1EI5A 3LR5A 2ZQAA 4EWFA 1IOUA 4Q0JA 5F1FA 2R78A 3PBQA 4P85A 1ZKJA 3O3VA 4C75A 3G31A 2RCXA 1G5UA 4O7DA 3Q7VA 5IU1A 4R38A 2JKGA 2W3FA 2X01A 3P98A 1BZAA 4GCZA 3ZG0A 3PHYA 1A0KA 2P04A 2KDKA 4R0QA 1TDGA 1W8QA 3TRCA 3DBAA 3G32A 3VOZA 4JXGA 4C6YA 1S66L 5J7EA 4B93A 1ES4A 1ESIA 4WELA 3GV9A 4G3WA 5L2FA 4F94A 1SDEA 5A8BA 1G6AA 2CMNA 5TJJA 1KGGA 3LIDA 4DE0A 2V9AA 3IX4A 3KYQA 3LY3A 1CI9A 2V0WA 5HW3A 1W5DA 5L10A 3B3XA 2BASA 1ERMA 2HP6A 4Y17A 4YINA 4L9EA 4MEZA 2ZC7A 4S2IA 2ZOIA 3PYPA 2PR6A 1S1YA 1K55A 5HPFA 2XFTA 3HJIA 3TJZC 4JPMA 2W3GA 4G3VA 3N8LA 2IA2A 3OLOA 3K3DA 1GCEA 3MKFA 1JTGA 4E3JA 5U47A 1FSWA 1Y54A 1K38A 4H6JB 4WYYA 1NLZA 5DFYA 1T1CA 4OPRA 4S2NC 3P7NA 4PHTA 4WEKA 4RYEA 2H0TA 4GN2A 1C3BA 4GJ4A 4ZRRA 1IKGA 4E6WA 5HAPA 3A3FA 1N9BA 3EOIA 2ZC4B 3UMEA 4NKPA 5IHVA 4KZAA 2WKRA 4QU3A 2V1ZA 1P9RA 3EEAA 4K0WA 1NYYA 1OTIA 5GL9A 1KOUA 3SS4A 4OPQA 5EVEA 3D4FA 1XFNA 5K5BA 5GHXA 1N9NA 3ZVWA 3LICA 4II7A 3BJNA 3EQUA 3NJAA 3VP1A 3TG9A 4XXRA 4RQ9A 4LFUA 2EWVA 4BBVA 3SZTA 5HAQA 4XUZA 4DJ2A 1GSXA 5GLBA 4BL2A 3H9WA 1KVLA 3KX0X 3BYDA 4X1MA 2FH5A 3AGDA 1K25A 4DDYA 5FSRA 4KZ8A 4S2KA 2I72A 1J9MA 1H5XA 1XFQA 5G4YA 1EROA 3ZHHA 1K57C 2W27A 4B4ZA 4KZ9A 1BUEA 1XJ2A 2DMWA 2HV1A 3A3EA 3IH9A 5HWTA 5TBMB 4EERA 4F3LB 3LIBA 4UAAA 4KQDA 4YWZA 1F9IA 3D72A 4R6LA 4GB7A 3FC7A 4FUWA 1SZVA 1KGEA 2Y2HA 3GR2A 2EWWA 3JYIA 5FATA 5L07A 3ZG7B 2EX9A 2O9AA 5FL3A 3UN7A 1TS8A 2W3DA 3IQAA 4AFIA 2V20A 1V9ZA 2J80A 2Y59A 2Z2LB 1DJBA 1PRQA 2ZQCA 3EGXC 1XXMA 3GMWA 5F83A 1YMXA 3S7NA 5GHYA 2ZC6B 3QP5A 1K6SA 3D9YA 3NBLA 3PTEA 3IXBA 1FQGA 3IS2A 4BLMA 1YSPA 3NULA 4HI4A 5M1AA 3ICYA 4FH4A 5FI7A 2EX8A 4MN7A 3MZDA 5DKKA 3OBFA 2IWBA 4D2OA 2OOLA 2WGVA 4HIAA 4X25A 3H7WB 1PI4A 4EUVA 4WZ5C 4B88A 4IUHA 1MWUA 4Q8IA 4F3LA 4BBUA 4CLCB 2ZQ9A 3DTEA 4MLLA 4IHQA 4WMCA 5GLDA 4ZJ2A 5E2FA 2VKSA 4R3JA 3A0RA 1UGUA 1SKOB 5CHUA 4EBLA 4E3IA 3UPOA 4O8GA 4K08A 3S4XA 4WUJA 1PI5A 1H8MA 4ZJ3A 1T1BA 4YNRA 4P87A 2VA0A 2XF3A 5L09A 3MSHA 4DE1A 2Y2IA 3GSGA 1BLCA 4OP8A 5F1GA 3S22A 5KIZA 4M3KA 4MBFA 5D3OA 3ZCZA 2PYRA 1NWZA 1DRMA 1ACFA 1FR1A 5EVLA 3B42A 1W7FA 1LLBA 4Y3IA 3VSLA 4HHDA 1BTLA 1E25A 2MJ6A 3DTIA 2JCHA 3H82B 3W4PA 3IXDA 1ONHA 3DTMA 4X68A 4Y15A 4L9GA 1NY0A 1H8YA 2A3UA 2BLSA 4P6ZS 5HWVA 4R4SA 2WZXA 1JWVA 3MKEA 4LV3A 3WS1A 2D02A 2JKRI 2WKPA 4XUXA 3H7WA 2A24A 4R3AA 3HLCA 1CF0A 3SOIA 1YT4A 3T12B 2HGVA 4QY6A 1PWGA 5CXWA 3L7HA 3FV7A 5DF9A 1SHVA 2Z6CA 4OP5A 4BJPA 2PDRA 5HL1A 4UHUA 3Q7ZA 2D01A 4OVDA 3MQOA 3CUEC 4IJGA 4EV4A 1FSYA 3CLOA 2HDRA 5C5KA 3OC2A 1HTZA 2VEAA 4NXGA 2KOIA 3G4PA 3CPTB 4N1XA 1S1ZA 4E3NA 3T1XA 1OTDA 4D60A 3VFFA 1AXBA 2Y8HA 5CTNA 1JTDA 3IHAA 1E4DA 5FEFA 2Z2MB 2M7UA 3EQVA 4JXWA 4R3BA 2PAVP 1G68A 3FKVA 3UE0A 2Z6DA 2EX2A 1M40A 3H82A 2PRFA 2K2NA 4JGOA 2A49A 1IELA 4FH2A 1W63Q 4I5SA 1HZOA 1LL9A 4JLFA 4IEDA 1LT0A 1J3WA 2DRWA 2WKQA 5FA7A 3AGEA 1CK3A 2R9XA 1PYYA 3VP4A 1ERQA 4BMWA 4X6TA 1Z09A 4DE3A 2V1BA 3KYZA 1YLPA 5GHZA 4MBKA 1NYMA 5J8XA 4MNRA 5EVIB 2UWXA 4NXBA 1VQQA 2ZM0A 5HDCA 2X71A 3SH7A 1G28A 1K56A 4EW7A 3UDXA 1WYBA 2L0WA 2Y91A 3SH8A 3PAEA 3F1OB 2Y2KA 2G2WA 3IXHA 1K4FA 4FOFA 2Y55A 4PKYG 1X0OA 3R7WB 5KSCA 4QD4A 3CPTA 3PXPA 3RXWA 1JVJA 4KUOA 4YFMA 2R9WA 1KDWA 2P9VA 4R4RA 3UDFA 3FPWA 2WKHA 3ZVTA 3IWQA 4NEED 3C4OA 1DP8A 3OPRA 1QMFA 5FAOA 3VP2A 1D06A 3HLGA 4JF4A 3LI8A 3Q7VB 3M6HA 5HDDA 4DN0A 2WADA 1P9WA 2JC7A 2PR5A 2XLNA 3WRZA 3E4QA 3BQAA 2Y2LA 1PNEA 3V50A 2Y2NA 4Y0UA 1WA9A 5DFXA 5A90A 5AQ9A 1F98A 5EVIA 4LENA 1H8ZA 3V3RA 4R70A 2WGWA 1CJFA 2QHKA 2EXBA 2V8FA 3LR4A 1CQAA 3MMHA 4WLAA 3D3OA 2QMIA 1KGFA 3RFBA 3G34A 3A0SA 3LIEA 3R7WA 1KE0A 5FQQA 2Y2GA 2VV8A 4HBUA 4X56A 3BFFA 5HX9A 1N4OA 4S2NA 1NRFA 4HH2A 1K54A 4GKUA 1GA0A 4HY8A 3LIAA 1H3QA 4QHCA 3ZQ5A 1T1AA 4JGRA 4NXFA 5HPIA 3ZGAB 4I38A 4OOMA 2G7UA 2BG1A 2JKTI 3B33A 4HNBA 3NDGA 1GHMA 3G35A 1JWZA 3UB6A 4LGWA 4DXBA 3IWIA 4ETZA 1T19A 2V2FF 3VP0A 3GRJA 1F5MA 3UPNA 3P01A 1LSVA 2ZMAA 1W8YA 1BLSA 5J4EA 1LL8A 1YSQA 3HLBA 3HLWA 1FILA 3ZG9B 1L2SA 1I5QA 3F1NB 5EOOA 1TS7A 4UEYA 1TS6A 3HBRA 2GZAA 3DAVA 3UNWA 3F1PB 3SW1A 3LCEA 3MFXA 3VMAA 2W3HA 1HVBA 3S7OA 1K0KA 2OAQ1 2LB9A 1NZUA 3QP2A 4BBTA 2XD5A 4DXCA 4UA6A 4OQIA 3WS5A 5JYOA 4U0TA 5FQKA 4L0LA 2HDSA 2VZWA 3K3CA 2ZQ8A 2Y2OA 3TE8A 1LSWA 3IF6C 1CEGA 5DTSA 3W2ZA 2YKHA 2Y4AA 5FAQA 5EOEA 4MN6A 5CGXA 1YLJA 3N6IA 4E6XA 5EPHA 1SCWA 5GLCA 4GDNA 3S1YA 1MY8A 3MJQA 3F1NA 3HUOA 4EBPA 4Y5FA 3MFDA 3SS5A 1SDNA 5DF8A 4CLCE 3F1PA 2Y79A 2XA7S 3BEBA 4WEJA 2FZ0A 4WZ4A 3VOYA 2HJ9C 3PBRA 3BQ8A 3GDIA 3IS2B 4LLOB 4R1GA 1ES2A 4N9KA 3QNCA 4HH3A 2XROA 3LEQA 2L4RA 3WS0A 3C2WA 3IF5A 3UB9A 3IBRA 3LEZA 3LO7A 3T4QA 2XQZA 1VEUA 3G30A 4N1HA 5F5YA 2JBFA 5EECA 3ZNYA 4WN5A 4OOYA 1LL5A 3IXGA 3T4LA 3A3JA 1KDSA 3EGDC 2KLIA 4GS9A 1YKDA 2VK3A 2XDMA 4ZAMA 2ACGA 3NOPC 3OOVA 1XKZA 4KZ6A 1KE3A 2EFUA 4NXEA 1WE4A 3NIAA 4O0PA 1NXYA 1L0FA 5IS1A 3N8SA 1MWRA 3OCNA 4OQHA 4DF6A 2VGKA 3MZEA 5CERA 2A2LA 1LSXA 2HF6A 3ISGA 5FAPA 4PM8A 3BLMA 3ZG5A 3P09A 4NETA 3M2KA 1VM1A 4S2MA 2PBYA 2HP9A 2GDNA 1ES3A 4RX3A 1IEMA 3T50A 3BFGA 3A0VA 1L0EA 2A24B 2PHYA 4KQRA 3LFVA 4GD8A 3N8RA 4BD0A 2P7JA 1IKIA 3NHQA 1TVFA 2GX5A 2B5RA 4E3KA 2KX6A 4MN5A 2JKFA 2ZQ7A 3ZNTA 4ARZB 2WAFA 2WK0A 4E04A 5CX7A 4X69A 3O5YA 1L3LA 4L9FA 3V67A 5FDHA 3UB8A 3HUMA 4ZBEA 2OV5A 2FFYA 2NUTC 5DJTA 2J8YA 4KZ7A 3WRTA 2W3EA 1DJAA 2PU4A 4KQOA 2Y2JA 4X55A 1MC0A 5EM1A 4EXOA 1K4EA 5CEDA 4P6ZM 1IYQA 4S2PA 4MBHA 3M2JA 2I9VA 1XJ6A 2VGLM 3BECA 1XGIA 2DNSA 2HPBA 2G2UA 3NI9A 2WYXA 3CMZA 2VGLS 1PZOA 3HLEA 2PD7A 3I7JA 4QPRA 1EWZA 3LI9A 4DRTA 4EEUA 3MZFA 4N9LA 3SS3A 5HSQA 2QJ7A 5GLAA 1Z6FA 3MBZA 3MQQA 5L8MA 4LRXC 3IX3A 4ARZA 3EEHA 1S4SA 4KZ4A 4JXVA 2HDQA 3HL9A 1OTAA 1MZUA 4OOLA 2B02A 2GJ3A 2Y2MA 3LY4A 1DJCA 1OJGA 3FPVA 2V1AA 4B9OA 1K6RA 1FCOA 1UWNX 3NCKA 1GSWA 5MC7A 3V5MA 1P97A 2P9VB 4OKPA 2ZM2A 3VFHA 4OONA 1XJ4A 3PBSA 3BW6A 3W8KA 3BFDA 1YPRA 4JF5A 3HJKA 4GHIA 4CLCD 4PM6A 2ZMVA 3BLSA 2J3TD 3PAGA 5M19A 2XFSA 4HOIA 3C5AA 4YOFA 4BL3A 3C8CA 1I2WA 2XK1A 2V0UA 2ZD8A 4JBFA 4M4XA 2VX8A 2JKRM 3NOUC 3ZDJA 3IH8A 1YMSA 1YM1A 4OQGA 2WGWB 2QKPA 1N9LA 3BY9A 4KZBA 2K7SA 3IX8A 3DTKA 3OZHA 5DF7A 4E3LA 4GW9A 4WBGA 4DKIA 2EFXA 1N9OA 3ITAA 4Y0OA 4LV1A 1T18A 3O86A 4EU0A 5E43A 1TD5A 4WM9A 3KSFA 3ULFA 2IWDA 3A3DA 1MKIA 1GHIA 3G2YA 2AVXA 5AVEA 2Y2PA 4JF6A 2XEPA 3KSGA 4LV0A 4QJGA 1QMEA 4XT2B 4KQQA 4Y2FA 5EE8A 1E3UD 1O7EA 5AQ7A 4CLCC 5F6AA 5FDSA 2J3TC 1NLYA 4Z9QA 4KG2A 3MXQA 4HJ6A 4RVAA 2C5WB 2QZ6A 2WKEA 4CQHA 1MXOA 1MWSA 3UY6A 2ZJ9A 4E3OA 1U60A 2Q9MA 4H8RA 3FYZA 5DTTA 4FTXA 1NZOA 1PFLA 1TEMA 4HJ3A 2E8JA 3IT9A 3QNBA 2O9BA 4OQ0A 2M1CA 5CRFA 3HLFA 1ZG6A 4O01A 2PYPA 1RCJA 4K0XA 2WAEA 3NOTC 4IVIA 4PM7A 5FQMA 1ZC2A 2Y2QA 2W1TB 4EQ1A 1ALQA 4OPZA 1Y4OA 2E8IA 4EESA 2OSUA 1YLZA 4KZ5A 1YLWA 4DE2A 4ESPA 3T1QB 4PKYA 1SKFA 1OTBA 5AVFA 2BTFP 3HLDA 1VETB 2V8CA 4UQIS 1CEFA 3MXSA 4GDBA 4RX2A 4Z1WA 2PU2A 2WKIA 2O0YA 3K2NA 4XT2A 2OLVA 5KZHA 3HUNA 5TR7A 2H28A 4FCFA 5EVID 1ZG4A 3L9KA 2INWA 3OPHA 4PPRA 2H0YA 5CGWA 4X53A 2UV0E 3UPPA 4ZDXA 1PZPA 2WUQA 1BYWA 1LHYA 5G4ZA 3MR0A 3HREA 4Q0IA 3KSHA 3C4PA 3BFCA 3JPUA 4EEPA 3IHBA 1JNUA 1FOFA 3V39A 4PM5A 1K57A 3Q1FA 5HWWA 3PBTA 5CGSA 5I94A 2ZL1A 4HP4A 2W1TA 1HLUP 1PWCA 2P74A 2RL3A 5FI2A 2QPNA 5F82A 5HFOA 3BM6A 4IBXA 4BWIA 3SH9A 4BD1A 5FEGA 3T4SA 1KVMA 5E2HA 3CWFA 1VETA 3UB7A 3E2KA 1S0WA 3FZCA 1BLPA 4UA7A 4QY5A 4P6BA 4JGQA 2DCFA 1UWPX 1V9YA 2VV7A 1VEUB 5EUAA 2PBDP 3UMDA 3Q07A 4I39A 3RXXA 1S4RA 3T1RA 1PWDA 1IFQA 5HDSA 5EVIC 2JKTM 5BOHA 5EFWA 2JN7A 1FCMA 4HJ4A 1W79A 4GS9B 3VOLA 1GHPA 5FQIA 3N7WA 3C30A 3E0YA 5F69A 3ZG8B 3CJMA 1BSGA 3AGFA 1ONGA 3UE6A 2XSSA 4JGPA 1L0GA 4HEFA 1Y28A 2ZC3B 3R4KA 1K54C 2XA7M 5KSHA 2H5SA 2ZC5B 5DTKA 2X02A 5FASA 4WZ5A 3FWLA 4IVKA 1M6KA 4BENA 1OPXA 1VB6A 3LR0A 3TW8A 3NDEA 2QWSA 5HZHA 4GOGA 5CHJA 1XPBA 3O88A 1DY6A 4EETB 5FQ9A 3JVUA 1OMEA 2B18A 1PW1A 1H0MA 4HP9A 4WL9A 1XP4A 1P0ZA 3QP4A 2XRNA 3OPLA 3BRMA 4S2JA 3E2LA 3G6OA 4CJNA 3BFEA 3M6BA 2GNXA 3ZYTA 2HJEA 3T4TA 3LGOA 1BLHA 5DKLA 1ES5A 1VHMA 2QJ5A 5HD3A 4KUKA 1OT6A 3KSIA 4H6JA 1ZTUA 1MWTA 5EM0A 5J3WA 2FFFB 2WGIA 1STZA 3CAXA 3GVBA 3MQ0A 3V3SA 2OWHA 1XA1A 4S2OA 1K55C 1KE4A 4LRZE 1EW0A 3PBNA 2HDUA 3QHYA 3WS4A 2HP5A 1YAXA 4K91A 2XD1A 2XR0A 4KG6A 2VLGA 3GTCA 3C7VA 5M18A 5HL6A 3UE1A 4X1LA 2ZLYA 1PIOA 2H10A 3GECA 4G3KA 3CUEA 3O87A 4NG2A 3U2AA 2IWCA 1FR6A 2B95A 5I5LA 3UO9A 2ZMFA 4B4XA 5HAIA 4GD6A 2YKFA 2WZZA 1Q2QA 4HBTA 4Y13A 4OH0A 3LIFA 3HCYA 3LYXA 3PBOA 3T4OA 4KG5A 1IYOA 3B47A 2VJWA 3BY8A 1D7EA 4OPYA 3DWKA 3E98A 3PR6A 1YLTA 2L1MA 4LPZA 5TBMA 3RJUA 3S7QA 3EWKA 3Q82A 1IYPA 3N4IA 2W0NA 4NK3A 1MPLA 5TGFA 3MXRA 4Y7PA 3HVFA 1MKMA 2VV6A 4IBRA 4I3JA 1DP6A 1BT5A 3WWXA 1BULA 4JXSA 3G2ZA 3DW0A 2J9PA 5E2GA 1XX2A 5G18A 2ZM8A 2J3WA 3NECA 3UB5P 1F2KA 1GA9A 4KENB 2O9CA 2HZ5A 4GHIB 4MCWA 3CI6A 4WMCD 4S2LA 4WF0A 4GZBA 5TFQA 3VSKA 1OJ5A 3A3IA 2JE5A 1MBLA 1ODVA 5CECA 4PMAA 4MDZA 2W1RA 3UE3A 4E3MA 4PM9A 3CZDA 4QWOA 4ZTKA 4BQMA 1TS0A 4Q0HA 1G6OA 4N92A 4HQAA 4GLQA 4CLCA 2CC1A 5AQAA 5HD5A 5LBRA 4ME4A 3CHWP 1OTEA 1SKOA 4QB8A 4DJ3A 1XA7A 3C7UA 1DP9A 4R23A 3OPPA 3W4OA 4HESA 3WS2A 2Q9NA 3RTYA 1FIKA 1YQSA 1L0DA 2XGNA 3NC8A 5CEBA 1S6RA 2LB5A 3T1SA 1NJ4A 2K31A 2O99A 4LCLA 2QYBA 2NUPC 4DDSA 2VGJA 3T4JA 3GQZA 3VE4A 3E4PA 3C38A 3LUQA 2PD8A 1TDLA 3CG5A 3CITA 4FD8A 1O07A 4LRYC 4RA7A 1IYSA 3KYEA 3FG8A 4KZ3A 4GNUA 1TF1A 2ZQDA 2EXAA 2XH9A 3ITBA 1JWPA 5DJUA 1XJ3A 4ID4A 4I3AA 2P08A 1AWIA 3RH8B 1HD8A 4DMZA 2Q0OA 5AJGA 3IBJA 3OCLA 5FQJA 2J9OA 1RGYA 1E3UA 1S67L 3NY4A 3IWOA 1I2SA 3FKWA 3QP6A 5E2EA 3IF6B 3S7PA 4EQIA 4EUZA 5FI6A 4U3TA 2ZBBA 5AQBA 4LV2A 1LI9A 1W63M 4OLGA 4A5RA 4Y0TA 3QP8A 4PAUA 5KMWA 3JVVA 4IUKA 4C3QA 2OWJA 5CHMA 2PT7A 5A91A 3T4KA 1D1JA 2EX6A 5EV0A 3BWLA 4EBNA 2ZOHA 4UA9A 4JKTA 4P0MA 5F68A 1K56D 1LI0A 2JHEA 3TOIA 5HARA 1XGJA 5JYPA 3VP3A 2EA9A 1Q2PA 3Q81A 4LCMA 1ESUA 2OAP1 4I3IA 4ETXA 5A92A 4U0XA 4MMNA 1WYCA 1RGZA 1GSVA
chains in the Genus database with same CATH topology
3OC2A 5EFWA 2JN7A 4HJ4A 2VEAA 4GS9B 3VOLA 4NXGA 2KOIA 3C30A 3E0YA 5IT5A 1S1ZA 5F69A 2M7VA 1OTDA 2Y8HA 1NRJA 4UQIM 3T50A 3UE6A 3A0VA 2XSSA 4JGPA 3MF0A 2M7UA 3EQVA 3LR3A 2A24B 2PHYA 3KO6A 1Y28A 3F1OA 3R4KA 2Z6DA 3VE3A 3H82A 3LFVA 3VV4A 2K2NA 2XA7M 4JGOA 5KSHA 2P7JA 4FSFA 1W63Q 4I5SA 3E4OA 1ZHHB 3NHQA 1OT9A 2GX5A 1LT0A 3LR5A 2WKQA 2KX6A 1OPXA 1VB6A 4MN5A 1IOUA 4ARZB 4Q0JA 2R78A 3PBQA 3LR0A 3TW8A 4E04A 5CX7A 4BMWA 2QWSA 5HZHA 3O5YA 4L9FA 2V1BA 3KYZA 3V67A 3UB8A 5C5KA 4EETB 5IU1A 4R38A 2NUTC 3JVUA 2B18A 5DJTA 2W3FA 4NXBA 5HDCA 4EW7A 1G28A 2W3EA 4HP9A 4WL9A 4GCZA 4KQOA 3PHYA 2L0WA 2P04A 2KDKA 1P0ZA 3TRCA 2XRNA 3DBAA 1MC0A 3F1OB 4EXOA 4P6ZM 1S66L 4FOFA 4PKYG 3R7WB 1X0OA 5J7EA 4B93A 4WELA 4G3WA 3G6OA 2I9VA 3PXPA 1XJ6A 2GNXA 2HJEA 2VGLM 3ZYTA 3T4TA 4KUOA 5DKLA 1VHMA 2QJ5A 5HD3A 5A8BA 2CMNA 5TJJA 4KUKA 1OT6A 3LIDA 3KSIA 3FPWA 2V9AA 4H6JA 1ZTUA 2VGLS 3KYQA 5J3WA 4NEED 2PD7A 1STZA 3CAXA 4QPRA 1DP8A 2V0WA 3LI9A 3MQ0A 4EEUA 2OWHA 1D06A 4LRZE 1EW0A 2BASA 3LI8A 3PBNA 5HDDA 5HSQA 4L9EA 4DN0A 2QJ7A 1P9WA 1YAXA 2ZOIA 3PYPA 2PR5A 2PR6A 1S1YA 3MQQA 5L8MA 4LRXC 3E4QA 5HPFA 3BQAA 4ARZA 3EEHA 1S4SA 2VLGA 3HJIA 5HL6A 3TJZC 1OTAA 1MZUA 4OOLA 2B02A 2GJ3A 3GECA 2W3GA 1OJGA 3FPVA 4G3VA 4G3KA 3CUEA 1WA9A 2IA2A 2V1AA 4B9OA 5DFXA 3OLOA 3K3DA 1F98A 1UWNX 1GSWA 5MC7A 3U2AA 1P97A 5I5LA 4R70A 4H6JB 2QHKA 1NLZA 2ZMFA 5DFYA 1XJ4A 3LR4A 1T1CA 3MMHA 3PBSA 4WLAA 3BW6A 3D3OA 3P7NA 4PHTA 3RFBA 2YKFA 4WEKA 3A0SA 3LIEA 3R7WA 3HJKA 4GHIA 4GJ4A 4ZRRA 4CLCD 3LIFA 2VV8A 2ZMVA 2J3TD 3HCYA 3LYXA 3PBOA 3T4OA 3EOIA 4HOIA 3UMEA 3B47A 2VJWA 3BY8A 4NKPA 4HH2A 1D7EA 2WKRA 4YOFA 3EEAA 1P9RA 3E98A 3C8CA 3PR6A 1OTIA 1KOUA 4HY8A 3LIAA 2L1MA 4LPZA 5TBMA 3S7QA 1H3QA 3EWKA 3ZQ5A 1T1AA 1XFNA 2V0UA 5K5BA 4JGRA 1N9NA 4NXFA 4M4XA 5HPIA 2W0NA 3LICA 4II7A 2VX8A 2JKRM 3BJNA 3NOUC 4I38A 4OOMA 3EQUA 3NJAA 2G7UA 1MKMA 2VV6A 4RQ9A 2EWVA 4I3JA 4BBVA 1DP6A 4DJ2A 1GSXA 2JKTI 3B33A 4HNBA 2QKPA 1N9LA 3BY9A 3H9WA 2K7SA 3KX0X 3UB6A 2FH5A 4ETZA 2J3WA 4GW9A 1T19A 1N9OA 1F5MA 1T18A 1XFQA 3P01A 5G4YA 2O9CA 4GHIB 4MCWA 4EU0A 1LSVA 3CI6A 1TD5A 3KSFA 2W27A 3ULFA 5J4EA 1LL8A 1XJ2A 4WF0A 2DMWA 1YSQA 2HV1A 5HWTA 5AVEA 5TBMB 1OJ5A 4EERA 4F3LB 3LIBA 4YWZA 4KQDA 3F1NB 1F9IA 3D72A 4R6LA 1TS7A 4UEYA 1TS6A 3KSGA 3FC7A 1ODVA 2GZAA 4XT2B 3F1PB 2EWWA 4Y2FA 4MDZA 3SW1A 2W1RA 3MFXA 3UE3A 2O9AA 4CLCC 5FL3A 5F6AA 2J3TC 1NLYA 2W3HA 1TS0A 1TS8A 2W3DA 3S7OA 3MXQA 4Q0HA 2OAQ1 1G6OA 4HJ6A 2LB9A 4AFIA 1V9ZA 2J80A 4HQAA 4BBTA 4CQHA 4GLQA 4CLCA 3EGXC 5HD5A 5LBRA 4ME4A 4HJ3A 3S7NA 1OTEA 2O9BA 4DJ3A 2M1CA 4L0LA 1DP9A 2VZWA 4O01A 3K3CA 2PYPA 3TE8A 1LSWA 3IS2A 3NOTC 3RTYA 1YSPA 4HI4A 3ICYA 3W2ZA 2YKHA 2LB5A 4MN6A 2W1TB 2K31A 4MN7A 4EQ1A 2O99A 5DKKA 3OBFA 2QYBA 2NUPC 4EESA 3T4JA 2OOLA 3VE4A 3E4PA 3MJQA 4HIAA 4PKYA 1OTBA 4EUVA 3H7WB 5AVFA 3C38A 3LUQA 2PD8A 4IUHA 4UQIS 3CITA 4F3LA 4BBUA 3F1NA 4CLCB 4LRYC 4Z1WA 4Y5FA 3FG8A 4IHQA 1TF1A 2O0YA 3K2NA 4XT2A 3F1PA 2VKSA 4CLCE 2Y79A 3A0RA 1UGUA 5DJUA 1XJ3A 2XA7S 2H28A 4WEJA 2FZ0A 4O8GA 4I3AA 2HJ9C 2INWA 2P08A 4K08A 3RH8B 4WUJA 3PBRA 3BQ8A 3GDIA 4DMZA 1H8MA 3IS2B 1T1BA 4LLOB 5AJGA 3IBJA 4YNRA 4HH3A 3OCLA 2XROA 2L4RA 2VA0A 3C2WA 1S67L 3UB9A 1BYWA 3IBRA 5G4ZA 3MR0A 3S7PA 5KIZA 3T4QA 4Q0IA 3KSHA 2PYRA 2ZBBA 1NWZA 1DRMA 5F5YA 4EEPA 3B42A 1W63M 1JNUA 4Y3IA 4WN5A 4HHDA 2MJ6A 3H82B 3T4LA 5HWWA 3PBTA 3EGDC 4PAUA 2KLIA 4GS9A 1YKDA 3JVVA 4IUKA 4L9GA 2OWJA 4HP4A 2W1TA 2PT7A 3T4KA 4P6ZS 5HWVA 3BWLA 3NOPC 3OOVA 2ZOHA 4NXEA 4BWIA 4O0PA 3T4SA 5F68A 2D02A 2JKRI 2WKPA 5IS1A 3H7WA 2A24A 4R3AA 3CWFA 2JHEA 3UB7A 3OCNA 2HGVA 2EA9A 5DF9A 2Z6CA 2OAP1 4I3IA 4BJPA 4ETXA 2PDRA 4JGQA 1UWPX 1V9YA 2VV7A 2D01A 4MMNA 3MQOA 3UMDA 2A2LA 3CUEC 4IJGA 1LSXA 4I39A 1S4RA 2HF6A 1GSVA 3CLOA 1IFQA 5HDSA 2JKTM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYZ A; 
#chains in the Genus database with same CATH topology
 4OLD A;  1FCN A;  2C6W B;  5DVA A;  1PW8 A;  2ZL1 B;  5IT5 A;  3DWZ A;  2M7V A;  3W4Q A;  2J7V A;  3IF6 A;  1NRJ A;  4UQI M;  3UDI A;  3MF0 A;  1RP5 A;  1YLY A;  3LR3 A;  3KO6 A;  5A93 A;  3QP1 A;  3ZFZ A;  3F1O A;  3VE3 A;  1CI8 A;  3VV4 A;  4CPK A;  4ZJ1 A;  3U4L P;  4FSF A;  3E4O A;  5CTM A;  1ZHH B;  2OLU A;  1OT9 A;  3TSG A;  3MS6 A;  1EI5 A;  3LR5 A;  2ZQA A;  4EWF A;  1IOU A;  4Q0J A;  5F1F A;  2R78 A;  3PBQ A;  4P85 A;  1ZKJ A;  3O3V A;  4C75 A;  3G31 A;  2RCX A;  1G5U A;  4O7D A;  3Q7V A;  5IU1 A;  4R38 A;  2JKG A;  2W3F A;  2X01 A;  3P98 A;  1BZA A;  4GCZ A;  3ZG0 A;  3PHY A;  1A0K A;  2P04 A;  2KDK A;  4R0Q A;  1TDG A;  1W8Q A;  3TRC A;  3DBA A;  3G32 A;  3VOZ A;  4JXG A;  4C6Y A;  1S66 L;  5J7E A;  4B93 A;  1ES4 A;  1ESI A;  4WEL A;  3GV9 A;  4G3W A;  5L2F A;  4F94 A;  1SDE A;  5A8B A;  1G6A A;  2CMN A;  5TJJ A;  1KGG A;  3LID A;  4DE0 A;  2V9A A;  3IX4 A;  3KYQ A;  3LY3 A;  1CI9 A;  2V0W A;  5HW3 A;  1W5D A;  5L10 A;  3B3X A;  2BAS A;  1ERM A;  2HP6 A;  4Y17 A;  4YIN A;  4L9E A;  4MEZ A;  2ZC7 A;  4S2I A;  2ZOI A;  3PYP A;  2PR6 A;  1S1Y A;  1K55 A;  5HPF A;  2XFT A;  3HJI A;  3TJZ C;  4JPM A;  2W3G A;  4G3V A;  3N8L A;  2IA2 A;  3OLO A;  3K3D A;  1GCE A;  3MKF A;  1JTG A;  4E3J A;  5U47 A;  1FSW A;  1Y54 A;  1K38 A;  4H6J B;  4WYY A;  1NLZ A;  5DFY A;  1T1C A;  4OPR A;  4S2N C;  3P7N A;  4PHT A;  4WEK A;  4RYE A;  2H0T A;  4GN2 A;  1C3B A;  4GJ4 A;  4ZRR A;  1IKG A;  4E6W A;  5HAP A;  3A3F A;  1N9B A;  3EOI A;  2ZC4 B;  3UME A;  4NKP A;  5IHV A;  4KZA A;  2WKR A;  4QU3 A;  2V1Z A;  1P9R A;  3EEA A;  4K0W A;  1NYY A;  1OTI A;  5GL9 A;  1KOU A;  3SS4 A;  4OPQ A;  5EVE A;  3D4F A;  1XFN A;  5K5B A;  5GHX A;  1N9N A;  3ZVW A;  3LIC A;  4II7 A;  3BJN A;  3EQU A;  3NJA A;  3VP1 A;  3TG9 A;  4XXR A;  4RQ9 A;  4LFU A;  2EWV A;  4BBV A;  3SZT A;  5HAQ A;  4XUZ A;  4DJ2 A;  1GSX A;  5GLB A;  4BL2 A;  3H9W A;  1KVL A;  3KX0 X;  3BYD A;  4X1M A;  2FH5 A;  3AGD A;  1K25 A;  4DDY A;  5FSR A;  4KZ8 A;  4S2K A;  2I72 A;  1J9M A;  1H5X A;  1XFQ A;  5G4Y A;  1ERO A;  3ZHH A;  1K57 C;  2W27 A;  4B4Z A;  4KZ9 A;  1BUE A;  1XJ2 A;  2DMW A;  2HV1 A;  3A3E A;  3IH9 A;  5HWT A;  5TBM B;  4EER A;  4F3L B;  3LIB A;  4UAA A;  4KQD A;  4YWZ A;  1F9I A;  3D72 A;  4R6L A;  4GB7 A;  3FC7 A;  4FUW A;  1SZV A;  1KGE A;  2Y2H A;  3GR2 A;  2EWW A;  3JYI A;  5FAT A;  5L07 A;  3ZG7 B;  2EX9 A;  2O9A A;  5FL3 A;  3UN7 A;  1TS8 A;  2W3D A;  3IQA A;  4AFI A;  2V20 A;  1V9Z A;  2J80 A;  2Y59 A;  2Z2L B;  1DJB A;  1PRQ A;  2ZQC A;  3EGX C;  1XXM A;  3GMW A;  5F83 A;  1YMX A;  3S7N A;  5GHY A;  2ZC6 B;  3QP5 A;  1K6S A;  3D9Y A;  3NBL A;  3PTE A;  3IXB A;  1FQG A;  3IS2 A;  4BLM A;  1YSP A;  3NUL A;  4HI4 A;  5M1A A;  3ICY A;  4FH4 A;  5FI7 A;  2EX8 A;  4MN7 A;  3MZD A;  5DKK A;  3OBF A;  2IWB A;  4D2O A;  2OOL A;  2WGV A;  4HIA A;  4X25 A;  3H7W B;  1PI4 A;  4EUV A;  4WZ5 C;  4B88 A;  4IUH A;  1MWU A;  4Q8I A;  4F3L A;  4BBU A;  4CLC B;  2ZQ9 A;  3DTE A;  4MLL A;  4IHQ A;  4WMC A;  5GLD A;  4ZJ2 A;  5E2F A;  2VKS A;  4R3J A;  3A0R A;  1UGU A;  1SKO B;  5CHU A;  4EBL A;  4E3I A;  3UPO A;  4O8G A;  4K08 A;  3S4X A;  4WUJ A;  1PI5 A;  1H8M A;  4ZJ3 A;  1T1B A;  4YNR A;  4P87 A;  2VA0 A;  2XF3 A;  5L09 A;  3MSH A;  4DE1 A;  2Y2I A;  3GSG A;  1BLC A;  4OP8 A;  5F1G A;  3S22 A;  5KIZ A;  4M3K A;  4MBF A;  5D3O A;  3ZCZ A;  2PYR A;  1NWZ A;  1DRM A;  1ACF A;  1FR1 A;  5EVL A;  3B42 A;  1W7F A;  1LLB A;  4Y3I A;  3VSL A;  4HHD A;  1BTL A;  1E25 A;  2MJ6 A;  3DTI A;  2JCH A;  3H82 B;  3W4P A;  3IXD A;  1ONH A;  3DTM A;  4X68 A;  4Y15 A;  4L9G A;  1NY0 A;  1H8Y A;  2A3U A;  2BLS A;  4P6Z S;  5HWV A;  4R4S A;  2WZX A;  1JWV A;  3MKE A;  4LV3 A;  3WS1 A;  2D02 A;  2JKR I;  2WKP A;  4XUX A;  3H7W A;  2A24 A;  4R3A A;  3HLC A;  1CF0 A;  3SOI A;  1YT4 A;  3T12 B;  2HGV A;  4QY6 A;  1PWG A;  5CXW A;  3L7H A;  3FV7 A;  5DF9 A;  1SHV A;  2Z6C A;  4OP5 A;  4BJP A;  2PDR A;  5HL1 A;  4UHU A;  3Q7Z A;  2D01 A;  4OVD A;  3MQO A;  3CUE C;  4IJG A;  4EV4 A;  1FSY A;  3CLO A;  2HDR A;  5C5K A;  3OC2 A;  1HTZ A;  2VEA A;  4NXG A;  2KOI A;  3G4P A;  3CPT B;  4N1X A;  1S1Z A;  4E3N A;  3T1X A;  1OTD A;  4D60 A;  3VFF A;  1AXB A;  2Y8H A;  5CTN A;  1JTD A;  3IHA A;  1E4D A;  5FEF A;  2Z2M B;  2M7U A;  3EQV A;  4JXW A;  4R3B A;  2PAV P;  1G68 A;  3FKV A;  3UE0 A;  2Z6D A;  2EX2 A;  1M40 A;  3H82 A;  2PRF A;  2K2N A;  4JGO A;  2A49 A;  1IEL A;  4FH2 A;  1W63 Q;  4I5S A;  1HZO A;  1LL9 A;  4JLF A;  4IED A;  1LT0 A;  1J3W A;  2DRW A;  2WKQ A;  5FA7 A;  3AGE A;  1CK3 A;  2R9X A;  1PYY A;  3VP4 A;  1ERQ A;  4BMW A;  4X6T A;  1Z09 A;  4DE3 A;  2V1B A;  3KYZ A;  1YLP A;  5GHZ A;  4MBK A;  1NYM A;  5J8X A;  4MNR A;  5EVI B;  2UWX A;  4NXB A;  1VQQ A;  2ZM0 A;  5HDC A;  2X71 A;  3SH7 A;  1G28 A;  1K56 A;  4EW7 A;  3UDX A;  1WYB A;  2L0W A;  2Y91 A;  3SH8 A;  3PAE A;  3F1O B;  2Y2K A;  2G2W A;  3IXH A;  1K4F A;  4FOF A;  2Y55 A;  4PKY G;  1X0O A;  3R7W B;  5KSC A;  4QD4 A;  3CPT A;  3PXP A;  3RXW A;  1JVJ A;  4KUO A;  4YFM A;  2R9W A;  1KDW A;  2P9V A;  4R4R A;  3UDF A;  3FPW A;  2WKH A;  3ZVT A;  3IWQ A;  4NEE D;  3C4O A;  1DP8 A;  3OPR A;  1QMF A;  5FAO A;  3VP2 A;  1D06 A;  3HLG A;  4JF4 A;  3LI8 A;  3Q7V B;  3M6H A;  5HDD A;  4DN0 A;  2WAD A;  1P9W A;  2JC7 A;  2PR5 A;  2XLN A;  3WRZ A;  3E4Q A;  3BQA A;  2Y2L A;  1PNE A;  3V50 A;  2Y2N A;  4Y0U A;  1WA9 A;  5DFX A;  5A90 A;  5AQ9 A;  1F98 A;  5EVI A;  4LEN A;  1H8Z A;  3V3R A;  4R70 A;  2WGW A;  1CJF A;  2QHK A;  2EXB A;  2V8F A;  3LR4 A;  1CQA A;  3MMH A;  4WLA A;  3D3O A;  2QMI A;  1KGF A;  3RFB A;  3G34 A;  3A0S A;  3LIE A;  3R7W A;  1KE0 A;  5FQQ A;  2Y2G A;  2VV8 A;  4HBU A;  4X56 A;  3BFF A;  5HX9 A;  1N4O A;  4S2N A;  1NRF A;  4HH2 A;  1K54 A;  4GKU A;  1GA0 A;  4HY8 A;  3LIA A;  1H3Q A;  4QHC A;  3ZQ5 A;  1T1A A;  4JGR A;  4NXF A;  5HPI A;  3ZGA B;  4I38 A;  4OOM A;  2G7U A;  2BG1 A;  2JKT I;  3B33 A;  4HNB A;  3NDG A;  1GHM A;  3G35 A;  1JWZ A;  3UB6 A;  4LGW A;  4DXB A;  3IWI A;  4ETZ A;  1T19 A;  2V2F F;  3VP0 A;  3GRJ A;  1F5M A;  3UPN A;  3P01 A;  1LSV A;  2ZMA A;  1W8Y A;  1BLS A;  5J4E A;  1LL8 A;  1YSQ A;  3HLB A;  3HLW A;  1FIL A;  3ZG9 B;  1L2S A;  1I5Q A;  3F1N B;  5EOO A;  1TS7 A;  4UEY A;  1TS6 A;  3HBR A;  2GZA A;  3DAV A;  3UNW A;  3F1P B;  3SW1 A;  3LCE A;  3MFX A;  3VMA A;  2W3H A;  1HVB A;  3S7O A;  1K0K A;  2OAQ 1;  2LB9 A;  1NZU A;  3QP2 A;  4BBT A;  2XD5 A;  4DXC A;  4UA6 A;  4OQI A;  3WS5 A;  5JYO A;  4U0T A;  5FQK A;  4L0L A;  2HDS A;  2VZW A;  3K3C A;  2ZQ8 A;  2Y2O A;  3TE8 A;  1LSW A;  3IF6 C;  1CEG A;  5DTS A;  3W2Z A;  2YKH A;  2Y4A A;  5FAQ A;  5EOE A;  4MN6 A;  5CGX A;  1YLJ A;  3N6I A;  4E6X A;  5EPH A;  1SCW A;  5GLC A;  4GDN A;  3S1Y A;  1MY8 A;  3MJQ A;  3F1N A;  3HUO A;  4EBP A;  4Y5F A;  3MFD A;  3SS5 A;  1SDN A;  5DF8 A;  4CLC E;  3F1P A;  2Y79 A;  2XA7 S;  3BEB A;  4WEJ A;  2FZ0 A;  4WZ4 A;  3VOY A;  2HJ9 C;  3PBR A;  3BQ8 A;  3GDI A;  3IS2 B;  4LLO B;  4R1G A;  1ES2 A;  4N9K A;  3QNC A;  4HH3 A;  2XRO A;  3LEQ A;  2L4R A;  3WS0 A;  3C2W A;  3IF5 A;  3UB9 A;  3IBR A;  3LEZ A;  3LO7 A;  3T4Q A;  2XQZ A;  1VEU A;  3G30 A;  4N1H A;  5F5Y A;  2JBF A;  5EEC A;  3ZNY A;  4WN5 A;  4OOY A;  1LL5 A;  3IXG A;  3T4L A;  3A3J A;  1KDS A;  3EGD C;  2KLI A;  4GS9 A;  1YKD A;  2VK3 A;  2XDM A;  4ZAM A;  2ACG A;  3NOP C;  3OOV A;  1XKZ A;  4KZ6 A;  1KE3 A;  2EFU A;  4NXE A;  1WE4 A;  3NIA A;  4O0P A;  1NXY A;  1L0F A;  5IS1 A;  3N8S A;  1MWR A;  3OCN A;  4OQH A;  4DF6 A;  2VGK A;  3MZE A;  5CER A;  2A2L A;  1LSX A;  2HF6 A;  3ISG A;  5FAP A;  4PM8 A;  3BLM A;  3ZG5 A;  3P09 A;  4NET A;  3M2K A;  1VM1 A;  4S2M A;  2PBY A;  2HP9 A;  2GDN A;  1ES3 A;  4RX3 A;  1IEM A;  3T50 A;  3BFG A;  3A0V A;  1L0E A;  2A24 B;  2PHY A;  4KQR A;  3LFV A;  4GD8 A;  3N8R A;  4BD0 A;  2P7J A;  1IKI A;  3NHQ A;  1TVF A;  2GX5 A;  2B5R A;  4E3K A;  2KX6 A;  4MN5 A;  2JKF A;  2ZQ7 A;  3ZNT A;  4ARZ B;  2WAF A;  2WK0 A;  4E04 A;  5CX7 A;  4X69 A;  3O5Y A;  1L3L A;  4L9F A;  3V67 A;  5FDH A;  3UB8 A;  3HUM A;  4ZBE A;  2OV5 A;  2FFY A;  2NUT C;  5DJT A;  2J8Y A;  4KZ7 A;  3WRT A;  2W3E A;  1DJA A;  2PU4 A;  4KQO A;  2Y2J A;  4X55 A;  1MC0 A;  5EM1 A;  4EXO A;  1K4E A;  5CED A;  4P6Z M;  1IYQ A;  4S2P A;  4MBH A;  3M2J A;  2I9V A;  1XJ6 A;  2VGL M;  3BEC A;  1XGI A;  2DNS A;  2HPB A;  2G2U A;  3NI9 A;  2WYX A;  3CMZ A;  2VGL S;  1PZO A;  3HLE A;  2PD7 A;  3I7J A;  4QPR A;  1EWZ A;  3LI9 A;  4DRT A;  4EEU A;  3MZF A;  4N9L A;  3SS3 A;  5HSQ A;  2QJ7 A;  5GLA A;  1Z6F A;  3MBZ A;  3MQQ A;  5L8M A;  4LRX C;  3IX3 A;  4ARZ A;  3EEH A;  1S4S A;  4KZ4 A;  4JXV A;  2HDQ A;  3HL9 A;  1OTA A;  1MZU A;  4OOL A;  2B02 A;  2GJ3 A;  2Y2M A;  3LY4 A;  1DJC A;  1OJG A;  3FPV A;  2V1A A;  4B9O A;  1K6R A;  1FCO A;  1UWN X;  3NCK A;  1GSW A;  5MC7 A;  3V5M A;  1P97 A;  2P9V B;  4OKP A;  2ZM2 A;  3VFH A;  4OON A;  1XJ4 A;  3PBS A;  3BW6 A;  3W8K A;  3BFD A;  1YPR A;  4JF5 A;  3HJK A;  4GHI A;  4CLC D;  4PM6 A;  2ZMV A;  3BLS A;  2J3T D;  3PAG A;  5M19 A;  2XFS A;  4HOI A;  3C5A A;  4YOF A;  4BL3 A;  3C8C A;  1I2W A;  2XK1 A;  2V0U A;  2ZD8 A;  4JBF A;  4M4X A;  2VX8 A;  2JKR M;  3NOU C;  3ZDJ A;  3IH8 A;  1YMS A;  1YM1 A;  4OQG A;  2WGW B;  2QKP A;  1N9L A;  3BY9 A;  4KZB A;  2K7S A;  3IX8 A;  3DTK A;  3OZH A;  5DF7 A;  4E3L A;  4GW9 A;  4WBG A;  4DKI A;  2EFX A;  1N9O A;  3ITA A;  4Y0O A;  4LV1 A;  1T18 A;  3O86 A;  4EU0 A;  5E43 A;  1TD5 A;  4WM9 A;  3KSF A;  3ULF A;  2IWD A;  3A3D A;  1MKI A;  1GHI A;  3G2Y A;  2AVX A;  5AVE A;  2Y2P A;  4JF6 A;  2XEP A;  3KSG A;  4LV0 A;  4QJG A;  1QME A;  4XT2 B;  4KQQ A;  4Y2F A;  5EE8 A;  1E3U D;  1O7E A;  5AQ7 A;  4CLC C;  5F6A A;  5FDS A;  2J3T C;  1NLY A;  4Z9Q A;  4KG2 A;  3MXQ A;  4HJ6 A;  4RVA A;  2C5W B;  2QZ6 A;  2WKE A;  4CQH A;  1MXO A;  1MWS A;  3UY6 A;  2ZJ9 A;  4E3O A;  1U60 A;  2Q9M A;  4H8R A;  3FYZ A;  5DTT A;  4FTX A;  1NZO A;  1PFL A;  1TEM A;  4HJ3 A;  2E8J A;  3IT9 A;  3QNB A;  2O9B A;  4OQ0 A;  2M1C A;  5CRF A;  3HLF A;  1ZG6 A;  4O01 A;  2PYP A;  1RCJ A;  4K0X A;  2WAE A;  3NOT C;  4IVI A;  4PM7 A;  5FQM A;  1ZC2 A;  2Y2Q A;  2W1T B;  4EQ1 A;  1ALQ A;  4OPZ A;  1Y4O A;  2E8I A;  4EES A;  2OSU A;  1YLZ A;  4KZ5 A;  1YLW A;  4DE2 A;  4ESP A;  3T1Q B;  4PKY A;  1SKF A;  1OTB A;  5AVF A;  2BTF P;  3HLD A;  1VET B;  2V8C A;  4UQI S;  1CEF A;  3MXS A;  4GDB A;  4RX2 A;  4Z1W A;  2PU2 A;  2WKI A;  2O0Y A;  3K2N A;  4XT2 A;  2OLV A;  5KZH A;  3HUN A;  5TR7 A;  2H28 A;  4FCF A;  5EVI D;  1ZG4 A;  3L9K A;  2INW A;  3OPH A;  4PPR A;  2H0Y A;  5CGW A;  4X53 A;  2UV0 E;  3UPP A;  4ZDX A;  1PZP A;  2WUQ A;  1BYW A;  1LHY A;  5G4Z A;  3MR0 A;  3HRE A;  4Q0I A;  3KSH A;  3C4P A;  3BFC A;  3JPU A;  4EEP A;  3IHB A;  1JNU A;  1FOF A;  3V39 A;  4PM5 A;  1K57 A;  3Q1F A;  5HWW A;  3PBT A;  5CGS A;  5I94 A;  2ZL1 A;  4HP4 A;  2W1T A;  1HLU P;  1PWC A;  2P74 A;  2RL3 A;  5FI2 A;  2QPN A;  5F82 A;  5HFO A;  3BM6 A;  4IBX A;  4BWI A;  3SH9 A;  4BD1 A;  5FEG A;  3T4S A;  1KVM A;  5E2H A;  3CWF A;  1VET A;  3UB7 A;  3E2K A;  1S0W A;  3FZC A;  1BLP A;  4UA7 A;  4QY5 A;  4P6B A;  4JGQ A;  2DCF A;  1UWP X;  1V9Y A;  2VV7 A;  1VEU B;  5EUA A;  2PBD P;  3UMD A;  3Q07 A;  4I39 A;  3RXX A;  1S4R A;  3T1R A;  1PWD A;  1IFQ A;  5HDS A;  5EVI C;  2JKT M;  5BOH A;  5EFW A;  2JN7 A;  1FCM A;  4HJ4 A;  1W79 A;  4GS9 B;  3VOL A;  1GHP A;  5FQI A;  3N7W A;  3C30 A;  3E0Y A;  5F69 A;  3ZG8 B;  3CJM A;  1BSG A;  3AGF A;  1ONG A;  3UE6 A;  2XSS A;  4JGP A;  1L0G A;  4HEF A;  1Y28 A;  2ZC3 B;  3R4K A;  1K54 C;  2XA7 M;  5KSH A;  2H5S A;  2ZC5 B;  5DTK A;  2X02 A;  5FAS A;  4WZ5 A;  3FWL A;  4IVK A;  1M6K A;  4BEN A;  1OPX A;  1VB6 A;  3LR0 A;  3TW8 A;  3NDE A;  2QWS A;  5HZH A;  4GOG A;  5CHJ A;  1XPB A;  3O88 A;  1DY6 A;  4EET B;  5FQ9 A;  3JVU A;  1OME A;  2B18 A;  1PW1 A;  1H0M A;  4HP9 A;  4WL9 A;  1XP4 A;  1P0Z A;  3QP4 A;  2XRN A;  3OPL A;  3BRM A;  4S2J A;  3E2L A;  3G6O A;  4CJN A;  3BFE A;  3M6B A;  2GNX A;  3ZYT A;  2HJE A;  3T4T A;  3LGO A;  1BLH A;  5DKL A;  1ES5 A;  1VHM A;  2QJ5 A;  5HD3 A;  4KUK A;  1OT6 A;  3KSI A;  4H6J A;  1ZTU A;  1MWT A;  5EM0 A;  5J3W A;  2FFF B;  2WGI A;  1STZ A;  3CAX A;  3GVB A;  3MQ0 A;  3V3S A;  2OWH A;  1XA1 A;  4S2O A;  1K55 C;  1KE4 A;  4LRZ E;  1EW0 A;  3PBN A;  2HDU A;  3QHY A;  3WS4 A;  2HP5 A;  1YAX A;  4K91 A;  2XD1 A;  2XR0 A;  4KG6 A;  2VLG A;  3GTC A;  3C7V A;  5M18 A;  5HL6 A;  3UE1 A;  4X1L A;  2ZLY A;  1PIO A;  2H10 A;  3GEC A;  4G3K A;  3CUE A;  3O87 A;  4NG2 A;  3U2A A;  2IWC A;  1FR6 A;  2B95 A;  5I5L A;  3UO9 A;  2ZMF A;  4B4X A;  5HAI A;  4GD6 A;  2YKF A;  2WZZ A;  1Q2Q A;  4HBT A;  4Y13 A;  4OH0 A;  3LIF A;  3HCY A;  3LYX A;  3PBO A;  3T4O A;  4KG5 A;  1IYO A;  3B47 A;  2VJW A;  3BY8 A;  1D7E A;  4OPY A;  3DWK A;  3E98 A;  3PR6 A;  1YLT A;  2L1M A;  4LPZ A;  5TBM A;  3RJU A;  3S7Q A;  3EWK A;  3Q82 A;  1IYP A;  3N4I A;  2W0N A;  4NK3 A;  1MPL A;  5TGF A;  3MXR A;  4Y7P A;  3HVF A;  1MKM A;  2VV6 A;  4IBR A;  4I3J A;  1DP6 A;  1BT5 A;  3WWX A;  1BUL A;  4JXS A;  3G2Z A;  3DW0 A;  2J9P A;  5E2G A;  1XX2 A;  5G18 A;  2ZM8 A;  2J3W A;  3NEC A;  3UB5 P;  1F2K A;  1GA9 A;  4KEN B;  2O9C A;  2HZ5 A;  4GHI B;  4MCW A;  3CI6 A;  4WMC D;  4S2L A;  4WF0 A;  4GZB A;  5TFQ A;  3VSK A;  1OJ5 A;  3A3I A;  2JE5 A;  1MBL A;  1ODV A;  5CEC A;  4PMA A;  4MDZ A;  2W1R A;  3UE3 A;  4E3M A;  4PM9 A;  3CZD A;  4QWO A;  4ZTK A;  4BQM A;  1TS0 A;  4Q0H A;  1G6O A;  4N92 A;  4HQA A;  4GLQ A;  4CLC A;  2CC1 A;  5AQA A;  5HD5 A;  5LBR A;  4ME4 A;  3CHW P;  1OTE A;  1SKO A;  4QB8 A;  4DJ3 A;  1XA7 A;  3C7U A;  1DP9 A;  4R23 A;  3OPP A;  3W4O A;  4HES A;  3WS2 A;  2Q9N A;  3RTY A;  1FIK A;  1YQS A;  1L0D A;  2XGN A;  3NC8 A;  5CEB A;  1S6R A;  2LB5 A;  3T1S A;  1NJ4 A;  2K31 A;  2O99 A;  4LCL A;  2QYB A;  2NUP C;  4DDS A;  2VGJ A;  3T4J A;  3GQZ A;  3VE4 A;  3E4P A;  3C38 A;  3LUQ A;  2PD8 A;  1TDL A;  3CG5 A;  3CIT A;  4FD8 A;  1O07 A;  4LRY C;  4RA7 A;  1IYS A;  3KYE A;  3FG8 A;  4KZ3 A;  4GNU A;  1TF1 A;  2ZQD A;  2EXA A;  2XH9 A;  3ITB A;  1JWP A;  5DJU A;  1XJ3 A;  4ID4 A;  4I3A A;  2P08 A;  1AWI A;  3RH8 B;  1HD8 A;  4DMZ A;  2Q0O A;  5AJG A;  3IBJ A;  3OCL A;  5FQJ A;  2J9O A;  1RGY A;  1E3U A;  1S67 L;  3NY4 A;  3IWO A;  1I2S A;  3FKW A;  3QP6 A;  5E2E A;  3IF6 B;  3S7P A;  4EQI A;  4EUZ A;  5FI6 A;  4U3T A;  2ZBB A;  5AQB A;  4LV2 A;  1LI9 A;  1W63 M;  4OLG A;  4A5R A;  4Y0T A;  3QP8 A;  4PAU A;  5KMW A;  3JVV A;  4IUK A;  4C3Q A;  2OWJ A;  5CHM A;  2PT7 A;  5A91 A;  3T4K A;  1D1J A;  2EX6 A;  5EV0 A;  3BWL A;  4EBN A;  2ZOH A;  4UA9 A;  4JKT A;  4P0M A;  5F68 A;  1K56 D;  1LI0 A;  2JHE A;  3TOI A;  5HAR A;  1XGJ A;  5JYP A;  3VP3 A;  2EA9 A;  1Q2P A;  3Q81 A;  4LCM A;  1ESU A;  2OAP 1;  4I3I A;  4ETX A;  5A92 A;  4U0X A;  4MMN A;  1WYC A;  1RGZ A;  1GSV A; 
#chains in the Genus database with same CATH homology
 3OC2 A;  5EFW A;  2JN7 A;  4HJ4 A;  2VEA A;  4GS9 B;  3VOL A;  4NXG A;  2KOI A;  3C30 A;  3E0Y A;  5IT5 A;  1S1Z A;  5F69 A;  2M7V A;  1OTD A;  2Y8H A;  1NRJ A;  4UQI M;  3T50 A;  3UE6 A;  3A0V A;  2XSS A;  4JGP A;  3MF0 A;  2M7U A;  3EQV A;  3LR3 A;  2A24 B;  2PHY A;  3KO6 A;  1Y28 A;  3F1O A;  3R4K A;  2Z6D A;  3VE3 A;  3H82 A;  3LFV A;  3VV4 A;  2K2N A;  2XA7 M;  4JGO A;  5KSH A;  2P7J A;  4FSF A;  1W63 Q;  4I5S A;  3E4O A;  1ZHH B;  3NHQ A;  1OT9 A;  2GX5 A;  1LT0 A;  3LR5 A;  2WKQ A;  2KX6 A;  1OPX A;  1VB6 A;  4MN5 A;  1IOU A;  4ARZ B;  4Q0J A;  2R78 A;  3PBQ A;  3LR0 A;  3TW8 A;  4E04 A;  5CX7 A;  4BMW A;  2QWS A;  5HZH A;  3O5Y A;  4L9F A;  2V1B A;  3KYZ A;  3V67 A;  3UB8 A;  5C5K A;  4EET B;  5IU1 A;  4R38 A;  2NUT C;  3JVU A;  2B18 A;  5DJT A;  2W3F A;  4NXB A;  5HDC A;  4EW7 A;  1G28 A;  2W3E A;  4HP9 A;  4WL9 A;  4GCZ A;  4KQO A;  3PHY A;  2L0W A;  2P04 A;  2KDK A;  1P0Z A;  3TRC A;  2XRN A;  3DBA A;  1MC0 A;  3F1O B;  4EXO A;  4P6Z M;  1S66 L;  4FOF A;  4PKY G;  3R7W B;  1X0O A;  5J7E A;  4B93 A;  4WEL A;  4G3W A;  3G6O A;  2I9V A;  3PXP A;  1XJ6 A;  2GNX A;  2HJE A;  2VGL M;  3ZYT A;  3T4T A;  4KUO A;  5DKL A;  1VHM A;  2QJ5 A;  5HD3 A;  5A8B A;  2CMN A;  5TJJ A;  4KUK A;  1OT6 A;  3LID A;  3KSI A;  3FPW A;  2V9A A;  4H6J A;  1ZTU A;  2VGL S;  3KYQ A;  5J3W A;  4NEE D;  2PD7 A;  1STZ A;  3CAX A;  4QPR A;  1DP8 A;  2V0W A;  3LI9 A;  3MQ0 A;  4EEU A;  2OWH A;  1D06 A;  4LRZ E;  1EW0 A;  2BAS A;  3LI8 A;  3PBN A;  5HDD A;  5HSQ A;  4L9E A;  4DN0 A;  2QJ7 A;  1P9W A;  1YAX A;  2ZOI A;  3PYP A;  2PR5 A;  2PR6 A;  1S1Y A;  3MQQ A;  5L8M A;  4LRX C;  3E4Q A;  5HPF A;  3BQA A;  4ARZ A;  3EEH A;  1S4S A;  2VLG A;  3HJI A;  5HL6 A;  3TJZ C;  1OTA A;  1MZU A;  4OOL A;  2B02 A;  2GJ3 A;  3GEC A;  2W3G A;  1OJG A;  3FPV A;  4G3V A;  4G3K A;  3CUE A;  1WA9 A;  2IA2 A;  2V1A A;  4B9O A;  5DFX A;  3OLO A;  3K3D A;  1F98 A;  1UWN X;  1GSW A;  5MC7 A;  3U2A A;  1P97 A;  5I5L A;  4R70 A;  4H6J B;  2QHK A;  1NLZ A;  2ZMF A;  5DFY A;  1XJ4 A;  3LR4 A;  1T1C A;  3MMH A;  3PBS A;  4WLA A;  3BW6 A;  3D3O A;  3P7N A;  4PHT A;  3RFB A;  2YKF A;  4WEK A;  3A0S A;  3LIE A;  3R7W A;  3HJK A;  4GHI A;  4GJ4 A;  4ZRR A;  4CLC D;  3LIF A;  2VV8 A;  2ZMV A;  2J3T D;  3HCY A;  3LYX A;  3PBO A;  3T4O A;  3EOI A;  4HOI A;  3UME A;  3B47 A;  2VJW A;  3BY8 A;  4NKP A;  4HH2 A;  1D7E A;  2WKR A;  4YOF A;  3EEA A;  1P9R A;  3E98 A;  3C8C A;  3PR6 A;  1OTI A;  1KOU A;  4HY8 A;  3LIA A;  2L1M A;  4LPZ A;  5TBM A;  3S7Q A;  1H3Q A;  3EWK A;  3ZQ5 A;  1T1A A;  1XFN A;  2V0U A;  5K5B A;  4JGR A;  1N9N A;  4NXF A;  4M4X A;  5HPI A;  2W0N A;  3LIC A;  4II7 A;  2VX8 A;  2JKR M;  3BJN A;  3NOU C;  4I38 A;  4OOM A;  3EQU A;  3NJA A;  2G7U A;  1MKM A;  2VV6 A;  4RQ9 A;  2EWV A;  4I3J A;  4BBV A;  1DP6 A;  4DJ2 A;  1GSX A;  2JKT I;  3B33 A;  4HNB A;  2QKP A;  1N9L A;  3BY9 A;  3H9W A;  2K7S A;  3KX0 X;  3UB6 A;  2FH5 A;  4ETZ A;  2J3W A;  4GW9 A;  1T19 A;  1N9O A;  1F5M A;  1T18 A;  1XFQ A;  3P01 A;  5G4Y A;  2O9C A;  4GHI B;  4MCW A;  4EU0 A;  1LSV A;  3CI6 A;  1TD5 A;  3KSF A;  2W27 A;  3ULF A;  5J4E A;  1LL8 A;  1XJ2 A;  4WF0 A;  2DMW A;  1YSQ A;  2HV1 A;  5HWT A;  5AVE A;  5TBM B;  1OJ5 A;  4EER A;  4F3L B;  3LIB A;  4YWZ A;  4KQD A;  3F1N B;  1F9I A;  3D72 A;  4R6L A;  1TS7 A;  4UEY A;  1TS6 A;  3KSG A;  3FC7 A;  1ODV A;  2GZA A;  4XT2 B;  3F1P B;  2EWW A;  4Y2F A;  4MDZ A;  3SW1 A;  2W1R A;  3MFX A;  3UE3 A;  2O9A A;  4CLC C;  5FL3 A;  5F6A A;  2J3T C;  1NLY A;  2W3H A;  1TS0 A;  1TS8 A;  2W3D A;  3S7O A;  3MXQ A;  4Q0H A;  2OAQ 1;  1G6O A;  4HJ6 A;  2LB9 A;  4AFI A;  1V9Z A;  2J80 A;  4HQA A;  4BBT A;  4CQH A;  4GLQ A;  4CLC A;  3EGX C;  5HD5 A;  5LBR A;  4ME4 A;  4HJ3 A;  3S7N A;  1OTE A;  2O9B A;  4DJ3 A;  2M1C A;  4L0L A;  1DP9 A;  2VZW A;  4O01 A;  3K3C A;  2PYP A;  3TE8 A;  1LSW A;  3IS2 A;  3NOT C;  3RTY A;  1YSP A;  4HI4 A;  3ICY A;  3W2Z A;  2YKH A;  2LB5 A;  4MN6 A;  2W1T B;  2K31 A;  4MN7 A;  4EQ1 A;  2O99 A;  5DKK A;  3OBF A;  2QYB A;  2NUP C;  4EES A;  3T4J A;  2OOL A;  3VE4 A;  3E4P A;  3MJQ A;  4HIA A;  4PKY A;  1OTB A;  4EUV A;  3H7W B;  5AVF A;  3C38 A;  3LUQ A;  2PD8 A;  4IUH A;  4UQI S;  3CIT A;  4F3L A;  4BBU A;  3F1N A;  4CLC B;  4LRY C;  4Z1W A;  4Y5F A;  3FG8 A;  4IHQ A;  1TF1 A;  2O0Y A;  3K2N A;  4XT2 A;  3F1P A;  2VKS A;  4CLC E;  2Y79 A;  3A0R A;  1UGU A;  5DJU A;  1XJ3 A;  2XA7 S;  2H28 A;  4WEJ A;  2FZ0 A;  4O8G A;  4I3A A;  2HJ9 C;  2INW A;  2P08 A;  4K08 A;  3RH8 B;  4WUJ A;  3PBR A;  3BQ8 A;  3GDI A;  4DMZ A;  1H8M A;  3IS2 B;  1T1B A;  4LLO B;  5AJG A;  3IBJ A;  4YNR A;  4HH3 A;  3OCL A;  2XRO A;  2L4R A;  2VA0 A;  3C2W A;  1S67 L;  3UB9 A;  1BYW A;  3IBR A;  5G4Z A;  3MR0 A;  3S7P A;  5KIZ A;  3T4Q A;  4Q0I A;  3KSH A;  2PYR A;  2ZBB A;  1NWZ A;  1DRM A;  5F5Y A;  4EEP A;  3B42 A;  1W63 M;  1JNU A;  4Y3I A;  4WN5 A;  4HHD A;  2MJ6 A;  3H82 B;  3T4L A;  5HWW A;  3PBT A;  3EGD C;  4PAU A;  2KLI A;  4GS9 A;  1YKD A;  3JVV A;  4IUK A;  4L9G A;  2OWJ A;  4HP4 A;  2W1T A;  2PT7 A;  3T4K A;  4P6Z S;  5HWV A;  3BWL A;  3NOP C;  3OOV A;  2ZOH A;  4NXE A;  4BWI A;  4O0P A;  3T4S A;  5F68 A;  2D02 A;  2JKR I;  2WKP A;  5IS1 A;  3H7W A;  2A24 A;  4R3A A;  3CWF A;  2JHE A;  3UB7 A;  3OCN A;  2HGV A;  2EA9 A;  5DF9 A;  2Z6C A;  2OAP 1;  4I3I A;  4BJP A;  4ETX A;  2PDR A;  4JGQ A;  1UWP X;  1V9Y A;  2VV7 A;  2D01 A;  4MMN A;  3MQO A;  3UMD A;  2A2L A;  3CUE C;  4IJG A;  1LSX A;  4I39 A;  1S4R A;  2HF6 A;  1GSV A;  3CLO A;  1IFQ A;  5HDS A;  2JKT M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...