3KZ1E

Crystal structure of the complex of pdz-rhogef dh/ph domains with gtp-gamma-s activated rhoa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 11
publication title Activated RhoA binds to the pleckstrin homology (PH) domain of PDZ-RhoGEF, a potential site for autoregulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 179
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kz1E00
2F1JA 1U94A 4M1MA 4HZUB 4EPTA 1YR6A 2B92A 2IUTA 4HDCA 4Q9JA 821PA 4Q9IA 5KOYA 4TL7A 1VYUA 3ZYCA 3EC2A 1BOFA 4TLBA 5HR5A 1NBMA 1K5GA 1WQ1R 2BJWA 2NQ2C 2HT1A 2ZYTX 1CIPA 2REBA 4D0GA 4D26A 1HEIA 4MRPA 4C9BA 1S1MA 5DISB 1N25A 1MT0A 2LKDA 1VG1A 3SEAA 4FWIB 2ODBA 5CJPA 5CDFE 3TSOA 1QHYA 1TQDA 1Z0DA 2CCGA 5EZ6B 3VKGA 4IDNA 4OKSA 5AJZA 1J8MF 3LO5A 1EESA 3E5HA 4JL5A 4TMVA 3WRYC 3SJBA 3GPLA 3TJZA 4F38A 5BN4A 4JBXA 4AWXA 2YOFA 2ZUCA 4GMDA 3RVBA 1AN0A 2MMGA 1MO3A 1ZM2A 4IDHA 2XJ9A 3UATA 1KK3A 2IT1A 1DAEA 4JLOA 621PA 4MQBA 1A1VA 2FOLA 2HV8A 2QGZA 1EWQA 1TU3A 4B73A 4YC7A 2ASEA 1R0YA 3PXGA 3ZIAA 2QL6A 3PENA 1GZSA 2ZUBA 1R2QA 5JWOA 1M6NA 1D5CA 3AVYA 3AP3A 1R6BX 5CYOA 3DMDA 1KO4A 4DIEA 4TYNA 1KY2A 1DG1G 4IDOA 1NP6A 1CBUA 5JCZA 3B8HA 4URZR 1N5KA 3EIHA 2WMNB 2BMEA 1GWNA 3PCRB 4QGHA 1KDOA 2VSFA 2JAQA 3B1ZA 1H8HD 1KDPA 1LS6A 1NI3A 3FFBA 3LXXA 4Q1FA 4IOJA 1N5JA 1WB9A 5BXQC 5FH9A 2GAAA 3K9LA 4E03A 2MMCA 2BKEA 5DHAA 2AK3A 4RJLA 1E99A 2ERXA 3RSLA 2XSZD 1ESNA 3A1VA 2OBNA 3EG5A 3R8FA 1N6NA 2F6RA 1NSFA 2QPAA 2J0UA 4LDJA 2ZE7A 2ATVA 5CLQA 1KI7A 3IHWA 3WYAA 4EAQA 5FOUA 2FWRA 5BQ5A 2DFTA 4LV6A 1XTKA 5FPTA 1Y3AA 1VHTA 1KNQA 2JA1A 3L0OA 4Q48A 3I8XA 4TTPA 4Q47A 3AGQA 5AJYA 1MOZA 1EXMA 1QBKC 1R7RA 2D74A 1TQ2A 3Q7QA 2ZI7A 4IDQA 1ZC4A 4NYIR 1AS2A 1T8TA 2WSSA 3Q9LA 5LD2B 1XPOA 2WJGA 2OBLA 4O25A 3ZVMA 2EYQA 1E9DA 3OEEA 4B33A 4LJ8A 2YHSA 5AWFC 4QG7A 3Q5EA 4DDTA 1LV7A 4Q1EA 3MWYW 2DB3A 4IEEA 5FTNA 4NHOA 5FI1B 4XD7D 2ZRHA 2QQEA 4RY2A 3VX4A 4DLXA 1KJWA 4UXHA 3W8RA 3K0AB 2W6ID 3LLMA 3BB4A 3QPVA 3RWOA 2EFHB 2YWEA 3QKRB 3MMPA 2YVUA 2ZVQX 2W0MA 1ZNXA 4ASUA 3Q3JB 3FDIA 4A9AA 4DUGA 5J4HA 4ZDIA 2H8KA 1E69A 3PFIA 3B6EA 3JVUA 5FUWA 4B3FX 4JJZA 4QRHA 1IXRC 3W3ZB 4DB2A 4G5RA 1NMZA 4FIDA 2J7PA 3KB1A 2JLQA 2JLZA 1JQJC 2ZRBA 1CJUC 2IBMA 2R65A 2R6GA 2ZRKA 3CX7A 3LY5A 4L16A 4Q03A 4I99A 2RHMA 3WNCA 1CJMA 3U3MA 1TL7C 3OIUA 4Q4HA 4B3XA 1IM2A 2EFDB 3DZ8A 3K70D 1KO8A 2ZS9A 3QSYA 2JLSA 1OIXA 1E1RD 2FEMA 5JCPA 4PQRA 1HT1E 2ZRAA 2PJZA 2GHIA 4TZ6A 2GILA 3G82C 1TNDA 4CGZA 3DEFA 4I81A 1NJGA 1BYUA 3UIEA 3AP2A 4PHTA 2ZR0A 5E7IA 1VDZA 3A37A 2YZ2A 4JIMA 1P62B 1MH1A 4RD1A 2XX3A 4D25A 2XXAA 4R71A 1II8A 3VMFA 2G83A 2ZPTX 1YU9A 4KITB 4WZBE 2NPIA 1KMHB 4V0ME 1G17A 4XVRA 1Q22A 2QAGB 1W47A 3I92A 5EE0A 1US8B 4LBYA 2ZJOA 1G8FA 4C0AC 5HE8A 5AUNB 2P5TB 4BRUA 3AUXA 5D3QA 2WV9A 2YJTD 2NO6A 4QBFA 1J7KA 2KWIA 3U44B 2XTZA 2WWXA 2P67A 4EJSC 5HZHA 3KL4A 4BZPA 1E96A 3ZGXA 1OKKD 4JVLA 1T91A 2JLVA 4PFSA 2QM7A 1E4VA 4JLKA 3NIBA 1SXJC 3EPJA 1ZNYA 2AN9A 2BMJA 2VP5A 3IQWA 2A3RA 3HU3A 3ETLA 4I1OA 2GCOA 2VP4A 3U5ZB 1F6BA 4ACAA 5TXGA 4B3BA 2BWJA 1Z63A 4YMUA 4XJXA 1GKIA 2G1KA 5JHHB 4EKDA 2QZ4A 5TMPA 4LV8B 2N1BA 3AVUA 2ZJZA 4PHFA 1DTSA 2W58A 3LD9A 4HUTA 2FFBA 3FOZA 1W36D 4U5XA 5GVRA 1KAGA 2KE5A 2QAJA 1C1YA 4FMDB 4JT2A 4MUBA 2Q9CA 5A4JA 4OHXA 1XFAA 1XXHB 4Q4LA 5JHGB 1G1MA 2ZI5A 2RGDA 1O3YA 3A4LA 2BMFA 4IOKA 4A0HA 3GLIA 1DAIA 4Q1AA 5BYJA 3VQTA 1RRFA 4IXMA 5IRCD 4F4IA 2XEXA 4HAXA 4RZUA 4LYFA 2E9SA 3QF4B 4H1VA 1TMKA 2HJGA 1AQYA 5JMTA 2NO0A 4IVQA 1NKTA 3PUXA 1CR1A 2VL7A 1M7BA 3DDCA 2IW3A 3TKLA 4C4PA 3IBGA 2JIZA 4EPVA 4DHEA 4M1OA 5FUYA 1KNXA 4RFVA 3VU9A 4HUQA 4C0LA 5AK0A 3A8TA 2F9MA 5FOTA 4FCTA 2W2TA 5JSZB 2Y8EA 1DPFA 3B1YA 4LJ9A 3SJAA 3NDPA 2C2HA 3F0TA 4HZUA 2Q9AA 2HCJB 4DXAA 4Z8YA 4OJKA 4LPKA 4ZCMA 5SZJA 2QRZA 1E2NA 5B64A 1P7CA 1AKEA 1LY1A 2FGKA 5L3SB 3TSWA 2WJYA 3QBVA 3ZD6A 3L0PA 4WA7A 5TB5A 1KMQA 2F1HA 3RHFA 1DVRA 3AKEA 3N2EA 5J4LA 1SGWA 1SVSA 4PXAA 3NDBB 4DLRA 5HCIA 1FTSA 1XEWX 2WJIA 1KYIA 1E79D 4GFDA 4CZ2A 4JZKA 1OB5A 1KKMA 2QN6A 3EC1A 4AKIA 3L82B 1R5OA 2AKYA 3AVQA 1YR8A 4TYQA 3UANA 4KI0A 2R6DA 2JLRA 3SQXA 2PMDA 4I4LA 1Z6TA 3MCAA 2FA9A 4OK5A 3U4QB 2D7DA 4WZ6A 1SZPA 1ZINA 2O0KA 4LY6A 4MGIR 5CIWA 1A2BA 3B9PA 4LX0A 4B75A 4DSTA 1PUJA 1IJFA 1HQCA 2F55A 5EXSA 3CWZA 4XTCS 5A0FA 4LJAA 4RD2A 4D82A 1AK2A 2G88A 1OFTA 2VTKA 4KV9A 3RS7A 3ZS9A 2H7VA 1JXOA 2Q9BA 3RC3A 1R8QA 3BC1A 4DCNA 1E9CA 1UKVY 3THOA 1AQUA 1EFRD 1QZXA 1F3OA 1V43A 3HWSA 4NYJQ 1DARA 1KSFX 4DCTA 1I4DD 5AUQA 1XD9A 4GSYA 4PO8A 1XP8A 4C2UA 3I8SA 1NN0A 4GZMA 1XNJA 2IS4A 4BFSA 4LC1A 2C9YA 1N0WA 2AHOA 1E2GA 3KQNA 3MLEA 2QROA 5LBIA 2JJ2A 3BH0A 3D8BA 4KLNA 2BBWA 4TL8A 4EPYA 4F92B 4DT1B 1I2DA 1Q21A 2OCPA 2Z43A 1OJLA 5KDLA 3GJ8A 1M8PA 1VCNA 1P6XA 1XCGB 4GP6A 4C2TA 3RSOA 2QENA 2ZSAA 2DY1A 1E1QA 1R0XA 1AKYA 4AC9A 5JS8A 3J81k 2IL1A 2IYYA 4D4MA 2IXEA 1G8HA 2ANCA 3QKSB 1QG4A 3LWNA 4YQFA 4PTLA 3O47A 3FGNA 4NPHA 5DN6A 1G7TA 4A82A 3LQQA 2X8AA 3OFND 2BV3A 3K0CC 4OYHA 1COWA 1DAKA 4AKEA 3U7FB 2J1LA 1W36C 2OLKA 3TQFA 4N0EA 4A8JC 4M4SA 1WBBA 1R5BA 1RRPA 3LBNA 4N3NA 2WMOB 1P60A 5BYKA 5DSZA 4HDQB 2J0SA 1Q1ZA 4AY2A 3GMTA 4ITRC 1KDTA 1E9BA 3NBXX 1M74A 1GFIA 2AFIE 3NG1A 5LB4A 4TT3D 2L0XA 4QC2A 4JVSB 1P75A 3GLGB 4PAMA 2A5FA 5B30A 2AX4A 2WKQA 1MKYA 2ONKA 3KXKA 4E07A 5EJEA 2LKCA 3NC1C 4J0QA 3PUVA 4L4UA 3HPQA 1SULA 2DWQA 4Z51A 4HLUC 1SHKA 1OFIA 1X8JA 1NF3A 3FVQA 2HLDA 3KJEA 4G1UC 4TYWA 1G5RA 2Q3MA 2JDID 1B0UA 1T9HA 3CX8A 4AG6A 3BK7A 3OIVA 3EWAA 4JS0A 4NCIA 5FL7D 3GJ3A 1BIFA 2CLCX 2PCLA 4BLQA 1XPUA 2WWGA 1II0A 2I4IA 4GOKA 4QGAA 4XTRA 3TUJC 4OI4A 4B2LA 4MA4A 5KO2A 1Z6YA 2OO7A 2NOAA 5JLJA 2CLDX 4NL4H 3DKPA 2FPLA 3W6OA 2ZI6A 4DSUA 3EWSA 1Z06A 2QSZA 4NKRA 3V9PA 1W7AA 2OFXA 4TMZA 2VA8A 1U81A 4RKEA 1F2UB 2C04A 3O8BA 1EX6A 1XEWY 1GP2A 3PEVA 1KMHA 3A1SA 4HLCA 4A0FA 4D2IA 1R10A 2QAGA 4TSFA 5EXXA 1FUKA 3CF2A 2CL0X 4NE2A 4EFNA 3QKTA 1CR0A 4BQSA 1BH2A 4LZZA 3UWKA 4BFXA 2QP4A 3KXIA 4W5WA 1RC8A 4JT4A 3ZVRA 2GESA 3LDAA 1ESMA 3CR8A 1T3SA 4QGFA 3GLIE 1QHXA 4NMMA 1S8FA 4Z54A 4FINA 2B8WA 3CF0A 1LTQA 3U44A 1NBMD 2FZLA 4GBMA 2GXUA 1NJFA 4HDOB 1D9ZA 3SS8A 2OUKA 4PC1A 3TVDA 3GFOA 1FQJA 5E7MA 3RS0A 4YMSA 3VNUA 3C14C 3IUYA 3BXZA 3U3RA 3ZLJA 1FNMA 1IOZA 2CK3A 3IILA 3B82A 1P9RA 2RKOA 2EW1A 3RNLA 3TNFA 1ZNZA 4BFZA 2GEVA 1CJTC 1CKEA 4PC2A 2RHDA 1NN1A 3OAAA 1MABB 2IHBA 3RYTC 3EZ6A 3O8RA 4KFRA 2RB4A 4FWTA 2V9PA 1EWRA 3QI2A 2EQBA 4H1UA 2Z4SA 1BYIA 4IVRA 4RKFA 4JKIA 2WWWA 4F91B 1FMLA 1QF9A 3I62A 3SYLA 1PLKA 4HLDA 1V5WA 1OW3B 5FUXA 2FFAA 1XXHA 1JB1A 4IHQA 1SQ5A 4B34A 4DLZA 1OFHA 3EZ9A 5KNBA 1TQ6A 2QNRA 1P9NA 3IQXA 2R8RA 3D6TB 4C0JA 2RAPA 1R4AA 2ZTSA 3RABA 2NIPA 1TEXA 4M1SA 3QF4A 1BMFA 1KOFA 3AQ4A 2HJVA 3L2OB 4I1UA 1JQLB 3I4LA 3BFKA 4MDEA 3IDQA 3L0SA 2BM1A 3RRMA 3IIMA 3SC3A 3I72A 4Z1MA 2GZAA 1S3GA 3KJGA 4URUR 2KJQA 1U9IA 4GI7A 4PHHA 4BUJA 5JSZA 2GK6A 4AURA 1G7SA 1TU4A 1P72A 4EQ6B 2O0JA 2W83A 1VHLA 1X8LA 4FMCF 4MRRA 1ZVQA 4NDZA 1HV8A 3IPYA 3P27A 4US0R 3K0FB 5G3ZA 4DLSA 4LUCA 1RE0A 4MKIA 3C41J 5L3SA 1IN8A 3CH5A 4CT4B 4HB4A 3PEWA 4HEJA 4AIIA 1GNPA 4LJ4A 2PX3A 3T15A 2V4ZA 5G41A 2OAP1 3AB3A 3CONA 3K0SA 1P4SA 2PZGA 3QF7A 3FHCB 1AZTA 1LB1B 5G53C 3ZS8A 4B2PA 3R8CA 3Q5DA 4B47A 2VQSA 5CITA 3ZZUA 1QHIA 3GFTA 1FFHA 3TW8B 3VAAA 3ZZ0A 1IN7A 4D0NA 4YDSA 1SVOA 2GJKA 1OH7A 1T0JB 4M53A 1E2EA 1VYTA 5KSOA 3FWYA 3U4QA 1JR3D 2ZJBA 5AJWA 5KSZA 1DBSA 4B32A 3AM1A 3CWQA 4LHYA 1G21E 3KKNA 4KJZA 3SHFA 5FUVA 1E0AA 4L15A 5DHFA 3U61B 3ZVNA 4V0MA 5J4VA 2VPPA 4CEIB 4FCWA 1LFDB 1NLYA 5EXPA 2ZETA 4KSCA 3JZAA 4DBLC 1JJ7A 3QPUA 3FHTA 1LF5A 2GJ9A 2HF9A 1CF4A 1I4LD 2FZ4A 2BC9A 3WP0A 1CEEA 2OM2A 4ZI2A 2ODWA 4V0NA 1P61B 1Z47A 4A2WA 1CXZA 1ZC3A 2Z4RA 5AJVB 2PLFA 3KZ1E 3KTAB 4Q4JB 2OEPA 5HCNA 3IPXA 4Q1BA 3QJYA 4EUNA 3T5GA 4HAUA 1QHNA 3FKQA 4ZDJA 1YZUA 4LC0A 2IF2A 3MWKA 1HE8B 4DT1A 5FBQB 2KBFA 3MUFA 2W6JA 1NSTA 2QE7A 4M1TA 2O8EB 3BS4A 4DSOA 2GA8A 4IKEA 3EA0A 1Q1EA 2WIBA 2GXQA 3L43A 2O8CB 5BN5A 2ZU0C 2BCJQ 1NL3A 2JATA 3CB4A 2XB4A 5FBLB 4X8OA 2UZIR 3BFXA 4LBVA 2IWRA 1XWIA 3KFXA 1TPZA 2RGCA 2IS2A 1J99A 2IS1A 3I5YA 3MAAC 1FPMA 1WRBA 1EFCA 5DI9A 3AVPA 3KQLA 1BKDR 1YZNA 4B2IA 1U2RA 2R62A 1GOTA 1ZM9A 1K8RA 3EXAA 4YDHB 1S9DA 4GOJA 2F1IA 5F9FA 2HCBA 1Q44A 3SE0A 1CRQA 2IYUA 1YRBA 4EDHA 4ZI3A 4Q5IA 4O0MA 3T1QA 2NZJA 4R98A 4BECA 1JBKA 2OSBA 3GLGA 4RFSB 4Q7LA 5IF9A 1DOAA 2IEYA 4PSAA 3T06B 3THYB 3MD0A 5JBQA 2QM8A 3K8YA 3IEVA 1JPNA 2OCAA 1QVAA 1G5TA 1ZM4A 4BEJA 4C7OB 4DIDA 4RVCA 4F7WA 3K09A 1Q12A 3ECCA 4DZZA 1NNEA 6Q21A 1SXJD 3PUWA 3WMGA 3LXRA 1P73A 3A1TA 1O87A 1ZMXA 3GLHE 3IHLA 4K8OA 3LBIA 4GP7A 2CJWB 2NGRA 1RRGA 3FPAA 5SZKB 2PT5A 2RGGA 1ZD8A 2MSDB 2FSHA 1KI3A 3RWMB 1ZAKA 4KYIB 4V02A 2JASA 2OE2A 2CNWD 3B13B 2YWFA 5LPNA 4KXFB 5B2ZA 1QHHB 1YR9A 3H84A 3TVTA 4Q00A 4Q4AB 1TQ4A 4H9GA 4P4UA 4QL3A 3UKDA 5C4GB 2CL6X 5FPHA 1IY2A 2CXXA 1KK0A 1F2UA 1VCMA 4MUAA 3K70B 2F7SA 4DVGA 1AGRA 1U8YA 2BOVA 3MG9A 4OK6A 2ZRFA 3C15C 2J9RA 2FPKA 5LB2A 2WJHA 3RAPR 3CKLA 4TQUS 4WXPA 1XXHE 1YQTA 2F3TA 3RC8A 4ZCIA 1UBCA 1SVLA 2ZREA 2BCGY 1D8TA 1AZSC 1ZIPA 1S1CA 1ZU5A 2IYQA 2VP2A 3I3SR 3ADCA 4KFUA 1B23P 1U8AA 2GF0A 2DPXA 2E87A 5HKKD 3CNOA 3K1JA 3ZQJA 1DEKA 3MJHA 1NN3A 2FX3A 2GEDA 3WP1B 721PA 1K6MA 5AJXA 1W5SA 2BJVA 1MO5A 2FSIA 1SVIA 3NKVA 4B3CA 1GG2A 2IYRA 2C8VA 2ORIA 4MGZR 2ZE8A 4IEIA 3VR3A 1UPTA 4B3DA 2QP9X 2QORA 1OIVA 1Z5ZA 2GJ8A 3KQKA 2JLYA 4MRVA 5JRZA 4KSBA 3LBHA 2RGXA 1MABA 2JEOA 4QJ5A 3DPUA 1CP2A 2HYDA 1JECA 4DLUA 2VSOA 4AKHA 1FOEB 4CDGA 4PO1A 1Z29A 4DJTA 5HE9A 3U7EB 3D31A 5H68A 1UM8A 3RS3A 2CE7A 2QT0A 4X8LA 1W5TA 2IYLD 1Z6XA 3W5IA 5KDDA 2NMVA 3AP1A 2BEKA 1JEEA 2YINC 3K9NA 4LJYA 4BFYA 4CT5A 4ERNA 2NO9A 4YMVA 2ZQ5A 3HR8A 1MO4A 1N5IA 4JKYA 3BOSA 3DL0A 3CRRA 1L4UA 1R0WA 1AIPA 1KHTA 1T6NA 4B76A 2DWOA 2I1QA 1KO7A 4LHWA 3RLFA 2O8FB 1YVDA 2G0NA 1OXVA 1E2HA 2IHYA 5FR1A 1MO6A 3GFPA 3TSZA 4AYWA 5AUPB 3C5HA 4D81A 1OH8A 2EU8A 1MV5A 4LHVA 3S1AB 4NBSA 1F2TB 3FKSD 3LA6A 4DSNA 2WPDA 5GVSA 3VR6A 1RW4A 3EPHA 4JBYA 3A36A 2RMKA 3MSXA 4CRWB 3BE4A 3NXSA 5TARA 3KKQA 2WOJA 4UNSA 4EQ6A 3P1JA 3LVRE 3TAHA 1NKSA 3SJZA 4KBGA 1RYFA 3TUIC 4FCVA 1GIAA 1TUIA 2BKUA 1CTQA 1QG2A 2RCNA 2ZSEA 4JLVA 4HAVA 4DLYA 4OI1A 2OXCA 2IF0A 1XD2B 2QGNA 4PPGA 4D0LB 3PEYA 1SVMA 2R6CA 4YXWD 3IKJA 4PX9A 1M7GA 3PQCA 4C0KA 3THXB 3DM9B 4DLTA 5FBRB 3GLFB 2J41A 1DG3A 3GLHB 2AK2A 5CJ2A 4NCHA 1ANKA 5C18A 2FSGA 3ZJYA 2WJJA 4KVAA 1D6JA 2ZE5A 1IN5A 1F60A 1COWD 2J46A 3WBJA 3WRXC 4TLCA 1Z0JA 4YMWA 3CBQA 4BEBA 4EFLA 3CPHA 2ZRLA 2A5GA 2GZHA 1GSIA 1ZP6A 3DM5A 3NH9A 4R7ZA 5EE1A 2WJVA 4K81B 4QKQA 2CHVA 4HATA 2VH5R 3PUYA 3BH7A 1EX7A 3FMFA 1NVUQ 3QY0A 3UK6A 5IT5A 1HURA 3EPLA 4BLRA 4EPRA 2RH5A 3WMEA 2BVNA 4HB3A 4LK2A 4R9UC 4DLWA 2V6JA 4JLNA 4CEIA 2OLJA 1Z83A 1ZIOA 5FBVB 3AGPA 4BFWA 1IXZA 2D2FA 2GZDA 2AXNA 2H92A 3KJIA 1WBDA 5CK5A 1N6LA 1U98A 2QY9A 3EZ7A 5E4FA 2HLDD 5SZIA 4LJ7A 1HT2E 3QIAA 4PZLA 5C1BA 3B78A 1IAQA 2FNAA 1CJVC 2XTMA 1G3MA 4IDPA 3BFVA 3ONWA 3Q8XB 2CCJA 1UFQA 4MRNA 4Q4JA 5GJCA 1R5NA 2AR7A 4GPTA 4Y0AA 4FMBB 2O8BB 2EFGA 4BLOA 1ZUNB 2YOGA 2ZIAA 3GLGE 2D2EA 3HP1A 1E9FA 2XNDD 2ZRCA 3DOEA 1UKZA 4ACBA 1H8ED 4DKXA 1GAJA 4JLBA 1SVWA 1ZNWA 2O8EA 1X3SA 2VHUA 4X8HA 3H1TA 2PZEA 1OHHA 4MITA 3X1WA 4MH0R 2O8CA 5TVKA 1W0KA 4TTQA 1IN4A 2WWYA 1ETUA 2DYKA 2BHRA 2NO7A 1P2TA 1GKUB 1U0JA 2EFCB 2XZLA 3T5DA 2C99A 1FUUA 4M22A 2FSFA 1Z0IA 1VECA 3SDZA 1Q20A 1Z6GA 4LBZA 4PHGA 1E32A 2OZEA 1LNZA 2WAYA 4C0QC 1A4RA 1TX4B 2CL7X 3ASZA 3GJ0A 4JL8A 3QOFA 4BLTA 2V54A 2NZ8A 4RD6A 1KI6B 4LRWA 3VNVA 4II7A 1E9RA 3FMIA 3GJ7A 3LLUA 2FFQA 2OESA 5DGXA 1ZJ6A 1AGPA 3LV8A 2CHGA 3RRYA 3TBKA 2W00A 3TGPA 1ZD9A 3V00A 3AEZA 3ZVLA 2XTNA 1HTWA 2CK3D 2RGEA 3M0EA 4RFSA 5EUQB 3M1IA 1HE1C 1OXTA 2KB0A 4QBIA 3TW4A 3THYA 4MKGA 3VR5A 1GILA 2X2EA 1N6OA 1UJ2A 1GKYA 1P3JA 3OAAD 1G8PA 2AD5A 3GCGA 4M21A 5FTJA 3R7WB 3TRFA 5JEEA 5JI2E 3B1WA 4PQYA 1HYQA 4C7OA 3C7KA 1A5TA 8OHMA 3HU2A 2W6IA 1TF7A 3SJCA 4BZQA 4URVR 2PJRA 4IXNA 4CW7A 1FMJA 1PLJA 2GTPA 4FW9A 4RSGA 5EP4A 1NIJA 3I73A 4YONB 2CJWA 1Z0KA 1N2CE 3OEHD 3U6KA 4LPSA 1LVGA 2ZR9A 1OV4A 1G3QA 4RZ2A 1HQYE 2W0SA 3NC0C 3P20A 4KVGA 4UNNA 2IYXA 1QHHA 2QI9C 4V0LA 4G5GA 4Q4AA 5HPYB 1PJRA 2NG1A 2J0QA 2WAXA 1XB2A 2EWWA 1SHZA 1YZKA 1KJYA 3EASA 4B74A 2HXSA 4V0KA 4PC7A 5LD2C 1VTKA 3CPJB 3KUCA 3M4YA 3NBZC 4G3XA 5DH9A 1E1RA 1Z0AA 2A7QA 4GMXA 4Z1MD 4B43A 1UBEA 4TQ9A 1E3MA 3PVSA 3CLVA 3U2QA 4O2LA 3NWJA 3THWB 1G4AE 1S2MA 2ZJ2A 2PEZA 3KXLA 5DO9A 1Q0UA 5JJLA 1AS0A 3CIOA 1PV4A 3EIEA 3DVLA 3U3JA 1Q1BA 3UMRA 3FE2A 4NYIQ 1VIYA 1X6VA 3KQUA 4A15A 5H1YA 2ECKA 1X8KA 4Q18A 2OCBA 1SKQA 4NONA 2QTVB 3VKWA 5F98A 3TLXA 3KB2A 3CRQA 3K0AA 1LF0A 1XCPA 2P6UA 1E9AA 3QKRA 3NEJA 3NH6A 2E1RA 4FMDF 4FXPA 3U3KA 3P4XA 1DS6A 2ZJ8A 3T35A 1XCMA 1OKKA 3K0EA 3NBFA 1R8SA 4TLEA 2BBSA 4CEHB 4P31A 1UEIA 5CIQA 4A6XA 3CZQA 1EFHA 2IYWA 1G6OA 3AH8A 2PCJA 4UXIA 4FN5A 4IVPA 4URWR 3TQCA 1G291 3A4NA 3AF1A 1G3RA 2VP0A 3HDTA 1XMSA 4IW3B 5FL3A 3QE0A 1NVVR 3KX2A 2ANBA 3X1XA 4JYBA 1KO1A 5DI3B 4M2LA 3SHWA 2V8OA 2O8FA 3FHOA 4B6FA 1T5LA 2H57A 2TMKA 3P26A 2FU5C 2IC5A 5G3YA 4D6PA 2QAGC 2C03A 2H17A 3S1AA 5JI3E 5K8LA 3GJ4A 4D80A 3WHLA 3CX6A 1F2TA 4DDWA 4OQLA 4W7SA 1XTSA 1G16A 4OQXA 1C4OA 1S3SA 2EYUA 2AFHE 5C4MA 4DCUA 1YR7A 4R2HA 1JJVA 4B48A 1KSJA 2ZI3A 5J47A 4Q7KA 4M0LA 4P4SB 3UXMA 2H16A 1Z2AA 4WVFA 4JVNA 3AF0A 5GJVC 4O3MA 4PC6A 3QXHA 5M04A 2JLWA 1G7CA 1US8A 2QE7D 1NMYA 1S4QA 2VIIA 1XD2A 1KJZA 2ZJYA 4HLUA 4Q1CA 5A5GA 3RS4A 5FTLA 3THXA 2CE2X 2F1RA 4C3ZA 4QM6A 1GDDA 3U7GA 1WCV1 1H65A 4NP6A 1CJKC 2QT1A 3GLFA 4KODA 3GLHA 1OH6A 3KJHA 5C46F 4UNPA 4AYXA 3CNNA 2O0HA 2GETA 1ZM7A 1XTIA 4JLAA 1NIPA 1IY1A 1U0HC 4LBWA 4NYMR 1P9WA 2ZJ5A 3X1DA 4KFSA 4NCJA 2C9CA 1ZYUA 3REGA 1HY3A 4TWZA 1RKBA 1XTJA 2CEAA 3TH5A 3VHLB 2FF7A 2ZEJA 5EUMA 5KYKA 2ZI4A 2B6HA 3AKDA 3LH5A 4FI3C 1MRNA 4L9SA 3H2YA 1IONA 4ABYA 4O2RA 5CYPA 3TR5A 1J90A 1N0UA 3I5XA 5KU1A 2XITA 2GXAA 2DFLA 3TAUA 1W48A 2UVQA 3QPWA 1FL9A 1XZQA 2KI5A 1IQPA 4W5JA 3GJXC 2VHCA 2FG5A 1PZNA 3ZIAD 4ESHA 2ODNA 1P2UA 1FW6A 2YV5A 1ZM3A 1EFUA 3BGWA 3DO6A 1L8QA 3FB4A 4TMKA 3W9YA 4BWYA 4PAOA 3SFVA 4KO8A 1KIMA 2J0VA 1KO5A 4XWKA 3FYHA 4M9SA 4TYPA 5DLQC 5KSYA 2VLIA 4OK3A 3ZZTA 3WXMA 2ZJAA 2V6IA 2O8BA 4US2R 3L8YA 1NY6A 1W2HA 2RGNA 3K53A 5K8TA 4EFMA 5GJBA 1EFRA 4QXAA 3B7GA 3DKVA 4QFMA 2DFKB 1W4RA 1N6IA 4A36A 1XTQA 1YHNA 3HU1A 2JGNA 2O52A 1VG0B 2QBYB 1PVOA 3B1XA 2PLRA 5FBWB 1E2IA 1E2PA 1OFUX 1JI0A 1NLZA 4RZXA 2IUSA 5K8IA 1IN6A 1KI1A 4DRZA 3SYKA 5AUOB 3UMSA 2FEOA 2Q3HA 2QQ0A 1YJ5A 4F4CA 2GBLC 1Q3HA 2WSSD 3CNLA 2OT3B 2P3SA 1KI6A 1P2SA 2QTFA 2HUPA 1G9XA 1Z28A 1GITA 3OEED 2GWHA 1ZW6A 4NH0A 2D3WA 4ZDWA 3WNBA 1QVRA 1VIAA 5AR1A 2OHFA 3SR0A 2A5DA 1KSHA 5TV2A 2PZFA 2YKGA 2ODEA 3OFNA 1XZPA 3KUDA 4M1KA 3A58B 3R9IA 3TK1A 2OCYC 1KK1A 1I4TD 1KI2A 1VMAA 1Y63A 3AVOA 1G19A 1AS3A 2VBCA 4MYUA 5EE3A 2QPTA 3R7WA 2F3RA 2QEQA 2V7QA 4LGMA 2FMXA 4LWZA 2Z0MA 2Z83A 3SZRA 1OXXK 2IYVA 4DUGD 4ASUD 4PSKA 3T34A 4AYTA 3AVWA 4HLQB 4PC3A 4W5HA 5J5CA 1VCOA 3CF6R 2JCSA 3R9WA 4TT3A 2DHRA 3EPKA 3OHMA 2PX0A 1VPLA 3D3QA 3H4MA 2J7PD 4MGKR 3SBEA 4RD4A 2Q0HA 2VF7A 1TADA 1R0ZA 2C9OA 3PJRA 3PG5A 3OIYA 3BBPA 4US1R 4EJSB 2KSQA 1FP7A 2ZXUA 1QRAA 3AVVA 2CBZA 2JDIA 4BLSA 1SXJB 3QG5A 1K5DA 2WSMA 5EP3A 1D9XA 1W0JA 1JR6A 2J45A 4C0HA 3B9QA 3BIFA 2REOA 3RANA 1KKLA 1VKJA 1ODFA 5C2JB 1UDXA 1FP6A 2GAOA 3THWA 4AKGA 1HH4A 3HR7A 3IIKA 4OQFA 1GRNA 4NU0A 2YC2C 3LAWA 2R9VA 2PEYA 4PAQA 1OSNA 521PA 3BAFA 3H86A 4JSYA 1YE8A 3QKSA 1N5LA 4CIDA 2ZROA 1L4YA 1IHUA 5K8UA 1DO2A 1RYHA 2PH1A 1U8ZA 3HYTA 1RRCA 1YRAA 2VHQA 1XMIA 4HUQB 1W2GA 5FPYA 3EAQA 3RS5A 5JEDA 1EFTA 1E2DA 3SU8A 2ZRIA 1XTRA 1ZD1A 5B58C 5JRJA 2Z6VA 1X86B 2QMHA 4GT1A 2B7CA 4ON9A 3X2SA 4XWOA 3X1ZA 1ONBA 5GJWC 2VSXA 5B57C 5EE9A 5L8VA 1CLUA 2CLSA 3K09C 4WZAE 4ZCLA 4AK9A 3VR2A 1CR4A 2PL3A 2BEJA 3KFVA 4DEYA 4LHZA 5KTYA 4URXR 1CRPA 3LVQE 4G5SA 1DADA 3X1YA 3ZDQA 2GJAA 3BB3A 1GL7A 4KLZA 2VEDA 4CEHA 4C0BA 4DEXA 2OG2A 4OJQA 2C5LA 4CF7A 3P4YA 1NVWQ 1WE2A 5EZ5A 1UADA 1E0KA 5J4YA 2QMOA 4DC9A 4OQMA 4BGDA 1A82A 1NLFA 2F9LA 2P65A 3PV0A 2JJ1A 3GLFE 3VKHA 3RDPA 4BE7B 2GEUA 1OXSC 2GKSA 3JVVA 5DI3A 3TR0A 5KDOA 4HAZA 5HZKA 1E2JA 1NVVQ 4WBSA 2ZSBA 3SOPA 1UBGA 421PA 4B6EA 1ELOA 1T3LA 1SVKA 4RD0A 4A2PA 4DCSA 3LX8A 2IYZA 1XJQA 4MYCA 4TMXA 4BFVA 2VP6A 1FX0B 1N6RA 4OI2A 4QHYA 1Z0FA 3RS2A 3DOFA 1ZCAA 4PZZA 3QBTA 1OF1A 3KKMA 4ZV4A 1G4UR 1RVDA 2WBLC 3C4JA 5E3HA 4C30A 1TAGA 5CM9C 1IXSB 2AWNA 1QDEA 2QPOA 2NTYC 2ORWA 2ZRDA 2RGAA 2JIZD 4P4SA 1OLOA 3TMKA 1ZUIA 2C77A 2QRNA 2WKRA 1RZ3A 2O5VA 4NYJR 3ICQB 3CRW1 1E9SA 2EVWX 4PPNA 2QTHA 4QHTA 4WOPA 4XH9B 1W4CA 1OHHD 3PEUA 1E2MA 2ZITA 4UKDA 2KBEA 1KK2A 1W0KD 1G3IA 2B7BA 4GOXA 3L0IB 2J59A 4XSGA 4KBFA 2AXPA 1Z2CA 3E2IA 2FFHA 2WHXA 5JWRA 3P32A 3SBDA 4ARZB 2OXRA 2JJ8A 4Q9LA 2FDCA 2X19A 4D4LA 2BBOA 3W34A 2N42A 2P6RA 4S35A 2GNOA 2ZE6A 4TZ0A 1OXUA 3ADDA 3EW9A 3W6NA 4NYMQ 1IY0A 2J7KA 4CYMA 1GNQA 3FTQA 3KKPA 2IX3A 5CM8B 4AG5A 4LHXA 3OE7A 2V1UA 3U60B 4JBWA 1KAOA 4Q9KA 2ATXA 4XWAA 4EPXA 4QM7A 2CHQA 3QXXA 4G5OA 5D3MB 2HEIA 3D7MA 3LX5A 3WYGA 4KAXA 2WIAA 2GXSA 3TE6A 1CR2A 2OFOA 3BH6A 5H70A 3K9GA 4A0GA 3QXSA 4POAA 1Z3IX 2R6AA 2C95A 1YZGA 2QP3A 3T1TA 1JR3A 2YWGA 4JLMA 4Q02A 5LDDC 4LYHA 4QHSA 4IOMA 3CW2A 2JLXA 1NG1A 3ND9A 3IO5A 1KDRA 2P5SA 2VYFA 3UPUA 1Z22A 1W36B 3GEIA 2G9NA 4A8JB 1LS1A 1ZU4A 4HI0E 1Z8FA 2OBMA 2UKDA 5L3QB 1OH5A 1EG7A 1NN5A 1RIFA 2BM0A 2HYIC 2XOKA 3SI7A 1DE0A 4ZKEA 4F93B 1L2TA 1E0SA 3L8ZA 2PBRA 3IIJA 4EIWA 1X1SA 2G1JA 2WZQA 2WWIA 4HAYA 1Q3TA 4KCGA 4CEJB 3MWJA 2EFEB 2IYTA 5EP1A 3GQBA 2F43B 1KZGB 1DELA 5IK2A 3TUZC 4ZO4A 5KSPA 5IHPA 2IUUA 4TTRA 2JJ2D 2C98A 2ZRNA 2GJSA 3KDSE 5KPJA 1M1YE 4NCKA 3A6PC 3QEJA 2QBYA 3AUYA 3K0FA 5KPDA 4JLJA 1UKEA 4P0TA 3FFAA 4MYTA 2QA5A 3FMPB 3QKUA 3LRPA 2OV2A 4P32A 1E1QD 2ZRJA 3F8TA 3ZH9B 1BS1A 2FN4A 1P2VA 2B21A 1J70A 1YZQA 2D06A 3A1UA 3QENA 4KYUA 5DN6D 4E5UA 4RZ3A 1T3HA 3ZQ6A 1SKYE 1XDBA 3A1WA 3NTUA 4TL6A 2A9KA 4B35A 4G01B 4N1AA 1YZTA 1F48A 4PSVA 3W8NA 1E0JA 2FJUA 3MRSA 4JLPA 3IGFA 1XJ0A 5DYGA 1YZLA 3QNUA 2BMDA 4JMPA 1GVNB 5SZHB 1GUAA 2GRJA 2J5XA 1FZQA 4JYCA 5FPSA 2CDNA 3ADKA 3CM0A 1JXMA 2FV8A 4D4JA 2IS6A 3LNCA 3QXJA 4A92A 3WBKA 221PA 4DLVA 3BORA 1BO6A 1OIWA 1Q1QA 3VR4A 2REXB 3LW8A 5FI0B 1Z6AA 3WNDA 3Q85A 4ZDKA 2WWHA 3AF2A 3VR1A 1WDTA 1E9EA 2PT7A 3PITA 4JJKA 1CS4C 1E2KA 1OYYA 4OHVA 4DDUA 1N0VC 5J4KA 2WTUA 5F3WB 2MSCB 4Q1DA 4U00A 4Q19A 3OESA 3U3OA 4L5BA 4YMTA 1N3BA 4EJSA 1XEFA 5F9HA 1G18A 3FMOB 4URYR 2C96A 1T5IA 1RFLA 1NY5A 3KTAA 4A6PA 1SXJA 5KNDA 2J87A 4HB0A 2G77B 1NBME 5FOXA 2ERYA 3GEEA 1GNRA 5BN3A 2ONJA 4PR0A 1XEXB 5IDVA 3AVXA 1DAFA 4K46A 1H8HA 4OHZA 2CNWA 1U90A 2Q3FA 3W3AA 4ZIRB 4Q01A 2O8DB 4MGYR 4UNQA 2HDNB 2ZANA 3HJNA 5KNCA 2CVHA 2DBYA 2P2LA 2QMEA 4QJ4A 4HAWA 2XSZA 3PIRA 4TN1A 2YNMA 4TSFD 2FPMA 4G0NA 4Q9HA 5J40A 2ZYUX 2ZRMA 2P6NA 1QHSA 1UF9A 2MSEB 1UEJA 3UG6A 2IK8A 4IRUB 4LYAA 1AA9A 2XGJA 2UZ3A 5E95A 3V4RA 2H1LA 4QBHA 1VG9B 4UQOA 4A4DA 5EXTA 4A0RA 4NZYA 3UWOA 4B3GA 2W2XA 1WP9A 5HKKA 4P4TA 1KGDA 2XAUA 4ZPXA 1N6HA 4QGGA 2Q21A 1PLLA 4UJ3A 2A5JA 1E6CA 3CRVA 2HXYA 2ZUDA 2VP9A 3NBYC 3QUSA 1GL6A 3QQ5A 1P5ZB 4UJ5A 5FR2A 1NRJB 4Q66C 5FOWA 3QXCA 4N0DA 4XD7A 1J2JA 121PA 4DB4A 3KKOA 5DYIA 2NO1A 2EWVA 3RRNA 4PZYA 3W90A 2WM9B 1G8GA 2VRWA 3UMFA 1PUIA 5TY0A 4Q7JB 1X1RA 1Z07A 1EGAA 2V1XA 3E70C 3R20A 3WMFA 1TF5A 3K70C 3EZFA 2A78A 5CLLA 4I1SA 1CU1A 1NG9A 1G41A 1L7VC 1W46A 2R6FA 4LI0A 3SYNA 1FX0A 3CO5A 4BFUA 4TL9A 2R2AA 1W44A 3I61A 1TEVA 1Q57A 1E4YA 1BMFD 3OIWA 1SKYB 5JWHA 2ZSDA 2ZS8A 5P21A 1XU4A 5CB6A 3T12A 3T1VA 3ND8A 1U0LA 5FTKA 4GZLA 2IYSA 5FOVA 1WXQA 2VF8A 3HPRA 4MYHA 3DMNA 2X1VA 4EPWA 2AD1A 3FKSA 1VCIA 4DCVA 3NEYA 4P33A 1G7RA 4HZIA 4QJ3A 2YYZA 1JR3E 3BERA 2BDTA 1E2FA 2CVFA 5TDHA 1WMSA 1G20E 2FE4A 5DNYB 4ILEA 2DWPA 4L9WA 2Z5FA 3BB1A 3A4MA 5EE5B 2WWFA 1KI4A 2BIFA 4ARZA 4U02A 2A5YB 3Q72A 1DAGA 4XSHA 5BW8A 4KHZA 2JLUA 4UNRA 1RJ9B 4YXWA 1IBRA 3LFUA 4WAUA 4M1WA 3SFZA 4ESVA 2CCKA 1OE0A 2W2VA 3ICEA 4JVMA 5KHOC 4QOSA 4Q7MB 4BASA 2GVDC 1M2OB 2LWIA 1WF3A 5H8WA 5D3MA 3AF3A 2OFWA 4FMCB 4XVUA 5KUTA 3I32A 4A1FA 4BFTA 1G3UA 2I3BA 3GEHA 2C78A 1W1WA 2YOHA 2GDJA 4LYJA 5JJIA 3H0KA 3CRMA 1XX6A 4BZXA 1E2QA 1U99A 3B1VA 2V7QD 5CK4A 3T61A 5FPKA 5JFGA 1JALA 4CVNA 3CPEA 2AKAB 3EA5A 2G6BA 4LCBA 4X8MA 4QNRA 1OPXA 3W6PA 1ZCBA 3B85A 3MGCA 4GL2A 1LW7A 3K9HA 3F3YA 2ZAOA 1JAIA 2WKPA 3K0CA 1G64A 1T8UA 3ADBA 3N5CA 5ELXA 4A8JA 4BLPA 3G0HA 1JAHA 5L3QA 2P0EA 4PANA 1AM4D 5HTKA 2LCFA 1G6HA 4B44A 1XBTA 2IXGA 3QVVA 4I1VA 1KY3A 3M6AA 2N46A 3MFYA 4M9QA 4BRWA 4CEJA 2FGJA 1IJEA 2F43A 4WIAA 4OI0A 3BJIC 1T0HB 1F5NA 3AF4A 3WY9A 1W0JD 1NVXQ 3BRWD 2QUZA 1KSGA 2W6JD 1G5PA 2ZRPA 2D4HA 2RGBA 3EARA 5FTMA 2D7CA 1TUEA 2XNDA 1GRRA 4TQAA 5CDFA 1H8EA 2IWHA 2ZYVX 4FD2A 1DO0A 1HA3A 4WW0A 1C9KA 2DCUA 3JZMA 3PUZA 4WXRA 2VHJA 5DIFA 1VYVA 4QNMA 2ZRGA 4YLGA 4E22A 4NTZA 4M9XA 2FH5B 2ZVPX 2J0UB 1FNNA 4LJ6A 1GL9B 3U7HB 1SXJE 4IJMA 2ZYWX 4JL6A 1KI9A 2I1VB 5JS7A 3N2IA 3T1OA 2CMKA 1KI8A 1D2EA 4B71A 4XVQA 1AJEA 4A2QA 1N6PA 4XOIA 4RCZA 3AKYA 3NHBA 3ZD7A 4W9MC 4TLAA 4Q21A 3IO3A 2GK7A 1JPJA 3CZPA 4E09A 2ZM5A 3QEOA 1ZUHA 3N70A 1GTVA 1XPRA 4GDFA 2OAQ1 1OB2A 4S2EA 2XJ4A 1HUQA 3QVUA 4OQNA 1W4BA 1E79A 1W4AA 2ZI9A 3MWLA 3V4FA 4ZKDA 4OHYA 4MKFA 4UXJA 2VHTA 3C16C 4TYYA 3GJ6A 4PQFA 2ZSFA 1J8YF 4P3YA 1W49A 2RGNC 2V3CC 1XF9A 4D4KA 4IFBA 5GADl 2JJ1D 2IA5A 3GD7A 1A2KC 1OT3A 1U9IC 4HSEA 2NPFA 3VFDA 2GCPA 1GRQA 4GRAA 4AI6A 1QHGA 3R9XA 2D62A 4U7DA 1E98A 5G40A 1S96A 2DR3A 1M7HA 1JEDA 1T4GA 2XNSA 2X2FA 4DWJA 2ZS7A 1XEXA 3B60A 4V0OA 3OEHA 2G3YA 4MKHA 1D2NA 2YWHA 4JLDA 1UAAA 3C8UA 2ZR7A 4LJ5A 1XMVA 2G0TA 4ZIRA 4HB2A 3OZXA 2O8DA 3GJ5A 4Q4HB 3WYFA 2R44A 4RD3A 5L3RA 4OL0A 4R2IA 3UG7A 3HYRA 1XJCA 3Q7PA 3VX3A 4IOLA 1Z08A 3B2EA 4JSTA 1WA5A 4OHWA 3VHXA 3AKCA 2IEZA 3G5UA 3LW7A 1XRJA 5BWMA 4MDFA 4RCYA 3PR1A 3SNHA 1G8YA 2QSYA 3F5FA 4Y0VA 5EP2A 4MRSA 1OYWA 2BBTA 2ZAMA 1EK0A 1S9HA 1DAHA 3O8CA 2XXAB 1II8B 2XZPA 2QMUA 3CUEF 3U6BA 1ZRHA 1YKSA 2PMKA 3AVTA 4PPFA 2AL7A 2ORVA 3EIQA 3DZDA 4TMTA 2AWOA 2Q6TA 5L3VA 4AD8A 4HYYA 3IEUA 1RPZA 1VG8A 1KZ7B 4KU4A 4QBGB 1XD8A 4XIGS 1KTVA 1FTNA 2IXFA 3OE7D 4NCNA 2X77A 4M8NE 4F4JA 3CR7A 1II9A 3VTKA 3CH4B 4M1YA 2B8TA 1DAMA 1M34E 2GCNA 2WOOA 1UKYA 2A2ZA 3EX7C 2V55B 2VO1A 3QG1A 1D2MA 2DFNA 3MJRA 2QG6A 5CB8A 4KFTA 4LV5B 1E94E 2GF9A 3I1FA 4TLDA 2YC4C 3SQWA 2GCOB 4PO9A 1N6KA 3RRZA 2GBLA 1NMXA 2K5UA 1UBFA 3C5CA 4LOAA 3EZ2A 4M9ZA 5F2EA 2J3EA 2XB2A 1MRSA 4GNKA 3WHKA 3LQRA 3OF5A 3BD9A 2ZU6A 3KQHA 3NHAA 4C0SA 2WVJA 1GM5A 3O8DA 5FL7A 5FOSA 3E1SA 2XOKD 4PPQA 4BPBA 1A7JA 1CULC 2GVZC 2WPDD 3ASYA 2OILA 4TMWA 5E7JA 3GLIB 1E2LA 3NVAA 1TTTA 5IK2D 5JJKA 1FQKA 5JZVA 3SN6A 3W5JA 5EQTA 2WICA 5FFMA 4G5QA 4LSGA 2HF8A 5UKDA 4V03A 4DDVA 4OBEA 1MR3F 2QU8A 5DE3A 1TF2A 3GP8A 5ANRB 1JNYA 1XMJA 2XZOA 4Z8XA 3DHWC 2H18A 3B5JA 4L8GA 2H5EA 3IBYA 4IFEA 3VU9B 1UDWA 2A30A 2HT6A 3AV0B 1RJ9A 2SHKA 1S0UA 1I2MA 3REFA 5JECA 1ZBDA 3TIFA 3BWDD
chains in the Genus database with same CATH superfamily
1NUPA 5H7XA 4CG1A 2W22A 5CHYA 5JMPA 1FRNA 4BKRA 4EPTA 1P8AA 1YR6A 3ABOB 4HDCA 3DC2A 1F8GA 4IZOA 4PYJA 3MUNA 3RFTA 1QZZA 4EVRA 1A9XB 1Q6ZA 1SVNA 3IAHA 3TFQA 2FTKE 4C04A 5HR5A 1K5GA 4IS3A 2BJWA 3CX4A 3PD0A 3RKSA 1F12A 2NXEA 3OA0A 1MC8A 3AEQB 1CIPA 1YAJA 2GZ1A 3G2OA 5F12A 5JAHA 1XN4A 3D4LA 1T36A 1K0FA 3H05A 2HHJA 3S5UA 4B0PA 4C9BA 4AECA 2FG7C 4J75A 2Z6UA 5JS6A 1Z0ZA 3F6YA 1MT0A 2JAXA 4BY9E 4RDCA 4H7IA 4PN7A 5CDFE 2ISCA 1QHYA 4J94A 3RBVA 4CMJA 3VKGA 2Q6OA 4IDNA 4OKSA 4ZHQF 2BFCA 3E5HA 4H7EA 4DXDA 4H1TA 4LZNA 4R2JA 2YOFA 3JAKB 1AN0A 3NZEA 3PHIA 4HDSA 3IDSA 3VR0A 2XJ9A 1V8PA 2OXTA 1KK3A 2FW9A 3IAS1 3LC1O 4HH1A 1ND5A 4G0UA 1A1VA 1EWQA 1C2TA 2PBFA 2UXDB 4N39A 3F67A 3TKAA 2RI6A 1V8OA 1R0YA 2ASEA 3S2GA 1QORA 1GEGA 3NONA 3ZDBA 5AOAA 4LN1A 2DPHA 2DSTA 3ZIAA 1QYRA 1WBJB 3S8MA 1R2QA 1D5CA 2ZXEA 5C51B 1Y42X 3AP3A 4MQEB 3NTVA 5JALA 5LSAA 1DTWB 4RU1A 5ILOA 2CZGA 4EO4A 5C32A 4CQJA 1DG1G 4UHDA 5MGBA 3F5SA 3OTWA 4URZR 2P8SA 3EIHA 1KH3A 2TMYA 3E81A 3KLPX 1YQXA 4G8JA 2FE1A 1GWNA 4BU1A 2ZZKA 1ENPA 4IG9A 1KDOA 2ZWVA 1NI3A 1C4KA 4UCWA 2Q50A 2IYNA 4I6JA 2H4YA 2C84A 1MF7A 3R0ZA 4HJRA 3K9LA 4GMKA 4J0GA 1BC5A 3EXIB 2FSPA 4U5QA 3SZMA 4H15A 5K2OA 3G23A 3GJSA 4P5EA 2BKEA 3WYNA 5T64A 1WD7A 1QZTA 3BKWA 1EQAA 3PSAA 4RJLA 1E3TA 2OBNA 4EY4A 1TE2A 3AJRA 3HFSA 4CR7A 3R8FA 5CA1B 5CJJA 1N6NA 4F6CA 1JVNA 3C5VA 2QPAA 3ELWA 4P81A 4KN8A 4ARBA 1MEJA 4ZQEA 1H2FA 1WMBA 2W90A 3DFIA 3LOUA 3N0WA 4IBOA 2OP1A 5BQ5A 3RCBA 4F2DA 5LQDA 1CB7A 3HU5A 1P5FA 1PZHA 3OPYI 2RH4A 2VBFA 4TTPA 3I8XA 4CHTA 1HYHA 5JU6A 3GFGA 2IOHA 1L7AA 1OQAA 2IPNA 4HDKA 3RFXA 3AGQA 5BSKA 2I7XA 3R3VA 5HRAA 2DLCX 1EXMA 3DEIA 2HFJA 3AL3A 3Q7QA 5T3UA 4JHLA 5JSYA 2I2FA 1AS2A 3Q9LA 1OREA 2O1WA 2WJGA 3NTLA 2HWKA 4Z4QA 3T3EA 1HYBA 1K6IA 3ISVA 3UJ3X 4RLFA 2EYQA 1E9DA 3RVOA 4B33A 5LIPA 3IEMA 4MGEA 1T4CA 2RJOA 3WNVA 3W5AA 1QONA 2B1QA 1KDZA 1MV8A 1ZJ4A 4I36A 3FCXA 2Y1GA 1R8JA 2GWRA 4Q1EA 3UMBA 1UPFA 1I8TA 1W5AA 4F1KA 4NHOA 1H05A 3I01A 2DQ4A 3VYVA 1QQBA 2P5UA 3WQRA 4HLNA 5JAMA 2QQEA 4RY2A 1ZJ5A 2W6QA 3L7CA 1I36A 3K0BA 5FBKA 2R7LA 5T4BA 1UMKA 1VJCA 1LK0A 4QYIB 1YQGA 2V9ZA 5DTIA 4F04A 2O5CA 4DUGA 1VL0A 3HABA 3N0XA 1V9CA 3Q3JB 5AK5A 5DHQA 4A9AA 2H8KA 1E69A 4ZJUA 3PFIA 3DFFA 4GS5A 1Z5OA 4XB6B 4JX9A 1TD1A 3O8OB 3ELYA 1ZD2P 4B3FX 3EY4A 3PDCA 4QRHA 3W3ZB 4NAUA 4G5RA 3T0GA 5BVHA 3E22B 5J2TF 2JFHA 3KB1A 3O83A 2BGTA 4V0QA 3GVIA 1CJUC 2WU4A 3VPXA 3LY5A 1DDOA 1UPBA 1RAHA 3TG8A 4Q4HA 1BRMA 3K70D 5K0SA 4RDIA 3EIXA 5J23A 1CQJA 2QWXA 2P3LA 4ZXPA 3VPSA 4DMFA 3T7AA 3QSYA 4MI3A 4P7KA 1RMTA 2G9RA 4PQRA 3P0EA 1L4EA 4QWMA 2PFKA 3CEHA 2GHIA 1LX6A 3WLFA 4J90A 1M0TA 1HRKA 2GILA 2XDYA 3DEFA 5DZSA 4I81A 4FFLA 3S8YA 2HU7A 4RADA 1BYUA 2JZCA 3AP2A 2ZR0A 1YACA 3NC4A 4LOLA 4ZT5A 2Z1NA 3UJ9A 1JA9A 1J20A 2YZ2A 1P62B 1MH1A 2ZYAA 4R71A 1II8A 3UOWA 3NDRA 4E0BA 4AO8A 3D2LA 3PQEA 2ZPTX 3BWBA 2VPWA 1YJ8A 4HBZA 2R6R1 4WZBE 3U37A 1H2EA 1GNSA 2F4VB 3IT3A 4EYKA 2ZIUB 3KYJB 1OJ7A 3ZXUB 1SUWA 4K03A 1MDBA 1XZLA 4EX6A 4C0AC 3BXEA 1NVEA 3K2BA 3ABRB 3NO4A 3OUTA 4CGYA 5AUNB 3UOGA 3E27A 4M49A 5D3QA 2YJTD 3FFWA 2NO6A 5J2UB 5I7RA 5K99A 5IFKA 2J3QA 1XLVA 2KWIA 5ALUA 5A3QA 1CY1A 3HC7A 2W2LD 3QFTA 5CW1A 2Z04A 1E96A 3ZGXA 1OKKD 4QUGA 4QLOA 5AW6A 2JLVA 4PFSA 3R23A 1NC3A 4JLKA 4NMXB 4XA8A 4B83A 4DJAA 3C3KA 3EPJA 2X2OA 1CVLA 5K8CA 2OENG 3E35A 4BQNA 3E5NA 3S29A 3PDJA 2X13A 4FC6A 4P8RA 4MLZA 5GPBA 2QXUA 5TS2A 2BN4A 1LD3A 4IKPA 1BVUA 3IR5A 4R6XA 1XDWA 2HRRA 1I6LA 4INPA 5THXA 2PL9A 3CH6A 4P1ZA 4MV9A 5IH7A 3O1LA 2PLAA 2OCIA 4FGWA 4JUFA 1NRXA 3AVUA 3TNLA 4ZANA 2XVMA 1DTSA 2J9FB 2XYHA 2P35A 3LD9A 3A70A 3TYXA 4S05A 3WRXA 3LQFA 4KGZA 5GVRA 4F4HA 2C2GA 1OPRA 2V7VA 2EP8A 1G5QA 5CDUA 2P79A 4KQMA 4O1MA 5AKYA 3K05A 1IPFA 1COZA 1XJWA 3BREA 4HGQA 2MYUA 5JHGB 2OHJA 5FD8A 2PMEA 3E9QA 4NE9A 1RHKA 4IOKA 2Q07A 3ISJA 2DKFA 4KI7A 4R1SA 4A0HA 1VFNA 1NKVA 2C54A 4Q1AA 1KZ4A 2A59A 4RWEA 1D2HA 5L7TA 4TS3A 4KRGA 4LYFA 1QTRA 4UFOA 1YTUA 4BO8A 2HJGA 3H7IA 4Y1FA 3DS8A 4UTRA 3I9LA 1KOLA 1AG9A 3GFFA 3W9SA 4EPVA 1PJAA 2IW3A 1PJ8A 3LZCA 3LPLA 3Q1KA 4IGEA 1CF9A 4YP9A 4XRRA 3VXKA 4L72A 1JFLA 4D9BA 4C0LA 3V55A 2XUIA 5CT4A 4S24A 5MFPA 2O1XA 2MOKA 1NURA 3HVJA 2FKAA 1QK3A 2I9PA 3RBZA 4C6TB 1DPFA 4LJ9A 4AFNA 3SJAA 3IAAA 5A4DA 5LQRA 2JIRA 1PSZA 2Q9AA 4ZU1X 1S5PA 2HCJB 3ADPA 4DXAA 1YXMA 4Z8YA 3TO5A 3H2IA 1IPHA 4PR3A 4OBBA 2PRZA 4A03A 4EHNA 3A2KA 1KRWA 2FR8C 4C88A 4MP6A 2UYGA 1LLFA 4KIFA 4LZJA 1EWVA 1U9CA 4LXTA 2B5OA 3RRXA 3TSWA 3QBVA 3V1KA 5ICSA 2V7TA 5HF9A 5L3SB 3ORHA 5HJ5A 3E1GA 2F1HA 1Z6PA 1USUA 4YJHA 3AKEA 2ADMA 4J0CA 4Q93A 2HGZA 4LEIA 2G28A 2RCYA 3OZDA 3UHJA 3GWZA 5A9SB 3LDHA 3ZDCA 2X3UA 3UKJA 5TEVA 1E79D 1W1IA 4CZ2A 3GAFA 4JZKA 3HXPA 1X7HA 3EC1A 4YCAA 3U7QB 1OB5A 2VXOA 2XMBA 3DO5A 2AKYA 3FDFA 4TYQA 2W43A 2QVGA 3E9NA 4MVJF 2A9VA 3W7BA 5B1YA 1IEXA 1PTJC 2RH9B 4NBNA 4B85A 3M6VA 2WUDA 5E6UB 3OQMA 2VHWA 4G1BA 3FWHA 4YUWA 1RNLA 2A3NA 1JE0A 1PR4A 1B16A 2E82A 4MCHA 5SICE 4CDMA 4CM4A 3WL3A 3PC6A 5CG2A 5F77A 3AUTA 4G07A 3FR7A 4LX0A 1TZBA 1Q2XA 2OD2A 5E1DA 3EUFA 2W37A 1L9XA 1JZQA 4OGFA 4EGCB 2GHTA 3RI3A 4MI6A 5JNLA 4WY8A 3CWZA 1XCJA 2GA9A 1H6CA 5A0FA 2YMMA 4J6EA 1QFXA 2PHZA 2VH2A 4D82A 4KV9A 4EYSA 5AW7A 3MHTA 2H7VA 3C1UA 2NYUA 1DJMA 1QWOA 4H3HB 4L95C 1C3EA 2QVZX 3SFTA 4DCNA 3L04A 1GNVA 1EFRD 4KVZA 2IE8A 4X60A 5F5LA 4LRSB 3UBMA 4KGXA 4RFLA 4W6QA 4JI5B 1R0KA 3MBIA 1IH8A 3MJCA 4TM7A 4CQMD 3ERCA 3PFBA 1URPA 3SYMA 4GC9A 5JROA 4M87A 3BIJA 1KJIA 1E3DA 4GZMA 1XNJA 4LGCA 2P9HA 4BFSA 4LC1A 4KWCA 2WIKA 4II2A 2AN5A 5TLSA 5IP5A 3HMQA 3BH0A 4O2BA 1BWSA 4QYTA 4OD0A 1Z4IA 1LLCA 1I2DA 4QVKA 5C34B 4EGAA 5KDLA 2A7XA 3RSFA 1XCGB 2NTNA 4UHBA 2Z98A 3LL7A 2G6TA 5JZOA 4YUYA 1K75A 2HRDA 3V4PB 3UMMA 1H2HA 3JSAA 4NF2A 1CS0A 1NATA 5JS8A 4KX3A 4FBGA 4D4MA 1JLKA 2XUOA 4L8YA 5CTAA 3O0TA 2CSXA 1G8HA 2ANCA 2CW5A 3K16A 3FGNA 1GPMA 5DN6A 4D96A 1CJBA 3E5RA 3LQQA 3T3NA 5BURA 4JY7A 2HH9A 1DAKA 2A9PA 1ISPA 4CF5A 1UC8A 3TQFA 1FRVA 4A8JC 1WZCA 2CUZA 2GYWA 3BFPA 3L7DA 1O03A 1R5BA 1VLJA 1HFKA 1E5LA 3PQ4A 5BYKA 2R8ZA 5I9LA 3ICPA 4PLVA 5I9BA 3K8ZA 5BMOA 4AQYB 5AVXA 2J0SA 1D1QA 3IT2A 3ZCUA 4AY2A 5KOJB 4JFRA 2FSVC 4DG5A 4DLPA 4BWGA 4HT3B 5TIIA 1TVKB 4PNPA 1KDTA 1E9BA 2FY8A 5EA2A 5IJWA 1V8DA 1YA6A 2AFIE 3I09A 4XPZA 2XDQA 3R5XA 3WB9A 4TT3D 1J2RA 2NP6A 3RT9A 4FKBA 1K8YB 4B80A 1JH8A 3GLGB 3A4TA 3L7BA 4EG7A 4YT5A 3RB8A 5B30A 5CGZA 3PC8A 4U7JA 4D3ZA 4E1BA 2WAMA 3KXKA 5DNCA 5LIRA 1DQSA 3S7ZA 3A31A 1PGJA 4FI3F 3T9FA 1C1XB 4BVFA 1N8KA 5I4KA 1H4QA 3OJOA 5AKXA 3WIUA 3GRRA 2UZ4A 3EE6A 2ZRQA 5JBIA 1SHKA 3M2PA 4PFJA 5ALPA 4JJEA 4TYWA 4JEHA 2Q3MA 2JDID 3QUAA 1B0UA 1QWSA 3CGGA 5GAJA 3BIWA 3BL6A 3BK7A 3OKFA 3EWAA 3RGWS 1H3NA 3M82A 4NCIA 3PHJA 4KAAA 2WLSA 3EFOB 1BIFA 2CLCX 4BLQA 4H0FA 1NPTO 2WWGA 4UEQA 4UATA 1CVIA 1II0A 2I4IA 1P2BA 4MX8A 1WD5A 2CFIA 4OI4A 1FP4B 2NN3C 4Z99A 5EQDA 3SIWA 4F2PA 5KO2A 3NWBA 5JLJA 3BGVA 3NIGB 2VDOB 4BKQA 1QX4A 4DQKA 4FEEA 4D9FA 4QBKA 2BR4A 2C0CA 2QSZA 4KUGA 4M60A 1YOVB 4CMIB 1JI3A 1U4NA 2JI4A 3HR4A 4M6WB 1B26A 1QG0A 2C5EA 3BK2A 3OLZA 1P1BA 3R6LA 2FCAA 2OFXA 4RGVA 1OASA 1KAEA 2OY0A 2C04A 1XEWY 3AR4A 1OLSB 1KMHA 2O8NA 1O94A 2O50A 3A1SA 4HLCA 1R10A 4AVYA 2A9JA 2I78A 3CF2A 1JVBA 4QFBA 1RHUA 2WK1A 5AJTA 3ICWA 1BH2A 1NC1A 1Y33E 3DTNA 2I6SA 3A2NA 3KG2A 3O2SB 4G65A 4LZZA 4OFBA 4JT4A 4PZ9A 3T7IA 4L5CA 3ZVRA 1IEWA 4AWBA 2VYVD 5JIBA 1GPDG 2Q4DA 5A03A 1V1RA 1Z73A 2OQVA 2ZZNA 3OKCA 3CF0A 3QK7A 3U44A 3KJXA 4A23A 3NXKA 1BAPA 1C80A 1NJFA 2GXUA 1VHDA 1D9ZA 4R8LA 4QZVA 2OUKA 4WCFC 3TMAA 1E6LA 2C29D 3FNQA 4FOPA 4Z2YA 4PG8A 1KFJB 1N2CB 5DT9A 2AOWA 4E5UA 1T9ZA 1NASA 5LOVA 1D5WA 4YMSA 3LC0A 3U5TA 3IUYA 3QLUC 1XVAA 4RZSA 3N6XA 1HE3A 1YDMA 1P9RA 1I01A 9ABPA 1RQXA 1T5DX 1V5IA 1YI8A 1ZNZA 2EW1A 2RKOA 3FUVA 3KQYA 4J16C 3TEMA 1CKEA 1KEWA 1RQLA 2FZWA 4DTIA 2QN1A 5HZMA 3OAAA 1MABB 4R54A 3RF6A 3RYTC 3TLCA 2OK7A 3U19A 3O8RA 1FXWA 1KE1A 3V3TA 2ZSUA 2PZBA 3AERA 2EQBA 3HCFA 2Z4SA 4IVRA 3ZDEA 5IF3A 2WWWA 4F91B 2XIJA 3JQQA 1C9EA 4OB6A 4DKJA 1PLKA 4HLDA 1FDIA 3CLSD 3GAAA 1TA9A 5JAQA 1HQKA 8MHTA 1EP3B 1XXHA 3AM4A 4L6AA 3FYUA 4RABA 2X9GA 1JB1A 2QK4A 2XMDA 4JA2A 1JR2A 4IHQA 2Z9BA 5JH7F 2LDBA 1W59A 3AOEA 3TPCA 3H5IA 2F8TA 5C1IA 3DV0A 3ED1A 2RAPA 4IIEA 4TRRA 2ZTSA 2O07A 4X90A 5JY6A 3Q8LA 4J49A 1BMFA 1J06A 1Y4UA 1D2AA 2H6EA 2XUZA 1N1EA 2HHCA 3AQ4A 1QPBA 4CLEA 3WISA 1ZJYA 3I4LA 3PPIA 3BFKA 3D0KA 4D3DA 3EISA 3O6VA 2OSVA 3IDQA 5JASA 2B34A 4X93A 3RRMA 4B7ZA 3SC3A 1C14A 2V6GA 3EG9A 1S3GA 3KJGA 3I5UA 4O4HB 3KD2A 2EW8A 4PHHA 5G0VA 4D43A 5JSZA 2DERA 2IUEA 2GS9A 4PTZA 3UV6A 4DA8A 4F45A 3MC1A 1ECFA 4BMXA 5IVKA 2O0JA 4G6ZA 1VHLA 1L8AA 1X8LA 4FMCF 4BNHA 4AJLA 1THMA 1UZNA 4UUPA 2C4VA 2XCIA 4UHFA 2PE5A 4ARAA 3L46A 4QPZA 3CH5A 1DUVG 1JHUA 2WJZB 1W8IA 3PYLA 3OHPA 2FDXA 4MQ5A 4OJNA 2OAP1 1FDTA 3K0SA 3FHCB 1NZDA 4FZVA 5DGCA 3DONA 3Q5DA 1NTOA 3ROGA 5KVSA 4PAGA 4F5DA 2XKBA 3LQKA 3KVYA 2FETA 2VTVA 3JS5A 3ZW7A 1LDGA 4R1LA 4G09A 4QGBA 2BLNA 4P86A 1IN7A 3ZZ0A 3O7WA 5ALWA 2PX2A 3IL2A 1QRTA 1SVOA 2KPOA 4D5GA 2GJKA 3STXA 1E2EA 3H2BA 4J1TA 3QOWA 4P2GA 5K3EA 4H31A 1GR1A 2C3UA 5AM0A 1VIDA 1DBSA 2WQ7A 1L3IA 2TMGA 1E3SA 2XMGA 3CWQA 1HT3A 2X8JA 1E1YA 1G21E 4Y1EA 5HFJA 5KNLA 3SHFA 2PK3A 2Y0CA 1W85B 4RPHA 1OBHA 4J2TA 1IAVA 4PBRA 2VPPA 4FFMA 4AS1A 2F59A 2ZIWB 5DW0A 3SF8B 1ONNA 3D64A 4MKRA 1T9KA 1BXKA 4KSCA 3CNQS 4UNIA 4V2UA 1LF5A 1ZH0A 4QUKA 1QU2A 1VZ2A 4JAVC 2BC9A 4QBTA 4QULA 5KI6A 3IODA 1CEEA 3EXHB 3DEJA 4INAA 4ZI2A 4D7AA 2DUWA 3FLAA 3HRIA 1SJ9A 1P61B 3VVMA 1LVUA 3LP5A 4WERA 5AM2A 4BO6A 2L18A 3NRCA 3V8BA 4LRTB 4HPJB 3R3SA 4JENA 2GAJA 3T7JA 5CB0A 3G85A 3OZCA 1F06A 2QR2A 2WA1A 1GFWA 1YZUA 1JDUA 3QLEA 4ZDJA 4DBZA 4FE3A 2IF2A 2QX7A 1EG2A 1EB8A 4Y9TA 2D0OB 5FBQB 5H3CA 4IQGA 1A0OA 1L5NA 1OFVA 1GUFA 2I6GA 1ORIA 4ZCSA 3UCXA 3WSTA 2GA8A 3H4VA 3GARA 1RXIA 1I3KA 3GIWA 3UV7A 4AW9A 1TYDE 4E11A 2WIBA 2FB9A 1KZHA 2WHPB 3AINA 3C45A 5JT1A 1BWPA 5BN5A 2PWYA 1E8DA 2ZIXA 3EVCA 4ZC1A 2BCJQ 4BWFB 1Y82A 1WEHA 2I4RA 2X6QA 3UOAB 1GN9A 3GYGA 2FPPA 3OU2A 4OM8A 4X8OA 5FBLB 4NJEB 5KYVA 3BE5A 2IWRA 4MW0A 4NECA 4L0QA 5BXYA 3IP7A 1VHJA 2ON6A 1ZXLA 3DYBA 2I65A 2FN9A 3MAAC 3I5YA 1B43A 1XYYA 4OB7A 3DCYA 4B9AA 1YZNA 3LPAA 3W3AH 1GOTA 1UBLS 1DWPA 4H6PA 4X20B 2WB4A 1TYZA 2DAPA 2JAHA 4XD2A 4YDHB 3E58A 3CLSC 1K06A 2F1IA 4YDRA 4ZQHA 1VBNA 2HCBA 2FMUA 1Q44A 3Q88A 3WIOA 4CI0B 5JR3A 3TQSA 1YRBA 1ZLXA 1B6GA 2PZ8A 3GFVA 1M9NA 4JYPA 4XB1A 2FZGA 3O4VA 3TNJA 3WDSA 3FLBA 3ZLTA 3CJTA 1TFUA 4A26A 4YT2A 4O0MA 1A8UA 2G04A 4R01A 3BXFA 4QFDA 3F98A 1OTXA 1CX9B 4BECA 4RFSB 2GJ4A 1DOAA 3T06B 4JQSA 2XVXA 3BDAA 4YT4A 5JBQA 2QM8A 3D6HA 2VVTA 4GI5A 2BD0A 2QJFA 2A58A 3W79A 5CRIA 4G67A 2J5QA 3O3CA 2C2XA 4Z4CA 1W9HA 4H27A 1NR7A 3K09A 2X23A 3ECCA 3KEGA 5I8ZA 2QTBA 4OUDA 3STVA 4DZZA 4ZYWA 2R8OA 5KNDD 3M5CA 3NPAA 1P73A 3A1TA 2H11A 1O87A 1X92A 1ZMXA 2AMJA 3GLHE 3HE3A 3IHLA 4U1RA 2Q7XA 4R2KA 1TT5A 3VR5H 2HIMA 5KYYA 5A5FA 3BYZA 2HMUA 2EZ8A 1SIUA 1ZAKA 3TOZA 1S8OA 3PPWA 4KE9A 2RI0A 4KXFB 2HA0A 5EYPA 5K9ZA 1QHHB 1A98A 2XYQA 4Q00A 2FPGB 4P4UA 4D8WA 3ZW8A 1Z82A 3L6DA 5TRTA 2VRCA 2W9XA 2CL5A 5FPHA 4X1OA 3PXBA 4A91A 3QHPA 2CXXA 4MXDA 4K7JA 1PEDA 2R48A 4RTLA 5IBQA 1M67A 1IEVA 4PYKA 3BGIA 3GZJA 4M0EA 5HNKA 1AGRA 3FPGA 2FRXA 3GC6A 2V6MA 2PWAA 4KWTA 5AK3A 1W75A 2FPKA 2FCRA 2J9RA 3BXOA 5IJ0A 1XROA 2AZMA 1DIBA 4MW9A 1P1FA 3BD6A 5TF4A 3RC8A 2BCGY 1SY7A 1D8TA 2YW2A 3CJQA 3I3SR 3D2AA 4MDYA 5HKKD 1NPYA 5JCOA 1Q7EA 2ZULA 3UT6A 1B6SA 3G2KA 5DN9A 3ZQJA 4F46A 1W0CA 1NN3A 2F1KA 2GEDA 4KN6A 3QW2A 2W6OA 3GRUA 3WP1B 2I4OA 1TTHA 3L40A 2BJVA 4GE3A 4ZO7A 2LD4A 5DASA 1IUPA 5HYVA 3Q1LA 1CETA 2BY4A 3ZWBA 1V5GA 2CLLB 4FGUA 5ADHA 5JFTA 1YONA 2ORIA 4MGZR 4RACA 3PK0A 1CQWA 5LQAA 2FEWB 3JATB 4PAWA 1CUAA 3NBUA 4L4YA 3ESYA 1JHQA 2IDZA 2Z9CA 5AOCA 3W2IA 5DX1A 2VSYA 2IIBA 2Q4TA 4B3DA 3IOYA 5DCUA 3ORFA 2D13A 1TQHA 1NE7A 5HILA 2NT4A 3LBHA 2JEOA 4D9HA 5KYTA 5F3RA 4MSUA 1R6UA 4HMQA 1YGYA 1CP2A 2VHYA 4RVFA 5I7FA 4JN6B 1SCKA 1OLXA 2YWRA 1NAHA 3CVVA 1FOEB 2C5AA 4CDGA 3K32A 4AKHA 5A71A 1Z29A 1TU0A 4DJTA 4F6RB 5H3HA 1YV9A 2CE7A 4P08A 1UK6A 2IYLD 3W5IA 1Q15A 3SQLA 3K9NA 4GOLD 1HE5A 2YINC 4IIXA 2JGIA 5ALTA 3ZHSA 1PJTA 4BBZA 1GSOA 2V7GA 3ZIDA 4PG4A 2IU6A 4KVFA 3HJUA 4PGAA 4JKYA 3DL0A 5IFLA 1V2HE 3CRRA 1L4UA 3QMWA 5AKGA 2J48A 3VH4A 1MJHA 1U6KA 4O4JB 3F74A 4K6HA 4FNAA 5INTA 1T6NA 2XMSA 1KO7A 4LHWA 1HG1A 5CUQA 2J6CA 4DS3A 2J3LA 1P44A 4D3YA 4HCJA 4S1WA 4OL9A 1SQ0A 1E7MA 3AEKB 1EZ1A 1G8KA 3ZZ1A 4ETNA 3GFPA 2CY0A 1KEUA 1T5BA 1ZMOA 2WABA 3IC5A 4LNHA 4UBIA 3RS9A 3UO8B 1XZDA 4LHVA 4ZJYA 4NBSA 3H2ZA 1JXAA 3AUAA 2X22A 3FKJA 3DHEA 3VBEA 1RW4A 1U2EA 1NBEA 3A36A 1Q7BA 2GPJA 4IO0A 5A9TA 5HK9A 4CRWB 3NXSA 5TARA 1IIRA 2HXGA 3CZAA 1P7PA 1T8YA 3PFCA 4L6IA 4UNSA 4NBUA 1FU7A 3VVLA 3A1DA 3LVRE 4B46A 4ZYLA 4UHHA 3KVRA 1NKSA 2QV7A 2RKBA 4KBGA 1QP4A 3DW3X 4FCVA 3SMQA 4IMIB 2Z56A 1IULA 2RCNA 3ZCRA 2B8EA 3RUPA 4CGZA 3A25A 1SAYA 2NAPA 2GX6A 2NVUA 2IFTA 3GPIA 3IT1A 1MJFA 2R6CA 2JFZA 5PGMA 1WEKA 3PDUA 4GAEA 1BTOA 2B8NA 4RPGA 4BLVA 4MLPA 2XT9A 2FW7A 3GLFB 2LBPA 4QG3A 3R0QA 1MNQA 1GY8A 3GLHB 2AK2A 3C39A 4NCHA 3VO2A 3TIVA 5C18A 2FSGA 2CSUA 3PNVA 4IH1A 1OFGA 3IVGA 4KVAA 1Z13A 1NYLA 2J9YB 3TW8A 1IN5A 3V4VB 5K01A 1X19A 4TLCA 5BSVA 3OCUA 2FI1A 2WVHA 3CBQA 4BEBA 3ICQB 2ZRLA 2A5GA 2I80A 2DEUA 1NXOA 1UDAA 3RYIB 2CHVA 5EKDA 4HATA 1BZYA 1CJCA 5IKMA 1DKRA 1Z37A 3D2CA 3RC7A 3OETA 2D1RA 5C81A 1QF7A 3IAFA 1C8KA 1HURA 3EPLA 3ZEAA 4FYPA 1Y0BA 4EPRA 2RH5A 4CM8A 4X85A 1Z63A 3IV6A 2BVNA 4KQCA 4R9UC 3KWMA 3EVTA 1MGOA 4D9NA 4DWVA 2JGDB 2V6JA 4M1QA 1VMKA 3ZC3A 4DLWA 3L06A 1QQ5A 3DD1A 4N8DA 2MINB 4P7FA 4FOSA 5BWCA 4CEIA 1JHDA 4BVKA 4DARA 1FFXA 1BGXT 1GRCA 3ZE6A 1IWOA 1IXZA 4ZP1A 5FBVB 3OWHA 5ALJA 4UQLA 4EARA 3OCCA 1F8YA 3KJIA 1WBDA 1XA4A 3PIDA 1JDJA 2R4UA 1PR5A 1U98A 1KP2A 2GO7A 4JSRA 4KDFA 5F9MA 3LECA 3LY7A 5ELLA 1HT2E 3FCCA 4PZLA 3TI7A 4Z6KA 2QD2A 1O89A 2C9DA 2FNAA 5EJ9A 4IDPA 1Z12A 3BFVA 4WINA 4LSMA 3RAJA 5IXYA 4BWVA 1K98A 1BMDA 1L5GB 3IKTA 3JD2A 3HTXA 2YN2A 3EBPA 3A3KA 1JFSA 1RYNA 2EFGA 4GH5A 1HNNA 3UGJA 4TXHA 1UKZA 4DKXA 1ZEJA 3X43A 3F4BA 3ZXYA 1SVWA 1ZNWA 5T57A 3KPUA 4PSDA 2C0QA 3RLIA 1SBTA 4E5DA 5JYCA 3DAPA 3H1TA 1SKBA 2CYAA 4FDLA 4YJDA 4MITA 1BA2A 5JDCC 5CAEA 3AFIA 5TVKA 4EM6A 2O8CA 1AZWA 2CFOA 1IN4A 1ZK2A 4MYDA 2WWYA 2RJ3A 2BHRA 1U0JA 1G8AA 2VDVE 3LCJA 5BSTA 1PQYA 5TQJA 3VTZA 3EULA 4M22A 4F1JA 3SVLA 1Z0IA 4PZAA 1GZ3A 3ZGLA 1V95A 1Z6GA 4RL4A 4LBZA 4YIKA 1E32A 3NX4A 3IKVA 4TTJA 1RQ7A 1UK9A 3EQ2A 1LBHA 1EDBA 2GZ2A 1G38A 5C4IA 4FFNA 1V45E 1CRZA 4MICA 4TWIA 1J33A 1KQ3A 1UKBA 2A4KA 4BLTA 4XQCA 2WF8A 1SOWA 1YD7A 5G0UA 4RD6A 3ZGOA 4FB4A 2WHEA 3RAFC 4PGGA 5LJIA 3G6KA 4BQFA 4LZLA 2VWPA 5M29A 3VNVA 3VAYA 4AMYA 4O02B 3FMIA 4GNRA 4BO3A 5DNUA 3LLUA 5HQ3A 2AZXA 4LY9A 1Y8AA 1ZJ6A 1AGPA 3LV8A 2CHGA 3O8NA 4JGBA 2CZQA 1RKUA 3DMGA 3I58A 1L5WA 4YRAA 3AEZA 4YHHB 5EUQB 2UYQA 5FIUA 3DZJA 1CE8B 4RTJA 1S02A 2ZSHA 1PK9A 2DPMA 2VQ6A 3ESCA 3JALA 4QBIA 3THYA 2XBUA 4HWOA 1CUEA 4P98A 3A10A 3LO8A 5DM0A 2F64A 2ZSJA 2X2EA 4MULA 1N6OA 3UAYA 5IZ4A 2CNKA 2AR0A 5FTJA 3GCGA 3QPAA 4TTAA 4F1WA 4WESA 3B1WA 4PQYA 2CF6A 2BFWA 3E2PA 1TO2E 3H1GA 4J1NA 4PZEA 3HM9A 1XELA 3CZCA 4NZPA 3ZDXB 4J4TA 2P2GA 1FFWA 4GXQA 3AHEA 5JVDB 2GTPA 5EP4A 4B87A 3H1AA 4IFTA 2CJWA 3CNBA 3OEHD 4DCOA 2Y4NA 2YHIA 2ZR9A 2YMLA 3MB8A 3CN9A 2DUNA 3REQB 4CIXA 3SZOA 2P78A 5D86A 2NX2A 4G5GA 2YV4A 1VPEA 4Q4AA 3WGMA 4ZMSA 1PJRA 5HPYB 2NG1A 2R1VA 3OD5A 2AKEA 2GYYA 1DBPA 3TPZA 1FYDA 1ZK3A 2AN1A 1VYHA 3EASA 2FW1A 2Q2QA 2ZAGA 2VCYA 2HXSA 2XUJA 5HIMA 2NU9B 3M4YA 2Q27A 4UAUA 4IJUA 5DH9A 5LMNB 3PU6A 1E1RA 1Z0AA 1W73A 2HSWA 3G8YA 4GMXA 1MTZA 2H0QA 4Z1MD 4R8RA 2RAFA 4I9UA 2W2KB 1W96A 3O38A 3V4LA 3EGDA 5D7BA 1ENYA 4OGGA 1G4AE 4OH1A 2ARKA 3H9EO 1OWOA 2DUMA 3N76A 3NJ8A 5C0OE 1QTNA 2BTQA 5EZYF 1K7YA 1PSDA 2TMDA 4OLFA 3SZUA 5ENZA 4XWWA 4N48A 2QL7A 4JNKA 1VP3A 4DFDA 1D1TA 2D5IA 5CYGA 1X6VA 1Q95A 5H1YA 2ECKA 3DDWA 1SCIA 1X8KA 3N0VA 4Q18A 1AY0A 1ODKA 5E4YA 1E3IA 2I2BA 3ROQA 2H0RA 5C1OA 3VKWA 3K0HA 5G4LA 1EFVB 1ZY2A 4DY6A 3NHWA 2I34A 1P7WA 4BQQA 3H0CA 1XZKA 1ONPA 2V03A 3LHKA 3UA4A 3TZEA 1C7QA 2VSQA 5JNUA 1XCPA 1MX5A 3QKRA 4AX8A 4TYMA 3ZJVA 3NEJA 5CTJA 3Q3EA 2QRVB 3P4XA 3WE7A 3MJVA 2GK4A 2JGMA 3K0EA 1OZGA 3VV3A 3E53A 2JRLA 3CEMA 3TTUA 2CLIB 4CIVA 4YBRA 5CIQA 4MWCA 3C4QA 3CZQA 3MOSA 1A9OA 1WUYA 3AH8A 2XECA 1A97A 3LRXA 1UXIA 4UXIA 1QHFA 2HK6A 4Z9AA 3ZHCA 1ZH6A 2PZAA 1G291 5HBRA 3RKRA 3A4NA 4K6MA 4JQCA 4BQOA 1K3TA 2DCMA 2VP0A 1XMSA 4IW3B 4JVOA 2FPWA 3B3JA 1JU4A 3X1XA 4F8JA 1K8QA 1PJSA 1KO1A 2X0IA 4BN4A 4M2LA 3SHWA 5LLDA 1S2GA 5HW0A 2Y2VA 5LZ5A 1BS9A 1SA0A 1U0EA 5G3YA 3C8HA 4D6PA 3HLYA 1HSZA 4B6QA 2H17A 3F71A 5JI3E 5K8LA 4FHEA 1F2TA 3HCDA 2E89A 3QWIA 2FN3A 1O9GA 1Z5PA 4GKAA 4OQLA 4W7SA 3N07A 2N75A 1TZJA 4OQXA 4AN4A 3L9XA 3OPQA 4N7MA 3JZFA 1S3SA 4UBNA 2BW0A 2AFHE 3U9LA 1ZFNA 2J6IA 1JJVA 1K7FB 1K6XA 4LI3X 3T52A 2DT8A 2P1RA 5B2EA 5IWAB 2H16A 3NT4A 1CUGA 1Q50A 3EVZA 4WVFA 1XCBA 3WJ7A 1ISRA 2VS1A 1U3TA 1XYVA 3D7LA 4LDZA 4RZQA 4BGEA 1ABBA 1ILEA 1OX5A 2FP4B 4A7PA 1G7CA 1X8XA 2ZB8A 2QE7D 1D0VA 2CXOA 4Q3DA 4BNYA 4D6XA 1S4QA 3EQ6A 1TECE 1XD2A 4ND1A 2VHZA 3R7FA 1QX3A 1HORA 1Y98A 3NYQA 1JFVA 2WVGA 4R2XA 2CE2X 3QV2A 4CLHA 4QM6A 1XKXA 2ZWOA 3UKOA 1WCV1 3ICOA 5DHRA 4K6CA 4IHKA 1EHCA 2NTEA 3RIYA 1N5DA 1FS6A 1UJ4A 2QJRA 1EVEA 5C46F 2JEYA 5BV7A 3BWXA 1GTRA 1G63A 1GLGA 1Z5GA 2O0HA 2PUDA 2PDAA 1FFDA 4MO2A 1KBZA 2PT6A 2FWIA 3I2JA 4RENA 3PT5A 3RVSA 3R6WA 3BSWA 3DP9A 2O14A 3OM0A 4KFSA 3IMGA 2XAAA 2ONZA 2XMRA 1VE3A 1FYXA 1NR1A 3EH2A 4HYQA 2CEAA 4RHFA 2ZYSA 8ABPA 3L7LA 5KWSA 1L7BA 1WX1A 2O7SA 1VJDA 5CDHA 2ZEJA 5EUMA 3KETA 2HREA 4N3GA 2B6HA 2WWTA 5L9AA 1MRNA 2YV3A 1AHIA 4L9SA 1RS0A 1UK7A 3EPPA 4LECA 1WXHA 3ANSA 4GKBA 2BGKA 3I5XA 2XITA 3AM5A 4ES6A 5E1MA 1ZD3A 3TAUA 1PGOA 2OM6A 1W48A 2UVQA 4F3RA 3QPWA 1LCIA 5ETJA 1XZQA 2B0CA 1IBLB 5JLAA 4QVIA 3GJXC 3RTEA 1PZNA 4Q1VA 4ESHA 5F2NA 1ZGGA 1P2UA 3L8MA 3K6SA 3ML1A 5LYYA 3IVAA 4OFZA 3P0RA