3KZ1E

Crystal structure of the complex of pdz-rhogef dh/ph domains with gtp-gamma-s activated rhoa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 11
publication title Activated RhoA binds to the pleckstrin homology (PH) domain of PDZ-RhoGEF, a potential site for autoregulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 179
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kz1E00
1YZQA 3D7MA 3T06B 2FSGA 5E4FA 4YMSA 5J4KA 4B35A 5L3VA 2ZETA 2H17A 3RS3A 2NTYC 1QDEA 1T4GA 1HE1C 4I1VA 2O8BB 2ATVA 1JAHA 1MKYA 1U8ZA 2R6AA 1ZNWA 1AGPA 1II8A 1OE0A 5JI3E 1OLOA 4W5HA 2GESA 3TRFA 1SULA 2C03A 4RD0A 4Q9JA 2C5LA 2P3SA 4JBYA 2GHIA 1FP7A 2PL3A 1L2TA 5AJZA 2R65A 5E7JA 3QBVA 1CXZA 1XEFA 4PC1A 2ZU6A 1TEVA 2CE7A 2HV8A 2CL7X 4DIDA 3EPLA 4JS0A 3B60A 3FMFA 4I99A 4QM7A 4D80A 5SZHB 2PJZA 3S1AB 4A0FA 2A5DA 1W0JD 1KJYA 2PMKA 2P65A 4Y0VA 2OESA 2BBWA 4Q1BA 5KSPA 3WNBA 4E22A 1CEEA 1T8TA 5TXGA 5FOVA 5DSZA 4AG5A 3DZDA 1LVGA 2GEVA 1DAFA 1VKJA 2BV3A 3KJIA 4C0LA 4EJSB 5KPJA 1JQLB 1NLFA 3WMFA 3ZVMA 4EQ6A 1S3GA 2WKPA 3CRQA 4KO8A 1D5CA 1JPNA 3AVQA 4KHZA 5BN5A 2WTUA 4M8NE 2Z83A 1KY2A 4CEIB 1W0JA 2IA5A 3AP2A 2FSFA 3OF5A 2QP9X 3I92A 4CT5A 3UG6A 1KNQA 1F2TB 2QORA 2WWHA 4D0GA 4AKGA 2D2FA 1RJ9B 3UG7A 2F9LA 3GFPA 4MGYR 3X2SA 3EIQA 4QC2A 3U7GA 2W83A 5FUXA 1Y63A 3ZS9A 1G8FA 1ZINA 1KNXA 3RWOA 5FOUA 4AYWA 4ZKDA 3L0SA 5JJIA 3EWAA 1C1YA 1NP6A 2J41A 2OBMA 3C8UA 3SQXA 1KO4A 1UBGA 2RMKA 3P1JA 1EK0A 5CDFE 1HTWA 3L82B 4LJ6A 3TW8B 4HLQB 4LK2A 4KSBA 4S2EA 5E3HA 2OUKA 1GVNB 3GJ4A 121PA 5KHOC 4RKFA 4UNSA 4TLBA 4IDQA 3ZH9B 2QT1A 2Q3HA 3M0EA 1M34E 4GP6A 1S0UA 1ZYUA 1TADA 1XCMA 4NYJQ 3NH9A 1GSIA 2V9PA 3C14C 5DI3A 5DGXA 3TUIC 2G1JA 4IDHA 2D4HA 3IHLA 2YV5A 2GKSA 3CPEA 4MRNA 3RS7A 4XWKA 2O8DA 1Z07A 1T5IA 4DUGD 2MSDB 1CU1A 1LTQA 1PLLA 3ICEA 2IUTA 4LHVA 2DWOA 2GILA 3GJXC 1EWQA 2HLDD 2WAXA 1UBCA 4DLUA 4Q02A 3U3JA 4DHEA 3KJGA 1DEKA 1NL3A 4BRUA 3AUXA 4B3CA 1XF9A 2UZ3A 2FH5B 4URVR 2W0MA 3E1SA 1NLZA 4UXJA 2JLYA 4AYXA 1N6LA 4MYCA 1KI9A 1XEXB 2W00A 4KV9A 5TVKA 3MG9A 3F0TA 3TAUA 3CRRA 1DG1G 5L3SB 3WBJA 1Z0AA 2XJ4A 4DUGA 1GP2A 1WP9A 2WM9B 3QVVA 5F9FA 4XSGA 1IOZA 1EESA 2F1RA 3DVLA 2ZJ5A 3K9GA 4P0TA 3KZ1E 2P67A 2CMKA 3OESA 2NGRA 4UNRA 3NHAA 3TBKA 2HLDA 1Q1EA 2ZJOA 5FL7D 1KY3A 5LD2C 3EXAA 4OI1A 1OXUA 4Q66C 5H70A 1NNEA 4HLCA 3SYLA 2REOA 5H68A 3ZDQA 2ZE6A 2ZS7A 2ZSDA 2HJVA 4JLKA 1G3IA 1T9HA 2WWWA 2BBTA 3SYKA 2D7DA 3UMRA 3HR7A 4LJ9A 1TQ4A 1M7HA 2YWGA 4YMTA 3R8FA 4MGIR 1RRCA 5C18A 1XWIA 4AK9A 1I2MA 3K70D 1HY3A 2IK8A 5EUMA 2J9RA 2OILA 1T8UA 2AR7A 2MMGA 5CYPA 5FL7A 2H1LA 3HYRA 1E9BA 3RANA 3GEEA 1CR0A 1XFAA 3CRVA 4QFMA 1Z0IA 1G8GA 1W0KD 3TK1A 2ASEA 4DT1A 1W44A 1X6VA 4GT1A 4OJQA 1IXZA 3IIJA 4XVUA 1NJFA 4PPGA 3SFVA 3KQLA 1D2NA 1CRQA 1TF5A 1FTNA 1JB1A 2ZRJA 3QKUA 2JLSA 1ZIPA 4PC3A 2JLZA 2VBCA 2B8TA 1AS0A 1C9KA 3HPQA 4I4LA 3RRMA 1TX4B 3LWNA 4HUQB 4V03A 3VKWA 1XBTA 1E2MA 2WJIA 2P6RA 3N2IA 3NHBA 2ZM5A 2GEDA 1OIWA 4HATA 2FFQA 4MDFA 4A0GA 2QP4A 4TQUS 1L4UA 2FE4A 2YC4C 2F3TA 4HB3A 1W0KA 1RW4A 1ZD9A 5LB2A 3U4QB 3OEED 1XRJA 5JEDA 2BMDA 4HAZA 2ANCA 4IEIA 4Q4JA 2JLQA 1UFQA 2RGDA 1XEWX 4O25A 1G4AE 2CCKA 2OFOA 4ZV4A 1TTTA 2NO0A 3QXJA 2D06A 2CHVA 4KXFB 1G4UR 4EPYA 5KSZA 1G17A 3K0AB 2ONJA 4MYTA 4B71A 5DISB 2A30A 4US2R 2QEQA 5KNBA 2BVNA 4LCBA 1GNRA 1P2UA 3CX8A 1OSNA 2JEOA 3SNHA 4TSFD 2O0JA 4DEXA 2ZR9A 5BN3A 3W3ZB 5TDHA 3TJZA 5KOYA 2IL1A 1Q57A 1KI8A 3FE2A 5BXQC 1CJMA 3OEEA 3BC1A 1E79D 1P6XA 2WV9A 1G3MA 3WMEA 1NVUQ 5IF9A 5FTMA 4LJAA 3LAWA 4LPSA 3M1IA 2V3CC 1E2JA 2BM0A 2WJJA 3VQTA 1FUUA 4C0AC 2QTFA 4CEJB 3THWA 3PUYA 3T34A 3J81k 1F2UB 3B1YA 3W6PA 4TSFA 1Z6TA 3FMOB 4O2LA 4XVQA 3BOSA 4II7A 4FCVA 4HAYA 5K8IA 1SVOA 4M22A 1WRBA 2GCPA 4DDWA 1HYQA 4DB4A 1NVWQ 5CYOA 3T61A 2CEAA 4KBFA 1E79A 1M2OB 4KITB 1Z83A 1N5KA 3AVXA 2QL6A 5JEEA 2AK3A 3TAHA 1LS6A 3EG5A 4WA7A 4PC6A 2AKYA 2ZRLA 1HUQA 4Q9IA 3AVWA 2R6CA 3EX7C 2JA1A 1GG2A 1KDOA 2G0NA 2P6NA 1ZW6A 1Q20A 4ON9A 3NC0C 4QBGB 3K70C 1G3QA 4B32A 2IHYA 3W6OA 2GVDC 5FFMA 4BGDA 4A0RA 1XPOA 2RGNC 2G1KA 1NN5A 3K1JA 2WWFA 4QRHA 4ERNA 1M7GA 2YINC 4RD4A 4BLOA 1W7AA 3WYGA 3LBIA 2IYZA 4KI0A 2W58A 4XTCS 3OIVA 1SXJE 2VF8A 4M4SA 3B13B 3B8HA 2V54A 1LW7A 2OSBA 3PUVA 3ZGXA 5EE3A 1NMZA 1OFUX 2MMCA 2Z43A 2ZRCA 3WXMA 3H2YA 5FUWA 1XTSA 1RRGA 5DN6D 1WBDA 2O8BA 4JT2A 4P4SB 5AJVB 4JIMA 3REFA 4IDPA 1Y3AA 4O2RA 3FMPB 3HP1A 3I62A 1FMLA 2ZREA 3RS2A 1AA9A 4BFTA 2CCGA 4URWR 3TLXA 3LLMA 1DAEA 4AIIA 2GA8A 2RAPA 4OHYA 1TUEA 1II9A 1KMQA 2ZI7A 2KB0A 2QTVB 3AB3A 1GRNA 3VFDA 4A2QA 4XH9B 3U6BA 2J46A 5EXXA 4LBVA 2RH5A 3SHFA 3ICQB 1ZM9A 3UWOA 3AVYA 2GZAA 1G1MA 4EPTA 3T1QA 1BYUA 1PLKA 3OE7D 4DLYA 3KUCA 3A1TA 5DN6A 1VIYA 1Z29A 4LX0A 3CF6R 1U8AA 2ORVA 3RRNA 2VO1A 5JHHB 3S1AA 1LFDB 2FMXA 3THOA 1D2MA 1OJLA 1N6NA 4PAOA 4B48A 4US1R 521PA 5JMTA 1JPJA 1G7CA 1E9FA 2XTMA 2YOHA 2IXGA 1G9XA 1DAMA 4PTLA 2PX0A 4URXR 1XD8A 2OAP1 4B47A 3AVOA 3AEZA 4AY2A 4EJSA 2EW1A 3A58B 4QBHA 3SEAA 2O8CB 3NG1A 5JRZA 4TLDA 4LOAA 2QSZA 4BZPA 4KVGA 4DLZA 621PA 4WIAA 4JLMA 5EXPA 1VECA 2WSMA 3IHWA 4L15A 4B44A 1P7CA 2J45A 4CEIA 221PA 3RNLA 1F2TA 4IXNA 3GP8A 5CM9C 4RD1A 4QJ4A 4DWJA 1JR3E 4L9SA 2R6FA 1RJ9A 4ZI2A 3WP1B 2W2TA 2YHSA 1JECA 1F6BA 1E9SA 3W90A 5F3WB 3MSXA 4TT3A 5J4VA 3FPAA 2OXCA 4NYIQ 4OK3A 1JJ7A 3TR5A 1P2SA 1EFRD 1IJFA 3NDPA 3P4XA 5C4MA 1Q1BA 1WMSA 1DO2A 2WJHA 4MDEA 1VG0B 3HYTA 4I1OA 2JLXA 3FTQA 3LX8A 3IGFA 2DR3A 1U94A 4GMDA 1J7KA 1ESMA 4UXIA 3FHOA 4IXMA 1E9AA 1TF2A 2ZR7A 3F5FA 5A4JA 5B57C 5JS8A 2G77B 1ZM7A 1GDDA 5BN4A 1UKVY 2DPXA 4WZ6A 4GDFA 2F1IA 1E2PA 4FMCB 3ZVLA 5IRCD 3L2OB 5DIFA 5KSYA 2O8DB 2RGCA 4XVRA 4BQSA 5FH9A 1NF3A 3HDTA 1EFRA 1H65A 1CJUC 2XSZD 5BYKA 2DFNA 4QBIA 1XB2A 4BUJA 1O87A 2I1VB 4WXRA 2ZJ2A 3HPRA 3QG5A 1SKYE 1J8YF 4LJ7A 4BPBA 1A4RA 1EWRA 1NI3A 2JATA 4RJLA 4LRWA 2BIFA 3N70A 4LC1A 5CJPA 2PLRA 4RSGA 2R6GA 2VSFA 1T0HB 1DPFA 1XJQA 1OXSC 2QAGB 2XTNA 3KB2A 2C9YA 2G83A 1AQUA 1H8ED 2WIAA 4D6PA 1R5BA 4L9WA 1HQYE 4FI3C 4IFBA 4MYHA 2XOKD 4DJTA 2A5JA 4EJSC 3ADCA 2BCJQ 2XSZA 2GJ9A 4KJZA 3CBQA 2XB4A 4G3XA 1U9IA 2JJ2D 4TL8A 3I5YA 3TH5A 3QF7A 4LYFA 2FPKA 1M1YE 1BKDR 2ZRHA 3H0KA 2JLRA 4C0HA 4Q19A 2ODNA 4C3ZA 3ECCA 4DC9A 5IT5A 1EFTA 3CO5A 4K46A 4HUTA 2C04A 2WJGA 3U7FB 4RKEA 4BLSA 4JLPA 2Q3MA 2QM8A 4Q9KA 1H8EA 1TF7A 1OH8A 4ESVA 3CLVA 4GP7A 2XOKA 4JVSB 4BZQA 4IOMA 2AHOA 4B73A 1NJGA 1Z2AA 2BBSA 2R62A 4F92B 2WBLC 4PSAA 4RZXA 1ZP6A 5GJVC 4JYBA 5JECA 4CEHB 2JJ2A 1XX6A 3GEIA 3G0HA 1PLJA 4LDJA 3WMGA 3ZZTA 3OFND 4YONB 3HJNA 3SOPA 1NIJA 1MT0A 2IBMA 1FP6A 3QIAA 3O8CA 4LY6A 1Q1QA 2O5VA 4B3GA 2B8WA 4NH0A 5UKDA 3UIEA 3FFBA 4W7SA 1W2GA 5JJKA 1SXJB 1Z28A 2JJ1A 5HE9A 3VHXA 2CDNA 3U3OA 4ZKEA 4A92A 3ZLJA 4RD3A 2FOLA 1GRQA 5CK5A 3LW7A 5EZ5A 1XTJA 3VNVA 3TMKA 2PEZA 3UKDA 5GVRA 1E2LA 4MGZR 1U98A 1IAQA 4OL0A 1GUAA 4D2IA 2ZYUX 1G8HA 4Z1MD 1NRJB 1Z8FA 1E96A 4HUQA 3BFVA 1K5DA 2GXSA 1U0JA 4D26A 1MOZA 2OO7A 3OFNA 3SE0A 1US8B 2BWJA 3WY9A 1OIVA 4Q03A 3MWKA 5K8UA 1IN7A 3LQQA 3NBXX 1GWNA 4IJMA 1TMKA 1O3YA 1I4DD 4W5WA 3F3YA 1DO0A 3PITA 2ZTSA 3U4QA 3ZD6A 1R0YA 1RIFA 2CLSA 2ZPTX 5FPKA 2XZLA 3BERA 5KNCA 3DO6A 1F60A 2D2EA 2RGXA 1ONBA 4Z1MA 3GLIB 3K0AA 5ELXA 1MABB 4DLWA 1U9IC 4I1SA 3AP1A 1QHNA 3RC3A 3DEFA 2ZRFA 4V0ME 3O8RA 1D9XA 3TQCA 4R7ZA 2CVFA 4ABYA 4YDHB 3CNNA 1FTSA 1S1MA 4P3YA 1MO3A 4C0KA 1Q3TA 4LHYA 1KYIA 2FU5C 3TSWA 3QQ5A 1N6PA 5SZKB 3UATA 1G7TA 1KI7A 2ZEJA 1ZM3A 3QPWA 2QG6A 3FVQA 1UKEA 4B2IA 1P61B 2REBA 1R6BX 1KDRA 1D6JA 3SS8A 5TY0A 4M1KA 4CEJA 1VMAA 1F2UA 2YJTD 4KFTA 5JSZB 1R8SA 4Q21A 4TQAA 1KI4A 3ASYA 5HPYB 3VMFA 2I3BA 3IILA 4UNQA 3R9IA 1OV4A 1E2FA 2R8RA 5BWMA 1G7RA 4HB0A 4RCYA 1IXRC 1NG9A 1Z6GA 5KTYA 3T1OA 2KBFA 1Q44A 4D82A 1GNPA 1QHHB 4P4UA 3CF2A 3UWKA 2VSOA 2IWRA 4RZUA 4B34A 4DCUA 4D4LA 4GOKA 4A8JA 4UJ3A 4ZCIA 3BH7A 1G19A 5CK4A 2C77A 4D4KA 4AWXA 2VQSA 4JKYA 1COWD 4U02A 2BEJA 5CDFA 2P0EA 2QA5A 3B5JA 3I72A 2PT5A 1NIPA 1ZC4A 4GI7A 4TYWA 1G8PA 5C1BA 1PUIA 5HZKA 1OXTA 3GJ7A 3K9LA 2F6RA 1ZCBA 4QBFA 2QPAA 5FOXA 4RY2A 2IT1A 4PHTA 2Q6TA 3A37A 3QOFA 1N3BA 1SVKA 4QG7A 2C8VA 4P4SA 5EUQB 3GLFE 3VHLB 1COWA 4QOSA 3K9HA 4YC7A 1D2EA 2HJGA 2P5SA 2FSHA 2PMDA 1XP8A 2GXUA 2ZYVX 4C2TA 1IQPA 2WKRA 2VRWA 4LZZA 4AC9A 1OT3A 4JJZA 3W6NA 1DTSA 3T15A 2IHBA 2HF8A 3ZS8A 2BMEA 1ZAKA 1QRAA 4HDOB 2GAAA 1DAHA 2ZUDA 5TARA 5KO2A 1W5SA 1XZPA 4LJYA 3D6TB 4J0QA 1NMXA 3IO5A 5EXSA 1IY2A 5TV2A 3WYAA 1PVOA 3KTAB 3BS4A 4D0LB 1XU4A 4LC0A 3LDAA 4LYAA 2AN9A 5FOWA 2F1JA 3U61B 1S8FA 4C30A 1ZUIA 5IHPA 2A78A 5AWFC 1FQJA 3ZYCA 5KDOA 1QBKC 3IBGA 3DPUA 4KYIB 2V4ZA 3K0CA 1MO6A 2ZYTX 2FFHA 3V4RA 3CH4B 1SVLA 2IX3A 5B2ZA 2O8CA 1J2JA 2B6HA 1N6RA 3N2EA 1AKYA 4NYJR 3D8BA 4A8JC 4R2HA 3FHCB 5EE5B 3ZVRA 3B9PA 4YXWD 4R71A 2C95A 4NTZA 3D31A 5FOSA 3Q85A 2CL0X 2QPOA 1KIMA 2GCNA 2ZI5A 4BFZA 2FV8A 2SHKA 3T35A 1MR3F 4GMXA 4X8OA 3A1UA 4TTQA 5EXTA 1GAJA 4A2WA 4LJ8A 2ORIA 2EU8A 3VX4A 2ZE5A 4LGMA 1X86B 5D3QA 4Q7LA 4IEEA 4XOIA 5FI0B 1AN0A 4HDQB 3QI2A 3MGCA 2HYDA 2P6UA 4QJ5A 2UZIR 4OQLA 2QMHA 4Q1FA 1P72A 1SHKA 3U7EB 3CM0A 2VLIA 1XCGB 3ND9A 2Z4RA 2OEPA 3AKDA 4YXWA 1DBSA 4BECA 4Q5IA 2P5TB 5H8WA 1R8QA 1J70A 4JYCA 4TL9A 4PHFA 4IFEA 3MCAA 2ATXA 3TUZC 1UF9A 4JLDA 4IW3B 5AJWA 2KBEA 1IXSB 1XNJA 2OXRA 4FMDF 3AF0A 3VR5A 1R10A 1ZM2A 2CL6X 3I3SR 4ESHA 4M53A 4V0KA 1E0SA 2IYTA 4KFUA 3ZD7A 4GNKA 4JZKA 2WWXA 1CTQA 2IYVA 3AF3A 2XAUA 4N0DA 1VDZA 4R9UC 1Z2CA 3VTKA 2C99A 4EKDA 3P27A 3U44B 1R0ZA 2ZAMA 2CHGA 3KJHA 3SBEA 1YZTA 2HXSA 4CGZA 1IY1A 1FL9A 3DOEA 1YJ5A 1AIPA 3P32A 2W6ID 4TLEA 1KHTA 2QAGA 3TSOA 4Q9LA 4C9BA 3K0CC 3THXB 1LNZA 1KI6B 1ZUNB 3AF2A 3TKLA 1GM5A 3CH5A 4DIEA 2WKQA 1KKLA 2MSCB 4ILEA 2ZQ5A 1G5TA 1LV7A 3PR1A 1QHGA 3PENA 1VG8A 4PPNA 5FTLA 1Q22A 2REXB 4JLNA 4C0JA 1H8HD 2ZJBA 3EZ2A 3WRYC 5FOTA 4B2LA 4O0MA 4TTRA 2NO6A 1P75A 1WF3A 2GK7A 5FL3A 1OYYA 1A7JA 2EWWA 4Q1DA 5P21A 2NOAA 2W6IA 3SHWA 4CF7A 4KCGA 2IUSA 5EZ6B 4LWZA 4JLOA 1M8PA 4MYUA 4YMWA 2Z5FA 3R9XA 2CVHA 3W34A 1NKTA 3A4MA 4QGFA 4BEBA 2QNRA 1XDBA 2W6JD 3Q8XB 2A3RA 4A4DA 1WCV1 1H8HA 4CEHA 1W5TA 4ZDIA 1RRPA 3IEVA 3HU3A 4URZR 4DSUA 1XPRA 1DS6A 4QHTA 3SN6A 2HEIA 3BFXA 1LS1A 3KJEA 3W5JA 1HT2E 2GJ8A 2KWIA 4M9ZA 3C7KA 5EP1A 1SXJA 2ZRNA 3BAFA 3KKOA 4UNNA 4L16A 3RS4A 3V9PA 1UM8A 1GOTA 3KKNA 4KBGA 1E3MA 1GIAA 3TE6A 3RC8A 3GLFB 2W6JA 1KK1A 2NO9A 2GF0A 4Q1AA 2QBYB 2RGNA 2YOGA 1XCPA 1R2QA 1E2EA 4Q7JB 2ZJYA 3B1VA 1US8A 2BBOA 5JFGA 4M1OA 2NMVA 2IF0A 5A5GA 2MSEB 2GEUA 2HF9A 2PLFA 2RGEA 4TZ0A 1GILA 1E2NA 2OFWA 3ETLA 2QAGC 1XMIA 1G18A 4TMZA 3M6AA 5L8VA 4Q18A 1VIAA 4LBYA 2JASA 3FDIA 3BIFA 2OM2A 3IQWA 4CIDA 1KJZA 3GLIA 1MABA 1J90A 1CR4A 1W46A 3RS0A 2H92A 2NG1A 1E2IA 1T3LA 2PCLA 3C41J 4B6EA 3LVRE 3DOFA 3B6EA 5E95A 3VR6A 1JR3D 2H16A 2LKDA 3PUWA 3VNUA 3QPVA 3IIKA 4JLBA 1PV4A 5B30A 4KAXA 3GLGE 3KQHA 1KI2A 4MUBA 1DARA 4F4IA 4JSTA 1N6KA 4KLZA 1Z6YA 5CLLA 1HURA 4OHVA 2FPLA 4B3BA 5AR1A 1KK2A 4GZMA 8OHMA 1E2GA 2D62A 1TQ6A 3RDPA 2W0SA 3GJ3A 2IS1A 2C9CA 4HAXA 3QUSA 1WBBA 5JSZA 1JR3A 2HDNB 3EA0A 4CT4B 4BFVA 4TMKA 1II0A 2BEKA 2HT6A 3BE4A 4ZPXA 4LYHA 4PHGA 4JBWA 1SXJC 4ZI3A 3I61A 4HI0E 3GQBA 2ZXUA 4A8JB 1LY1A 3I8SA 1HA3A 1FQKA 2YWHA 4JJKA 3X1DA 1QHHA 2ZRBA 1OKKD 3A6PC 2BHRA 2EFCB 2L0XA 2IWHA 3T1VA 5CITA 1E69A 2KSQA 3L0OA 1OH5A 3T12A 2V6IA 1CS4C 1CKEA 4M9SA 3OAAD 1K5GA 1S4QA 1TQ2A 4HAVA 2ZRDA 1OW3B 3ZQJA 5SZJA 3N5CA 2HCBA 4H9GA 4G5GA 4QGAA 1LB1B 3Q72A 3A1WA 3P26A 1E0AA 2W2XA 4B2PA 5LBIA 4BE7B 2PX3A 3Q7PA 2ZSEA 3FYHA 1OKKA 3NC1C 4E03A 1KAGA 4V0LA 4D4JA 4HLUA 4QM6A 4P4TA 4DLTA 1CJVC 3EASA 3ASZA 4OQNA 2O52A 5K8LA 3A36A 3M4YA 2YVUA 2GCOB 3RHFA 3OAAA 3G82C 4JL6A 4JL5A 2IYUA 1FW6A 3BK7A 3CWQA 3LBNA 1XTIA 4HZUB 2GXAA 1NY6A 2CLCX 1DOAA 2CHQA 3OEHD 4A2PA 3VAAA 3QF4B 4Z8XA 4CRWB 1NG1A 4EPVA 1N0WA 3I4LA 5C2JB 2ZI9A 3UK6A 1N2CE 2GVZC 1IJEA 1F3OA 2I1QA 4D81A 3DKPA 1JALA 3NDBB 4NYIR 1T5LA 4G1UC 3V4FA 2XZOA 4XD7D 3AH8A 2RB4A 3Q3JB 1R7RA 4JVNA 3KTAA 4M1YA 4KLNA 1Z63A 2ZSFA 2DB3A 1QHSA 4M2LA 1U0LA 1XMVA 2ZJ8A 4PSKA 4MKFA 4D25A 3Q7QA 2W2VA 3OEHA 3AGQA 4TT3D 5DO9A 2YC2C 2EFHB 1OFTA 1XTKA 4XIGS 1E98A 4DLRA 1S2MA 2CBZA 1VHTA 4A6XA 1ZIOA 1E4VA 3QXHA 4RVCA 1W48A 4TYNA 3MD0A 4XD7A 2IYQA 3R8CA 1XPUA 1S9HA 3DDCA 2ONKA 2PCJA 3BRWD 3CNLA 5DH9A 4EFNA 2H18A 5C4GB 1DE0A 3HR8A 1P9NA 1BO6A 1YHNA 2OG2A 2RHDA 5AUPB 4WW0A 4RZ3A 3RS5A 2OBLA 1VYTA 2ZRAA 1W36B 4RD6A 3B1ZA 4ZDJA 1E1RD 1ZD1A 3I32A 3K09A 1DAIA 2GJKA 2JDID 2XNDD 4PXAA 3SJCA 2VL7A 4TL7A 2X19A 3MUFA 3R20A 1XD2B 3CR8A 1U2RA 2FZLA 5DI9A 2FG5A 3K0SA 1AKEA 3LXRA 1A5TA 4JMPA 4HLUC 4NL4H 4FCWA 3RRZA 3SC3A 2WZQA 4PO8A 3WNDA 3ZZ0A 1Z0FA 3T1TA 3IO3A 4TYQA 3MAAC 1YZKA 1N5JA 4A6PA 3CRMA 2R44A 2H57A 1AGRA 1RVDA 3QVUA 3OIWA 5GJCA 1E2KA 3SZRA 4ACAA 3CIOA 5HZHA 2VP9A 1S96A 2WSSD 1JEEA 4OHWA 4PAMA 1E1RA 2VP6A 1UDXA 1GKIA 2R2AA 4IKEA 1M7BA 2EWVA 2X2EA 4LPKA 2JDIA 2QE7D 1A2BA 2XNDA 3MJHA 3SFZA 2DYKA 4B6FA 4DZZA 1BOFA 1CR2A 1OB5A 1ZMXA 1DADA 4D0NA 3NEYA 3RABA 4M1WA 3SJBA 2VA8A 3LA6A 1KJWA 1IBRA 4G01B 4LI0A 1OF1A 4GRAA 1CULC 1ESNA 2BDTA 3CPHA 4BEJA 1NBME 2ZJAA 3THYB 3AM1A 2A5YB 2QRNA 3CW2A 3U44A 4XWAA 1T3SA 3C5HA 1KO5A 2GBLA 3GLGB 3VX3A 2Z6VA 3W8RA 4EDHA 4X8HA 2GJSA 2WSSA 5EP2A 2GWHA 1VG1A 2J0QA 4BRWA 2IYRA 4MRPA 1EX7A 3QY0A 5JBQA 2V7QD 2X1VA 2QE7A 5JJLA 4L5BA 3THXA 2BMJA 2QU8A 1KI6A 2R9VA 2ZRMA 2WMNB 3KX2A 4A15A 1U8YA 1U0HC 1YVDA 2GETA 1Z22A 2B92A 2QM7A 4GFDA 4JVMA 2FNAA 1PUJA 2FWRA 3EZ7A 1R0XA 2VHJA 4BFWA 1RPZA 4NCNA 1I4TD 3ND8A 2ZANA 2JJ1D 1EX6A 1IY0A 1G41A 4UKDA 4DCSA 4OKSA 1N5IA 3SQWA 3FGNA 4LJ5A 2V7QA 2AXNA 3T5GA 1KI1A 1JXMA 3W5IA 2AWOA 1OB2A 3K09C 5F98A 5F2EA 1P9RA 3TUJC 3B1XA 3Q5EA 1L4YA 4F38A 1JAIA 3DZ8A 3DMDA 4A0HA 1J8MF 1TEXA 2ZRKA 2DBYA 1G21E 2XITA 4AKEA 1TQDA 1I4LD 4HSEA 4KODA 4TTPA 4PAQA 1IN4A 1WB9A 4BASA 1NMYA 3IUYA 4NKRA 4QHSA 1JNYA 2BC9A 3I1FA 4Q7KA 4GL2A 1KZGB 5FBRB 1DAKA 1TNDA 3AUYA 3TVTA 1N0UA 4B3XA 1BMFD 2VPPA 4FW9A 2H8KA 1L8QA 4KFRA 5D3MB 3I8XA 4MQBA 3QXCA 2AL7A 1Q3HA 3GLFA 2GAOA 1GL9B 4BLRA 3VKHA 2QBYA 2FSIA 1AZSC 2ZR0A 4POAA 1E6CA 4QHYA 1GNQA 3TW4A 4PANA 3A4LA 1YR7A 3KFXA 2OT3B 3EAQA 4RFVA 4TZ6A 4K8OA 2GBLC 1KOFA 5SZIA 2GTPA 2J0VA 5EE9A 2ZI3A 3MJRA 3TR0A 4IDNA 1VCOA 2A5FA 2BKUA 3H84A 4C4PA 1E4YA 1BMFA 4GBMA 5LPNA 4HDCA 5CIWA 2XXAB 4XTRA 3PIRA 4V0NA 1QG4A 3MWLA 4LV6A 3DL0A 4EUNA 4H1VA 3UMSA 1G5RA 3L8ZA 3MWYW 3PEUA 4ZCMA 3SYNA 1AZTA 1VCIA 1W2HA 2BJWA 1NVVQ 1UADA 1G7SA 1QF9A 4S35A 4FCTA 1SVMA 5BYJA 3X1ZA 4EFLA 4MKHA 5JWRA 3IPYA 2VSXA 1FOEB 4FINA 4QKQA 1ANKA 1YRAA 2JLVA 1KKMA 1NVXQ 1X1RA 5CIQA 2DCUA 1KMHB 4DDTA 4FIDA 1G5PA 1P60A 4JLVA 4MRSA 2IYXA 3W8NA 4LUCA 4LHWA 1JXOA 2F9MA 2FFAA 3SDZA 4QJ3A 2QMOA 2FF7A 2O0HA 4HB2A 4MRRA 4ZIRB 5AJXA 3QE0A 2ZVPX 4MH0R 3I73A 4OQFA 4B74A 4OQMA 3EZFA 2G9NA 5JWOA 3HWSA 2X77A 4OHZA 3ADBA 4OQXA 1E1QD 4AD8A 3SBDA 1CBUA 3CF0A 2IEYA 4NCKA 1OH7A 1QVRA 3W3AA 3G5UA 3LVQE 1U99A 2C98A 4N3NA 4C0SA 2ECKA 2WJVA 1UEJA 5KUTA 3KFVA 3CWZA 2WVJA 1F5NA 4GOXA 1T3HA 1P9WA 1RKBA 2O8EA 2VHUA 4WOPA 2C78A 1Q21A 1XXHE 4IOJA 1U81A 1AQYA 3AF1A 1P2VA 2EFEB 1PJRA 1GL7A 1E1QA 3PQCA 5AUQA 2QPTA 3KDSE 4ZCLA 2EVWX 2PEYA 4D4MA 421PA 1TPZA 4FD2A 1KDPA 3BB3A 4Q00A 1DELA 2Q9AA 4Z8YA 1GTVA 5J4LA 5G40A 4ZDKA 3NIBA 2IF2A 2PT7A 4Q1CA 3VR1A 3KXIA 1SKYB 4KVAA 5KDLA 3TNFA 1MV5A 3GLHE 1EXMA 4LHZA 4Q4AB 2Q0HA 5GVSA 3LRPA 2EFGA 4G5SA 5TB5A 1XTRA 3EPKA 4W9MC 4PQRA 1CP2A 5FPHA 1UKZA 1UPTA 2VYFA 1W4CA 2XJ9A 3AQ4A 3PUXA 2GCOA 4IDOA 2FPMA 1W4RA 1WE2A 1W4BA 2WMOB 3PCRB 1X1SA 3KKMA 5CJ2A 1K6MA 4GOJA 3ZZUA 4HZUA 3GD7A 3LV8A 3QF4A 4G0NA 2GJAA 3WRXC 4B33A 4LHXA 3KQUA 4Z54A 3QKSB 2NIPA 1B0UA 2Z0MA 4CVNA 1ZD8A 1M6NA 2BCGY 2V6JA 5TMPA 4QGGA 1N6IA 4EPXA 3FMIA 3TVDA 4TQ9A 1EG7A 2XX3A 2BMFA 4NPHA 2KE5A 3U6KA 2FA9A 3WBKA 2ZROA 1V5WA 2ERXA 3BH6A 1E2HA 1SQ5A 2B7CA 3EARA 1G8YA 3E2IA 4W5JA 2PBRA 1WXQA 2CJWB 2ODEA 3BXZA 2YWEA 1KO1A 2CXXA 5JWHA 5AK0A 1W36D 3QSYA 1P73A 3GCGA 1A1VA 3AGPA 5JRJA 3MWJA 1OPXA 1CF4A 4HLDA 2OV2A 3QJYA 1BYIA 1WA5A 3BBPA 4WBSA 1MO5A 3PJRA 3KQKA 1OFIA 1QHYA 2B21A 1FX0B 5FTJA 5EE1A 4GSYA 2GZHA 1IHUA 3O8DA 4QGHA 1A82A 2IXFA 4K81B 1LF5A 4JSYA 3IIMA 2VEDA 4DB2A 2ANBA 1YZUA 1EFHA 2ZS9A 5FTKA 1VYUA 2WIBA 1V43A 3CR7A 3K8YA 3AVTA 3X1XA 3MMPA 4PX9A 3PEVA 2R6DA 2BM1A 3F8TA 1RRFA 4BZXA 2FEMA 4TYPA 3RLFA 2O8FB 1YKSA 2K5UA 4ITRC 4O3MA 4IVQA 1X8KA 3U3KA 2V8OA 2NZ8A 1OHHD 1XD2A 4M9XA 4PPQA 2GK6A 4MGKR 4UQOA 2J3EA 2Q21A 1ZU5A 2J5XA 4AG6A 1RC8A 1YR6A 3K0EA 1C4OA 5FR2A 4P33A 821PA 4X8MA 1E9RA 2X2FA 4HYYA 4Z51A 2WICA 2ZU0C 5KDDA 1YZGA 3CKLA 3MRSA 1Z6XA 5G41A 3JZAA 4C0BA 3OZXA 5AJYA 1CJTC 3BD9A 1IM2A 2OCYC 3U5ZB 4TWZA 3VR4A 3BB1A 5DYGA 1E0JA 3FOZA 5JZVA 1UDWA 2EFDB 2WOOA 3QKRB 5E7MA 1OHHA 1FMJA 2J7PD 1B23P 3AF4A 4Q48A 1UJ2A 4MUAA 3GFOA 3THYA 2ZRGA 2A9KA 1ZBDA 2AFHE 4YLGA 1E9EA 4F93B 4HEJA 4JLJA 1KAOA 1P4SA 5G3ZA 3EPJA 2AWNA 3NBFA 3GLGA 4BLQA 4JLAA 5CM8B 2LKCA 3WHKA 5FBLB 4PO9A 2N1BA 2NQ2C 2OZEA 3GJ0A 1ELOA 4R2IA 3VR3A 5FR1A 2AFIE 2XEXA 3B2EA 5E7IA 5DLQC 4OJKA 3ZVNA 1GZSA 2OCAA 2E1RA 2IEZA 3PXGA 1S9DA 2IYWA 2J7PA 3QKTA 4PPFA 4V02A 5LB4A 5KNDA 1X3SA 1ZVQA 4MITA 3NTUA 5FUYA 3WNCA 3AVUA 4TLAA 3QENA 3UXMA 4PHHA 2F43B 2UKDA 4TL6A 2WWYA 1T91A 3ZJYA 3CX6A 4JVLA 2QUZA 2EQBA 2HCJB 4MKIA 1SXJD 4PZLA 3KQNA 4Q47A 2OAQ1 4NCIA 1K8RA 1GKUB 2I4IA 1E0KA 4KYUA 4RZ2A 1ZJ6A 1S3SA 4Y0AA 4DLVA 1W36C 1UBEA 1XTQA 4M1MA 4P31A 3BORA 2QSYA 2ZIAA 3NEJA 3PG5A 3W9YA 4X8LA 3LNCA 1NN1A 1XXHB 3X1WA 1Z06A 5HCIA 5L3RA 1E99A 1M74A 3DM5A 2FZ4A 3SR0A 4QXAA 1J99A 1ZNYA 3IBYA 3LD9A 4MRVA 2DWQA 1YRBA 1CJKC 4PZYA 1VYVA 3A1VA 3KKPA 4RCZA 1HEIA 4DSTA 4RD2A 2IS6A 1XMJA 1ZNXA 4TMXA 1MH1A 4KFSA 4GZLA 3RRYA 1LF0A 3DHWC 2C2HA 4IOLA 2IYYA 2GNOA 2B7BA 4A9AA 5IDVA 3BWDD 4TYYA 4YMVA 2J1LA 3GMTA 4EPWA 3GLHB 1X8JA 1KDTA 2N42A 2YKGA 2QP3A 3UPUA 3Q9LA 3R7WB 2J0UB 3LY5A 2IS2A 1DG3A 1YZNA 4C7OB 1U90A 3HU2A 4LYJA 4L8GA 2YNMA 5D3MA 4FMCF 4KU4A 3HU1A 1OIXA 3U3MA 3AVVA 2WPDD 4BFXA 1ZUHA 1BH2A 3QEJA 2PJRA 4G5QA 3SJZA 4MA4A 1Z6AA 3GFTA 2IC5A 2CNWD 4EAQA 2AKAB 3TQFA 2G0TA 4ARZB 4NHOA 5JHGB 2HT1A 5FBQB 3FFAA 1GL6A 2A5GA 2WWGA 1RE0A 3AP3A 3GEHA 1N6HA 2OBNA 2LCFA 3LBHA 5GJBA 5JCZA 2VTKA 1CRPA 5FI1B 4OHXA 3VU9B 1CLUA 4EFMA 4L4UA 3BH0A 1G291 2XXAA 3JZMA 1YR8A 1RYHA 1HE8B 1SVIA 2G6BA 1RZ3A 1I2DA 2WPDA 2ZE7A 2ZI4A 4XWOA 1G6OA 1XZQA 4RFSB 2J87A 3T5DA 2IXEA 4BFYA 2ZSBA 2VIIA 3KXKA 4N1AA 2CNWA 1ETUA 4FN5A 1X8LA 2IYLD 5JS7A 4DLSA 5HKKD 4U00A 2QN6A 4LV5B 1UAAA 2PZEA 5J4YA 2XGJA 4R98A 1G6HA 1OXXK 1P5ZB 2OFXA 4DSNA 4URUR 1OYWA 3L8YA 4YMUA 1VCMA 3DMNA 2RGBA 1E9CA 1KMHA 4AYTA 3QPUA 3PUZA 1MRNA 2BJVA 4OI2A 3EIEA 3SU8A 2V1UA 4U7DA 3AV0B 3AVPA 5FTNA 1YQTA 3B9QA 4C0QC 4ZIRA 2H5EA 2PH1A 3EW9A 2ZAOA 1G64A 1KO7A 3LH5A 4UJ5A 3RWMB 1OH6A 4DCTA 5J5CA 2NPFA 2X8AA 1TL7C 5J40A 4PC7A 2KI5A 3AKEA 5HKKA 3EZ9A 1NY5A 1T6NA 5KPDA 4OI4A 3K0FB 3FWYA 3B85A 5J47A 2O8EB 1G3UA 5EP4A 2QQEA 3JVUA 5EJEA 4AI6A 5A0FA 1Z47A 4JT4A 4B3DA 2ORWA 5L3QB 4B3FX 1KSJA 1ZU4A 2Q9BA 1HV8A 3EA5A 4DVGA 2A7QA 5FPTA 4URYR 1F48A 5G3YA 3PEYA 1WDTA 3OHMA 4E07A 2WJYA 4Q4HB 4I1UA 1NBMD 4FWTA 3V00A 5CLQA 3RAPR 4NZYA 4M1SA 2FGJA 4U5XA 3EIHA 2QAJA 1JJVA 4Q1EA 3TIFA 3AKYA 3P4YA 1A2KC 3GJ6A 1KZ7B 3NXSA 1FFHA 4NYMR 4CYMA 2F7SA 3KB1A 1JBKA 3ADKA 4QL3A 3L0IB 4F7WA 5HE8A 4Q01A 1CR1A 2VH5R 4LV8B 5HR5A 3WYFA 3NBYC 4Q4AA 3L43A 1VTKA 1NBMA 3LX5A 4OYHA 4M1TA 4YQFA 4NONA 2FJUA 1QHIA 2AK2A 2IYSA 2QRZA 4OK5A 3LW8A 3U3RA 4UNPA 1II8B 1OFHA 2QQ0A 1G16A 2FX3A 2EYQA 3X1YA 4US0R 5DHFA 1QG2A 5DNYB 3EPHA 4PC2A 3LQRA 3CZPA 1Z08A 4B75A 2CE2X 1SKQA 4FMDB 2ODWA 4IVRA 4WAUA 4ZO4A 4DDVA 4XSHA 2FN4A 3LFUA 3FHTA 2E87A 2AXPA 5KYKA 4DCNA 3OIUA 1KSHA 2WOJA 5CB8A 3QKSA 2YWFA 4IOKA 5GJWC 2IW3A 5HCNA 2D74A 1TU4A 4HB4A 2NZJA 1VG9B 2CLDX 3CX7A 3KL4A 4NDZA 1UEIA 1SVWA 2NO7A 5ANRB 1N0VC 1E9DA 4DLXA 4ASUD 3UANA 1XJ0A 2J59A 4NYMQ 4TMVA 1G20E 4MKGA 1HQCA 1YR9A 5EE0A 2G88A 5EP3A 2DHRA 3WHLA 3L0PA 3LO5A 2QMUA 2CJWA 2AX4A 3MLEA 5CB6A 3QXXA 3GLIE 3EC2A 4DEYA 4DBLC 2NPIA 2JIZD 4JL8A 1GKYA 4NE2A 3NBZC 4YDSA 3NVAA 4B43A 2TMKA 4DRZA 1Z0JA 2QTHA 3IQXA 3CNOA 3PFIA 2XB2A 1XEWY 4V0OA 3KUDA 1TUIA 2WAYA 4ASUA 3C5CA 4EQ6B 2VP0A 1FX0A 4E5UA 1W49A 3QNUA 2GXQA 4F4JA 3PVSA 4TLCA 3OE7A 4DKXA 2DY1A 1R0WA 3TGPA 1KO8A 1KI3A 4N0EA 3A4NA 5LD2B 1KGDA 3K53A 4C2UA 1AJEA 2DFKB 4BLTA 3A1SA 1SGWA 3BFKA 3SJAA 2C9OA 2JIZA 4G5RA 4A1FA 1IN6A 4EIWA 1DVRA 3EC1A 4JBXA 2O8FA 4DSOA 2OLKA 2QY9A 4I81A 5FBWB 2GF9A 4AKHA 1GRRA 4KSCA 1GITA 1DAGA 4FWIB 1D8TA 1BS1A 5IK2D 1UKYA 2O0KA 3BJIC 2VP5A 4NCHA 3LLUA 3IKJA 1Z3IX 5K8TA 3NWJA 2DFLA 5HTKA 1T0JB 3H86A 4CW7A 4HAUA 1KSGA 1KSFX 2JLUA 2CK3D 2OHFA 2QT0A 4PSVA 1P2TA 1P3JA 721PA 1QVAA 1SZPA 2RKOA 1S1CA 3C4JA 2ZVQX 2YYZA 1RYFA 1YZLA 1ZM4A 5BW8A 3QKRA 4A82A 4BWYA 5DI3B 4V0MA 3U7HB 4E09A 3U60B 1G3RA 1FUKA 1W4AA 2WHXA 1Q0UA 2ZITA 5IK2A 3FKSD 5FPYA 1ZC3A 4G5OA 3TSZA 4PQYA 2HUPA 3ZQ6A 2FEOA 3RVBA 2ZI6A 3H4MA 1CIPA 1R5OA 3WP0A 1Z0KA 1AM4D 4WZBE 3E70C 5M04A 1QZXA 2D3WA 4LJ4A 2CK3A 3RYTC 5BQ5A 4ACBA 1R5NA 4B76A 1QHXA 3BGWA 5FBVB 2ZRPA 2ZE8A 2Q9CA 1W47A 4NP6A 3A8TA 4NCJA 4Q4LA 3RSLA 4CZ2A 3I5XA 4CDGA 1NN0A 4TMWA 1ZNZA 4QNMA 2VHTA 1XJCA 1TU3A 4FMBB 3FKSA 1GFIA 4TMTA 1VPLA 2F55A 3VKGA 3D3QA 3QBTA 1FNMA 1FNNA 3O8BA 1RFLA 2F43A 1XEXA 3IEUA 1E2DA 1SVSA 2ODBA 5L3SA 1NSTA 4IHQA 4JKIA 2RGGA 3QG1A 3IPXA 4NBSA 2GDJA 3SI7A 4QNRA 2HYIC 3QXSA 4NMMA 2XTZA 1L7VC 2RHMA 5DYIA 1YE8A 5JLJA 2ZJZA 1ZRHA 3EZ6A 2JCSA 4OI0A 2XZPA 2DFTA 3DM9B 5B64A 5JCPA 1KK3A 1XXHA 3GJ8A 3K9NA 1KTVA 1AS3A 2GZDA 1JI0A 5H1YA 1R4AA 3UMFA 1JQJC 5C46F 1PZNA 2F3RA 3C15C 3O47A 1IN5A 3FKQA 4DXAA 1NVVR 2PZFA 3P20A 2GRJA 1Q1ZA 2EYUA 2VHQA 1AS2A 2Z4SA 4FXPA 4Q9HA 1VHLA 4WXPA 2RCNA 3C16C 1KK0A 2FFBA 2F1HA 2NO1A 2YZ2A 5DHAA 2IUUA 3OIYA 2FGKA 1MO4A 3B1WA 3R9WA 3IDQA 4DT1B 3GLHA 2G3YA 4WZAE 2H7VA 3R7WA 2J0UA 4M0LA 1FPMA 1FZQA 4C7OA 1EFCA 2ZYWX 1EGAA 2JAQA 2CCJA 4H1UA 5KU1A 5G53C 3CUEF 4PO1A 4UXHA 1Z5ZA 2JJ8A 2BKEA 3Q5DA 3K70B 5FPSA 4HZIA 4ARZA 3GPLA 3H1TA 2OE2A 4IVPA 3U2QA 1ZCAA 2HXYA 1E94E 4PQFA 5FUVA 2QI9C 1EFUA 2Q3FA 2VF7A 1P62B 1WQ1R 3E5HA 4OBEA 2E9SA 3LXXA 1ODFA 4NU0A 2AD5A 4Q7MB 1N6OA 1IONA 2J7KA 2A2ZA 3VU9A 1MRSA 4XJXA 5B58C 4Q4JB 3CRW1 4GPTA 5JI2E 1VCNA 3PEWA 4RFSA 2IS4A 4DCVA 2VP4A 2OCBA 1E2QA 3EWSA 4EPRA 2V55B 2ERYA 3KKQA 2Y8EA 3CONA 1JEDA 4A36A 2QGNA 4LBZA 4BLPA 1NN3A 5J4HA 2D7CA 2VP2A 5AUNB 5F9HA 1XD9A 2BOVA 3REGA 3CPJB 4F91B 3NH6A 2LWIA 1D9ZA 3PV0A 2V1XA 2QROA 1SHZA 2DWPA 2FDCA 1XMSA 1E32A 3MFYA 2ZSAA 3FB4A 1UBFA 1YU9A 4AURA 2QGZA 4HAWA 2KJQA 1HT1E 1N25A 4IRUB 1JR6A 5EQTA 3THWB 2ZUCA 1AK2A 3ADDA 3ZIAD 1IN8A 1NSFA 2UVQA 2YOFA 2QENA 2XNSA 3QEOA 3GJ5A 3VR2A 2ZUBA 1W1WA 2QZ4A 3BB4A 3DKVA 2JGNA 3K0FA 1Q12A 2OCPA 4PFSA 3B7GA 3ONWA 4P32A 3NKVA 5L3QA 3B82A 2WWIA 4BFUA 5KSOA 1BIFA 2VHCA 5GADl 4BFSA 3RSOA 2N46A 4AKIA 1TAGA 4TN1A 3CB4A 4DDUA 4Q4HA 5LDDC 4WVFA 2P2LA 4LBWA 3ZIAA 2ZRIA 2J0SA 3JVVA 2PZGA 2ZS8A 5DE3A 2AD1A 2C96A 2OLJA 1NKSA 4PZZA 3KXLA 2RGAA 6Q21A 2JLWA 4OK6A 5AUOB 3AKCA 4M21A 2QMEA 4PR0A 4ZDWA 1HH4A 3CZQA 4F4CA 3B78A 4M9QA 1N5LA 1OXVA 1NLYA 4LSGA 1Z0DA
chains in the Genus database with same CATH superfamily
1TPYA 1YSCA 3D7MA 3DOHA 3PPVA 5E4FA 3NHRA 4YMSA 2ADMA 2COEA 5EJFA 2AOUA 2H7YA 4MVJI 4XX0B 1QE5A 4MJLA 3RTEA 2D1YA 2HJWA 4JASB 4UVDA 1AHIA 1EFPA 3FUWA 2VXCA 4OO3A 4UHKA 5SYNA 3TO5A 1FIUA 1GN8A 1II8A 2E55A 5JJBA 4Q3BA 2EKQA 2FFJA 4D99A 2TS1A 4YV2A 2HSDA 4W5HA 4HFRA 2IHKA 1PR0A 4OSEA 3JARA 3H5IA 6CHYA 2AOTB 5KI6A 1R0RE 2P3SA 3F8SA 4NZPA 2ACVA 1FP7A 3NONA 1M67A 4N39A 2BP7A 3T9FA 2CLFB 1DQSA 2V45A 3GFVA 3D6HA 2FX2A 2WYIA 3DQQA 3OQBA 1CXZA 2R8YA 4PC1A 3MJDA 8GPBA 2I9KA 1F8XA 3OFSA 2CV2A 2NQTA 4MW9A 2OQ2A 4P83A 3PPXA 2D00A 3PC7A 3OECA 2HV8A 4OX9B 1H1DA 4HH0A 4JS0A 3FMFA 2V97A 4NABA 3UK1A 1Q0HA 5BMVA 2GN0A 2J48A 2FW7A 1RJDA 4OLFA 5H82A 2O19A 3S1AB 1M1UA 4YCNA 1RLUA 1HFKA 2NACA 2VDJA 3VSCA 4P3KA 3CLSD 2PMKA 4D9CA 2ADFA 2QIPA 3V42A 2R8ZA 3WV4A 1K4YA 3UK2A 1RYYA 3WNBA 4M87A 3BYZA 2PUWA 4E22A 4CTOA 1CEEA 3H87A 1BX1A 2I7CA 1JFSA 2RAUA 2H1WA 3NUZA 3Q7TA 3RS9A 1LVGA 2D1QA 2EHJA 3TRJA 4UUMA 4A0SA 2Z4TA 2AR0A 4EITA 1NLFA 3PC2A 1OBOA 2C7GA 3CZMA 3DC2A 3U4AA 3ZVMA 5BO5A 1AK9A 1JHUA 3GF4A 3P9XA 4LWOA 1D5CA 3HHEA 1TUBA 5HFJA 4EATA 1K86A 2OD2A 2WTUA 2Z83A 2HEGA 1C80A 1CZRA 1L7XA 1KY2A 1X19A 4MCAA 1W0JA 3RUPA 1NW4A 3W5VA 1IYZA 1R4NB 3PT5A 5B12A 4PTZA 2HWKA 2D2FA 2FRVA 5TQ0A 1NI5A 4DJFC 1YRYE 4GRIA 5JDCA 4LF6B 3AWDA 5DKFA 2F9LA 3IH5A 2EL7A 1MX9A 3RSQA 2WK1A 3KALA 4QYSA 3X2SA 2QM3A 2QVGA 5EVJA 3U37A 3ZHXA 3AHFA 4C78A 1B7GO 1CUIA 2YY5A 5LMUB 4HDNA 3Q6IA 2IPAB 3IB3A 4EUEA 1Z74A 3JAKB 3QX9A 4XD2A 1N57A 3UK7A 4C5CA 1KNXA 5FOUA 5K0LA 2LE0A 1GYPA 4B83A 4ND3A 3F96A 1T4DA 2A8YA 5DPMA 3RTDA 5JJIA 1WCWA 3LBFA 4G8DA 1ZESA 1HPLA 2ORYA 1XZDA 4R2MA 3SQXA 3P1JA 4MUKA 1ORVA 4LJ6A 3TW8B 2WFMA 5AM0A 5F3DA 3HO1A 3IDAA 3GP3A 5E3HA 3GJ4A 1C4XA 2V7GA 121PA 1GT91 2IYPA 4UNSA 3R7FA 4IDQA 4CKXA 1AOXA 3LY8A 4GP6A 4W1QA 3CF4A 5LR6A 1ZYUA 2JIDA 1XCMA 3K5PA 1YUBA 3NH9A 4N40A 4NYJQ 5AQ1A 4UAVA 1G6KA 1KJ9A 5DGXA 1U8XX 4FOLA 2PKRA 5IF3A 3HVIA 3D54D 1V6AA 3IHLA 3IT3A 3RS7A 3OWXA 2JKYA 3TL2A 4XWKA 2O8DA 1TYDE 2GDZA 2GRAA 2W2LA 1MXFA 1CU1A 5NULA 1UANA 5KKAA 1JTVA 1R9MA 4RTNA 1PLLA 3BWVA 3ICEA 1BW9B 2TMGA 4L76A 2JGKA 1GSAA 2B5VA 4Z6KA 1E5DA 2WAXA 3MWFA 3SLKA 1JSXA 4DHEA 4Q02A 1KEEB 3IR5A 3KJGA 5KTPA 1DEKA 1NL3A 4U2GA 3AUXA 1DHTA 3AFMA 4B3CA 5TIIA 4DEVA 2A33A 2V9ZA 1NI4B 3U7RA 5AW4A 1AHNA 1QONA 1ZGCA 3UA3A 4E7OA 2JLYA 1BJRE 2W00A 1LC3A 3DBRA 3NP9A 1QWSA 3EC7A 4UE3S 4COKA 1CETA 3D4PA 2QM0A 3Q3HA 3ETJA 3HN2A 3G49A 2MT9A 4D3XA 3TF5A 1GP2A 1WP9A 3K4HA 4XSGA 1EFVB 1MA3A 2RH8A 3JALB 1L4MA 3K9GA 3KZ1E 3H5VA 5JCOA 4E33A 4GUAA 1GZUA 2HLDA 4X94A 4YP9A 3SK0A 3WIDA 5C51B 4HWPA 3SC2B 5LD2C 2QN9A 4J91A 5EJGA 3Q7EA 3NBQA 3NANA 1R8JA 4HLCA 1RXVA 1DRJA 1DQRA 2C00A 2CN1A 5IJZA 3SYLA 3ZDQA 3GYGA 2O3RA 2ZS7A 2JBAA 2O2CA 2ZSDA 3G5TA 4JLKA 2D3TA 1UK7A 1OAAA 5ALIA 5I9TA 3RYIA 3DO5A 1LD3A 2KS6A 3AM4A 1SKAA 3UMRA 3HR7A 2BD0A 2Z95A 3LI2A 2YWGA 4G0XA 3D4LA 5KTTA 4MGIR 1WBJB 4ZZ1A 3U16A 2VJPA 1E89A 1SIOA 3D3WA 2J9RA 5HXAA 2Y1XA 2MMGA 2UV8A 4D43A 3IEIA 4KN5A 1A9YA 1THZA 5TT1A 4UPDA 3USZA 3VYRB 3CVOA 3COSA 3OQIB 2A3NA 2V7XA 4B0OA 4D44A 4YPVA 3G1UA 4UAJA 2QR5A 1G5HA 1NZJA 3CRVA 1Z0IA 4QFMA 1G8GA 4RY0A 4WPGA 5D5HA 5DBOA 1K7YA 1W44A 4KNVA 4OJMX 3LY7A 3LQYA 5HIKA 5F73A 3SFVA 1A9TA 2JI6A 3BGOS 5IJ9A 2QRLA 1FTNA 1SQSA 2PRZA 3QKUA 2VBCA 2B8TA 3PC6A 1C9KA 3HPQA 1YONA 4I4LA 3RRMA 3LWNA 2HHLA 4HUQB 1I1OA 1SCDA 3WB0A 1XBTA 3TFQA 4ZEMA 2GM5A 3DE3X 4D97A 4KMOA 2NU9B 4WBXC 2Q0SA 5JROA 3O26A 2ZM5A 1BROA 1OIWA 1QC5A 2A92A 3ROEA 4D98A 1YOVA 2QP4A 3S2IA 3T3DA 4NBLA 1RW4A 4C03A 1F0YA 1N5OX 3DVAB 2VG8A 1XRJA 4QRDA 4HAZA 4IEIA 4QLAA 4ZV4A 2OFOA 2VDVE 2NO0A 1LWNA 3IALA 3QXJA 4EA9A 3V4VB 3JRWA 4RVFA 5EUCA 5J2TF 5KSZA 2VR1A 5TPZD 3K0AB 1KQOA 2ONJA 2ZB7A 3MFQA 5DISB 5EKTA 3W5HA 4BX3A 4US2R 1GNLA 1VL0A 2HU2A 2VK8A 3I9KA 5JXIA 3QX3A 2IY7A 1FY2A 1IG3A 3F1KA 2ZK7A 4MRAA 3W3ZB 2QN3A 4HDSA 5KOYA 3RT7A 4LF5B 5JCOC 5K0ZA 1C3VA 4WSOA 4I1RA 5F76A 1DWPA 4BV9A 5BR1A 5CEEA 1T0IA 4CLOA 3OEEA 1CQXA 3E0XA 1P6XA 5JISA 1GAXA 2NXEA 2OM6A 4CR6A 1ZVVA 3G9UA 1ST3A 2OCGA 1NVUQ 6GPBA 3REOA 1CP3A 4MROA 4K6GA 4O2AB 4KRXA 2JFBA 2PZBA 3M1IA 3P0EA 4LPSA 4EY7A 1NQOA 1UOEA 3A4YA 4L4YA 4GO1A 3G2NA 1K08A 1H23A 3O1IC 1PJLA 4CMIB 2PQMA 3MPOA 3PUYA 3T34A 5A05A 1ONSA 3G79A 2W7TA 1O97D 4RKQA 4TSFA 5EL0A 2ZVDA 3CHYA 3MS2A 3EOAI 4QYIB 1E63A 2LZ0A 4KLCA 1AUOA 4M83A 3WMWA 4ZI2A 1JEYA 3BOSA 2VJAA 4JI1B 2SICE 1E1KA 5F2KA 1Q6ZA 1T2AA 2OO5A 4MWOA 1NVWQ 3T61A 1RT9A 4GPAA 3QFHA 2P4QA 1E79A 1VLQA 1JU9A 5ESWA 1DI0A 4KX5A 3KRTA 4KITB 1B4DA 2IQIA 3EB9A 1E1YA 2QX6A 4ECEA 3TAHA 3WWEA 3LX6A 1A5AB 3EG5A 1CT9A 2WWRA 3TQQA 1XYYA 4B9EA 1C7JA 2W5UA 2B4YA 1SIBE 3I58A 4R1NA 3WE7A 5HUQA 1J20A 1AV6A 1Q20A 4ON9A 1UC5B 2C54A 2AB0A 3L7DA 3L79A 4ZOLB 1AKUA 2I7VA 4B32A 1RHJA 1RM5A 4BGDA 1XPOA 4KQMA 2GEJA 4YAWA 1VI5A 3IDFA 5KC8A 4OU4A 3B2NA 3KSAC 1M2KA 3U19A 1L5FA 3GGGA 3QX8A 3B3JA 2VK1A 4WJKB 5AVVA 1M34B 2YICA 1RI2A 3PE4A 2IYZA 3IRUA 4QOEA 4I9FA 2W58A 3FCSB 3OIVA 1SXJE 4HX2A 4M4SA 4Y6GB 1DDGA 3QYAA 1CCWA 4ICIA 1P1IA 3RO7A 2OSBA 2FG7C 3ZGXA 2Z09A 1FNCA 2YJNA 4N01A 4G89A 1OFUX 4XX0A 2ZRCA 2QLJA 1EK2A 1E92A 3H2YA 4EOGA 1XTSA 2PE5A 1HM5A 3NNDA 2XBLA 1XDWA 1NV8A 2QVXX 3B5EA 1EWVA 3RLIA 2YJGA 1WBDA 4JIMA 3LIPA 3REFA 2QTZA 1Y3AA 4IDPA 4FTWA 1PR3A 3FMPB 3UGTA 4YECA 5JXJA 1V8DA 1ZS9A 5FO0A 2ZREA 3DWEX 3TAXA 4BQNA 5LQCA 3RS2A 3ND5A 2AOTA 3B8EA 4MARA 4OHYA 3ZV4A 2WR8A 4KN9S 1L5NA 4QQ8A 4IM7A 3KIPA 4W1RA 4R1QA 5A9SB 1I1QB 2J46A 3OHPA 4QVGA 4OQQA 4TKUB 1EUZA 4REMA 2PH3A 1ZM9A 1XK6A 4BU0A 2VFAA 5M3BA 3ZXXA 4CLEA 3TIGA 5EPOA 4O4HB 3STXA 4DLYA 5DN6A 3B20A 5GMOA 3DAFA 1P33A 3KQSA 3AU9A 4GLOA 4BKQA 5KOJB 3GQVA 2FQWA 4L0CA 3HABA 3IC5A 4GAEA 4PM4A 3UHFA 5IDWA 1ENZA 1PYGA 3LG2A 2VO1A 1UK8A 2DPGA 3H4IA 1IHXA 3S1AA 5JHHB 3IT0A 2H1FA 1LFDB 2D59A 3THOA 4LDQA 1Z0ZA 4B4KA 1PF7E 3R77A 4PAOA 4US1R 1RXWA 5JMTA 1XLTA 1G7CA 1E9FA 3A05A 5JTUA 1D6SA 2OO5C 2PFGA 1B14A 4GBJA 4MWSA 4A10A 1DAMA 4RC9A 1UJ4A 4P7GA 1PGPA 2PSSA 4F9TA 2O06A 2P7HA 4URXR 1B3BA 1XD8A 2OAP1 4B47A 5IXYA 2G80A 3OD1A 4XGQA 3PUIA 4QBHA 4DQKA 1K75A 3NG1A 3UAXA 4G1EB 1QFYA 2VBIA 4UC0A 2BEUB 3GYBA 3OQHA 5ALUA 4KVGA 4BZPA 3BF7A 5F1PA 4DLZA 2HHCA 4JLMA 1I51A 5EXPA 4KAJA 3OOSA 3IHWA 3B1KA 3PDIB 1EVLA 3LQFA 4L15A 3MHPA 3R4VA 3UAWA 2X41A 1F0PA 2NXNA 3HO6A 3DUFB 4MUYA 1IZZA 2BFDB 4AZTA 3GP8A 1R4NA 4JUBA 4R6WA 4KNYA 3DMHA 3UJPA 2XB6A 2P9FA 4Y67A 2JFUA 1K5HA 1YTLA 3K71B 1VA5A 1JECA 1USWA 2Y9PB 4I3FA 1K92A 4J7CA 4M8LA 4LQCA 2PXXA 4KC0A 1VA4A 3PE6A 4OQEA 3VC7A 4NYIQ 4OK3A 5DNWA 1JJ7A 5JNWA 1KQNA 2Q3CA 4CIWA 3IFSA 2XE8A 4G5FA 3OTGA 3JAKA 1K8YB 2HSWA 1ZD2P 3NDPA 3UHJA 2Y3IA 2R5WA 4W8GA 1GPDG 4IUBS 4X6XA 3AR6A 2JLXA 4MDEA 5CA0F 3ESZA 1I30A 4WBNF 1J7KA 4HJRA 1TZBA 1UWKA 4UXIA 3YASA 1PK7A 3FHOA 1FMFA 1N3IA 1TF2A 4UZEA 5JS8A 3U81A 3TW8A 4JJEA 4HC4A 2ONCA 4BLWA 4EL5A 2HCFA 2OP0A 4QUJA 3ZHBA 5IBCA 3Q1LA 1GDDA 1UKVY 4WZ6A 1E2PA 1RCFA 1T9ZA 2XLCA 5IRCD 5DTQA 1Z4LA 1GPBA 3AEKB 4DCCA 1GUZA 1O0BA 1YWGO 4IJ6A 1UT6A 1NF3A 2TECE 3S2GA 1T3TA 3HDTA 2QRVB 4BQSA 1EGHA 1OYVA 1RR6A 2CLHB 3C39A 1KIAA 4FEYA 1XR3A 1KEZA 1PCXA 4L4RA 3UWMA 2DFNA 4QBIA 1XB2A 4DQVA 1GGFA 2VF4X 4XFDA 4AIRA 1YXMA 4LJ7A 4OREX 4BPBA 4YQEA 1BW9A 8LDHA 1NI3A 3X3HA 2JATA 3PR3A 4EA7A 1HYHA 2WSIA 2B34A 2MR6A 3KKZA 1RP1A 3CF4G 3EXHB 3SQOA 2PLRA 4LNUB 2R6GA 2VSFA 2VA9A 4RSGA 1XLTC 1DPFA 3IQIX 5ALEA 2R5FA 1KEEA 3L7NA 3E5RA 5HF6A 3O6VA 5T41A 1OILA 2HPZA 4PRLA 1NI4A 3AETB 4PGHA 1XU7A 1TVKB 3AB7A 5ERXA 3LPDA 4FI3C 1IDOA 2DX7A 4M76B 3T3HA 1IQUA 3HE3A 3N1UA 3P2IA 2XSZA 5AOAA 2CVQA 1XLWA 1G5QA 1Z4MA 1ZUNA 2V5AA 3IBFA 1TQHA 5AHOA 2OQIA 5EIWA 2B2CA 3JYQA 3T0GA 3CBQA 2XB4A 5DM2A 4BCDA 5A1JA 3VM6A 2PUBA 3B51X 3N7TA 1M1YE 4NS4A 1EFVA 4RS3A 4BO7A 4OP1A 4A7PA 2RHOA 3JALA 3OKCA 1CUEA 3H0KA 4PQGA 3VPSA 4QX6A 4U8GA 4FQ8A 2IJGX 3IIEA 3SC2A 1G0NA 3R76A 3WOHA 4XLZA 4FDTA 1F06A 4FE3A 4HN9A 4HUTA 5JV5A 3U7FB 2TMYA 4DQDA 1M9NA 2Q46A 4ERXA 4EEZA 4BLSA 4JLPA 2Q3MA 2AJBA 3KKEA 3P8ZA 4Q9KA 5DGIA 3VO9A 5CLIA 3D64A 4GP7A 1E61A 2FTKE 2XOKA 5ARDA 1OWNA 4IOMA 5DYTA 2R62A 2WU4A 1OTYA 1PQYA 3SYMA 2D6FA 1F12A 4Q3KA 1NLUA 2WM2A 2WZDA 3ZWKA 1ODKA 4PS0A 3AEUB 4ZOBA 2D5BA 5GJVC 4PZCA 3S8EA 2B1QA 5A5GA 3UMMA 3GEIA 1NT2A 3KTOA 4PG4A 1U0EA 1P1HA 1D4AA 3VVLA 3WMGA 1L3IA 3NJ8A 3JWEA 3VXKA 5BWLA 1W5BA 2JAHA 3PR2B 3UWSA 1CPYA 3K6SA 1DXYA 1JHXA 4OXYA 3OQIA 5EESA 3ZHUA 3EVZA 3UIEA 1J2TA 3FFBA 1GTL1 1DMSA 1W2GA 3I01A 3DTTA 4M99A 5BSGA 4G41A 4B0PA 3KU4A 5HE9A 3WIEA 3AINA 5H83A 4ZKEA 3ZLJA 2DKNA 3C97A 4UD2A 2V7WA 5CK5A 3LW7A 2ST1A 3UKDA 2Y1CA 1PT5A 3E9EA 1EJ2A 2BFBB 1TYZA 2B61A 4D2IA 2ZYUX 3PC8A 4MO2A 5BVHA 3F5MA 4HUQA 4U7GA 1K3FA 4C4SA 4X00A 1KYTA 2NU9A 4D26A 3SE0A 2ZUFA 1M6HA 4IMJB 3V4SA 3HCRA 3HA5A 4DG5A 3V8RA 1DOHA 1YQDA 3PDHA 1PKEA 3CUUA 2QI9F 1ZI8A 1IN7A 1U80A 4IJMA 4EG1A 3DP7A 3ZD9A 1EMDA 1WPXA 1I4DD 3PIDA 4UCXA 4W5WA 4KR7A 5IAEA 3PITA 5T67A 3DVAA 4F11A 4C4RA 5IU6A 3ZD6A 3HHPA 1G20B 5AKZA 1R0YA 2Y76A 1UL1X 5FPKA 3CLRD 5THXA 5MDHA 2PKQP 3BERA 2GBCA 1AN9A 1F60A 2RGXA 2RGUA 5K0FA 4Z1MA 3GLIB 4K9PA 3K0AA 4YJ3F 3OEWA 3ELYA 6YASA 3HFSA 2OBFA 4HL6A 4DLWA 5KX5B 4GI5A 3HUEA 4JJIA 3RC3A 2D1TA 1N0HA 5AVOA 4PCUA 3WTCA 3QU7A 3TQCA 2Q1UA 1P0FA 2CVFA 3PYLA 4XFJA 2Q4BA 1H5UA 2VS1A 5EWLB 3KEFA 4E1BA 1GDHA 3T38A 2HN9A 1RWQA 1O5TA 4LHYA 1P2FA 5HIMA 4KOAA 1U6IA 2VDRB 2YVQA 4N7RA 1BRMA 2IDMA 2ZUSA 4MV3A 1P5RA 2PBLA 3PXDA 4XFKA 1SXQA 1YMQA 3GRRA 4K9RA 5EJIA 1YQUA 3FVQA 4W5TA 3PL5A 2E3JA 4B2IA 1P61B 2GT1A 2O50A 3BKXA 3E9RA 4LDPA 4OL9A 4DLAA 3N87A 4ZT4A 1KDRA 1J97A 4G8JA 4CMIA 1IB6A 2P6MA 1L4BA 1NUQA 3A31A 3DBIA 2YJTD 4HTFA 3UMBA 5JSZB 1KTIA 1R8SA 3I5AA 4HXFB 4CKEB 2YHBA 3E2MA 4QYIA 1LLCA 4E5KA 1Z4QA 2OQRA 3VMFA 3A3KA 2I3BA 3IILA 3OZUA 4WKGA 3V5NA 1QTIA 4UNQA 3R9IA 1XN4A 2VJQA 4U9IS 3ZU5A 2Q9UA 2YJ5A 4JLWA 3R8XA 1G7RA 3N8HA 1MC8A 1YS1X 3R3ZA 4NE9A 4RCYA 1IXRC 4FONA 4MB2A 4I3HA 2O3SA 5KTYA 3T1OA 1GGMA 4KUEA 2GTHA 1IEVA 4JBNA 4E0BA 2W6PA 3U1TA 4D82A 5C7IO 2D4AA 3SX0A 1N77A 1KYVA 3D8TA 3T7IA 5A3QA 3M5WA 4GOND 3HDVA 4GOKA 4YRKA 1YIAA 1ZSYA 4ALNA 3G9XA 2JKZA 3PC8C 3KJFA 1FDWA 2OECA 3H83A 1HT3A 2YHUA 1R74A 2BEJA 4G63A 2P0EA 1SMKA 2QA5A 3I72A 5CUQA 3CZAA 1ZMBA 4ZOLA 1WVMA 3MCTA 1Z68A 3RRFA 1CEYA 4GI7A 4TUYF 1WSAA 1G8PA 1PUIA 3JV7A 3WB9A 3WFJA 1M34A 4AJLA 5TE9A 4BNTA 5CDSA 3PHJA 5I5GA 3K9LA 4ZV7A 4CM6A 3ZDCA 1ZCBA 2QPAA 1YZYA 2EX0A 1A7KA 1EFDN 1EP1B 4FNOA 4A8JA 4UM7A 1C8VB 2IT1A 3A37A 3LUGA 3DTVD 3DH0A 2BM9A 3AYXB 1N3BA 1WDWB 1V5FA 3H05A 3QVXA 4IJ5A 5E0KB 4PYQA 4UASA 3C3BA 1JKMA 1YIOA 3T0FA 4DIFA 5JNRA 2VBFA 3DLHA 4ENPA 4F5EA 5FNVF 4R16A 3PCTA 1F8FA 4TSKA 5ESXA 1E6WA 1XCLA 1R6VA 4MQ6A 3ZE7A 5BUZA 4PICA 5JAZA 2WKRA 4YP7A 2VRWA 4LZZA 3WGKA 1HORA 4RENA 4NARA 3F90A 3HH8A 4YRJA 5A9SA 5KQMA 3I2GA 3RUEA 4KP7A 3T15A 1GUDA 2IHBA 3K92A 2HF8A 4TKUA 2VKTA 2BMEA 4F5WA 3DBVO 2RDMA 2ZUDA 4RH0A 5TARA 4C07A 1AGYA 4UARA 4C08A 4C4AA 4PWZA 4XE5A 3D6TB 1DUVG 3LF1A 1LSUA 3O8OB 4O4HA 4J0QA 1BRTA 1NMXA 3H2BA 4N54A 1ZO8A 4UHHA 1VHQA 5TV2A 3W7BA 1PVOA 1F4PA 2GD0A 2HF2A 4PXSA 1WVGA 4TWRA 3RYFB 2NZVG 1P1FA 2AN9A 2V7VA 3I9FA 5FOWA 1Y4ZA 1S8FA 3UK0A 5LC1A 2YFYA 3DVSX 5IHPA 2PMFA 4HD8A 2A78A 4AX4A 3S8MA 1R6DA 1B74A 1JQBA 3TTVA 4N0QA 4B45A 3QVSA 2A86A 3FX2A 5K3AA 1GZ3A 2P3LA 1MO6A 1Z56C 2IZZA 5INTA 4IIXA 5IWCA 4LY3A 3PRKE 1JEJA 2VXOA 3DAGA 1FFXB 1N6RA 4MSUA 1AKYA 4NYJR 3V7FA 2OORA 2BEUA 3G17A 2R1VB 5EIEA 2VKQA 3QNWA 2JJYA 3FHCB 2FW6A 4ZYLA 3IDSA 1SXIA 5DW0A 1TM2A 4UTVA 2X3YA 3PDIA 4ZYWA 1J0BA 1FFEA 2X5JO 3B52X 4BFZA 5E6RB 1QORA 4QDUA 2ZIGA 1JPVA 1Z26A 3DUFA 1MR3F 4DXDA 1RYEA 2BFDA 4HGPA 5M5BA 5TMBA 4XYEA 4IDEA 1U1DA 4R8KA 5J63A 5JO9A 3WDLA 4A2WA 2ORIA 3VX4A 1FYXA 4WJZA 4HVCA 1L9XA 2RI1A 2ZT7A 4OB8A 3COPA 3X0DA 1VLVA 3W2GA 4R54A 3QNMA 4BXOB 2OXIA 2ZGVA 1PS9A 1XVTA 2P6UA 2BTEA 3NWEA 4U7HA 1X9IA 2QMHA 1FFCA 1FS6A 1QCDA 3LFTA 4H7PA 3KSDO 2Y67A 3QPCA 1BMDA 1T29A 4YXWA 1DBSA 4H7FA 4DFDA 2BM8A 3HP4A 3AERB 3V1TC 2F8MA 1P7YA 1RWXA 4M46A 5DCLA 5CLFA 1TECE 4G84A 4LCJA 4PCVA 1QM5A 2WE7A 2JVKA 4G23A 3PTLA 3IVMA 1J8VA 3O8LA 4JGBA 5HBGA 4AMGA 4H4CA 1PZEA 4M53A 5AHRA 4V0KA 2CLMB 1E0SA 1GPLA 3QYFA 4KFUA 3AEKA 4GNKA 5DEIA 1ULUA 4RVSA 1T2EA 1DIAA 5BURA 1IY9A 1YR2A 4RBNA 4OIFA 4N0DA 1VDZA 4D0SA 3B7PA 1R16A 1Z2CA 1WF6A 5K51A 5DP1A 4EG8A 1CUJA 2C99A 5B3JC 4C0XA 3TRKA 2QJOA 4ZO6A 5K99A 2ZAMA 3M6LA 4K86A 1Y3DE 3TKAA 3IVGA 1O6ZA 5DTJA 1Z5NA 3DOEA 3IP6A 4FS8A 1RAHA 3GDOA 3EXHA 3OT1B 4IDAA 3P32A 5K01A 1U8FO 4HUJA 5U9CA 1KHTA 3LZ6A 4Q9LA 2JFZA 4B3TB 2NSHA 5AOBA 3THXB 4MWTA 1LNZA 4PLVA 3AETA 1K7SN 3H2HA 1GM5A 4UOQA 4DIEA 9MHTA 3A25A 1Y9EA 4EM6A 3JQ7B 2BUBA 1ISMA 2B6NA 2OORC 1XVLA 2PTGA 2BTOA 2ZQ5A 3HGMA 2I6SA 1RKVA 4HGYA 3DMGA 4PPNA 4TXMA 4U0JA 2AMJA 5K1ZA 4UOZA 1E7MA 1U7WA 5BN1A 1TRKA 1G8JA 4MYSA 1KETA 3VPFA 3WLAA 1BXZA 1U11A 3DHVA 4C0JA 5KIAA 2ZJBA 1L5KA 2AG6A 1D5WA 4O0MA 3MT8A 4M1ZA 3AXSA 2GMWA 4GH5A 1WF3A 4MQFB 1OYYA 3TVYA 3UUEA 3GW8A 1SBZA 2NOAA 4Q1DA 2HC9A 5P21A 4CF7A 4ZYYA 3M6WA 3ANNA 5FTLA 1ZR4A 2O57A 2ADOA 5EZ6B 1BA2A 2BFMA 1U0SY 5ESRA 1K6EA 1ZMRA 5EI5A 2YN0A 4JLOA 1E7RA 3RVDA 5FPQA 3S1SA 4YMWA 2MSLA 3INYA 3NHPA 3OTQA 1BWPA 2CVHA 1OWPA 1JDZA 4JJGA 4MHOA 5F1OA 1ID8A 3CINA 1RAEA 4QGFA 4BRSA 4B81A 1EIZA 5JT1A 1IPEA 1XDBA 3P9IA 3AEUA 3Q8XB 3DL7A 1KZHA 2VNSA 4KPEC 1WCV1 2HA5A 2GN8A 1W5TA 3NOQA 3ZY4A 2P4UA 3N3BC 3HB5X 4KEAA 3TLGB 1UXHA 3LC2O 4KQWA 3SN6A 4C43A 4H77A 2VOJA 3TW0A 2ILTA 3V1LA 3KJEA 3HTXA 2UUAB 1HT2E 2XXJA 3A3PA 3HL0A 4YHBA 5DIZA 3K31A 4MV0A 1T9AA 1A3CA 3C7KA 4R8SA 5A4MS 4KRFA 3BAFA 4EFKA 4QUDA 5TJHA 1L6RA 2QN2A 3PYMA 2G71A 4UNNA 4ZHQB 4Q16A 4FGLA 5ELMA 1UM8A 3T3EA 1E3MA 1F38A 3RC2A 1HNWB 4UE2A 4N3GA 4B4OA 2BFBA 3GLFB 5FX2A 1Y3CE 1KK1A 2PGAA 4Q1AA 4FFNA 4XM1A 3NRCA 2YOGA 2VJYA 3FYTA 5A0TA 1R2QA 1E2EA 1BAPA 1R27A 1GCIA 2IHJA 3B1VA 2EX4A 2XW6A 1NOJA 2C9ZA 3EZGA 5DP2A 1OREA 4KO4S 3Q8WA 2AXEA 3IA2A 3ETEA 1MAHA 4MCIA 3D4BA 3ND7A 4PLTA 5ALPA 2RH9B 1P74A 2ISQA 3EXHC 3FGOA 3WYDA 4AJNA 1GILA 4J0DA 2J3QA 2WF6A 2XCLA 4LOKA 5FJJA 1ISHA 5A06A 3KUUA 2AV6A 1G18A 1DT3A 4TMZA 1NOIA 5L8VA 4Q18A 1G20A 1VIAA 3QQPA 1Y89A 4M60A 4DMFA 2H5JA 2JASA 1P77A 3L1VA 3FDIA 4BN4A 1A8HA 2OZVA 3C6KA 2WF7A 2DHDA 2O5CA 2P77A 3IQWA 3ROTA 1KJZA 1JMYA 5HKLA 3RBZA 2BH9A 3IBCA 4X7PA 1HLPA 2WSLA 3M6XA 3GLIA 2QQFA 2SBTA 4NBTA 2EF1A 5HJ7A 1ZJ5A 1T3LA 2R84A 5KX5A 3DJYA 2JRLA 1OC2A 1GPMA 1MAAA 1Y9JA 2H16A 1A76A 2LKDA 2GPTA 4ID9A 2PGJA 5CDYA 3IIKA 4ND2A 3RIXA 4O2BB 1NVGA 1PNQA 3GLGE 5EWLA 3AYZB 1A8UA 1WPQA 2YV3A 3M4XA 4I0WB 3UCXA 5E7QA 3HB7A 5BXYA 2O7RA 2FPLA 1BXRB 2WLSA 3D8UA 4MTLA 1Z17A 2GGSA 3FNQA 4UBOA 1WU7A 5A7HA 4B85A 4GZMA 4F5YA 3AR7A 4P7BA 2PSDA 3GUUA 2CJFA 1JTFA 1IEWA 1VL1A 3GBVA 4BE9A 3RDPA 3KEGA 5I8PA 5SYMA 4OJTA 4I2VA 1XQ1A 2PWAA 3B53X 1W59A 5JSZA 4CKEA 3IV7A 4IEFB 4XDGA 1JR3A 1V1MB 2QHXA 4KTTE 5CPFA 1NHWA 1ZIYA 5DB4A 3EA0A 1FU4A 5A03A 1UBUS 4WXHA 2HGSA 3P0HA 1RCUA 3AEQB 4JBWA 3I61A 2VTVA 3EZNA 4HI0E 5DTMA 1ILWA 2ZXUA 3R6TA 3K1TA 4G36A 1CUVA 1HA3A 4QDZA 2Y0BA 3T5AA 3SNKA 1DEHA 3LDFA 4C1NA 2I3DA 3BJZA 3C1OA 4KV7A 4EO4A 3CGGA 2BHRA 3T1VA 1THTA 1ZVKA 4OMDA 1EBFA 5DX1A 3B9RA 4EA6A 1YMUA 3NORA 2XMRA 1M8FA 2OCLA 2V6IA 3OIFA 1RHQA 3E8XA 4ISBA 4LTMA 1GZ7A 4BKMA 1S4QA 1EGVB 4F8YA 4M98A 3T3NA 1OW3B 3RBXA 3ZQJA 2I29A 4G5XA 1ZUWA 2C2GA 2HCBA 3OLYA 1LB1B 4BNDB 2Q8NA 4BTLA 2WDPA 2QVCA 3P26A 2YFKA 3BQ9A 3EYAA 2REQB 3IXLA 4GQBA 2HA3A 1YUMA 3ZU3A 5JMPA 5AKIA 4OHKA 2EEPA 1QKKA 2N3ZA 3L6RA 4QXPA 3EQZA 1D8AA 3O1LA 3SY8A 3FG9A 2Z9BA 3VDNB 4Y30A 1EYZA 4HLUA 5IC6A 3L5OA 2Z6QA 4DLTA 3EASA 4L28A 3ZQ4A 2O52A 1YMVA 4ARBA 3D5QA 3BILA 1O7JA 3G82C 4JL6A 2C4UA 4R4JA 4BB6A 3WL4A 1SUDA 2YFQA 1G5IA 3DLTA 3ANXA 4U5QA 3WGMA 2CLCX 4O4IF 1HQKA 3LXMA 3U4GA 3Q2OA 3MTBA 1JBQA 1HZZA 2VZ8A 1NG1A 3JTMA 2XHZA 3I4LA 2AMYA 1IOVA 2CVZA 1KEUA 3DFZA 3AI3A 4HVAA 5EJMA 4ER5A 4NYIR 3NDBB 2XZOA 4BVFA 5GPBA 4J6FA 4JXXA 2JF0A 5IVKA 3O1HB 2R3SA 1CR6A 5BSTA 4I55B 4R8LA 1Q7TA 2DPHA 1ORWA 4M0PA 1Y8AA 2I2BA 1QP4A 1O8BA 3ZGZA 3MWDB 1VGQA 3IJRA 3RYFA 4WK0B 1Y1QA 4KLNA 1QHSA 4ZU6X 1FSFA 1FTWA 3TOSA 1NQVA 4JP5A 2GZRA 1COZA 4AMZA 3SVLA 1KYQA 3L77A 3OEHA 1W1UA 1N2HA 1XTBA 1IU9A 2ERCA 5F1KA 5ABPA 5B1EA 3Q2KA 2YC2C 3Q6NA 2FHSA 3UAYA 3LNTA 2JC3A 1QYCA 1GLVA 3W2IA 3JQBC 2AG8A 4EW6A 2H51A 1J8QA 4H7JA 4P92A 4G6ZA 3NFRA 2QIOA 2HRZA 4XD7A 1FFXA 4ZAVA 1BA3A 4MQUA 2ZUUA 2R1VA 4FZJA 3CNLA 3AJDA 4DDHA 2FQ1A 3C8HA 2V3WA 3R7BA 1YHNA 5CT5A 3GMDA 5E6RA 3NT2A 4MVJA 1FYFA 1EJBA 4P84A 4K6MA 4DMKA 2VK2A 1VYTA 1N92A 2YWXA 3A28A 4R0NA 4V39A 1B0AA 4DR7B 5ALQA 2XCTB 4OSPA 2VBGA 1A50B 3BTOA 3K09A 2CV1A 4BXOA 3TIXB 4ZAWA 1KIFA 3LGAA 1E1DA 2KW5A 3K0HA 3KD3A 3MUFA 1UC8A 3CR8A 2FZLA 5G0TA 4WADA 5DI9A 2FG5A 3U56A 3PI7A 1A5TA 3BRWA 2JFFA 4HLUC 4JMPA 4QWWA 3RRZA 1YFJA 1GZDA 2Q2OA 3QU5A 2J5RA 3LECA 2V98A 3WNDA 3AERA 3IO3A 4CNQA 3NV7A 1M6VB 2FMUA 2VYVD 1XP5A 1DRKA 1S2OA 1GFSA 1M6EX 2CFRA 3RHSA 1RVDA 3AF6A 4G8CA 2G63A 1ES9A 3RR2A 3M1AA 3L6EA 3EXIB 3ZTTA 2HF7A 3RU2A 3H6KA 4V2IA 1GKIA 1DCKA 2EWVA 1H2FA 3FSGD 3TOVA 2QE7D 1F7VA 1HEUA 3FGZA 3MT7A 2PPVA 1OB5A 4CIXA 2PIAA 4D4HA 1GNTA 1DADA 3CT4A 2BF4A 2QSUA 3FYCA 4D0NA 1MZPA 3DXFA 2VI5A 2B25A 2VA8A 3DE0X 1A2OA 3LHDA 1X14A 3BZBA 3OOWA 1OFGA 3QFTA 5ARCA 1EVQA 2BDTA 3PDWA 3SQLA 1L7BA 2A5YB 2QRNA 1PWEA 5EIHA 4AUKA 2DH5A 1P45A 2LCIA 1WMFA 3C5HA 3ZCUA 5BSHA 2UYHA 3F1LA 3IDOA 2IU6A 3VX3A 3LTNC 3TOZA 2QVBA 1S2LA 3U3DA 3I9MA 4EDHA 3OT1A 2XUFA 5I01A 3PDJA 1VG1A 1VCHA 3UGKA 3DFIA 5JBQA 2GJ4A 2V7QD 3HKCB 5IH3A 4L5BA 3THXA 5JJLA 3P5SA 1QYIA 2FJ0A 2HUNA 1UPXA 2OYSA 2WMNB 1MVNA 4CV0A 4A15A 1U8YA 5D5QA 4KOEC 1DP4A 3JQ7A 1XDZA 1LCIA 5FO1A 2YW2A 3EG9B 1LDMA 1Y82A 1PUJA 2I8LA 4HMPA 2BLNA 1DWOA 1B8NA 2DFDA 4FNMA 2FPRA 5JVDF 5KNBH 2D5LA 2WB4A 1E5LA 4QG3A 2QRKA 2XRFA 5BSKA 2JJ1D 1I3NA 4MQFA 1G41A 1FYDA 4EG6A 1RJGA 1SWWA 4GI2A 4MPTA 3UV3A 5K2OA 2PL1A 1KI1A 2VJLA 1PQUA 3I39X 3O8QB 1OB2A 3K09C 1T24A 4LXGA 4MZDA 1UEXC 3ELBA 3TUJC 3OHSX 3Q5EA 1YJCA 2PQ0A 4J7UA 1CUGA 3SQDA