3KZ1E

Crystal structure of the complex of pdz-rhogef dh/ph domains with gtp-gamma-s activated rhoa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
179
structure length
179
Chain Sequence
b'AIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rho guanine nucleotide exchange factor 11
publication title Activated RhoA binds to the pleckstrin homology (PH) domain of PDZ-RhoGEF, a potential site for autoregulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 49
structure length 179
sequence length 179
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3kz1E00
4OQLA 3B1VA 1G17A 4ZV4A 4I1UA 1CEEA 5KO2A 1J2JA 4NPHA 3A8TA 3QKSB 1G3IA 2OAQ1 2OO7A 2W2VA 2IWRA 2D7CA 3ZYCA 2WICA 2KI5A 2QQ0A 3BB4A 3B85A 3MWLA 3L43A 4ZDWA 3FMPB 4OI1A 2XOKD 4LBVA 5GJWC 1NRJB 3U3KA 1QHXA 3ZVRA 2OE2A 2RGNC 1E1RD 2C5LA 1W48A 1OFHA 2FZLA 5FL3A 1OLOA 3KQNA 4QHTA 2JJ2D 5CLLA 3DPUA 4GOXA 4KLZA 1XFAA 4TQUS 3QF4A 1II0A 1MOZA 4LRWA 1WP9A 3K09C 4N0DA 4A2WA 1OH5A 4TTQA 4ZCIA 4XTCS 3RS7A 1UBGA 2DB3A 2ZANA 2VHUA 4JZKA 4PC1A 1RRPA 2BJWA 3FKQA 3C8UA 3V00A 2XZPA 3CWQA 2D06A 2IC5A 1G8YA 1P6XA 3K0FA 4B48A 2W2XA 3VNVA 4V0KA 1XCGB 1E2QA 4HZUB 4WW0A 1XPUA 4A8JA 3TR5A 3LNCA 3MD0A 3P1JA 1FQJA 5ANRB 1EFCA 3M0EA 1GFIA 4LDJA 2QP4A 4S35A 3JZAA 4BZXA 4YMUA 4OK5A 4TL8A 4Z8XA 2JLXA 2GA8A 2O8CB 1R8SA 2VTKA 2ZRMA 4KHZA 1G20E 4R7ZA 4CEJA 5F2EA 2WSMA 3QG5A 4HI0E 2GJSA 3ZZ0A 4DSUA 1E9FA 4QGAA 1QG2A 1XMSA 4UQOA 1I4DD 1M2OB 3AKCA 1X1SA 4XSHA 4JLMA 5A0FA 4MRPA 5C4GB 4MDFA 3TW8B 1OV4A 1VTKA 4D4KA 3BFVA 3SJZA 2QP9X 1EWQA 2XEXA 1Q57A 3ADKA 1NBMA 2ZRBA 4M9QA 2ZROA 1TF7A 3AVOA 4HDOB 4KODA 4PAOA 4DCVA 5B58C 5C2JB 2IEYA 4UXIA 1NIJA 3PENA 2WSSA 1KJZA 1KI7A 1GWNA 3AKEA 3K0FB 2CNWD 2NO7A 5H1YA 2VHQA 5HTKA 5DE3A 2FSGA 1GITA 1FUUA 1W4BA 3QKRA 3EASA 2QPTA 3QENA 1ELOA 2GESA 4BFUA 1XWIA 1EWRA 2OCAA 2QPOA 2G83A 3L2OB 4HB3A 4EFMA 4TMZA 1ZIOA 4TYYA 1NVVR 1KO8A 4LV5B 2GNOA 4RZXA 3U60B 2J41A 2QT0A 1E0KA 3T5GA 5A4JA 1E4YA 1OF1A 2DFTA 2ZR9A 2QMUA 3BH0A 4OQNA 5FBRB 3VU9B 3FKSD 3FMOB 2IEZA 1NVWQ 2VEDA 1F2UA 2W0SA 4XH9B 3VHLB 4JL8A 5CM8B 4ERNA 1EFRD 1WF3A 2OCYC 2K5UA 3NHBA 4UJ5A 4C4PA 2HCBA 4PO9A 3VNUA 4K81B 2HT1A 4U00A 1J8YF 3PUVA 3IO3A 5KOYA 4C0KA 3U2QA 1DAIA 1NVUQ 1CRPA 1XMIA 1IY2A 4OQXA 2ZSEA 4NZYA 4Q9HA 2V3CC 5L3VA 2EFEB 3ADCA 1OYWA 3GJ5A 4KFUA 4TYNA 3U4QA 2IWHA 1QHYA 5D3MA 3HPQA 2VP9A 1XJCA 3L82B 3U7EB 4AY2A 1N6PA 3AGQA 3G5UA 1W49A 3PXGA 3UKDA 3SYKA 3R8FA 3U3MA 4BFWA 3IUYA 2QE7A 1T5IA 3K9LA 4RFVA 4GOKA 3IHWA 2VIIA 4LSGA 3SDZA 1G3UA 1SVMA 4XWOA 5KNBA 1G4AE 1SZPA 4B6EA 1DAKA 1Q44A 1F6BA 2F1HA 4HUQB 1G9XA 2ZRKA 3NIBA 3DEFA 3MWJA 4DUGD 5L3SA 4B2PA 3RS3A 1YZGA 5DN6D 1ZU5A 1II8A 1ETUA 5FPHA 1XTQA 3AUXA 3K53A 1KNXA 1DG3A 4JKIA 2BEKA 3SBEA 2IL1A 4GNKA 1Z0DA 3UXMA 4L4UA 3U4QB 2C77A 1XEFA 5KTYA 5EE3A 3R9IA 4MGKR 4OYHA 4IDOA 1G41A 3SZRA 5BW8A 2DPXA 2TMKA 1DAGA 4HAUA 3C16C 2A5DA 4XD7D 5DO9A 1N0VC 3RAPR 5FTMA 2MSEB 3LO5A 4LV6A 4M9ZA 1DS6A 4NDZA 2ZUDA 2BWJA 2IXEA 4OI0A 4IDPA 2QY9A 1DE0A 3VAAA 3K0CC 1Q1EA 2O5VA 2QGNA 1EFUA 1T4GA 4EKDA 1E94E 3EZ6A 4H1VA 2ZRPA 1E79A 5FBVB 4NL4H 5JS8A 2OXCA 5EE1A 2MSCB 2OHFA 2X2FA 4ZCMA 1UKZA 2LKDA 1LVGA 1S9DA 3SI7A 3TR0A 4PHTA 2KBFA 3NBZC 5CIWA 2WAXA 5F98A 1Z6XA 2RGCA 2OFXA 1P3JA 2VA8A 3UWOA 2J3EA 4DCSA 2WAYA 1YZKA 2DY1A 1KI6B 4PC2A 4PQYA 2IF0A 2A5YB 4DCNA 1G5RA 3EZ9A 5J4KA 3WBKA 3FFAA 3KTAB 2AKAB 5JWHA 5KSZA 1JI0A 2WKPA 3GJ7A 4R9UC 4R98A 1R5NA 2RKOA 3SR0A 3O8BA 3X1ZA 2Q3HA 2X2EA 3K70B 3THXB 5BXQC 1FZQA 4G5QA 3FGNA 2QTFA 4BWYA 2J7KA 3HDTA 2AKYA 4URVR 3WY9A 4ZO4A 3OFND 3Q7PA 4LPKA 4BLRA 4BEJA 1QG4A 4AIIA 4HAZA 3TLXA 4MRVA 3LBIA 1E1QD 5FTLA 2IS6A 4A36A 4M21A 1GVNB 2QNRA 5HR5A 1R6BX 1NY6A 4IRUB 1AZTA 3PEVA 1IBRA 2HLDD 4LYJA 5JWRA 1ZUNB 3VKHA 4YMWA 1JB1A 1O3YA 3NWJA 4QXAA 2I1VB 2J1LA 1G4UR 1RYHA 4XWAA 4GL2A 1OJLA 1ZINA 3ZQ6A 3KUDA 4DKXA 4RD2A 3VTKA 1NN5A 1ZNZA 1BH2A 3EX7C 5JS7A 2V6JA 1CJVC 1J8MF 1Z0AA 3PR1A 4LPSA 1UM8A 4Q1EA 5IT5A 5IDVA 4LJ7A 1P9WA 4TLDA 4HAXA 5EUMA 5LB2A 5IK2D 2CJWA 4F4IA 4B3BA 1Z0JA 1I2DA 3O47A 5F9HA 2OCPA 3OEHD 4ASUA 3SN6A 4BFZA 1I4LD 3SHFA 2FSHA 4M1SA 4P4TA 3HJNA 4L15A 4XWKA 1GILA 2BBSA 1E2LA 2XTMA 4GI7A 1P2TA 4DLZA 1HH4A 2F1JA 4JL5A 5EXPA 5FOXA 2BIFA 3B9PA 1MKYA 1PLKA 5JI2E 2O8FA 3A4LA 4Q03A 3A36A 3R9XA 3ECCA 4NMMA 2Z83A 1Z6YA 5BQ5A 1ZC3A 2BDTA 4Q4HA 1IN5A 1ZIPA 1IJFA 1T0JB 1FP6A 3KQHA 3LFUA 4JYCA 2FMXA 4IFBA 5GADl 4JKYA 2ZREA 4B74A 1Z06A 2GJKA 3ONWA 2RGDA 3UPUA 5F3WB 2BV3A 1F2TB 5C4MA 2VPPA 1KAOA 3EIHA 2FE4A 3T35A 2REBA 1OXTA 1KKLA 1QHNA 1VCOA 2JLYA 3FMIA 4LJ6A 2WJHA 3UIEA 4C0JA 4ZI3A 1Z63A 1GL9B 3MAAC 1P9RA 1QDEA 4KBFA 1YVDA 3AF4A 2ODBA 3QJYA 4Q9KA 1AS2A 2G6BA 4KXFB 1X6VA 2IYZA 3B1ZA 3F8TA 4ABYA 1G1MA 4JLPA 1Q12A 3BWDD 2XNDA 4BFTA 2WOOA 1L8QA 4IHQA 3RC8A 4DZZA 1L4YA 4RJLA 4KVGA 1ZCBA 5FR1A 3F5FA 2F1IA 4NE2A 1JNYA 4Q4HB 1Z07A 1LV7A 4Q4AB 3SJAA 1DBSA 1WDTA 2NG1A 1ZBDA 2G1JA 2R6FA 2BCJQ 4KYUA 5EQTA 3CH4B 1Z2CA 1SHZA 5FOVA 5DIFA 2JLWA 4JJKA 1KSHA 3VR6A 3AVUA 2VHJA 2DWPA 3LDAA 4KYIB 3U3JA 3MCAA 4A0GA 2ZSFA 1XZQA 3ZIAD 2FFAA 1OXUA 3H4MA 4QGGA 1HUQA 4KV9A 4UNRA 1CJKC 2ZJ8A 2Z6VA 5BYJA 1QHHA 3PUXA 3ZZUA 3A1TA 1FX0B 3QVUA 2CK3D 2WVJA 3SHWA 3N2IA 2X77A 2F9LA 4NTZA 5JECA 4JIMA 2QGZA 1GNQA 3GLFE 4QM6A 2R6AA 2YV5A 2KWIA 2GILA 3WHLA 1OPXA 1KGDA 4JL6A 4EQ6B 1HQCA 2XB2A 3U3RA 4IVRA 1UDWA 5CDFA 2NPIA 1Z83A 4TYPA 2P0EA 3OIYA 5KYKA 2GETA 3HP1A 4M8NE 4F7WA 3AVVA 4OK3A 2ATVA 2PCJA 4BEBA 2XZLA 1S1MA 3AEZA 4G1UC 2ZPTX 4G5OA 2ZAMA 4II7A 3ZVLA 4BLQA 5DHAA 2N42A 2PMKA 4OBEA 3CRQA 4Q01A 1MT0A 2W2TA 2GCOB 1G5PA 2ZRGA 4DXAA 2VP2A 2WIBA 1I4TD 1X8LA 3IKJA 4N1AA 2REOA 3SOPA 2H17A 5DI3B 3C4JA 2QBYB 1TL7C 2ZRDA 5J4VA 2Y8EA 4US1R 2FOLA 1G8PA 1P2UA 1FP7A 1RJ9B 4B75A 3QOFA 4CT5A 1F48A 1R8QA 1OFIA 3U44B 3R9WA 3UANA 4BLSA 2IHYA 4DB2A 4LJ4A 1HE1C 4LK2A 2NTYC 4ZDKA 1TUEA 3CPEA 4MRSA 1M8PA 3IEVA 4LUCA 3THOA 1Z6AA 2IYWA 2OILA 4AKHA 1CS4C 3IHLA 3VR2A 4A1FA 2P2LA 1QVAA 3WP0A 2H18A 1Q22A 5F9FA 1W5TA 2A9KA 3AF0A 4TLCA 2RGXA 4FI3C 3KXKA 4QOSA 4BZQA 3S1AA 5HCNA 3H0KA 4GP7A 5JSZB 2WBLC 5KPDA 1W7AA 2IS1A 2B21A 1U81A 2EFGA 2EYQA 1GAJA 2HV8A 2Q9CA 3Q85A 5CJ2A 3L0PA 2FEMA 4ZI2A 1W44A 2WKRA 4QHYA 2Z43A 3EG5A 3KQLA 1KI1A 1S8FA 4IEIA 2JLZA 3THYB 2VP0A 3KKNA 2GKSA 2EFDB 4M2LA 3U3OA 2O8EB 1G3MA 4DT1B 3IBYA 3T34A 4TT3D 2J0VA 2WJIA 1D6JA 3RABA 3VR5A 1OXSC 1IN6A 1XJ0A 1VG8A 2F43A 3QKUA 2J0UB 5CB6A 2CE7A 2FWRA 1GKIA 4I99A 3IEUA 2NIPA 1MR3F 1QF9A 2V1UA 3CBQA 3EPHA 3EPLA 2CHVA 3D8BA 5FOTA 3AVYA 4NYIR 1E69A 1AZSC 3FPAA 4WVFA 1U8AA 4HZIA 3U7FB 2MMGA 4HAYA 4DCUA 4TTPA 5G40A 3OAAD 2V7QD 1CKEA 1NL3A 1T3LA 4TL6A 1FUKA 1OIVA 2CHGA 4A15A 3FFBA 1OFTA 3MWKA 1OH8A 4POAA 2FPKA 1XB2A 1W0JA 2D7DA 2YWEA 1Y63A 2GEDA 4PPQA 1COWA 3Q5EA 3T12A 1TX4B 3LY5A 4IJMA 5D3QA 4EPVA 3QF7A 2QG6A 2Q6TA 2HCJB 2VHCA 3K0SA 1XCPA 2ZJ5A 3EWAA 5BWMA 4F93B 2BKEA 2VYFA 4NKRA 3TSWA 5GJBA 1XEWX 2XGJA 2GBLC 3GJ6A 2YWHA 4L5BA 2OFOA 4M53A 4EUNA 4UJ3A 1IY0A 2CHQA 2KJQA 1S1CA 4PQRA 3ZH9B 4ZIRA 4Z54A 2FV8A 1A4RA 3OE7D 1BO6A 2F9MA 1XEXB 4A0HA 5AJZA 1HA3A 3I4LA 4MKHA 3SFVA 5KHOC 2ZSBA 3LX8A 1VECA 1XTRA 3V4RA 3K09A 3NDPA 3O8DA 1KK0A 3N5CA 1Z6GA 4Q1AA 3H2YA 1SXJD 1YQTA 4EFNA 4CZ2A 4HUTA 1U98A 3CIOA 4DLSA 4O0MA 5FI1B 4XVUA 221PA 1BIFA 3FTQA 4MUBA 1XMJA 1D2NA 3LXRA 1WBBA 1NJFA 1T8UA 4AYXA 2ZRIA 1AGRA 2ZI4A 4BZPA 3BAFA 1MABB 2GK7A 2XB4A 4Q1DA 3PIRA 1R5OA 2L0XA 4NYJQ 4Q21A 2P3SA 3QKSA 4M1KA 2ODEA 5TV2A 5AUOB 1XXHB 5L3QB 3I73A 3TGPA 2FN4A 5KDDA 2YYZA 2OT3B 3FWYA 2AD1A 2FSIA 4A0RA 3I5YA 3ICEA 3ZJYA 4KI0A 4DCTA 2JDIA 4CT4B 4KSBA 1G19A 3REFA 4U7DA 5DSZA 1JBKA 3QSYA 3I92A 3QEJA 3CW2A 3RHFA 1RW4A 1ZP6A 1WRBA 4JJZA 1EG7A 1N6HA 4FCTA 3R8CA 1WXQA 2AFIE 4NYMR 3WNDA 4PZYA 4YXWA 2V8OA 1EK0A 2J0SA 421PA 4BASA 1RIFA 4ESVA 4ZKEA 3QXHA 4GMXA 2IYLD 3HR8A 4HB2A 4JBYA 3SS8A 1NKSA 5JRJA 2BMJA 4ON9A 1M6NA 1G6HA 1OKKD 5GVSA 4BQSA 1D2MA 4HZUA 1E32A 4BLPA 3PITA 1TMKA 2JJ8A 1RC8A 3LBHA 3CRRA 5K8UA 3W8RA 2C8VA 1NP6A 2IA5A 1W2GA 2O8CA 4KLNA 4FCVA 1M7BA 1DO2A 2OESA 4RZ2A 2G88A 4A6PA 3F0TA 4IKEA 2LWIA 3VQTA 1TEVA 1XNJA 5DI9A 4B35A 4LHVA 1HURA 4HDCA 1CP2A 1DAEA 3Q3JB 4PSKA 4YMSA 5HKKD 2BM1A 2ZRAA 3VR4A 3MGCA 2BC9A 3BE4A 2ZUCA 3AV0B 2D62A 4Y0AA 1E2EA 5J5CA 1WE2A 1AKYA 2CE2X 2ZRNA 4UXHA 1IOZA 2ZJBA 2DFNA 2CL0X 3AF2A 5HE9A 1U9IA 2OEPA 3AUYA 3CRVA 1KI2A 4C9BA 2ZJOA 3AP1A 6Q21A 4LJ8A 1R5BA 2V1XA 4QRHA 5IRCD 4IW3B 1AN0A 1JR3A 2AXPA 4ACBA 1R0YA 1CF4A 1U8YA 2ZVPX 1ZM7A 4LHWA 1MV5A 2YKGA 4Q9IA 2FNAA 4B3FX 1FQKA 4MYCA 1UKEA 4NBSA 4TSFD 1KY2A 4NH0A 4ARZB 5JEDA 1NG1A 1K8RA 1VCNA 1XBTA 4MYUA 4LYFA 4FMBB 1WCV1 2FPMA 5TY0A 1W1WA 4P4UA 3W6PA 1P62B 2F7SA 4G5SA 3VU9A 3JVUA 2B7CA 3CZPA 2D2FA 2QI9C 3CF2A 1E96A 1E0JA 2OBMA 3GJ3A 1OB5A 4EFLA 3TIFA 2ZSDA 4MRNA 4IOJA 3QVVA 4S2EA 4M1YA 1K5GA 2Z4SA 5CITA 1Q21A 5CIQA 1AIPA 2Q21A 4P4SA 5JJLA 1D5CA 2GXUA 3RSOA 4U5XA 3TAUA 1SVIA 1OXXK 1U0JA 2NO6A 5L8VA 3KB2A 3PEUA 2R62A 1Z8FA 4FW9A 1KK2A 1S4QA 1ZUIA 1NI3A 2GAOA 4R2HA 3ZGXA 4B2LA 1YRAA 3LD9A 1UBFA 2RGEA 3TW4A 4LV8B 1A2KC 1YJ5A 1MO4A 4QJ4A 3X1XA 5JHHB 2WV9A 5TB5A 3ZVMA 4G0NA 4HYYA 4JLOA 4EIWA 1JXOA 2QU8A 3KX2A 3SQXA 3ADBA 1KK1A 1PV4A 1KY3A 1ZNYA 3AGPA 3ZZTA 1O87A 3P4XA 4RKEA 1JECA 4PHGA 3O8RA 2PJZA 4C7OB 2ODWA 4UNQA 2ZE5A 4M1TA 3I5XA 4FMDB 4Q4JB 1QHSA 2IHBA 2QPAA 4QJ5A 4A4DA 1S9HA 1OT3A 3PEWA 2P67A 4HUQA 3HU2A 3LAWA 2VSFA 1I2MA 3QXJA 4TZ0A 1HYQA 1Z0FA 5E95A 4QBGB 3IQXA 4KU4A 2IXGA 2BM0A 1BMFA 3PQCA 1NKTA 3C5CA 2CBZA 1AQYA 4P4SB 4MGZR 3NHAA 5FTKA 5HZHA 3CRMA 1G7SA 3K1JA 4L8GA 1V43A 1OE0A 1TF5A 4Y0VA 4PAQA 1H8HA 3C41J 2IYXA 3U6KA 4R71A 2GCNA 1ZUHA 4HDQB 4US0R 2BJVA 4A2PA 1G8HA 1W4CA 3OEEA 4Q9LA 2AWOA 4B32A 3LQRA 1N6OA 2VP5A 4P31A 3D6TB 2EFCB 3X1DA 3LH5A 3PUWA 2QRNA 2YC2C 4B76A 3QNUA 3MRSA 4GZLA 2WWHA 4P0TA 1CXZA 3P4YA 4Q9JA 1HEIA 1L4UA 3IQWA 4Z8YA 4HB0A 3AB3A 3TQCA 2IYTA 4PO8A 2J9RA 2BBTA 4G5GA 2V6IA 2BEJA 2ZITA 4UKDA 1UEIA 2IXFA 2LCFA 1RVDA 2AWNA 4A8JC 4LOAA 2GZHA 5FPSA 5LDDC 3WRYC 3GMTA 2AK3A 4ESHA 3CX6A 4ZKDA 4LI0A 1OSNA 4A0FA 3EZFA 4XVRA 1GNPA 4AG6A 3GLGB 3DDCA 3EZ7A 3CF0A 5BYKA 3ND9A 1LS1A 3CLVA 5EJEA 4I81A 1NBMD 2I3BA 3Q8XB 1FTNA 2QM7A 3JZMA 3TUJC 1AKEA 2PT5A 3PVSA 4OQFA 4DLVA 3RSLA 4NCIA 1TQDA 2W83A 3WP1B 2WSSD 1GL7A 3QI2A 1FPMA 1YZQA 3W34A 2FX3A 3EA0A 5KSYA 1ZM4A 1VG0B 1EX6A 1KSJA 1KI6A 1KMHB 5FUYA 1XPOA 4WXRA 5B30A 3IPXA 4F92B 1Q3HA 3GLHE 1KI4A 3F3YA 2F6RA 3KTAA 2O0HA 4GDFA 1R0WA 1ZMXA 3Q72A 5CB8A 3E5HA 3K0AB 5FL7A 4BGDA 2FG5A 2XZOA 3BBPA 3THXA 121PA 4IVQA 1KJYA 2WIAA 4D0LB 2CLCX 3L8ZA 4HEJA 2WJJA 4AG5A 3W3ZB 1WQ1R 3SC3A 2ZJAA 2RAPA 1DO0A 3I3SR 4D80A 4ZDJA 4X8OA 1ZD9A 1BYUA 3MUFA 1SKQA 2IYSA 4EJSB 5J4HA 3EA5A 3LLMA 3EIEA 1D2EA 3KJHA 3TVTA 1E9RA 2IX3A 5BN4A 2J5XA 3QG1A 1JPJA 1Q1ZA 2OUKA 4LYAA 5CM9C 1ANKA 4E09A 4YMVA 2LKCA 1XDBA 5JCZA 3TAHA 4EPXA 4MGYR 3GLIE 1G18A 2QT1A 2R6DA 1NSTA 4CDGA 4URXR 5DH9A 1R0XA 1LF0A 4QC2A 5HE8A 3G82C 4WA7A 1MRNA 4UNSA 5GVRA 2QMOA 2ZR7A 1KHTA 1LY1A 4AYTA 5FUXA 2QE7D 3TSZA 5JWOA 4RY2A 3GJ4A 1WMSA 3UG6A 1XEWY 4M9XA 1TU3A 1P5ZB 2XSZA 4KAXA 4LC1A 3SNHA 3RWMB 1P75A 3DOEA 4IOMA 5JBQA 1P60A 3SU8A 2DHRA 2GF0A 3D31A 4I1OA 2ZI6A 4PXAA 4LYHA 3UG7A 2VP6A 2EVWX 3KB1A 1VG1A 1Z47A 1H8EA 3MJHA 3CF6R 4EJSC 4V0ME 1NMYA 3NG1A 4PQFA 1WA5A 4YLGA 5DYGA 1XCMA 3ADDA 4FMDF 4IOKA 3TVDA 3EPKA 1CJTC 2GK6A 3UMRA 4OI2A 1FOEB 2XX3A 3WNBA 1Q1BA 3VX3A 3M1IA 2FSFA 1D9XA 2B8WA 1YR9A 3GP8A 2XITA 1W4AA 3OHMA 3ZQJA 4RSGA 1F2TA 4D4LA 2H92A 3B60A 4E03A 2PMDA 1GG2A 2C99A 4DDWA 4QJ3A 1QHIA 3CNOA 1XZPA 2AN9A 2JJ1A 4Q1BA 1KAGA 2PX0A 2RH5A 5FL7D 2FGKA 4HLCA 4GOJA 1XRJA 4AKGA 2GZAA 2AD5A 3X2SA 4PPNA 2IYRA 1N6KA 4NU0A 1S3SA 5J4YA 1KO5A 1N5IA 1GKYA 3BC1A 3CPJB 5EP3A 2JLRA 4DBLC 1E79D 3ZVNA 1MH1A 2H8KA 3DMNA 2IUUA 5FPKA 3L0OA 621PA 2FEOA 2FF7A 5EE0A 4M22A 2J7PA 2QAGB 4URUR 4PSVA 4Q7KA 1AS3A 2H57A 4WXPA 1SXJE 2BVNA 3LLUA 2WJYA 2W58A 5FFMA 2O8BB 2YZ2A 3CONA 2GXAA 2C95A 1P9NA 1GNRA 4Q4AA 4V0NA 4Q48A 3DKPA 2JIZA 2GXQA 1EFHA 4V03A 2D3WA 3BB3A 1IAQA 1OIXA 1U0HC 4G01B 4XTRA 1X8KA 2CL6X 3PJRA 4C30A 4YC7A 4C2UA 2PLFA 4H1UA 4DJTA 4RCZA 1YR6A 3ND8A 1E2MA 2Z5FA 3L0SA 1F5NA 4IDHA 4TLEA 1VKJA 4HLUA 3GD7A 3RANA 2QQEA 2QSZA 4RD6A 1M74A 4W5HA 5EZ6B 2ZU6A 1FX0A 1CTQA 1E2IA 1KYIA 1T91A 2RGAA 1CLUA 3NH6A 3KQUA 1TADA 4L9WA 4WZ6A 5B64A 4E07A 1EGAA 2HYDA 3RWOA 3QPUA 1PUIA 1VCMA 3SJBA 2F3RA 2FJUA 1NN0A 1FNNA 1G8GA 1XD2A 4QNMA 5CYPA 5FTJA 3RYTC 4EQ6A 2QAGC 1MO5A 4LHZA 3DL0A 1XD9A 4ZCLA 1RZ3A 4PFSA 2HXSA 4Z1MA 1KDOA 1GM5A 3BERA 4IDQA 5G53C 3KJIA 2WOJA 5SZIA 2N1BA 3A1SA 3D7MA 1X8JA 3FYHA 2HF8A 3QE0A 4PO1A 2XXAA 3GQBA 1R2QA 3UMFA 2GCOA 5JZVA 3M6AA 1JQJC 2GJAA 1OW3B 2NO1A 3CNLA 3IDQA 2IYVA 3I8XA 4KBGA 4RD0A 1EESA 4Q7MB 5DI3A 1B23P 2QBYA 2GJ8A 3MG9A 4LZZA 2IUTA 1KTVA 2O8DB 4DEYA 4D26A 1AM4D 2ANCA 4OQMA 1RJ9A 1ZU4A 3U44A 4XJXA 4ASUD 4C0AC 4JMPA 5B2ZA 4B6FA 5J4LA 1HT2E 2FU5C 1XD2B 4MQBA 4D82A 1L7VC 2NPFA 2W6IA 3GLHB 4GZMA 5JI3E 4A82A 3DO6A 1UBCA 2QTHA 1UKYA 3BD9A 5TARA 5EXXA 3WMFA 2JLSA 4PZZA 2CLDX 5JSZA 2JLQA 2EFHB 2EYUA 4HSEA 3REGA 2AFHE 3IILA 1PUJA 3CRW1 5EP4A 3VMFA 2G1KA 1E2FA 3EAQA 3P26A 3TMKA 1GZSA 5AUNB 2W00A 3QXSA 2C9OA 1UF9A 4Q4LA 4JBWA 3THYA 1JQLB 1Y3AA 1A5TA 1R10A 1N6IA 2V55B 3R7WB 3ASZA 3NC0C 4IXNA 2ERYA 2O8EA 3KXIA 4DT1A 3BS4A 4JVNA 2HEIA 2PBRA 4BRWA 1JXMA 3B1XA 4BUJA 1Z3IX 2X1VA 3T06B 4TWZA 4GBMA 4PTLA 3CNNA 1NLFA 2GBLA 1G21E 4JLNA 4MA4A 4TQ9A 3GLIB 1TF2A 2J0UA 3VKGA 4JLBA 3NVAA 1E3MA 1X3SA 2KSQA 3TQFA 4TMTA 2ZR0A 2XNDD 4DLYA 2IS4A 1ZJ6A 4Q02A 3HYTA 4JLDA 4ZDIA 3FOZA 2BHRA 4MGIR 4F4CA 3PUZA 5FPYA 1JAHA 1VHTA 2ONKA 4MYTA 2OXRA 2IUSA 1RRGA 2FH5B 1W47A 3EWSA 4UNNA 2GDJA 4CW7A 2GVZC 3GFOA 1X86B 2ZRHA 5JRZA 2WPDA 3TH5A 3NDBB 3QPVA 4D4MA 1RRFA 4RZ3A 4B2IA 1E6CA 1YZNA 3A1VA 4RFSB 3UWKA 2JEOA 4BFXA 4HLDA 1NSFA 1KO7A 1XTSA 4QHSA 4C0LA 3AF3A 2ONJA 1S96A 2WKQA 2YOFA 3MSXA 3FMFA 4X8HA 2UKDA 4AD8A 2CL7X 5J47A 4XSGA 2B7BA 3MMPA 3THWB 3QUSA 2D2EA 1TQ6A 3CR7A 2XJ9A 3CWZA 4MRRA 2PX3A 3A1WA 2ORVA 4L16A 1LFDB 3NKVA 5CK4A 1Z6TA 5LB4A 3DZ8A 2KB0A 1XEXA 3W6OA 2FPLA 1NLYA 1J7KA 2ZI5A 4D25A 1L2TA 3KKQA 4LCBA 4QBFA 1QZXA 5SZHB 1IONA 2ZJ2A 3RS2A 1DPFA 4PX9A 1JR3E 2VSXA 4RKFA 4MDEA 3OESA 2HT6A 3FDIA 3DZDA 4RZUA 3CX7A 1E9AA 4RD4A 4EAQA 3UK6A 4JLJA 1LW7A 2JLUA 2JASA 1BS1A 4MUAA 1HT1E 2QSYA 1C1YA 1A2BA 1J90A 1CR4A 1OHHA 1W4RA 2YWFA 3CUEF 3A6PC 2QA5A 1IY1A 1ZYUA 1MABA 1OXVA 1SXJB 2VHTA 4TLAA 3FHOA 4B34A 4ZPXA 1JR6A 4Q66C 2UZ3A 1XXHA 5L3QA 1NVVQ 4LC0A 4PC6A 2REXB 1G7CA 4LHXA 3VX4A 4B71A 4EPYA 1ESNA 1NBME 2QROA 2RGNA 2XTZA 3KKMA 3NBFA 4TMKA 3TSOA 4FN5A 1VG9B 3GJXC 3LWNA 2H5EA 1EX7A 4W5WA 4HB4A 3AVQA 2A7QA 2ZJYA 1T3SA 1ZAKA 1JALA 1NVXQ 4L9SA 3WHKA 4X8LA 5LPNA 5JJIA 3NEJA 2PZEA 2GWHA 2XOKA 2ECKA 2JAQA 1FMJA 5DLQC 5K8TA 1IQPA 4B3GA 2AXNA 4J0QA 1E1RA 4R2IA 1US8A 2DFLA 3VHXA 5IHPA 1DADA 2ZS8A 2OFWA 1FMLA 2JJ2A 3OIUA 5DHFA 4LJYA 4UNPA 4LHYA 3TBKA 3GLFA 2OZEA 2QENA 4NP6A 4PR0A 4X8MA 2P5TB 3KKPA 2OBLA 2O0JA 1KIMA 1NLZA 4TMXA 1IXZA 5DNYB 3CKLA 3NEYA 1FNMA 4JLVA 5AK0A 1SXJC 5H68A 4UXJA 2AHOA 3LQQA 2QP3A 5KU1A 3PCRB 1GOTA 3AVTA 1F3OA 3FVQA 2C9YA 4A92A 1RFLA 2CXXA 1QHGA 3QY0A 4CGZA 4O2LA 3BRWD 3H84A 3SYNA 3T1OA 3QEOA 3LW7A 4HAVA 2OCBA 5JMTA 4G3XA 5TVKA 4BFVA 1VYUA 3O8CA 1TQ2A 1AGPA 1E2NA 2P5SA 3OIWA 4FMCF 4NCJA 4D2IA 3KKOA 4B73A 4MYHA 1W36D 1ZM9A 2R6CA 5C18A 1US8B 3SBDA 4GP6A 1X1RA 721PA 2RCNA 3GFTA 3BOSA 5M04A 3RNLA 4C0BA 1U2RA 4QGHA 3GLFB 1W0JD 3ICQB 1YRBA 2OLJA 2GF9A 4JSTA 1OFUX 3RRMA 1SVSA 1E99A 1K5DA 1COWD 2X19A 1N2CE 3M4YA 1KMQA 2DBYA 2IK8A 1W5SA 2SHKA 3RRNA 1XF9A 1W36C 4MKFA 2ERXA 5J40A 3HPRA 2HUPA 3I62A 2CNWA 1W2HA 2DCUA 3ZS9A 2ZYWX 4ARZA 1ZW6A 1ZVQA 1GIAA 4CEHB 3EC1A 1XTIA 1KK3A 4B33A 4O3MA 3DM5A 1II9A 2YNMA 2ATXA 2P6NA 5E4FA 1YKSA 4AKIA 1KI8A 4B47A 2CVHA 3AQ4A 3W8NA 1A1VA 3E1SA 1S0UA 4PSAA 5FI0B 4F38A 3I61A 3FHCB 4D0NA 3ZDQA 3DOFA 3QPWA 4B3DA 2WWGA 3WYGA 2PEYA 2PZGA 3OZXA 2ZI7A 1AK2A 1OYYA 2OV2A 3PG5A 3IGFA 2G0NA 3FKSA 1N6NA 3N70A 3HWSA 3HYRA 3BH6A 1XTKA 1KZ7B 1HTWA 1Z28A 2BMEA 1R7RA 1EFRA 2PH1A 2YOGA 3PV0A 4A6XA 1Q0UA 1G16A 2HXYA 3IBGA 3QBVA 1LF5A 2DFKB 2XAUA 3DHWC 1TNDA 3BB1A 5EZ5A 5DGXA 1E98A 2Z0MA 3ZD6A 1IN8A 4DLRA 3QQ5A 3B7GA 5KPJA 1UJ2A 1NNEA 2IT1A 1RYFA 2CVFA 5KSPA 3C14C 3T15A 1E2JA 2PJRA 2XXAB 1UBEA 4XIGS 4GT1A 3B82A 3LVRE 4AKEA 3SQWA 4O25A 4C7OA 1E9SA 3I1FA 3H1TA 1YHNA 4Q4JA 5AUQA 2ZSAA 2JDID 1P7CA 5C46F 2X8AA 2VH5R 2EU8A 1T9HA 3EW9A 3Q7QA 3AH8A 3KXLA 3B8HA 3P32A 1MO6A 1DELA 5EUQB 5BN3A 4C0HA 4YXWD 2ZS9A 1AJEA 1Z29A 1FW6A 1Z5ZA 1HY3A 2I1QA 4LX0A 2JA1A 4KFSA 5KDOA 4AWXA 1YZLA 4DUGA 1CJMA 3EPJA 1DG1G 1BOFA 1P2SA 1IN4A 1SVKA 2O0KA 3QF4B 5DN6A 1XPRA 3KFXA 2DR3A 5EE9A 3WMGA 2B6HA 3SE0A 3TKLA 1UKVY 5FOSA 3WRXC 2ZYTX 5KSOA 1UFQA 2J59A 4OJKA 2ZI3A 3RLFA 4B3CA 1UDXA 2ZE6A 4OHXA 3CH5A 4A2QA 3LRPA 4FWIB 5G3YA 3K0CA 2ZRJA 5ELXA 4Q7LA 4A8JB 1T8TA 1W0KA 4QG7A 2A30A 4XOIA 4D6PA 4RD3A 3AM1A 2VBCA 3NH9A 1UADA 3L8YA 3CZQA 1V5WA 3KL4A 4XD7A 4DEXA 3W6NA 2I4IA 3U5ZB 1H65A 4CEJB 3B13B 4NCNA 2A78A 1T6NA 2RGBA 3FHTA 4Q1FA 3GLGA 1QRAA 5HZKA 3H86A 1LB1B 5TDHA 2GHIA 1YR8A 2ORIA 1RKBA 2WM9B 5CLQA 3MWYW 5JHGB 1DTSA 4V02A 2IS2A 2AR7A 4TMVA 3X1WA 3KQKA 1Q1QA 1PZNA 4IFEA 1E9CA 4Q19A 2ZU0C 3AF1A 1ESMA 3OF5A 4E22A 3LBNA 1JEDA 1KMHA 1JR3D 2P6UA 4BECA 3A58B 5FBQB 4NHOA 3I32A 1N0WA 2FFBA 1G3RA 2GAAA 4XVQA 4WAUA 3RDPA 2ZM5A 1RPZA 3W5JA 2VSOA 4IEEA 5JCPA 1U9IC 3K0AA 4FD2A 3U7GA 1NN3A 1SVWA 2R6GA 3QKRB 4Q47A 4DDVA 4US2R 1VIAA 3AP3A 1OH6A 3B78A 4LJ5A 2PZFA 1TU4A 2QM8A 1JJ7A 2YINC 4NYJR 3CO5A 3IIMA 3A4NA 1YU9A 1QBKC 1SVLA 4YQFA 4P33A 4CEIA 1UAAA 5DISB 4E5UA 3MLEA 2JATA 1P73A 1T3HA 1IN7A 4GPTA 4QM7A 1KDTA 4EJSA 1Z0IA 2ZVQX 3OFNA 1N3BA 1CIPA 1YZUA 2ZIAA 4PC3A 2VQSA 1KJWA 3EZ2A 1XU4A 3I8SA 2ZYVX 4BPBA 4BE7B 2ZJZA 1E1QA 1DAHA 1F2UB 2IYUA 3UMSA 2HJVA 4JVMA 3B5JA 3KJEA 1KI3A 4W5JA 4JT4A 2HYIC 1IHUA 2ZQ5A 4DC9A 2HLDA 4MKGA 1VYVA 5H8WA 4AYWA 1BKDR 3A4MA 2C98A 4AI6A 4M1OA 2VO1A 4EPWA 3TUZC 4JS0A 1KOFA 3DVLA 1N6LA 4NCHA 1C9KA 1CR2A 1CR1A 1KO4A 1XX6A 1T5LA 4JLKA 4N0EA 3MFYA 2ZYUX 1U90A 4P32A 3E70C 5AWFC 4IOLA 1EFTA 4Q1CA 2OBNA 2A5GA 1SKYE 5GJVC 4MH0R 4PAMA 5D3MB 2B8TA 5TXGA 1W0KD 2J45A 2YOHA 1KNQA 3KJGA 4GRAA 5UKDA 2WTUA 4CEIB 1GKUB 1ZD8A 1NY5A 2DWQA 2UZIR 3PUYA 5CYOA 8OHMA 2NQ2C 2CCJA 2E87A 2FA9A 4JVLA 3BGWA 5IK2A 2QTVB 3B6EA 2WMOB 1BMFD 4QFMA 5A5GA 1NMZA 3OEHA 3HU3A 1KI9A 1E2GA 1YZTA 4V0OA 1QVRA 1PLLA 5L3SB 2ZRLA 1H8HD 2IF2A 2QAJA 3OEED 1II8B 4BRUA 4JVSB 4KO8A 5LBIA 1IM2A 1E9EA 3EC2A 4NCKA 3HU1A 1Z08A 3DKVA 1RRCA 3GEIA 4ITRC 2ZRFA 1DEKA 1A7JA 2A5FA 2NGRA 4YMTA 2ZETA 1ODFA 5B57C 4OHVA 4TL7A 1N5KA 5JEEA 2ZS7A 3ASYA 4JT2A 4M0LA 2PL3A 4MITA 3K8YA 5KNCA 2UVQA 2BBWA 2IBMA 2NO0A 2Q9AA 5CDFE 1ZC4A 2GCPA 2BBOA 4DLWA 1XJQA 2BCGY 1ZM3A 3Q5DA 2GTPA 3TUIC 4TL9A 2F3TA 1JPNA 4YONB 1KKMA 3ETLA 1KDPA 5E3HA 4C2TA 1NMXA 2CMKA 4OI4A 4LJ9A 2WHXA 2QAGA 2YHSA 1TUIA 2ASEA 2HF9A 3V9PA 1TEXA 2O8BA 2WMNB 2H1LA 2QORA 3AP2A 1PLJA 1SVOA 1G5TA 1GRQA 3QXCA 1A82A 4CRWB 2Q3FA 2G77B 5FOUA 1DVRA 2A3RA 2VRWA 3SJCA 3SFZA 2W6JA 3VR1A 1N0UA 3A37A 2EQBA 3AKDA 5BN5A 3VR3A 4Z51A 4PC7A 2AX4A 4IXMA 2BKUA 4HATA 2C78A 2DYKA 5FBWB 3LV8A 5FUVA 3BFXA 1VCIA 2ZI9A 5C1BA 3K70D 2VL7A 4QGFA 3CX8A 2ZE8A 4FINA 2IYYA 5EXTA 2ZXUA 3WMEA 1HQYE 2QZ4A 4KJZA 3ZIAA 4DHEA 1GDDA 1KO1A 2AL7A 4KSCA 5CJPA 1R0ZA 2MMCA 1E2DA 4DLTA 3NBYC 2WWFA 821PA 1TTTA 4DSTA 4EDHA 4OJQA 1ONBA 1S2MA 3BIFA 3K70C 4LJAA 5AR1A 3TNFA 2E1RA 2NOAA 4URWR 1G7TA 3KFVA 2CK3A 4RD1A 3B1YA 3C5HA 521PA 4NYIQ 5E7MA 1G3QA 4TZ6A 3DM9B 2CCKA 3TRFA 2XTNA 4CIDA 2GEVA 4K46A 4TYQA 1C4OA 4D0GA 4OHZA 3Q9LA 1G6OA 1NJGA 1Q3TA 2FFHA 4PZLA 1XP8A 3VFDA 4I1VA 1UEJA 1TQ4A 4M4SA 3IIKA 1Z0KA 3GJ0A 4FXPA 2VP4A 5FUWA 2NO9A 4QBHA 1N6RA 5HCIA 4OKSA 1NN1A 2VF7A 4PPFA 4PPGA 2O8DA 2WJVA 3JVVA 1G7RA 1CU1A 5K8IA 4F4JA 3LX5A 4HLQB 1S3GA 3IIJA 2XSZD 3T61A 3T1TA 1BYIA 1IXRC 2VLIA 4OK6A 5AJXA 4KVAA 2ZTSA 3BJIC 4PHFA 2GXSA 1P72A 2G3YA 4QBIA 1R4AA 2B92A 4D81A 2RMKA 2CJWB 3EIQA 2OSBA 1H8ED 3I72A 4H9GA 3W3AA 2BMFA 3NXSA 3GLHA 3BFKA 1E4VA 3LA6A 3LXXA 4W9MC 1NIPA 5E7IA 1GRRA 4DSOA 4GFDA 2H7VA 3MJRA 1ZNWA 1PVOA 2FZ4A 2OLKA 3KDSE 1D9ZA 3VKWA 4C3ZA 3WBJA 4DIEA 1FL9A 1SHKA 2O8FB 4BFYA 1N25A 2QEQA 3RRZA 4QKQA 2W0MA 2HJGA 2W6JD 1XTJA 1XMVA 4TQAA 1K6MA 4Q18A 3TJZA 2G0TA 4D4JA 5JFGA 1OIWA 1XXHE 4W7SA 2ODNA 3R7WA 2JJ1D 1CJUC 4TN1A 3BORA 1RE0A 3BK7A 1M1YE 3LVQE 3GEHA 3QKTA 5L3RA 4AK9A 4Q5IA 1ZCAA 4DWJA 1N5LA 4WOPA 2NZJA 3GLIA 1IXSB 3W9YA 1AA9A 1JJVA 2QMEA 3D3QA 4BLOA 3AVXA 1MRSA 1EXMA 3EARA 4ILEA 4TT3A 4B43A 5GJCA 2EW1A 2J7PD 2XNSA 3RS0A 2FDCA 2EWWA 3SEAA 1KSGA 1DOAA 1FFHA 4EPRA 5P21A 5JJKA 4G5RA 5TMPA 1FTSA 4N3NA 1CR0A 2EWVA 3CB4A 2Q0HA 2J87A 2JIZD 3OIVA 1VMAA 3QBTA 4KFTA 4NYMQ 3W90A 4C0QC 1SKYB 1E9BA 3K0EA 3FE2A 4RFSA 5AJWA 5G41A 1LNZA 4M1MA 4TTRA 2RB4A 2KE5A 4FWTA 2QUZA 3OAAA 2AK2A 2BMDA 5EP2A 1GSIA 1F60A 2V7QA 2GRJA 2WZQA 4FMCB 3RS5A 2D4HA 3ZLJA 1KZGB 3P27A 4V0MA 5IF9A 4C0SA 2NMVA 2C2HA 4RCYA 1YE8A 4QNRA 1E2KA 1WB9A 2FGJA 1GTVA 3THWA 5CK5A 3B2EA 2FFQA 5SZKB 3KUCA 4O2RA 3N2EA 4PANA 3WXMA 5JLJA 1Z22A 4FIDA 2NZ8A 3T5DA 4DDUA 4M1WA 4URZR 1E0SA 1UPTA 2PT7A 4I4LA 5G3ZA 1QHHB 3R20A 1KSFX 1E2HA 2C96A 2V4ZA 4TLBA 1SULA 3CR8A 3A1UA 4HLUC 3C15C 1U0LA 3WYFA 2WJGA 2RGGA 4WZAE 1W46A 4V0LA 4Z1MD 2QL6A 1G8FA 3SYLA 4LBWA 2YWGA 3LW8A 2JGNA 5FTNA 1ZNXA 3OE7A 3GEEA 2IYQA 3KZ1E 4CF7A 5FOWA 2GZDA 2Q3MA 4LY6A 4U02A 4AURA 2J46A 2R8RA 2XJ4A 3K9NA 2YC4C 1VPLA 1ZD1A 3PFIA 1M7HA 4JBXA 2GEUA 4HAWA 3GFPA 3T1VA 2H16A 1SXJA 4DVGA 2JLVA 5FBLB 1J70A 4A9AA 1VYTA 1LTQA 2J0QA 2MSDB 3B9QA 4BFSA 1M7GA 3IPYA 3DMDA 1U99A 4RVCA 4FCWA 1P2VA 2IW3A 4DIDA 1E0AA 3CPHA 4OHYA 3C7KA 3IO5A 2W6ID 3EXAA 4M9SA 3GCGA 1GRNA 3ZD7A 2QMHA 4NONA 3K9GA 4K8OA 4DDTA 2V9PA 4KITB 2YVUA 4B44A 1J99A 4P3YA 3RC3A 5AJYA 4CVNA 1Z2AA 2P65A 1LS6A 1VHLA 1B0UA 2YJTD 2OM2A 5DYIA 3WYAA 2Q9BA 4LWZA 4BLTA 2F55A 4ACAA 2A2ZA 4YDHB 4JLAA 4I1SA 1TPZA 2ZUBA 4B3XA 2N46A 4LBYA 3HR7A 3S1AB 4DB4A 1CBUA 2RHMA 1OB2A 1ZRHA 1T0HB 3V4FA 4DLUA 4F91B 1G291 5EXSA 3UATA 1TAGA 2CDNA 2DWOA 2Z4RA 2GVDC 1CRQA 3U7HB 3NTUA 5EE5B 4DRZA 1OKKA 1E2PA 1YR7A 4CYMA 3J81k 3FB4A 1MO3A 2F1RA 3E2IA 3ZS8A 2ANBA 2QN6A 3U6BA 2ZEJA 1IJEA 3QXXA 2HDNB 5SZJA 2C03A 2D74A 3BH7A 2CCGA 2F43B 3QIAA 5EP1A 2CLSA 4URYR 2V54A 3X1YA 5FH9A 2OAP1 3AVPA 2KBEA 4PHHA 2WPDD 3BXZA 4OHWA 4WBSA 2C04A 5HKKA 1WBDA 4KCGA 2P6RA 3W5IA 3AKYA 4YDSA 1Q20A 1VDZA 4MKIA 4OL0A 3T1QA 4GMDA 1U94A 3GPLA 1W36B 4WIAA 3PEYA 2R2AA 1G64A 4IVPA 1DAFA 1OH7A 1PJRA 2ZRCA 4Q7JB 2QRZA 2WWXA 4KFRA 4WZBE 3K9HA 5KDLA 2PLRA 5FPTA 3U61B 1U8ZA 1KDRA 4LGMA 4Q00A 2A5JA 1GP2A 1HV8A 2PEZA 4GSYA 3TE6A 5LD2B 2WWIA 4LBZA 2GJ9A 1JAIA 1AS0A 2C9CA 2ZAOA 2R65A 4CEHA 1D8TA 2PCLA 4DSNA 5KUTA 3GLGE 2R9VA 1CULC 5H70A 3AVWA 2JCSA 3NBXX 4TSFA 1HE8B 3GJ8A 4IDNA 2ZE7A 4EPTA 1NG9A 5E7JA 3P20A 5AUPB 2ORWA 3L0IB 2O52A 3RS4A 4DLXA 4QL3A 3B1WA 4JYBA 3RVBA 4ZIRB 5HPYB 3TK1A 3G0HA 1P61B 1XD8A 5FR2A 1NF3A 1DARA 3NC1C 1GUAA 1GL6A 1VIYA 2BOVA 1N5JA 2WWYA 2CEAA 2G9NA 2R44A 1SGWA 4JSYA 1DAMA 1OHHD 2E9SA 5KNDA 4TYWA 4AC9A 2VF8A 1JEEA 1ZM2A 1M34E 3RRYA 4TMWA 1E9DA 2RHDA 1P4SA 2OG2A 2WWWA 5AJVB 5LD2C 1SQ5A 3CM0A 3WNCA 5K8LA 1AQUA
chains in the Genus database with same CATH superfamily
3UH0A 1MC1A 1G17A 3B1VA 3I4FA 1NDQA 4ECEA 1LLQA 2WTEA 5ALMA 3F5MA 5CA0B 5KO2A 1J2JA 1SZJG 3QKSB 2VYND 3FWNA 5E2IA 1OAAA 1ZNQO 2OO7A 3EHDA 5AHRA 4EW2A 5ILOA 3WGQA 1U0GA 2CLMB 3FBGA 4JX8A 4PG6A 4F3NA 1QFMA 2EEZA 3NOOA 3L43A 4Y1EA 1M8JA 3FMPB 2XOKD 3TCKA 5JUWA 1NC1A 2OE2A 5ADHA 4O33A 5T5QA 2YV4A 4ZO8A 4RACA 4O4LB 4R9RA 1KJQA 2FZLA 5FL3A 3UWDA 4EG1A 1DQSA 5ENZA 9ATCA 3RSCA 4OU4A 4BB0A 1GZVA 4KLZA 4TQUS 5ARDA 1II0A 1MOZA 1QDUA 1WMFA 3SR4A 4J1TC 5D5QA 2F4VB 1KY5A 4MB2A 3K09C 5BVGA 3OECA 4N0DA 2IH5A 4C7OB 4CKBB 2OYSA 4P1ZA 1ZEMA 2NUPA 1SUCA 4Y9TA 3ZJ4A 4ZCIA 1ZGZA 1UBGA 3OMLA 2ZANA 4R84A 2DB3A 1NJ2A 2X0DA 4PC1A 5TMDA 2NYUA 5EESA 4RAQA 3FCSB 2QN7A 3D0RA 1T9CA 2XZPA 2D06A 4BY9E 3KLMX 1G8YA 1ZJZA 3K0FA 4FLEA 2JGRA 3IKMB 4A8JA 2VTVA 3LNCA 3TR5A 2XMCA 2MOKA 1XLTA 2AG1A 4U0JA 5F3RA 3CE6A 5A6SB 2ZGVA 1S4MA 5DGDA 4BZXA 2E7ZA 2I2FA 4OK5A 4TL8A 4W99A 1XVAA 2O8CB 1R8SA 3ZWCA 1JEYA 2ZRMA 4KHZA 3B3JA 2CBGA 4ZVSA 1OJ7A 1ZEJA 2G8NA 2Y66A 1SB8A 2FW6A 3VH1A 3IQFA 4N4AA 1X38A 2IKSA 1OTHA 4MCAA 4HWOA 3QG5A 3ZY5A 4AMUA 4EHBA 4B3SB 5DNWA 1R16A 4QGAA 3V46A 2PZBA 1M2OB 4WKCA 3NGMA 1QYRA 1VLVA 4XSHA 4JLMA 3MWDA 5KKAA 5C4GB 4ARBA 3TW8B 4D4KA 1VTKA 1W5BA 5IMSA 1B26A 3G1TA 2PX8A 1RJDA 1SRQA 4GI1A 1EWQA 3SC4A 5DNEA 2XEXA 4QDJA 4PAOA 4RU1A 4Y6QA 2ZROA 1M3SA 1TF7A 4KODA 3V1YA 5B58C 1BD3A 2AH5A 5K0CA 1NIJA 1Z62A 3RKRA 4TKVA 3I2FA 3PENA 1N7IA 1NFQA 3DWGA 2WSSA 4PRYA 3ZV6A 1EGVB 1SG9A 3ABRB 2I9PA 4JELA 4LGCA 5NLLA 1JDZA 2VHQA 5HTKA 4KQWA 5TIIA 4JROA 4ETIA 3M33A 4N0QA 2FP3A 3UJ9A 1E7SA 3D59A 3QKRA 1GD1O 5LQNA 4BFUA 4BRSA 2DRIA 4C1NA 1ACJA 4X65B 1XYVA 1RPNA 4JOBA 4MZXA 1NVVR 2WSIA 1EBBA 2PD6A 3QP9A 1KO8A 2WABA 1ISSA 2GNOA 3AEQA 2CYAA 3T5GA 2YVQA 1OLUA 1E4YA 2BP7B 1AC5A 3GCWA 3M4NA 3WDKA 5A4JA 4YRPA 4V1CI 1SQGA 2QMUA 1RHJA 3CURA 3VU9B 5FHRA 3U9TA 1T5SA 2IKQA 2HA7A 2IEZA 3FMOB 4XR4A 4I08A 3RUAA 5BV7A 2W0SA 4H3SA 4CTKA 2QX9A 4XH9B 2PUFA 1LX6A 5A04A 4DG8A 1WF3A 2X8BA 4H7JA 2FEAA 2B20A 4UJ5A 4QO7A 5CUQA 3DJFA 2FUEA 5THQA 2K4MA 2BFFA 3O3NB 2I4NA 3C3YA 3B2NA 1O03A 4PO9A 4OL9A 1UDCA 5CAEA 3VNUA 3DKKA 3PA6A 1OYOA 1J8YF 4G4JA 3IO3A 4FNOA 3RYIB 3U2QA 1DAIA 1HYBA 1XMIA 1M54A 5B12A 4OIMA 5L3VA 2DUNA 2OOKA 3GJ5A 4J7UA 3T7TA 1QORA 4RSRA 4MV5A 5IX8A 4P3OA 5J3JA 3VM6A 4TYNA 3F9CA 2CXHA 5ERGB 4EWLA 4O4HF 4BNTA 5FAKA 1XJCA 1ZW1A 3OPNA 3BTSA 1N6PA 1HZZA 3AGQA 4XYEA 1MX3A 1V1RA 2BDEA 4AY2A 4CL2A 4WGGA 3IUYA 3KTOA 3LPDA 1VIDA 4K2HA 2P5YA 3BCRA 3Q40A 1ISIA 4QGBA 4D8UA 1ZGHA 2VIIA 3FPCA 3HCEA 2VDNB 5AKXA 1LV8A 1VIMA 1G3UA 1E6WA 4CL8A 4O1HA 4UVHA 4ZAGA 1YGYA 3TXXA 1GV1A 4EJ6A 1Q44A 4HUQB 1L5FA 3V4SA 3AEKA 4Y0NA 2W2KB 4ZT7A 1RKQA 2GM9A 1DBVO 1YQUA 3KFLA 2ZUUA 4B2PA 5CA0F 4XGRA 2XE8A 1EX1A 2WZBA 3RS3A 3R3WA 5DN6D 4DLLA 4BC1A 5JZBA 1XZKA 1XTQA 4MVYA 3I6QA 1DG3A 2Z4TA 4MB0A 3WQSB 3WMWA 3WYDA 3KSBC 3DAHA 2PMEA 4RKYA 4I9GA 4MUGA 1ZLXA 1PK9A 2O1EA 4CM3A 1AQNA 3TF5A 1S3IA 1SR8A 3N9IA 1B16A 2OORA 2FEXA 2ZRQA 3HBFA 5IEBA 1G6KA 2CMDA 4TUYB 3K9CA 4S0XA 5KTYA 1TTHA 3QFSA 4BN4A 1ZJWA 4LZAA 1G38A 1G41A 4G84A 3SZRA 3T3HA 1W88A 5BW8A 3CIFA 1JS1X 1EVKA 3SIRA 2A5DA 3GA7A 3GZJA 1RLJA 4ZQHA 2RC6A 5DO9A 3DDWA 5G0UA 3V1LA 3UV6A 3QVLA 1MB4A 1U2QA 1V71A 4NDZA 4CIVA 2WSYB 4OI0A 3CLSD 2WAAA 1JU9A 4PLPA 3WLPA 3D6JA 4ZAXA 4BN0A 4RAOA 3WJ2A 3Q15C 1F14A 1ADYA 2PTHA 4H1VA 2EFJA 5F77A 4CHTA 3V7NA 5FBVB 2LUOA 2NXCA 4MGEA 4MDHA 3G7SA 2OXCA 2PNFA 4R6WA 2MSCB 3FCUB 4OP2A 5EE1A 2HRDA 1JVBA 5G4KB 4MULA 1X9HA 3SJ7A 2DHEA 1TUGA 1NV9A 1DO8A 3I04A 3R77A 4P3NA 4X41A 5JQWA 3H1EA 4MQLA 3I9JA 5ITZB 3B9RA 5EVJA 1F38A 4U9HS 3IR6A 3NBZC 3S2YA 1QZTA 2WAXA 4KBYA 5F98A 3AIKA 4OMUA 3JPWA 4DCSA 1DP4A 3P2YA 2BF4A 4DY6A 3KALA 2DY1A 2XLBA 1CY7A 3HGQA 4D02A 4PC2A 1AGNA 4UZFA 2A5YB 4CI9A 3GDWA 4KK4A 2Y27A 3OMXA 3ZHRA 5C35A 5LQDA 1YRLA 3QV1A 4BUCA 1R18A 4R9UC 3IE2A 3AM4A 4BU1A 4F84A 1H1TA 3B53X 4JDPA 4R98A 2VK2A 1R5NA 1UJ6A 2GASA 2RKOA 4CI0B 2G6TA 1DAOA 2CXPA 2OPBA 4GGOA 2FVXA 4U3JA 4LDQA 5B6PA 2HZBA 2BFEA 2OP0A 4GLJA 2CSUA 4YRZA 1QK4A 3ROKA 5A62A 1HSOA 1ZX1A 3IVMA 5KMGA 1VA5A 3NHRA 1CUEA 3LE8A 3N8IA 4ZO4A 5TEVA 3T6KA 2QM0A 4GAEA 4BEJA 2W93A 2O7QA 4YTEA 1QG4A 3DDNA 2J85A 3DEHA 2OC4A 3LGAA 1SG6A 4ZQIA 1QYDA 3TLXA 4AVYA 1H66A 5FTLA 1UP7A 1GVNB 2QNRA 3D6NB 4WXYB 5BNIA 4IRUB 1AZTA 1E64A 2XHZA 4RCVA 4XB1A 5IYZF 5LQSA 1IBRA 1VL1A 2RI6A 1R4NA 4R41A 4RDIA 4QLAA 3IMGA 1JB1A 1KXJA 1P9LA 3QJ5A 4K9KA 5BN4B 1JDBC 3V8VA 3W9SA 3BD6A 1YTLA 4BMYA 1AB5A 3NWJA 1QCYA 4QXAA 1F8XA 5G4LA 5KINB 5KTSA 4RX1A 3HG7A 1D4OA 1G20B 3GELA 3UHFA 1XO1A 1RYHA 4QQKA 3KZVA 4R1UA 2CDBA 2WUEA 3EAFA 3P2OA 4QYMA 5ALYA 4E30A 1WMDA 1JG3A 3VTKA 2GD1O 1ZNZA 3T99A 1ORRA 3OCYA 4L75A 1EGHA 2Q1XA 3N2ZB 4BV9A 2V6JA 4ZHQB 3PR1A 4L22A 1SPXA 1UM8A 2ODTX 5IT5A 5IDVA 1ZA2A 3IDAA 4PLFA 3I1JA 2C5GA 5LB2A 1CF2O 4NOKA 3FGPA 1JX6A 1PYGA 2Q5CA 3FVVA 3WMRA 2CJWA 4EHHA 4OTZA 3SM3A 3UAWA 4D9FA 1O9BA 1CC1S 2DLNA 4ASUA 4RXUA 4Y2VA 2FLVA 4RPGA 3QY9A 5DYYA 2FSHA 2R97A 2ZG6A 3SHFA 1VIVA 4L15A 4MEAA 5HCUA 3RG8A 1E2LA 2QGFA 4JFAA 3VJKA 1P2TA 4ZZ3A 1HH4A 3I23A 4ROTA 3IR7A 5FOXA 1OD6A 2BIFA 3IEIA 4FFVA 2DTDA 2HRBA 1PG0A 3ESQA 3NR2A 1PLKA 3GFBA 5JI2E 1QDLB 5HIAA 1QH1B 1KVUA 2XADA 2FKNA 4L85A 3AYXB 3COYA 4MJLA 3IERA 4Q03A 3ECCA 2IP4A 3IC5A 4BNYA 2F8TA 9MHTA 2XY4A 1RHUA 3E2PA 1Z6YA 3FAZA 3RC7A 4DMHA 1TOAA 4P4NA 1ZC3A 2JFHA 3IB6A 4UARA 1ZIPA 5LIPA 1JT9A 3GO4A 3RSGA 2A5LA 1A72A 2QR3A 4MS3B 2R6HA 1FFEA 4JI3B 5GADl 5KNCD 1X7YB 2RGDA 3UPUA 1CUVA 3BGIA 2PXAA 2R96A 2VPPA 3SAJA 3QPAA 3T35A 1I3KA 3QKIA 2YDXA 2A1IA 2DM6A 1VCOA 1DUIA 1C8LA 4OA5A 4RNDB 3W2HA 3OOHA 4E0BA 4CT0A 3FMIA 4JP2A 2WJHA 3GWGA 7YASA 1Z63A 1V9CA 4HH3C 5IU6A 1HDGO 4CR7A 4JBHA 4U8HA 1SXHA 1NQAO 3VPAA 2ODBA 3QEMA 1TC2A 3JQGB 4N6GA 4TUYF 4Q9KA 3TZQA 5CG1A 5JSZA 2IYZA 4C5CA 2QLFA 4NFHA 5C37A 3C3JA 3DE7X 1EBUA 1OCEA 1QIGA 2FUG6 1USWA 4LXIA 2DZDA 3K8QA 3AW8A 4QA9A 3P2EA 2OHOA 3NIGB 4WPGA 4X92A 1LQ2A 5JNTA 5FR1A 5EWJB 2QL7A 3L8MA 4EB6A 4L73A 1N8KA 2I8AA 5TJHA 1HGXA 3QITA 4Q4HB 1Z07A 4YBRA 4MVJH 1LV7A 3WIVA 3RAFC 5I8ZA 5SY4A 1YAJA 2CB0A 2VUTA 1DIBA 1GL3A 2R6FA 2BCJQ 1OGYA 3FRJA 1AK1A 3OZGA 3CH4B 3NM4A 4X3OA 1SBIA 1IIRA 3FOWA 1T2EA 2XB9A 4O4IA 1TZKA 5CVCA 4N03A 5DIFA 5JSKA 1Z25A 3DYVA 2BGJA 1A88A 1YS2X 2PT9A 2PJUA 2ZSFA 1XZQA 1GARA 3JSAA 3MWGA 2FFAA 1I6MA 4QUGA 3SK0A 4AMGA 4UZEA 1XZBA 1HUQA 1BWSA 3WTCA 1UCFA 3P94A 5CB4A 4KV9A 3MGAA 2VAXA 1LK7A 1KWGA 3R5JA 1CJKC 4KPUB 4YI5A 1KYVA 2QTWB 1I5OA 2HK8A 5BYJA 1S8OA 4ZK2A 3PUXA 3ZZUA 4V2UA 5I9MA 4BV2A 5EKUA 2XXJA 1YASA 4ZYUA 3DBOB 4XR9A 3SXPA 1L4BA 2CK3D 2B8JA 5HDQA 3N2IA 2E21A 3PP8A 5EUCA 1K7EB 1UXGA 1YS1X 4K9QA 3RFCA 2QGZA 1INLA 3L4BC 1ODSA 2XA9A 5IFLA 1IC6A 1P3DA 2KWIA 4HQOA 1KGDA 1SCKA 2PIDA 1SKBA 5AOVA 3UV7A 3UMGA 2XB2A 1F17A 2D1YA 7REQB 4HBGA 4D6YA 4G5FA 1P81A 5CDFA 5IUJC 2GCGA 2PXCA 2GLTA 4BMOB 4D45A 2E4ZA 5KYKA 4M8NE 2HHHB 1DC7A 4PGAA 2DF8A 3AVVA 4G23A 2ATVA 5FLXA 4IMIB 3U80A 4M87A 2P4SA 4ILKA 3ZVLA 4QTYA 2II6A 2VBGA 3EVZA 3V55A 1O9GA 4Q01A 3LBYA 4REOA 5NULA 4JJEA 1CD5A 1B00A 3HEAA 2VP2A 2A1TR 4N1AA 5T4EA 1X8LA 2Q45A 2AZMA 1L7QA 1I51A 2REOA 3KK0A 4XDYA 3UA3A 1W87A 4I4TB 4WK2B 1VLMA 4A91A 1Z7BA 1TL7C 3PWSA 5CHEA 1VJTA 2DQYA 1AHNA 3FX2A 3WYBA 4KTVE 2HTEA 4US1R 3F5QA 2JFBA 5BR8B 2UYCA 3I9MA 2C4WA 4CLDA 1FP7A 4I1YA 4B75A 3VC3A 2GAJA 4BBAA 1MORA 3GJSA 3PICA 1R8QA 2YBDA 3PA8A 3W3AD 4BLSA 3VTAA 4DB2A 1O9HA 3U26A 3IJRA 2OHJA 2X0EA 4EA8A 5C7OO 3W5CA 4BO5A 3OUUA 4ZDKA 4MRSA 1CUYA 1LNSA 5IF3A 3I6ZA 4S04A 3KDAA 2X4GA 5GOTA 1Y5LA 4ZHQF 2IYWA 1JE0A 4M1QA 5F73A 5I7RA 2B1IA 4PYQA 3T38A 5EFOA 1FVHA 1QVAA 2IU3A 5FNVA 3E1GA 1LRJA 1A9RA 4WESA 1GN8A 4JR0A 3I1YA 4LF5B 3DB2A 2I6TA 4MWGA 4DJEC 3S1AA 3TFWA 2IYPA 2XD9A 5JSZB 5FEUA 4RYDA 4ENVA 3EXFB 4L6CA 4RK5A 3GJTA 4YAIA 4ETNA 4GDMA 5CA1B 2B9VA 2VDKB 1EDEA 4JN6B 5GZ3A 1UMBB 2BFOA 2Q9CA 3Q85A 1IZ8A 3HCWA 2H4FA 3NBMA 3JAKB 1L4HA 3OY2A 3RYHB 1MIHA 2WKRA 1Q74A 1ZLYA 3DZJA 1GDHA 3EG5A 3GMSA 1KI1A 1S8FA 3THYB 4OH7A 4X66B 3KYIB 2EFDB 4M2LA 4QUBA 3RU7A 3SQOA 3A11A 3LHDA 3VNBA 3OZBA 4JVOA 5I51A 2IZ5A 4CU5A 4OGLA 1U1FA 2J4CA 1NRXA 3CCBA 3WO0A 3ZD8A 1NFRA 4E5KA 1BS2A 2JBAA 2PBFA 4ZV9A 1DV2A 1N2IA 2OECA 5CDSA 2V7EA 3O8QA 3O4JA 2P77A 1XJ0A 1EINA 2YWRA 3QBDA 4I14A 1VG8A 2MSLA 3WHIA 2X41A 5CB6A 2GM4A 2YCBA 5E4YA 5IAKA 1Q91A 2IV7A 1X7XB 2BHNA 2C0PA 4A2CA 1KP2A 2RD2A 4ARUA 3FH0A 3EPLA 3I2IA 3PNYA 2G08A 3OZSA 2VPIA 4UEWA 1I30A 2O8VA 1AZSC 2GLXA 4WVFA 5IPFA 4HZIA 4X71A 3NEAA 3B12A 4KR7A 4TTPA 5G40A 4MV3A 2GO7A 3T7RA 3LWBA 1NL3A 1T3LA 3G9TA 4TL6A 3PJGA 5ED0A 4YCAA 3IDZA 2I5PO 1KZ4A 4J0JA 4YRMA 3E6AA 2XCQA 4NNPA 1RCFA 4PIVA 4QQRA 3H0EA 5EQDA 2D7DA 4XJSA 4BO6A 1E1KA 1XF1A 3ELYA 1SK9A 3I05A 2GEDA 3B2QA 4YHHB 4F46A 1PWZA 2QG6A 1XZMA 3HV0A 3RYCB 3DLIA 2ZB8A 1SUIA 1XCPA 5KTKA 3M49A 3HADA 5T67A 2C9MA 1C3XA 3I39X 2E4YA 1DC3A 1M5UA 3N2GB 2VYFA 4NKRA 2ZUTA 4ZEOA 1RP7A 2FMTA 5GJBA 2G9RA 2P2ZA 3DV0B 1IHXA 2WMDA 4OQYA 1RPTA 2PUWA 4TS3A 5AI6A 3HKCB 4WK4B 2CHQA 2L19A 4DSZA 6REQA 5LVAA 1S1CA 1GNTA 4B82A 4ZIRA 4EHAA 3R41A 4Z54A 5IAOA 1A4RA 3BBLA 2R751 1BO6A 2O23A 3OE7D 4A0SA 4MR9A 3IE1A 3TSAA 3N75A 4MEBA 2V7PA 5KHOC 4Q6BA 1THZA 3C74A 1GA6A 1G2OA 4HADA 3MHTA 1FXSA 3TXAA 1W29A 1KR2A 2OYRA 2GS9A 3N5CA 1K8XB 3GJZA 1QTIA 3OKPA 1NSYA 3VV2A 3VZRA 5B3LA 5CVTA 1Y7IA 2BZGA 3TYXA 1TCBA 1KMMA 3SP1A 4EFNA 5KYYA 5DW3A 4DLSA 1BJRE 2LCIA 4OQ4A 3VC7A 3MTAA 1UPXA 1XJ5A 2P1ZA 4J3JA 221PA 2Q6VA 4I5GA 2HNBA 1GO2A 3JQ9A 3MWEB 1NX9A 2UAGA 3JQQA 4RV4A 4YV7A 2YVAA 1QJ4A 1FSFA 1V11B 3DE1X 5ARBA 1Q95A 3V7FA 4WN9B 5F33A 2ZI4A 1MV8A 4ZARA 1MABB 3PIRA 2P6OA 4N5HX 1R5OA 2IBSA 1A76A 2L0XA 2R87A 2DTEA 1GNSA 4HX5A 3BTOA 1HRKA 1QANA 2QJFA 2YZ7A 3C7AA 2WF6A 3TGPA 1MNQA 3I73A 2XW6A 5DHPA 2RG1A 1A04A 2OT3B 4BX9A 2AD1A 3F5SA 5LR6A 4ZI7F 2FSIA 3O1LA 4G07A 3BAZA 2ZT7A 4BMNA 5B55A 1QR2A 1SCIA 2CL5A 3ZGZA 3VH4A 3DVQX 1EUDA 1H5QA 5H9VA 3SC2A 2AOWA 3F9IA 3TLGB 5IXSA 5IXYA 1HM5A 3CW2A 4RK1A 5CFZA 3IL2A 3WRXA 1N6HA 1U1IA 4FCTA 3R8CA 3ZU4A 4HFRA 4EEKA 1Z18A 3N8NA 4KQFA 3RHTA 3MJ4A 1Q77A 2HHJA 4ZKEA 3QXHA 3CVXA 3DFFA 1F7VA 3ORQA 2IYLD 4GMXA 4IJWA 5IHXA 4JJFA 4QVGA 3TTXA 3DEZA 2HGSA 5AW9A 5KS2A 4JYPA 4TXLA 1R6DA 3GLVA 1D2MA 3IUQA 2DULA 2JAWA 2MJLA 3LBFA 4HZUA 4U7WA 5DLDA 1X74A 5FFNA 3V8RA 2XDAA 4BLPA 1OA0A 1LD3A 1TMKA 5TNXA 4NEGA 5C1DA 5KOJA 5CA1F 4NAUA 2GZ3A 2ECQA 1XRMA 3HKDA 3PQ8A 1IIBA 1A98A 2C8VA 3GYBA 3IOBA 3QPDA 3UUEA 4CG2A 4PHCA 3GA5A 2R66A 1BE1A 1LPOA 3VQTA 1C50A 1PR0A 1KFCB 1XNJA 2CZQA 2VVTA 2RB5A 3M9LA 4D99A 5B2EA 5C1OA 2I6UA 1XSEA 2O5CA 2J3JA 1HDXA 4PSKA 3DTVB 3DCYA 1DUVG 1VL6A 4HDKB 1YB4A 4R0VA 4EFDA 3ZCQA 1T3TA 3I01M 2ODPA 1T9BA 3E9YA 3TLZA 3UGKA 2EV9A 2QMZA 4Y0AA 1DI0A 1E2EA 1MB9A 2P40A 2BFAA 2ZRNA 1O95A 4YJHB 5KYGA 2QV0A 3A4TA 4OX9Y 2QL5A 3T52A 1U0RA 4NNJA 1IOZA 1B0ZA 1U1CA 1NAHA 2VJMA 2CL0X 2ZJBA 3P9CA 4MYDA 5FCDA 3ACDA 4BTEA 2PKRA 4NICA 1M0SA 3U31A 3UK0A 3AUYA 3CRVA 4FTWA 2YDYA 4E88A 1N5MA 5K8VA 3PGVA 1PK8A 1QTNA 4QRHA 3HCRA 3O4FA 1E7WA 1NKVA 2A84A 2BZ1A 2O9JA 2W6MA 3AUFA 3PFNA 1ESCA 4HNRA 4AZ3A 3L8CA 3MEQA 3R7SA 4B3JA 3PNVA 1Q2XA 2FNAA 2X4IA 3C3BA 3KD3A 1FQKA 4MWDA 4MYCA 2O48X 3N74A 5H4GA 5DDIP 4DV2B 2WP0A 4ARZB 1B74A 2WF5A 1W8DA 4JBIA 4PYJA 2DPHA 4GPAA 4N8EA 4UPDA 4YY3B 4WLEA 1ZOPA 4JBNA 4RMNA 2IP2A 4Z9AA 4H6VA 2G4LA 4FX5A 1U8XX 3MA0A 2Q3EA 2CKDA 4BS9A 1W1WA 3DR3A 3DNPA 4PG5A 1KVQA 3SS9X 3VR5H 2VJPA 4QSMA 1OQAA 5DNCA 3CZPA 3Q8MA 2QI9C 1E96A 1E0JA 2OBMA 2XB6A 3DXFA 4RF3A 3D8HA 3KLOA 1E8DA 5LBTA 5A4IS 4EFLA 1OB5A 1VPVA 4MRNA 2FFRA 2YMLA 4QLOA 1PQWA 1QQBA 4S2EA 4M1YA 4GUDA 1QIIA 2P62A 2Z4SA 5ALNA 1ZMTA 3TX2A 4F6RA 5FA5A 4YMLA 5K01A 1AV6A 2WP8J 3DHVA 2ZW9A 5H83A 3QGMA 5JJLA 2Z6UA 3RSOA 4U5XA 1Z82A 1SVIA 1U0JA 1A2QA 4JLUA 2XWBF 4HH0A 3EEQA 5GONB 1XI2A 1OX4A 2G09A 2PV7A 2FZKA 3OJ0A 4J16A 3LDFA 1RJEA 2RGEA 2YWCA 1U3FA 3L5KA 4JMLA 1EAMA 5I45A 1JEOA 4N7BA 3IE0A 4QJ4A 3H11B 3JQ6A 1IMJA 3TJMA 1F9AA 4V0SA 5GAJA 3DB1A 4AJ9A 4EIWA 2VJKA 1OXBB 4EA7A 2QU8A 2GZ2A 1VGRA 3KCQA 1IQUA 3FKJA 1WNTA 3TQQA 3O8RA 2PJZA 3KWLA 5IC6A 1EAYA 4P2BA 4J0IA 1CEYA 2NLOA 2IHBA 4BRZA 5JANA 1FDTA 3AWIA 1WX1A 3HJTA 3GQVA 2P67A 3LLSA 2DR2A 3HU2A 4PAWA 5B3AA 3LAWA 1I2MA 3SKYA 4EMUA 4I3GA 1HYQA 5E95A 3WDLA 1OZAA 4TZ0A 3OQ6A 3HDQA 4KU4A 2HADA 5ITWA 4HMPA 1YR1A 4MW6A 4Y1RA 4C6TB 1UM9B 1THMA 3C5CA 3ROQA 5HM6A 4EHDA 1AQYA 5ECWA 1W25A 4L5JA 4OQQA 1LDNA 1YL7A 2X8JB 4UC0A 2QX4A 4UEQA 1WHTA 3IUJA 2AQ8A 2B1JA 4L8GA 2OB1A 2J3IA 1TF5A 2XNHA 3UJDA 4PAQA 1H3EA 1AH2A 2IYXA 3HDVA 2SCUA 3L05A 3SXUA 1ZUHA 1F51E 2QWXA 2AV6A 4GQAA 4XGIA 2F17A 3MS2A 1GUDA 1N6OA 2UYYA 4TRMA 2HXGA 3W4KA 4AMVA 2BSAA 3S28A 3N0WA 3LH5A 1NE7A 4GBGA 1CXZA 2G5TA 1W35A 1L4UA 4Q34A 1T24A 1N5RA 1Q6ZA 3KRTA 4HB0A 2SECE 2PWZA 3Q0EA 2QUHA 3TQCA 2IYTA 3MJEA 4ARSA 1JHAA 2BBTA 2Y4NA 3CTPA 3FWZA 3NWPA 1MJNA 2AOTA 2AMFA 2LCFA 1JN0A 5CVDA 5K1ZA 3QWIA 3W9UA 1E6KA 1ESDA 3IPLA 4X3CA 4RSMA 4RPJA 2HV9A 1M34A 1N4DA 2QX6A 5FNZA 3WRYC 4LI3X 1C81A 1GTG1 3CX6A 1GTZA 3CVVA 2GGSA 4W8HA 3RPEA 1JMKC 1D5WA 3EZ7A 1PAUA 2X76A 1G66A 1V95A 1LS1A 1U4OA 1TCAA 2EX4A 1FXWF 2C3YA 2I3BA 3Q8XB 4I81A 5EJEA 3H19A 2QM7A 3AW9A 3PC8C 4PEVA 1RMTA 1O96A 5IZCA 4ED9A 3PVSA 2EGGA 2KPOA 4DLVA 3S1LA 2PV0A 5BOVA 3U40A 1GL7A 3AY7A 3H6GA 3EMKA 1JHUA 1MOSA 3WLTA 1UWCA 2Q3LA 1X0VA 3WB1A 1XMOB 4KXVA 4X7BA 1KFEB 1YMUA 1KSJA 3BWEA 1H0SA 2JGIA 4DM4A 1XPOA 3EQ2A 1XWWA 1DKLA 3IPXA 1Y81A 2BW0A 2ZJ1A 2VUUA 1SAYA 3KTAA 3OBBA 4ZQGA 5KOHA 1N8SA 2O0HA 1N3YA 1R0WA 2I2XB 2REQA 5FWYB 3Q72A 5BSTA 3OZDA 2BMVA 4ND5A 4R3WA 6NULA 3QFCA 4QFBA 5FL7A 3C3DA 1IBCA 5IDXA 3P9SA 3RU9A 4ZO7A 4E3ZA 5G0SA 1T1EA 2YHBA 2CLCX 4DNFA 1R0LA 3DOIA 3L7OA 4I2NA 3D0QA 3I3OA 3FUCA 1L4LA 4UHFA 1WQ1R 2H4YA 3BSYA 4BUZA 2XQVA 3LLCA 1S3FA 3ZWAA 1DO0A 3I3SR 2V97A 4PN7A 4CLRA 4RVHA 3WGYA 1RI5A 3HL0A 4KKVA 1QHEA 4KMRA 4X8OA 4EHFA 3F78A 1SKQA 3LZCA 3MUFA 4EJSB 1PR4A 2I65A 4UHEA 1RAAA 3TVTA 1E9RA 2EZ9A 5DNVA 3JY6A 4QLBA 1OTYA 1LK0A 3CUUA 1D2RA 4RPKA 2J5XA 5A4MS 1W4ZA 1YV9A 1ODKA 1Z2DA 3FGZA 4QICA 3CJQA 2V0GA 1B8PA 1ANKA 2EIHA 4JJ8A 1PTJA 2VDWA 3H18A 1V6AA 2RJNA 4MW4A 3HL4A 4YASA 4BP9A 3GGDA 4EPXA 5AIBA 3SYRA 2IPMA 1CQXA 1DT3A 2R6DA 3J7TA 4AZ0B 3HUUA 4CDGA 4URXR 1QGUA 1R0XA 1GTRA 2IUEA 3EXHB 4QC2A 3RI3A 4Y2HA 3ELDA 4HWRA 4YRBA 1T0BA 4HC4A 4RJ2A 5IN5A 1T9GS 3OU2A 3O26A 4UNSA 1N5OX 5TGTA 4TXHA 1FYFA 2M6LA 4ANFA 1ZI9A 1SC9A 3DBIA 2W6ZA 5GVRA 5KC9A 5IKMA 5EWLA 1A8SA 4UU0A 5SYNA 3LFHA 4AYTA 5LQRA 1KY4A 2QE7D 3B89A 5FUXA 4ZQEA 5JVDA 2AQIA 3TTVA 3T3GA 3UG6A 1XEWY 5FDFA 1H0RA 4EKNB 2FRVA 2C7GA 2XSZA 4KAXA 4LC1A 4CMGA 2D0OB 5KJFA 3SNHA 3U09A 1Y6ZA 1XT6A 2WF8A 2ZCUA 3QOWA 1OVMA 3I9KA 4IOMA 1P60A 4OPMA 3WBBA 1J23A 1KYTA 5LP6A 4BNHA 1ODJA 2ZI6A 1K06A 5KIAA 4ID9A 4GMFA 1H2WA 1HQDA 2EVWX 1W19A 5INTA 3O6VA 2UXDB 3ZZ1A 3G8AA 2VNKA 4KQMA 3MJHA 4FOPA 3G49A 5CXQA 1NMYA 2ZB7A 2D5IA 3NG1A 4MUYA 2PGOA 4RK4A 1I14A 1WA5A 4YLGA 3GZTB 2F8SA 1XCMA 4GXRA 2IQ5A 2B4RO 2GK6A 4BNZA 2XX3A 3JYPA 3O2NA 4XB6B 4MUFA 5JYBA 1YR9A 3QELB 3OHMA 1XVVA 5JMWA 3MMNA 4AX4A 5KOJB 1QFJA 1WKCA 5LDGA 3IPAA 2NU8A 5TSDA 2PMDA 4UMDA 4R40A 2POQX 5EIEA 2C99A 2FPWA 3PPIA 1U8EA 3FTCA 3CNOA 2AN9A 3PPWA 4TPKA 2ODAA 4DQ0A 2IOFK 1YS9A 5CCXA 4LF9B 3LBAA 4GVPA 1J6UA 1RTKA 2IGBA 4EB8A 3OLVA 1L7NA 4RXMA 1VL2A 3E4DA 4E08A 5T7BA 1NR1A 2GZAA 3CWCA 1PG5A 4YCDA 4PPNA 2IYRA 1N6KA 3HXPA 4NU0A 3X2SA 4DJ5X 1GKYA 3BC1A 3M2PA 4K28A 4LISA 1Z4IA 2QHXA 1E79D 2QNBA 4ZC1A 2Y0DA 3TD6A 5A06A 2J5RA 1MH1A 4GKKB 2Z9CA 3DMNA 621PA 3HZOA 3RIGA 2DFPA 4OLJA 5HIIA 4BCDA 2FWJA 3CUYA 2J7PA 3FDFA 2NADA 3O21A 5AKZA 4R1TA 2H57A 3KZCA 2BVNA 1NLUA 2FK8A 2QR5A 2WJYA 3LLUA 3M5CA 4KIFA 4L78A 3DLAA 3EDOA 2VYCA 3I83A 4RE5A 1P9NA 3FFTA 4FEGA 2VXCA 4Q48A 2MINA 3KBOA 3EIFA 1JILA 1BG6A 1KZ9A 1JLLB 2QRPA 1M1NB 5GZ6A 3CGGA 5BN5B 2WV7A 3FETA 1C9DB 2DUUA 2BKXA 1OIXA 5K20A 1LWOA 4U5QA 4ENRA 4NU5A 5B7GA 5C52B 3MCUA 2I9KA 1ZWKA 4LXXA 4M8SA 1L4MA 1YVUA 2GN2A 4BJ5A 3WK8A 4CBVA 4RCZA 5IKPA 3HJFA 3ND8A 1PGPA 2Z5FA 4GH5A 4MS1B 4EYQA 1QGED 1S7GA 3G9ZA 1UOQA 4HDMA 2ZWMA 2PLNA 3PDCA 3TECE 2QQEA 3WOVA 3O2SB 3VUFA 2QUAA 3EVCA 1K27A 3FWPA 1KYIA 3DC7A 3GRPA 3WWDA 1K0UA 1T91A 4PLZA 1CLUA 2VJAA 3ZOZA 1BHSA 4GEKA 2LCQA 4F11A 2X5OA 4YRAA 3P9PA 5B64A 1H93A 2BFPA 4G0XA 1EGAA 3AHGA 4MK4A 1TIPA 1RYYA 2X22A 4YT2A 3D4BA 3L4EA 1APBA 1NN0A 1FNNA 1XD2A 1SPBS 2C2OA 4OFXA 3WNVA 4W5TA 2QAGC 3JALA 4J0EA 1V25A 4LHZA 5E38A 2EF0A 4REQA 3ZBTA 5FUMA 1VE3A 3Q4GA 1P17A 1L9KA 2O54A 4PR3A 1GM5A 3E23A 3QEKA 2V4MA 4DVJA 1OASA 1PR2A 4H6PA 1R5JA 3H1FA 3T9BA 1NXOA 4RLHA 1X8JA 4LFCB 4MX8A 2DBVO 1WVIA 4FEAA 3VTZA 3L1VA 1R2QA 2HMTA 2VDRB 2J6BA 1RCUA 2GCOA 4HYEA 3WISA 1FBTA 1JQJC 3QVTA 2GJAA 1OW3B 1A1VA 4M9CA 1Y7LA 1BGWA 3DE0X 2IYVA 3I8XA 1EESA 2CXOA 5BR4A 4Q7MB 1ZXLA 3LG2A 4EY3A 1VHQA 4DQKA 2EJWA 2QBYA 3MG9A 2IUTA 3B3QA 1SXPA 3ZBPA 1AM4D 2ANCA 1ABEA 3DYIA 3KXDA 1ZU4A 4MTLA 5AVVA 1O6CA 1IZZA 2XHEA 4HG2A 1U0BB 4U0KA 3ROTA 1JEQB 4EGCB 3L8HA 5GZ1A 3EF1A 1MD9A 4ZT3A 1VKRA 3O8OB 1NW4A 4MQBA 2NAPA 5M7EA 1P7ZA 5BSMA 2Q7XA 4YCBA 1Z7EA 2W6IA 3GLHB 4GZMA 4MW0A 4X64B 4TXMA 5FBZA 5LUBA 4UREA 4K6GA 5MF6A 4EW3A 1RI1A 2JHFA 3RKUA 3BD9A 1UKYA 4L57A 1PJSA 1B41A 1U31A 4IUYA 4YROA 5EXXA 1WCYA 2FOXA 4JHXA 3B7PA 3WMFA 3LQ1A 4JC5A 5IULC 1PX2A 1ZO8A 2DLDA 2AZDA 4IGAA 2NU7B 4Y2SA 3A05A 4F2DA 3SVLA 2R7MA 2TRSB 2VG8A 2AFHE 4R2LA 2RHCA 5EP4A 3CRW1 1M2VB 1QQ5A 2EQAA 1I7PA 1VHJA 3P26A 3TMKA 2LXNA 4KQCA 1GZSA 1Z34A 3KB8A 3GUUA 1UF9A 4RESA 4IUBS 2A9PA 1ABFA 3AL0C 1G42A 4KVFA 1QP8A 3BIOA 2C07A 1N6IA 1WKBA 4WT7A 3ASZA 4XEUA 3M70A 1EWYA 1E7QA 1JLRA 4YYEA 1SCAA 3EXEB 3NATA 4U6QA 1NFFA 3VISA 4XPIA 5FYQA 1OY1A 3VTFA 1P44A 4DR4B 4BRWA 4RXTA 5ICMA 2UUOA 3B1XA 4FYXA 1Z3IX 3T06B 1PNVA 1F0YA 4GBMA 3CNNA 4JLNA 3TLBA 5E7QA 4TQ9A 1H6AA 2NT3A 3VSBA 3VKGA 1XAIA 4JLBA 2Q8NA 4BP8A 1GTL1 1E3MA 3TQFA 1I94B 3LUKA 3SZLA 3L4SO 4DLYA 4HDNB 3EGEA 4Q02A 2B2XA 3HYTA 2ZR8A 3OJFA 3FOZA 2B83A 4MGIR 3X2FA 3VOSA 1JAHA 1SBTA 2Q3BA 4S1NA 1A69A 3T1NA 1DGQA 4NCXA 3A14A 4EABA