3KZIH

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3kziH01
5B66H 5E79H 5H2FH 5GTHH 3WU2H 5KAIH 5GTIH 2AXTH 3KZIH 3A0BH 5B5EH 4IL6H 1S5LH 3JCUH 3A0HH 5TISH 4UB8H 4PJ0H 4UB6H 5KAFH
chains in the Genus database with same CATH superfamily
2NZ2A 5KAIE 1SLQA 3WU2H 2A45G 2RN0A 3L37A 3H1HG 1LTIC 3L74D 2IYOA 2KZIA 1NAYA 3GW6A 4GODA 4GT1A 3CC4P 2O1JA 4DCKA 2JR8A 4I7ZC 3CI9A 5AW6B 3LIDA 4EIJA 4LGDE 1X8YA 2FYNC 3L72G 1GK4A 3VMXA 1NU1G 1SQQK 2HLOA 2KLVA 2MKVA 2OQQA 4ZKUA 1RF0C 2FYUG 1Y47A 4D6TJ 1BE3G 1LT1A 4GIFA 2B88A 1FU1A 4RESB 1KYOH 2AEJA 1XTGB 2Q1KA 2YIUB 1M1JC 2RH0A 3CCEP 3M9HA 2ZXEB 2J58A 1GW3A 3L73E 4AUWA 1BGYG 3LW5J 3M0AA 2KNCA 3BCCJ 3KYQA 1USDA 4HB1A 3G6EP 3R2PA 2O01J 1SQQD 1SQVD 1VQMP 2V7QH 3H1IE 1HJ0A 4HKZH 1YJNP 1MFZA 3A0BE 3HE5A 3PRJA 5AW0B 1KFNA 3Q5RA 2IYPA 2K37A 3IF4A 1ZP0C 2KUBA 4UB8H 1FAVA 1L0NE 2WSCJ 1LTSC 1KYOD 1EZVD 2IFNA 3GHGB 1S4XA 1PPJG 2M5AB 1EZVI 1GK6A 1FZFA 1J2JB 2AXCA 1IFPA 1JY2P 1L4AD 2WITA 2V4HA 1LTGC 3RK3C 3M91A 1RF1C 3AEFC 1EXIA 2AEFA 2W8ZA 2ITAA 2POHA 3GMAA 1BSNA 2HYNA 2GA1A 2R3CA 4BRYB 4ZNCA 1FE6A 2FXOA 3GF7A 1RF1B 2KNCB 1VQKP 4L74A 1GZLA 1QX8A 3M06A 2FKWB 1KV4A 1K8AQ 1LWUA 1S2EA 1S9KE 3AE3C 3AE2C 4U7JA 1RF0A 1L2PA 3HE4A 5CCGD 3CC2P 2OGUA 1NH4A 1S5LX 3MGNA 4OH8B 2YKPA 5M1BA 4C46A 5CMZA 2QEXP 2P2UA 3CWBG 1LJ2A 2QJYB 5KLIC 1VDFA 2BCCE 2K88A 1M1JA 1FDOA 1XTCC 3BCCD 2MJZA 1EXJA 3M9QA 3H32B 2KLUA 3Q3DA 4PV1C 4BRYA 3IN6A 1L0LK 1P84D 2LKMA 2ZXXA 3H1KD 3K5BA 3TSIA 2BCCD 2B87A 2D2CD 3BCCE 3GG2A 5KLVD 2RKLA 4WWIA 2D2CB 1KN7A 2JKVA 1FDIA 3TGUD 4H44C 2JWDA 2FY8A 1ZOYC 1IFNA 2FYUD 2R5DA 4OWFA 1ZW0A 2E75D 1KFMA 5CJ0A 3RK3E 2K3RA 2C9NY 4H13D 1GMJA 1EC5A 1SQPK 1NTKD 1NTZE 1OW7A 3CXHH 5AVRB 3ZDMA 1T6AA 1S5LE 4I6MC 2E5YA 1KZUB 1JCDA 4PV1D 1FJPA 3CD6P 3CX5I 1AQ5A 2YO3A 5GTIH 1JMBA 2JDIH 3OAKA 3A0HH 2W6BA 3B4SA 5C39A 3MHVA 2Q9IA 1BDCA 3MD0A 3D6ZA 3HTKA 4DT0A 1EZVE 3HD7D 1JCCA 3KPEA 2IDBA 3V6IA 5APTA 3FWLA 3U1AA 1PPJE 1RQVA 2QRXA 3AE6C 3VP9A 1OVRA 1GU5A 3H1ID 3W68A 2M3BA 4I2LC 1N73C 2UWJE 3SFEC 1KB9H 1LTBC 1N73B 1A02J 1KTMA 3TDKA 1NTMK 4AQRD 3G71P 1NJIQ 2M5AA 2WSCH 4N78E 3CCSP 4QMAA 3NXSA 2G3AA 3H1LE 2AXTE 4IL6E 1VQ7P 1N7LA 3FXDA 2KSJA 1LP1A 1URQB 3BRTB 5AW4B 3VMYA 3O6QA 1URQD 1PP9D 2PP6A 4WY4A 3V4WA 3AE1C 1SFCC 4KHXA 3T97B 5GTIE 3E1RA 1N7SC 2O01N 3KZIE 3N4XA 2E42A 1K05A 3L74G 3L35A 3L71D 1AFOA 1E79H 2L5GB 2WSSH 5AVQB 1SQBG 2QG4A 4L75A 1H88A 3CCVP 4GOEA 3S4RA 1QVGO 4L76A 5CCHD 2N1TB 2J59M 5AW9B 5BU5A 1Y8AA 2A06E 1K9MQ 1AA0A 5BU8B 3UIAA 2Z4EA 3L72D 5AVXB 1BE3D 2HR3A 1NHLA 3TGUJ 3P7KA 1PL5A 2NPSC 4Y28J 1NOHA 2IFMA 5AVSB 4ASWA 2WPSA 2W27A 3TGUG 3AEGC 2P67A 3JC22 4U3FE 1AQTA 1SQPE 1SQPD 1GL2D 2FBWC 1ZR4A 1N7SD 1SQVE 3L73J 2H8PD 2W83C 3M0DA 1VF5C 2W6JH 5BVZA 3A5TA 2P10A 2E75C 3GHGC 4GDOA 2QM8A 4PJ0E 3TGUE 3L75D 3VYIA 1NWQA 3C8VA 4HH2A 3RK2D 2YKOA 2B9BA 3VOPA 1X79B 3H1LD 2XNDH 4D6TE 1ZV8A 4EYYQ 1LWUC 2KIKA 3H25A 1RF1A 3TNUB 2WMMA 1NYHA 4N78D 5EFWB 5KJ7D 3L70D 4HJGH 1NKZB 2KP8A 3HE5B 5APVA 1W2BO 3AE7C 2AEMA 5APSA 3Q1MA 1H0TA 1N2DC 3L71J 3SWYA 1RE4A 1YI2P 2W6AA 2IX7C 3CPWO 1MFTA 3L4FA 1FZCC 1JY2N 5B66H 1GU4A 1PGQA 1KQLA 1GL2B 4WB4A 3HD7C 1LTTC 2YNYA 2YXQB 1L0NG 2Y0EA 1JMMA 1G1JA 5AW3B 4YXWH 3CCUP 1A02F 1MUUA 2R3SA 1SP4A 1L4AA 1L0NJ 5CJ4A 1OIPA 3W67A 4C7NB 1JTHA 2OARA 3VP8A 1N8RQ 1RQUA 3USSA 1S5LH 1IC2A 3CXHE 3H1HJ 3PLNA 4UB6E 1NTZK 2FYUK 2YKQA 2H43A 2ZT9B 1KYOI 3SWKA 4IFDK 4TLFA 1BSHA 3MUDA 4JQ0D 4C7RA 3TK1A 1PGOA 3RK3D 1FZGA 1ZMEC 3A0HE 1L0LE 1SFCB 3SSUA 3OW2O 4RJTA 4OVNF 2BASA 3KXDA 4PD4I 5E79E 2E43A 4WVZA 1SQBD 2K9JB 2HODA 2W90A 4W7ZA 4Y99C 1OMIA 4H0LB 2RMZA 4K3AA 2FYUJ 3H32A 1SQXK 3PTZA 1BE3J 3O8ZA 3CWBE 1GL2C 5AW7B 5KLVG 2FXPA 2K9YA 2V7QJ 2L91A 3CCRP 3RK3B 1KB9E 2B87B 2YMYA 2QVAA 2ZYAA 1NTKJ 3JCUE 3NFQA 5AVTB 5KLVJ 1CZQA 1BCCJ 1N86A 2OTLP 2KI7B 1CSBA 1NTME 1NTKG 2N1TC 2M3EA 4ZMDA 1SQPG 1HVVA 2HPCB 2E74B 4IL6H 1QL1A 1JB0J 1JY2O 1SQVG 2I8DA 3KQGA 4R4MA 3VMAA 4Y99B 4C7NA 3L75J 2KYVA 2Q7CA 1YTZT 1FS0E 2Z5HA 1KILE 2PAJA 3B5NA 3KZIH 3B8EB 1YHQP 3L75G 2E75B 3WMM0 1UIXA 3CCQP 1KB9I 1LGHB 2CPBA 4KT0J 2WWWA 2OTKE 2QJYC 3A2AA 5KKZB 1URQC 1SQBK 1U57A 2ZT9C 4B86A 2N9BA 1USEA 4JF7A 1VQ9P 2JWAA 3L70G 4L73A 5B5EH 3B5NC 3MZWB 1WRGA 1LTJA 4W7YA 5AVWB 5TISH 3L75E 4PD4E 2GUSA 1JY3N 3L72J 5KJ7A 2B89A 1NU1J 2CK3H 2P1JA 4OGQD 2OYHA 3L36A 2XDJA 3MIWA 1IFMA 2FYNB 1OWAA 1KYOE 1SS1A 1JOCA 2Q6QA 3L73G 1BCCE 1LT9B 1OW6A 3HD7B 2G8YA 4R4LA 5APUA 1KD1Q 1KILC 1ZN5A 3N7NA 1KORA 1RE3A 3AEDC 3WUUA 5GTHE 1NTZJ 1VQ4P 1VQPP 3CWBJ 1PP9E 3L72E 2QSIA 2ZT9D 4O9BA 1BGYJ 1NTZG 2FFDB 2ZYDA 1W2EA 1YTZI 2IBZG 1KILA 2A06D 5AW1B 1IJDB 2FXMA 1YJWP 5AW2B 5CCGC 1L0LJ 2WSFJ 3H1KG 5AVYB 3T97A 3U59A 5K5GB 4N6JA 3MUDC 2JO1A 1T8ZA 3VTPC 1M1KQ 1DEBA 1DD3A 2GUVA 2KS1A 4IL6X 2BEQD 3H1HE 1LTJB 2IBZE 1KILD 1LT9A 2I1KA 2YXRB 3HUSB 4NPEA 3Q5PA 3II6A 2ZJSE 2PGDA 1L4AC 1KQFB 3P8MC 1Q82Q 1FZEA 2OYHB 1FBMA 1VQLP 2LXCB 3HUSC 3HRNA 3TYYA 1T2KD 1YYCA 2IBZI 2PRRA 5TJHA 2PFXA 5CBNA 3FXEA 5APXA 2WVRA 4PD4H 1SQVK 1YJ9P 2KB7P 1GTWA 3H1LG 2Y9YA 3AEAC 3G9RA 2XNXA 4CPGA 3S9OA 1JY3O 2WPQA 3PHLA 1HTLC 5APWA 3CMAP 2HG5D 3MTUE 3SFDC 1U7JA 1Z56A 4GKGA 1Q7YQ 1GDTA 1CW5A 4EI2A 1N7SB 2NPSD 1IFIA 5E79H 1SQXJ 2WQYC 4Z1MH 2ZVNB 3TF5A 2XKMA 3EWKA 2SPZA 2HFED 1SQXG 2WZ7A 1JY3P 3H1IG 4D6TG 1GL2A 4PD4D 1YIJP 1H0TB 1JM0A 3C9IA 3H1IJ 1U7MA 3AEEC 4N3YB 3GF3A 3M0DC 3CXHD 2E74D 2WPRA 3JCUH 2H7HA 1SQPJ 2NPSB 2OYOA 3IAOA 1BCCD 4U3FJ 5DJTB 2Y0CA 1SFCD 3A7OA 4WBAA 2KXPB 1FC2C 1RH5B 2H88C 3RK2C 3D71A 4JPZB 4U3FG 1NGMB 5CCHA 1ZRTD 4DZOA 2QA4P 3V4QA 3P8CE 2OYIC 1FZBA 1AJYA 3GLMA 3PP5A 2H89C 2O1KA 2OYIA 1BGYE 2N9YB 1JTHB 1W5CE 2E5TA 3CCMP 3D6YA 3A0BH 1SQBJ 3FX0A 5KLVE 1P84E 3H1KE 3RL0D 1UIIA 1PIXA 2ZYGA 3SWFA 2C9LY 2VRSA 3L70J 4UB8E 3VMZA 5KAFH 1P84I 1HBWA 3WUVA 4AYCA 1KB9D 1HGZA 3M9BA 2WT7B 1D7MA 2I1JA 1PGPA 1QGKB 2YIUC 1M57D 3F89A 3QH9A 3CL3D 1NU1E 2M8RA 2WSEJ 2Y0DA 1JUNA 4BXLA 1S9KD 1RE3C 1PZQA 3RL0g 5B5EE 1QEXA 1FZCB 2ZFCA 2QJKC 4YXDC 1Q86Q 1WMKA 1X0TA 3CX5E 2WSFH 3H1JD 4NPFX 1QL2A 5KAFE 2KOGA 3RBXA 2O3JA 3A3YB 4OGQB 4GOFA 3CCLP 4LC1A 3RL0C 3KDPB 1LWUB 2R32A 5KJ7C 1J1DC 1WT6A 1T3JA 1IK9A 3IFMA 2C0WA 2WTYA 4PV1B 4EOTA 1GW4A 2J5UA 2QJPC 3MP7B 1T2KC 3O6QB 1NTMG 3I56P 2Z5IA 1VF5B 1LP1B 1URQA 1BDDA 1YBKA 1YQ4C 4JYCA 1L0LD 1Q2NA 3CMEP 3OJAB 1NTMJ 1SQXE 3NTNA 5CHXA 1S72P 1VQ8P 1CI6A 2E74C 3L71E 1LT9C 3LW5H 1VQ5P 1HWTC 3PH0A 4UB6H 2O01H 3IR9A 2K1AA 1R8EA 3AE8C 3G3ZA 4YPCA 1LTJC 2NRGA 1AVOA 1FDMA 1P84H 3ABVC 3BRVB 3L73D 3P32A 3VN0A 4JBZA 1IK7A 1G2CB 1OVUA 2LXBA 3L70E 1PFIA 3H6PA 2R44A 1OX3A 1FOSE 4KJMA 1M90Q 1N7SA 3H1LJ 3BASA 3V2RA 4JYBA 4PJ0H 1ZLLA 5TISE 2FYZA 3H1HD 4DJGA 2E76C 1SQQJ 2IBZD 2E76B 2A06G 2K9JA 2QJPB 1VL2A 1IFDA 3BVHA 1IZNB 1VQOP 5APYA 4XA4A 1J1DB 1DEEG 2P7JA 2HPCA 4RKUJ 3RGUA 2Q5UA 4I1LA 3NMDA 1EQ7A 4H44D 2OYIB 3C1LA 4OGQC 4XFJA 2Q3IA 1R5LA 1MKMA 3CC7P 1EDJA 1MZ9A 2JJLA 1EDLA 1AVYA 3L74E 1QVFO 1YQ3C 1M1JB 3CCJP 1HJBA 2KS1B 1L4AB 1VPCA 1OFCX 4RO0A 3AE9C 4XE5B 4A7PA 1NTKE 2D2CC 4WY4D 2QIWA 2LR2A 4H0LC 1FJKA 1Q90D 3B71A 4TT3H 1DD4A 1NAFA 3EFGA 3H1JG 5APQA 2DW3A 2FYUE 3S1KA 4HYTB 2A45I 1NO4A 2KK7A 2QM7A 1FOSF 3L74J 2WSEH 2CPSA 1RE4C 3WU2E 1M56D 1NKNA 1T3UA 4EDFA 4H13C 5CCHC 5KAIH 1K04A 4H13B 4I7ZB 1EZVG 5CCGA 5AW8B 2GM4A 1KQSO 1E5WA 5GTHH 3KHUA 3AEBC 2XU6A 3HD7A 4LLHA 3RK2B 2QJKB 1PPJD 2A45H 2XZRA 4H44B 4DOJA 1SQXD 1EDKA 5H2FE 2HODB 1HF9A 1QLED 1LNQA 3B5ND 3P8CD 1CI6B 4NPDA 1ZRTE 3CX5H 1NVOA 3U1CA 1OVVA 2E76D 4BWNA 1EDIA 1ZXGA 1BCCG 2Q3EA 2KZJA 2BEZF 3TNUA 1DIPA 1N73A 3EFFK 5KLIB 1PP9J 1NTZD 1HGVA 3B5NB 3V2NA 3AE5C 3CWBD 5AVZB 5CBOA 1VQNP 1GD2E 1M7LA 2N1TD 1PP9G 3AE4C 3BCCG 2WPVB 1L0NK 2IZ1A 3CLQA 3H1KJ 3D70A 1SQBE 3HUSA 1JNMA 1OW8A 2YO2A 4W80A 1SVFA 1Y9BA 3CX5D 1KMIZ 3QWOC 3L71G 3OA7A 4ZKPA 1DX7A 1NU1D 2C0XA 4WY4B 1NU1K 1MV8A 2WT7A 1HH0A 3F5HA 4K35A 1KQGB 2P58A 3CXHI 2R5BA 4H0LD 3RL0B 1S1CX 2BCCG 1K73Q 5B66E 1FZCA 1SQQE 1PV3A 2M0BA 3BATA 3LIEA 3V2QA 3WUTA 2BCCJ 3Q5SA 1LTAC 2N1TA 5KTBA 1KC8Q 1DH3A 3EQ2A 3H1JE 3JSVC 1BGYD 1OZHA 1ZR2A 1H8AA 2YMKA 1M8OB 1RHZB 1SFCA 1SQQG 5AVUB 4WY4C 2ZAEB 1J1EB 2KSEA 3GHGA 3AECC 3V2PA 5H2FH 3V5BA 5KLVK 5KKZC 1G1IA 1HUCA 1S3JA 1NTMD 3FGAD 2FFDC 2OTJP 2JEEA 1VF5D 2QE7H 1X22A 3PJSK 4M3LA 1J1EC 1TU3F 1Q81Q 1VQ6P 2OYHC 2AXTH 3RBZA 1KILB 1L0LG 4D6TD 1RY3A 3G4SP 3R4YA 2IPPA 5AW5B 2NPSA 2IZ0A 3I55P 3Q2YA 1BE3E 1IFJA 2FFDA 1JO5A 3E1IA 3HTKB 4IOIH 3FWNA 4MN4C 3HE4B 1YITP 4ASVA 1JEKA 1AV1A 5DJUB 2ZVOB 4YTPC 5AVVB 4IFFA 3H1JJ 1FZAA 1L0ND 1OXZA 1PGJA 2Y9ZA 4U3FD 1IO4A 4IFMA 1G2CA 1NTKK 1SQVJ 2JP3A 3I5CA 5L8RJ 3ITKA 1H89A 2XV5A 1R5SA 1X9VA 3E7KA
chains in the Genus database with same CATH topology
5B66H 5E79H 5H2FH 5GTHH 3WU2H 5KAIH 5GTIH 2AXTH 3KZIH 3A0BH 5B5EH 4IL6H 1S5LH 3JCUH 3A0HH 5TISH 4UB8H 4PJ0H 4UB6H 5KAFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 H;  5E79 H;  5H2F H;  5GTH H;  3WU2 H;  5KAI H;  5GTI H;  2AXT H;  3KZI H;  3A0B H;  5B5E H;  4IL6 H;  1S5L H;  3JCU H;  3A0H H;  5TIS H;  4UB8 H;  4PJ0 H;  4UB6 H;  5KAF H; 
#chains in the Genus database with same CATH topology
 2NZ2 A;  5KAI E;  1SLQ A;  3WU2 H;  2A45 G;  2RN0 A;  3L37 A;  3H1H G;  1LTI C;  3L74 D;  2IYO A;  2KZI A;  1NAY A;  3GW6 A;  4GOD A;  4GT1 A;  3CC4 P;  2O1J A;  4DCK A;  2JR8 A;  4I7Z C;  3CI9 A;  5AW6 B;  3LID A;  4EIJ A;  4LGD E;  1X8Y A;  2FYN C;  3L72 G;  1GK4 A;  3VMX A;  1NU1 G;  1SQQ K;  2HLO A;  2KLV A;  2MKV A;  2OQQ A;  4ZKU A;  1RF0 C;  2FYU G;  1Y47 A;  4D6T J;  1BE3 G;  1LT1 A;  4GIF A;  2B88 A;  1FU1 A;  4RES B;  1KYO H;  2AEJ A;  1XTG B;  2Q1K A;  2YIU B;  1M1J C;  2RH0 A;  3CCE P;  3M9H A;  2ZXE B;  2J58 A;  1GW3 A;  3L73 E;  4AUW A;  1BGY G;  3LW5 J;  3M0A A;  2KNC A;  3BCC J;  3KYQ A;  1USD A;  4HB1 A;  3G6E P;  3R2P A;  2O01 J;  1SQQ D;  1SQV D;  1VQM P;  2V7Q H;  3H1I E;  1HJ0 A;  4HKZ H;  1YJN P;  1MFZ A;  3A0B E;  3HE5 A;  3PRJ A;  5AW0 B;  1KFN A;  3Q5R A;  2IYP A;  2K37 A;  3IF4 A;  1ZP0 C;  2KUB A;  4UB8 H;  1FAV A;  1L0N E;  2WSC J;  1LTS C;  1KYO D;  1EZV D;  2IFN A;  3GHG B;  1S4X A;  1PPJ G;  2M5A B;  1EZV I;  1GK6 A;  1FZF A;  1J2J B;  2AXC A;  1IFP A;  1JY2 P;  1L4A D;  2WIT A;  2V4H A;  1LTG C;  3RK3 C;  3M91 A;  1RF1 C;  3AEF C;  1EXI A;  2AEF A;  2W8Z A;  2ITA A;  2POH A;  3GMA A;  1BSN A;  2HYN A;  2GA1 A;  2R3C A;  4BRY B;  4ZNC A;  1FE6 A;  2FXO A;  3GF7 A;  1RF1 B;  2KNC B;  1VQK P;  4L74 A;  1GZL A;  1QX8 A;  3M06 A;  2FKW B;  1KV4 A;  1K8A Q;  1LWU A;  1S2E A;  1S9K E;  3AE3 C;  3AE2 C;  4U7J A;  1RF0 A;  1L2P A;  3HE4 A;  5CCG D;  3CC2 P;  2OGU A;  1NH4 A;  1S5L X;  3MGN A;  4OH8 B;  2YKP A;  5M1B A;  4C46 A;  5CMZ A;  2QEX P;  2P2U A;  3CWB G;  1LJ2 A;  2QJY B;  5KLI C;  1VDF A;  2BCC E;  2K88 A;  1M1J A;  1FDO A;  1XTC C;  3BCC D;  2MJZ A;  1EXJ A;  3M9Q A;  3H32 B;  2KLU A;  3Q3D A;  4PV1 C;  4BRY A;  3IN6 A;  1L0L K;  1P84 D;  2LKM A;  2ZXX A;  3H1K D;  3K5B A;  3TSI A;  2BCC D;  2B87 A;  2D2C D;  3BCC E;  3GG2 A;  5KLV D;  2RKL A;  4WWI A;  2D2C B;  1KN7 A;  2JKV A;  1FDI A;  3TGU D;  4H44 C;  2JWD A;  2FY8 A;  1ZOY C;  1IFN A;  2FYU D;  2R5D A;  4OWF A;  1ZW0 A;  2E75 D;  1KFM A;  5CJ0 A;  3RK3 E;  2K3R A;  2C9N Y;  4H13 D;  1GMJ A;  1EC5 A;  1SQP K;  1NTK D;  1NTZ E;  1OW7 A;  3CXH H;  5AVR B;  3ZDM A;  1T6A A;  1S5L E;  4I6M C;  2E5Y A;  1KZU B;  1JCD A;  4PV1 D;  1FJP A;  3CD6 P;  3CX5 I;  1AQ5 A;  2YO3 A;  5GTI H;  1JMB A;  2JDI H;  3OAK A;  3A0H H;  2W6B A;  3B4S A;  5C39 A;  3MHV A;  2Q9I A;  1BDC A;  3MD0 A;  3D6Z A;  3HTK A;  4DT0 A;  1EZV E;  3HD7 D;  1JCC A;  3KPE A;  2IDB A;  3V6I A;  5APT A;  3FWL A;  3U1A A;  1PPJ E;  1RQV A;  2QRX A;  3AE6 C;  3VP9 A;  1OVR A;  1GU5 A;  3H1I D;  3W68 A;  2M3B A;  4I2L C;  1N73 C;  2UWJ E;  3SFE C;  1KB9 H;  1LTB C;  1N73 B;  1A02 J;  1KTM A;  3TDK A;  1NTM K;  4AQR D;  3G71 P;  1NJI Q;  2M5A A;  2WSC H;  4N78 E;  3CCS P;  4QMA A;  3NXS A;  2G3A A;  3H1L E;  2AXT E;  4IL6 E;  1VQ7 P;  1N7L A;  3FXD A;  2KSJ A;  1LP1 A;  1URQ B;  3BRT B;  5AW4 B;  3VMY A;  3O6Q A;  1URQ D;  1PP9 D;  2PP6 A;  4WY4 A;  3V4W A;  3AE1 C;  1SFC C;  4KHX A;  3T97 B;  5GTI E;  3E1R A;  1N7S C;  2O01 N;  3KZI E;  3N4X A;  2E42 A;  1K05 A;  3L74 G;  3L35 A;  3L71 D;  1AFO A;  1E79 H;  2L5G B;  2WSS H;  5AVQ B;  1SQB G;  2QG4 A;  4L75 A;  1H88 A;  3CCV P;  4GOE A;  3S4R A;  1QVG O;  4L76 A;  5CCH D;  2N1T B;  2J59 M;  5AW9 B;  5BU5 A;  1Y8A A;  2A06 E;  1K9M Q;  1AA0 A;  5BU8 B;  3UIA A;  2Z4E A;  3L72 D;  5AVX B;  1BE3 D;  2HR3 A;  1NHL A;  3TGU J;  3P7K A;  1PL5 A;  2NPS C;  4Y28 J;  1NOH A;  2IFM A;  5AVS B;  4ASW A;  2WPS A;  2W27 A;  3TGU G;  3AEG C;  2P67 A;  3JC2 2;  4U3F E;  1AQT A;  1SQP E;  1SQP D;  1GL2 D;  2FBW C;  1ZR4 A;  1N7S D;  1SQV E;  3L73 J;  2H8P D;  2W83 C;  3M0D A;  1VF5 C;  2W6J H;  5BVZ A;  3A5T A;  2P10 A;  2E75 C;  3GHG C;  4GDO A;  2QM8 A;  4PJ0 E;  3TGU E;  3L75 D;  3VYI A;  1NWQ A;  3C8V A;  4HH2 A;  3RK2 D;  2YKO A;  2B9B A;  3VOP A;  1X79 B;  3H1L D;  2XND H;  4D6T E;  1ZV8 A;  4EYY Q;  1LWU C;  2KIK A;  3H25 A;  1RF1 A;  3TNU B;  2WMM A;  1NYH A;  4N78 D;  5EFW B;  5KJ7 D;  3L70 D;  4HJG H;  1NKZ B;  2KP8 A;  3HE5 B;  5APV A;  1W2B O;  3AE7 C;  2AEM A;  5APS A;  3Q1M A;  1H0T A;  1N2D C;  3L71 J;  3SWY A;  1RE4 A;  1YI2 P;  2W6A A;  2IX7 C;  3CPW O;  1MFT A;  3L4F A;  1FZC C;  1JY2 N;  5B66 H;  1GU4 A;  1PGQ A;  1KQL A;  1GL2 B;  4WB4 A;  3HD7 C;  1LTT C;  2YNY A;  2YXQ B;  1L0N G;  2Y0E A;  1JMM A;  1G1J A;  5AW3 B;  4YXW H;  3CCU P;  1A02 F;  1MUU A;  2R3S A;  1SP4 A;  1L4A A;  1L0N J;  5CJ4 A;  1OIP A;  3W67 A;  4C7N B;  1JTH A;  2OAR A;  3VP8 A;  1N8R Q;  1RQU A;  3USS A;  1S5L H;  1IC2 A;  3CXH E;  3H1H J;  3PLN A;  4UB6 E;  1NTZ K;  2FYU K;  2YKQ A;  2H43 A;  2ZT9 B;  1KYO I;  3SWK A;  4IFD K;  4TLF A;  1BSH A;  3MUD A;  4JQ0 D;  4C7R A;  3TK1 A;  1PGO A;  3RK3 D;  1FZG A;  1ZME C;  3A0H E;  1L0L E;  1SFC B;  3SSU A;  3OW2 O;  4RJT A;  4OVN F;  2BAS A;  3KXD A;  4PD4 I;  5E79 E;  2E43 A;  4WVZ A;  1SQB D;  2K9J B;  2HOD A;  2W90 A;  4W7Z A;  4Y99 C;  1OMI A;  4H0L B;  2RMZ A;  4K3A A;  2FYU J;  3H32 A;  1SQX K;  3PTZ A;  1BE3 J;  3O8Z A;  3CWB E;  1GL2 C;  5AW7 B;  5KLV G;  2FXP A;  2K9Y A;  2V7Q J;  2L91 A;  3CCR P;  3RK3 B;  1KB9 E;  2B87 B;  2YMY A;  2QVA A;  2ZYA A;  1NTK J;  3JCU E;  3NFQ A;  5AVT B;  5KLV J;  1CZQ A;  1BCC J;  1N86 A;  2OTL P;  2KI7 B;  1CSB A;  1NTM E;  1NTK G;  2N1T C;  2M3E A;  4ZMD A;  1SQP G;  1HVV A;  2HPC B;  2E74 B;  4IL6 H;  1QL1 A;  1JB0 J;  1JY2 O;  1SQV G;  2I8D A;  3KQG A;  4R4M A;  3VMA A;  4Y99 B;  4C7N A;  3L75 J;  2KYV A;  2Q7C A;  1YTZ T;  1FS0 E;  2Z5H A;  1KIL E;  2PAJ A;  3B5N A;  3KZI H;  3B8E B;  1YHQ P;  3L75 G;  2E75 B;  3WMM 0;  1UIX A;  3CCQ P;  1KB9 I;  1LGH B;  2CPB A;  4KT0 J;  2WWW A;  2OTK E;  2QJY C;  3A2A A;  5KKZ B;  1URQ C;  1SQB K;  1U57 A;  2ZT9 C;  4B86 A;  2N9B A;  1USE A;  4JF7 A;  1VQ9 P;  2JWA A;  3L70 G;  4L73 A;  5B5E H;  3B5N C;  3MZW B;  1WRG A;  1LTJ A;  4W7Y A;  5AVW B;  5TIS H;  3L75 E;  4PD4 E;  2GUS A;  1JY3 N;  3L72 J;  5KJ7 A;  2B89 A;  1NU1 J;  2CK3 H;  2P1J A;  4OGQ D;  2OYH A;  3L36 A;  2XDJ A;  3MIW A;  1IFM A;  2FYN B;  1OWA A;  1KYO E;  1SS1 A;  1JOC A;  2Q6Q A;  3L73 G;  1BCC E;  1LT9 B;  1OW6 A;  3HD7 B;  2G8Y A;  4R4L A;  5APU A;  1KD1 Q;  1KIL C;  1ZN5 A;  3N7N A;  1KOR A;  1RE3 A;  3AED C;  3WUU A;  5GTH E;  1NTZ J;  1VQ4 P;  1VQP P;  3CWB J;  1PP9 E;  3L72 E;  2QSI A;  2ZT9 D;  4O9B A;  1BGY J;  1NTZ G;  2FFD B;  2ZYD A;  1W2E A;  1YTZ I;  2IBZ G;  1KIL A;  2A06 D;  5AW1 B;  1IJD B;  2FXM A;  1YJW P;  5AW2 B;  5CCG C;  1L0L J;  2WSF J;  3H1K G;  5AVY B;  3T97 A;  3U59 A;  5K5G B;  4N6J A;  3MUD C;  2JO1 A;  1T8Z A;  3VTP C;  1M1K Q;  1DEB A;  1DD3 A;  2GUV A;  2KS1 A;  4IL6 X;  2BEQ D;  3H1H E;  1LTJ B;  2IBZ E;  1KIL D;  1LT9 A;  2I1K A;  2YXR B;  3HUS B;  4NPE A;  3Q5P A;  3II6 A;  2ZJS E;  2PGD A;  1L4A C;  1KQF B;  3P8M C;  1Q82 Q;  1FZE A;  2OYH B;  1FBM A;  1VQL P;  2LXC B;  3HUS C;  3HRN A;  3TYY A;  1T2K D;  1YYC A;  2IBZ I;  2PRR A;  5TJH A;  2PFX A;  5CBN A;  3FXE A;  5APX A;  2WVR A;  4PD4 H;  1SQV K;  1YJ9 P;  2KB7 P;  1GTW A;  3H1L G;  2Y9Y A;  3AEA C;  3G9R A;  2XNX A;  4CPG A;  3S9O A;  1JY3 O;  2WPQ A;  3PHL A;  1HTL C;  5APW A;  3CMA P;  2HG5 D;  3MTU E;  3SFD C;  1U7J A;  1Z56 A;  4GKG A;  1Q7Y Q;  1GDT A;  1CW5 A;  4EI2 A;  1N7S B;  2NPS D;  1IFI A;  5E79 H;  1SQX J;  2WQY C;  4Z1M H;  2ZVN B;  3TF5 A;  2XKM A;  3EWK A;  2SPZ A;  2HFE D;  1SQX G;  2WZ7 A;  1JY3 P;  3H1I G;  4D6T G;  1GL2 A;  4PD4 D;  1YIJ P;  1H0T B;  1JM0 A;  3C9I A;  3H1I J;  1U7M A;  3AEE C;  4N3Y B;  3GF3 A;  3M0D C;  3CXH D;  2E74 D;  2WPR A;  3JCU H;  2H7H A;  1SQP J;  2NPS B;  2OYO A;  3IAO A;  1BCC D;  4U3F J;  5DJT B;  2Y0C A;  1SFC D;  3A7O A;  4WBA A;  2KXP B;  1FC2 C;  1RH5 B;  2H88 C;  3RK2 C;  3D71 A;  4JPZ B;  4U3F G;  1NGM B;  5CCH A;  1ZRT D;  4DZO A;  2QA4 P;  3V4Q A;  3P8C E;  2OYI C;  1FZB A;  1AJY A;  3GLM A;  3PP5 A;  2H89 C;  2O1K A;  2OYI A;  1BGY E;  2N9Y B;  1JTH B;  1W5C E;  2E5T A;  3CCM P;  3D6Y A;  3A0B H;  1SQB J;  3FX0 A;  5KLV E;  1P84 E;  3H1K E;  3RL0 D;  1UII A;  1PIX A;  2ZYG A;  3SWF A;  2C9L Y;  2VRS A;  3L70 J;  4UB8 E;  3VMZ A;  5KAF H;  1P84 I;  1HBW A;  3WUV A;  4AYC A;  1KB9 D;  1HGZ A;  3M9B A;  2WT7 B;  1D7M A;  2I1J A;  1PGP A;  1QGK B;  2YIU C;  1M57 D;  3F89 A;  3QH9 A;  3CL3 D;  1NU1 E;  2M8R A;  2WSE J;  2Y0D A;  1JUN A;  4BXL A;  1S9K D;  1RE3 C;  1PZQ A;  3RL0 g;  5B5E E;  1QEX A;  1FZC B;  2ZFC A;  2QJK C;  4YXD C;  1Q86 Q;  1WMK A;  1X0T A;  3CX5 E;  2WSF H;  3H1J D;  4NPF X;  1QL2 A;  5KAF E;  2KOG A;  3RBX A;  2O3J A;  3A3Y B;  4OGQ B;  4GOF A;  3CCL P;  4LC1 A;  3RL0 C;  3KDP B;  1LWU B;  2R32 A;  5KJ7 C;  1J1D C;  1WT6 A;  1T3J A;  1IK9 A;  3IFM A;  2C0W A;  2WTY A;  4PV1 B;  4EOT A;  1GW4 A;  2J5U A;  2QJP C;  3MP7 B;  1T2K C;  3O6Q B;  1NTM G;  3I56 P;  2Z5I A;  1VF5 B;  1LP1 B;  1URQ A;  1BDD A;  1YBK A;  1YQ4 C;  4JYC A;  1L0L D;  1Q2N A;  3CME P;  3OJA B;  1NTM J;  1SQX E;  3NTN A;  5CHX A;  1S72 P;  1VQ8 P;  1CI6 A;  2E74 C;  3L71 E;  1LT9 C;  3LW5 H;  1VQ5 P;  1HWT C;  3PH0 A;  4UB6 H;  2O01 H;  3IR9 A;  2K1A A;  1R8E A;  3AE8 C;  3G3Z A;  4YPC A;  1LTJ C;  2NRG A;  1AVO A;  1FDM A;  1P84 H;  3ABV C;  3BRV B;  3L73 D;  3P32 A;  3VN0 A;  4JBZ A;  1IK7 A;  1G2C B;  1OVU A;  2LXB A;  3L70 E;  1PFI A;  3H6P A;  2R44 A;  1OX3 A;  1FOS E;  4KJM A;  1M90 Q;  1N7S A;  3H1L J;  3BAS A;  3V2R A;  4JYB A;  4PJ0 H;  1ZLL A;  5TIS E;  2FYZ A;  3H1H D;  4DJG A;  2E76 C;  1SQQ J;  2IBZ D;  2E76 B;  2A06 G;  2K9J A;  2QJP B;  1VL2 A;  1IFD A;  3BVH A;  1IZN B;  1VQO P;  5APY A;  4XA4 A;  1J1D B;  1DEE G;  2P7J A;  2HPC A;  4RKU J;  3RGU A;  2Q5U A;  4I1L A;  3NMD A;  1EQ7 A;  4H44 D;  2OYI B;  3C1L A;  4OGQ C;  4XFJ A;  2Q3I A;  1R5L A;  1MKM A;  3CC7 P;  1EDJ A;  1MZ9 A;  2JJL A;  1EDL A;  1AVY A;  3L74 E;  1QVF O;  1YQ3 C;  1M1J B;  3CCJ P;  1HJB A;  2KS1 B;  1L4A B;  1VPC A;  1OFC X;  4RO0 A;  3AE9 C;  4XE5 B;  4A7P A;  1NTK E;  2D2C C;  4WY4 D;  2QIW A;  2LR2 A;  4H0L C;  1FJK A;  1Q90 D;  3B71 A;  4TT3 H;  1DD4 A;  1NAF A;  3EFG A;  3H1J G;  5APQ A;  2DW3 A;  2FYU E;  3S1K A;  4HYT B;  2A45 I;  1NO4 A;  2KK7 A;  2QM7 A;  1FOS F;  3L74 J;  2WSE H;  2CPS A;  1RE4 C;  3WU2 E;  1M56 D;  1NKN A;  1T3U A;  4EDF A;  4H13 C;  5CCH C;  5KAI H;  1K04 A;  4H13 B;  4I7Z B;  1EZV G;  5CCG A;  5AW8 B;  2GM4 A;  1KQS O;  1E5W A;  5GTH H;  3KHU A;  3AEB C;  2XU6 A;  3HD7 A;  4LLH A;  3RK2 B;  2QJK B;  1PPJ D;  2A45 H;  2XZR A;  4H44 B;  4DOJ A;  1SQX D;  1EDK A;  5H2F E;  2HOD B;  1HF9 A;  1QLE D;  1LNQ A;  3B5N D;  3P8C D;  1CI6 B;  4NPD A;  1ZRT E;  3CX5 H;  1NVO A;  3U1C A;  1OVV A;  2E76 D;  4BWN A;  1EDI A;  1ZXG A;  1BCC G;  2Q3E A;  2KZJ A;  2BEZ F;  3TNU A;  1DIP A;  1N73 A;  3EFF K;  5KLI B;  1PP9 J;  1NTZ D;  1HGV A;  3B5N B;  3V2N A;  3AE5 C;  3CWB D;  5AVZ B;  5CBO A;  1VQN P;  1GD2 E;  1M7L A;  2N1T D;  1PP9 G;  3AE4 C;  3BCC G;  2WPV B;  1L0N K;  2IZ1 A;  3CLQ A;  3H1K J;  3D70 A;  1SQB E;  3HUS A;  1JNM A;  1OW8 A;  2YO2 A;  4W80 A;  1SVF A;  1Y9B A;  3CX5 D;  1KMI Z;  3QWO C;  3L71 G;  3OA7 A;  4ZKP A;  1DX7 A;  1NU1 D;  2C0X A;  4WY4 B;  1NU1 K;  1MV8 A;  2WT7 A;  1HH0 A;  3F5H A;  4K35 A;  1KQG B;  2P58 A;  3CXH I;  2R5B A;  4H0L D;  3RL0 B;  1S1C X;  2BCC G;  1K73 Q;  5B66 E;  1FZC A;  1SQQ E;  1PV3 A;  2M0B A;  3BAT A;  3LIE A;  3V2Q A;  3WUT A;  2BCC J;  3Q5S A;  1LTA C;  2N1T A;  5KTB A;  1KC8 Q;  1DH3 A;  3EQ2 A;  3H1J E;  3JSV C;  1BGY D;  1OZH A;  1ZR2 A;  1H8A A;  2YMK A;  1M8O B;  1RHZ B;  1SFC A;  1SQQ G;  5AVU B;  4WY4 C;  2ZAE B;  1J1E B;  2KSE A;  3GHG A;  3AEC C;  3V2P A;  5H2F H;  3V5B A;  5KLV K;  5KKZ C;  1G1I A;  1HUC A;  1S3J A;  1NTM D;  3FGA D;  2FFD C;  2OTJ P;  2JEE A;  1VF5 D;  2QE7 H;  1X22 A;  3PJS K;  4M3L A;  1J1E C;  1TU3 F;  1Q81 Q;  1VQ6 P;  2OYH C;  2AXT H;  3RBZ A;  1KIL B;  1L0L G;  4D6T D;  1RY3 A;  3G4S P;  3R4Y A;  2IPP A;  5AW5 B;  2NPS A;  2IZ0 A;  3I55 P;  3Q2Y A;  1BE3 E;  1IFJ A;  2FFD A;  1JO5 A;  3E1I A;  3HTK B;  4IOI H;  3FWN A;  4MN4 C;  3HE4 B;  1YIT P;  4ASV A;  1JEK A;  1AV1 A;  5DJU B;  2ZVO B;  4YTP C;  5AVV B;  4IFF A;  3H1J J;  1FZA A;  1L0N D;  1OXZ A;  1PGJ A;  2Y9Z A;  4U3F D;  1IO4 A;  4IFM A;  1G2C A;  1NTK K;  1SQV J;  2JP3 A;  3I5C A;  5L8R J;  3ITK A;  1H89 A;  2XV5 A;  1R5S A;  1X9V A;  3E7K A; 
#chains in the Genus database with same CATH homology
 5B66 H;  5E79 H;  5H2F H;  5GTH H;  3WU2 H;  5KAI H;  5GTI H;  2AXT H;  3KZI H;  3A0B H;  5B5E H;  4IL6 H;  1S5L H;  3JCU H;  3A0H H;  5TIS H;  4UB8 H;  4PJ0 H;  4UB6 H;  5KAF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...