3KZIH

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3kziH01
5E79H 5B66H 5B5EH 3JCUH 3A0BH 4PJ0H 1S5LH 3KZIH 4IL6H 3WU2H 4UB6H 5GTIH 5GTHH 4UB8H 5H2FH 5KAFH 5TISH 5KAIH 2AXTH 3A0HH
chains in the Genus database with same CATH superfamily
3MUDC 1FJKA 3BCCE 3TNUB 3H32B 1RF1B 1GU5A 2B87B 3HUSA 2K9YA 1J1EC 4MN4C 1M90Q 2NPSC 4HKZH 4JYCA 1FOSF 1DD4A 3WUTA 3L70J 2E74D 1RE4A 5B66H 1BGYJ 1L2PA 3CX5H 4I2LC 3CPWO 4HB1A 1EZVD 2BCCE 2FYNC 2O01N 2JR8A 1QLED 2ZXXA 2D2CB 1YTZT 2P2UA 3MUDA 1SQPG 3PH0A 3HD7B 3C8VA 3D6ZA 2CK3H 1FZCC 1N7SC 1DH3A 3MTUE 1SQVJ 2W90A 3M9HA 1H0TB 2NPSA 2OYIC 5GTIH 4IOIH 3CXHD 5KLIB 1VQ8P 1SQBK 2IPPA 3CWBE 3LW5J 2H43A 3R4YA 1OFCX 1NTKE 3H1HE 3O6QA 2KB7P 4W7YA 5AVXB 1NH4A 5KLVE 1PFIA 1KILE 5APWA 5AW7B 2Q3EA 4ZKUA 5AVRB 3MGNA 1SQXE 3KXDA 2N1TC 2CPSA 5CCGD 2AEFA 2JEEA 2Z4EA 2I1JA 4K3AA 1PIXA 2OYIA 3PHLA 2FFDA 1FAVA 3TDKA 1KQFB 2RKLA 1PPJE 2K9JB 3C9IA 4U7JA 1E5WA 4I6MC 2CPBA 5GTHE 2YKQA 1LT9C 1PGQA 5KKZC 1L0LJ 3PLNA 2KZIA 3CCUP 3RGUA 4EDFA 3KHUA 3CWBG 1GU4A 4PD4D 1YYCA 1D7MA 4ZMDA 3U59A 3H1HG 4OVNF 2QJKB 1FOSE 3GW6A 2M3BA 2N1TA 5KJ7C 5KLVG 4TLFA 2QE7H 1JMMA 3H1KD 2IZ1A 2ZFCA 1RF1C 2IBZI 4LGDE 1SQXG 3IFMA 2OYOA 3E7KA 3WUUA 3CL3D 2QEXP 2ZVNB 1LT9A 1FJPA 1X8YA 1PPJG 1LTAC 3VN0A 2QJYC 1KD1Q 1QEXA 3MZWB 1CSBA 2WSSH 4NPFX 3USSA 1X0TA 3BCCD 5CJ0A 3B5ND 2D2CC 4N3YB 5KJ7A 3LIEA 3U1AA 3HD7C 1S3JA 3TNUA 3H32A 1FZGA 1TU3F 1Q7YQ 1RF1A 3Q5RA 1FZEA 2B87A 5APYA 3RK2B 1YQ4C 2XZRA 1LTBC 1EZVI 3H6PA 5K5GB 2O1JA 1LTSC 2YXRB 3AECC 2BCCD 4IFMA 5H2FE 1Y8AA 1JY3P 2WZ7A 1HUCA 3TGUJ 3B71A 4C7RA 2AEMA 1URQD 3HD7A 3CXHI 4U3FE 2XV5A 3AEEC 2E75B 5AVTB 1HJ0A 5APXA 3CCQP 1H0TA 2JJLA 2H8PD 2Q3IA 1QVFO 2C9LY 1NTKD 4ZNCA 2IFNA 1LP1B 3KDPB 3D70A 1JMBA 1GTWA 5KLVD 2KSJA 2E43A 1NTZK 2E74C 2K1AA 5KAIE 1LNQA 5E79E 3WMM0 2ZYDA 1KYOE 5CJ4A 1U57A 2R3CA 4GDOA 1LTTC 1JY2O 3JSVC 4PV1B 2QSIA 1BCCE 4U3FG 1KV4A 2K9JA 1RH5B 4PD4I 2NPSD 3V4QA 3JCUE 4OGQD 1GK4A 3HE4A 1HGZA 3GG2A 3Q1MA 3H1ID 1AVYA 1YQ3C 2E5TA 2M8RA 2KZJA 1OW8A 2ZT9D 5GTHH 1JNMA 2FXPA 3OW2O 3P8MC 4DZOA 2E76B 1U7MA 3L72E 3D71A 4N78E 1GDTA 2FYZA 3KPEA 2WPQA 4GOEA 1PP9D 5CCGC 3UIAA 2Z5IA 1BCCG 1R5LA 2WSEJ 2FYUG 3CX5E 1JEKA 3CD6P 1DX7A 4U3FJ 1KILB 1X9VA 5AVYB 1EC5A 1ZRTE 3RL0g 2XNXA 3Q5PA 1PGOA 1JTHB 2P67A 4H13D 3NFQA 2E75C 3GF7A 2Y0EA 3L72G 3V4WA 5CCGA 3II6A 1K73Q 2O3JA 4NPEA 3RBZA 3H1LG 3SSUA 2GUVA 1MKMA 4RESB 5KTBA 2FKWB 2LXBA 2VRSA 2OQQA 3T97B 2IX7C 3FWLA 5H2FH 1J1DB 3L70E 4EI2A 1S5LX 2POHA 2GM4A 1GL2B 1AQ5A 2FYUJ 5KJ7D 1L0NE 2HODB 5CHXA 1BDDA 4ZKPA 3K5BA 5AW5B 2HFED 3F89A 5BU8B 2OYHB 1NU1G 4QMAA 1AVOA 3HE5B 2LR2A 1LP1A 1USDA 1SQVE 2QRXA 3L72J 3VYIA 1NTMD 4H44B 1JM0A 3P32A 2HYNA 1NTZJ 4RKUJ 3BRTB 1W2BO 1IO4A 2D2CD 4DOJA 1QL1A 3H1LJ 5KAIH 2XKMA 2RN0A 3HD7D 4HH2A 1BCCD 1URQC 1OWAA 1M1JB 5E79H 3E1IA 3L70G 1QVGO 1NKNA 4JQ0D 1SLQA 1EDLA 3MP7B 4R4LA 1KYOH 1RY3A 1N2DC 1VQOP 1Q81Q 2IFMA 1YIJP 1L0NG 4D6TD 3ABVC 2ITAA 5M1BA 2R5BA 2IYPA 3I56P 1A02F 3GHGB 3VMZA 1E79H 4DJGA 2WVRA 3JCUH 1KFNA 1SFCB 4DT0A 1SQVG 1KILC 1NU1J 3G71P 4OWFA 1USEA 3AEDC 2QM8A 1URQA 3R2PA 2KLVA 1L0LE 3A5TA 1M7LA 3L71D 2QJPB 1T2KC 1GW3A 3CLQA 4IFFA 1YTZI 2WSCJ 1QX8A 1Q2NA 3CX5D 1IJDB 3A7OA 1RE3C 2L5GB 1KC8Q 1ZN5A 1ZRTD 4OGQC 1ZOYC 2G3AA 1KILA 1LTIC 1L0NJ 1NTKK 2WPRA 1EQ7A 2PP6A 2ZT9C 1JY3N 1J1DC 1AJYA 3PTZA 5KLVK 1JTHA 2NRGA 1JO5A 1SQQD 1GL2C 3SFEC 2W83C 2B9BA 3Q2YA 1L0LG 2M0BA 3AE8C 2Q9IA 4JF7A 3FX0A 1VQ4P 3L74E 3CCRP 2OYHC 1RE3A 2K37A 2FFDC 1WT6A 4A7PA 2N9BA 1L4AB 2AXTE 1BE3G 3T97A 4H44C 1NO4A 4L75A 3S4RA 1BGYD 2WSCH 2A45I 2ZXEB 1KB9E 1FS0E 3CCJP 1GL2A 1U7JA 4UB6E 2HODA 2I8DA 4NPDA 3RBXA 3CCSP 1MZ9A 3M9BA 1M1JC 3TGUE 3RK3E 1S4XA 3RK2D 3ZDMA 4H13C 1GK6A 1IFPA 2OYHA 1YBKA 2KI7B 1MV8A 3HE5A 1T6AA 3IR9A 1HJBA 3G9RA 1HGVA 4C7NB 3L74G 2KS1B 3AE5C 4WBAA 3B4SA 2YMKA 1EXJA 5AVUB 1SFCC 1OW6A 5B5EE 3G4SP 3W67A 3AE9C 1JCDA 1M1JA 3IF4A 2JP3A 4GT1A 2FXOA 2E75D 2QJPC 1BE3J 2QIWA 5L8RJ 1VQPP 3LW5H 3L73J 2KK7A 1OW7A 1M56D 3TGUG 2W6JH 3GHGA 2W27A 4PJ0E 2HLOA 3FWNA 1SVFA 1KTMA 1SQPD 1SFCA 2YO2A 4Y28J 1N8RQ 4Z1MH 3N4XA 1L0LD 1OMIA 1FDIA 3CX5I 3M06A 3CI9A 3L74J 1HH0A 3MD0A 4PV1D 4HJGH 1VQ6P 2YMYA 1VPCA 3A0HE 2FBWC 2XDJA 5APTA 2A06E 1K05A 1S5LE 2XU6A 4L76A 1GMJA 1XTCC 1A02J 1L4AC 5KLIC 2K88A 1ZMEC 1PV3A 1VL2A 3V5BA 3NTNA 4WY4B 1WRGA 2E76D 1NTMK 1FZAA 2E5YA 3NXSA 3D6YA 4C46A 1HF9A 4M3LA 5AVQB 5APQA 1XTGB 4UB8H 4AYCA 1FC2C 5BVZA 2HPCB 1KQSO 1JB0J 2WPSA 1OZHA 3CWBD 4H0LB 3V6IA 1KFMA 2W8ZA 1L4AA 4LC1A 3H1HD 2A06G 1KILD 1CZQA 1HTLC 2AXTH 1SQBJ 3M9QA 1UIIA 4AQRD 3PP5A 1SQXD 3TGUD 1KB9H 2O1KA 2QJKC 3RL0B 1T2KD 2LXCB 3P8CE 2R32A 4UB6H 3CCEP 1ZR2A 1IFNA 4ASWA 1PPJD 2FYUE 4IL6X 4C7NA 2R3SA 4GODA 1T3JA 2KS1A 4XE5B 2MKVA 2JWAA 4O9BA 1MFZA 1PP9J 1JOCA 4JYBA 1RHZB 2KOGA 3S1KA 5KAFE 1K04A 4XFJA 4JPZB 2OTLP 1GL2D 4L73A 3SWFA 2M5AB 1T3UA 5B5EH 3FXDA 2XNDH 1HWTC 1FZFA 3FGAD 3M0AA 1NTZE 1W2EA 1SQQK 3G3ZA 1M8OB 1LT1A 3H1LE 3RK2C 3AEAC 4KJMA 3H1JJ 2WSFJ 1CI6B 1AV1A 4I7ZB 4PJ0H 2R5DA 4H44D 1RQUA 3L35A 2C0XA 2W6AA 1EDKA 2V4HA 4YPCA 3E1RA 1BSNA 3I55P 3U1CA 4WY4C 5AVVB 5APUA 5AVSB 3RK3B 3BASA 2V7QJ 1P84H 3AEGC 4Y99B 3PRJA 1NU1E 2K3RA 3JC22 3EFGA 1NTZG 2FXMA 3L75J 3A0HH 2PFXA 1UIXA 1PGPA 4H0LC 3V2QA 1Y9BA 3Q5SA 1EZVE 3A0BH 1S5LH 3EQ2A 2IBZG 3KZIH 1SFCD 4B86A 4WY4A 3GF3A 4U3FD 1S1CX 2H89C 2P1JA 2LKMA 5AW1B 3AE3C 2WSFH 2WSEH 1QL2A 3RL0C 1W5CE 1NTMJ 5BU5A 1RQVA 2O01J 1KZUB 2YKPA 5CMZA 1KMIZ 4PV1C 2PGDA 1FDOA 3O6QB 2BEZF 3AE4C 2V7QH 1FZCB 1N7SB 1KQLA 1NAFA 1IFJA 3B8EB 2KSEA 4IFDK 1H8AA 1N73B 1EZVG 4YXDC 2KNCB 3AE1C 1KYOD 3GMAA 3L36A 1SQPK 1GZLA 1KORA 4CPGA 1NYHA 1FZBA 1L0LK 2E76C 3G6EP 3BVHA 2FYUD 2J58A 1JY3O 2J5UA 1VQLP 2YO3A 5AW9B 2W6BA 1K9MQ 1VF5B 1VQ5P 2OTJP 2YIUB 1IZNB 4ASVA 2L91A 1AQTA 1YJ9P 3LIDA 1L4AD 2ZAEB 3HRNA 2KYVA 1X22A 1NAYA 1LJ2A 4PD4E 2P10A 3F5HA 3L72D 4LLHA 1FU1A 2M5AA 4N78D 3H1KE 1YJWP 5AVWB 5TISE 5KAFH 3RK3C 3H1LD 1LT9B 1LWUB 2H88C 5KKZB 4Y99C 4BWNA 1ZLLA 2P58A 5AVZB 1VQKP 1SQQJ 1CI6A 2WMMA 2HG5D 1BE3E 1OIPA 4W80A 3GLMA 2B88A 2E42A 3L73E 1ZW0A 3TK1A 3MIWA 1OVVA 1Q82Q 3CC4P 2GA1A 1NU1D 4UB8E 1J2JB 3QH9A 1OVRA 3H1KG 2QJYB 1SQXK 3TSIA 1JY2P 3A2AA 2Q7CA 4WVZA 2IDBA 3P7KA 2GUSA 2YKOA 3CMAP 2OGUA 2H7HA 3L70D 4I1LA 1X79B 3AE7C 4K35A 1N73C 3L73G 3BCCG 1L0ND 3AEBC 2M3EA 4IL6E 3VOPA 4KT0J 3SFDC 5TJHA 2RMZA 4TT3H 3S9OA 1JUNA 3CCLP 2JDIH 1KYOI 1Z56A 2JO1A 3VMAA 1VF5C 2UWJE 4BRYB 1SQVD 2YIUC 4EIJA 3CXHH 3GHGC 1FZCA 2BCCG 1N7SA 1N86A 3H1KJ 1PL5A 1N73A 2KNCA 4WY4D 1HBWA 3VMXA 3CC7P 1NOHA 3Q3DA 1SQPJ 2C0WA 2MJZA 5DJUB 1LTGC 1R5SA 5C39A 1LWUC 2G8YA 1N7LA 4GKGA 1SQBE 2AXCA 3HE4B 2E74B 2BASA 1H88A 1IFMA 1SS1A 3BCCJ 4H0LD 1Q86Q 3H1IE 1NTKG 3CCMP 3WU2E 4R4MA 1VDFA 2WWWA 1OVUA 2ZVOB 1LTJB 1EXIA 4YTPC 2Y9ZA 2KP8A 4PD4H 2P7JA 1P84E 3SWYA 1PP9E 3RL0D 1LWUA 3OA7A 2BCCJ 3VP8A 3VP9A 1S72P 2QVAA 2Y0DA 5TISH 1FBMA 1BE3D 1SQBG 1DD3A 1IFIA 1PGJA 3L73D 1EDIA 3A0BE 3L4FA 1G1JA 1Y47A 3BRVB 3KZIE 4N6JA 3H1IG 2ZYGA 3ITKA 3AE2C 3SWKA 3H1JE 1YJNP 3KYQA 3CWBJ 5DJTB 4JBZA 4WB4A 3TYYA 1NTKJ 3H1HJ 1YHQP 3AEFC 2Q1KA 5KLVJ 1H89A 5CCHC 2FY8A 3L74D 3VMYA 2DW3A 1PP9G 1FE6A 3V2RA 2KIKA 2SPZA 1MFTA 2JKVA 3NMDA 1SQXJ 2IYOA 2FYUK 2IZ0A 2KLUA 3OJAB 1M1KQ 1IK9A 3A3YB 4W7ZA 2WT7B 1KB9D 3O8ZA 3QWOC 3L75E 3EFFK 4GOFA 3HTKB 2QA4P 3RK3D 3H1JG 5CCHA 4WWIA 2ZYAA 1K8AQ 5APSA 4OH8B 3H1IJ 4IL6H 2QM7A 4EYYQ 1IK7A 2WQYC 4BRYA 1ZP0C 1NTME 3L37A 2I1KA 4AUWA 3MHVA 1S9KE 3B5NB 4RO0A 1YI2P 4GIFA 3M91A 1G2CB 3IN6A 1LTJC 1DIPA 1LGHB 1DEEG 3CC2P 1R8EA 1S2EA 1SQBD 3L75G 2WITA 4D6TE 2HR3A 3CMEP 1WMKA 2A45G 1KQGB 1NU1K 3M0DC 5AW4B 2N9YB 3VTPC 2WTYA 2KUBA 1T8ZA 3C1LA 2KXPB 2Y9YA 2PRRA 1VQNP 1URQB 2IBZE 2QG4A 1NJIQ 1N7SD 2J59M 1LTJA 5AW2B 1NTMG 1RF0C 1NGMB 1PZQA 1P84D 3WU2H 5APVA 3L71E 4L74A 3FXEA 1QGKB 3HUSB 5B66E 5AW3B 1CW5A 3M0DA 1L0NK 3CCVP 2AEJA 1JCCA 2A06D 4D6TG 1VF5D 2PAJA 3V2PA 4EOTA 1JY2N 3EWKA 2YNYA 1RF0A 1NKZB 3H1JD 3KQGA 2N1TD 1SQVK 1EDJA 2B89A 1SQQE 2BEQD 1OXZA 5GTIE 3WUVA 4BXLA 1J1EB 3L71G 2NPSB 2Q5UA 3BATA 1KB9I 4HYTB 1YITP 2Q6QA 2YXQB 1G1IA 4OGQB 1AA0A 2R44A 2HPCA 1DEBA 4YXWH 1M57D 2ZT9B 3CXHE 2FYNB 1ZR4A 1BCCJ 2NZ2A 1BGYE 2WT7A 1VQ9P 3L75D 3B5NC 1OX3A 1BSHA 4D6TJ 5AW8B 3HTKA 3OAKA 2Y0CA 3P8CD 1SQQG 3N7NA 2OYIB 2C9NY 2FFDB 3W68A 1BDCA 5CBNA 3IAOA 3TF5A 3PJSK 3V2NA 2A45H 1ZV8A 1S9KD 5CBOA 3I5CA 1SP4A 1KN7A 3B5NA 1GD2E 5AW0B 3L71J 4KHXA 1G2CA 3H25A 4I7ZC 1MUUA 1BGYG 2N1TB 2O01H 4H13B 2WPVB 1VQ7P 1Q90D 5EFWB 1NTZD 1NWQA 2RH0A 2Z5HA 3HUSC 5AW6B 2OTKE 5CCHD 4RJTA 2JWDA 4XA4A 1P84I 1NHLA 1ZXGA 1IFDA 3AE6C 1RE4C 2IBZD 1GW4A 4DCKA 1NVOA 1SQPE 1IC2A 2ZJSE 1HVVA 1AFOA 1VQMP 2OARA 1FDMA
chains in the Genus database with same CATH topology
5E79H 5B66H 5B5EH 3JCUH 3A0BH 4PJ0H 1S5LH 3KZIH 4IL6H 3WU2H 4UB6H 5GTIH 5GTHH 4UB8H 5H2FH 5KAFH 5TISH 5KAIH 2AXTH 3A0HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 H;  5B66 H;  5B5E H;  3JCU H;  3A0B H;  4PJ0 H;  1S5L H;  3KZI H;  4IL6 H;  3WU2 H;  4UB6 H;  5GTI H;  5GTH H;  4UB8 H;  5H2F H;  5KAF H;  5TIS H;  5KAI H;  2AXT H;  3A0H H; 
#chains in the Genus database with same CATH topology
 3MUD C;  1FJK A;  3BCC E;  3TNU B;  3H32 B;  1RF1 B;  1GU5 A;  2B87 B;  3HUS A;  2K9Y A;  1J1E C;  4MN4 C;  1M90 Q;  2NPS C;  4HKZ H;  4JYC A;  1FOS F;  1DD4 A;  3WUT A;  3L70 J;  2E74 D;  1RE4 A;  5B66 H;  1BGY J;  1L2P A;  3CX5 H;  4I2L C;  3CPW O;  4HB1 A;  1EZV D;  2BCC E;  2FYN C;  2O01 N;  2JR8 A;  1QLE D;  2ZXX A;  2D2C B;  1YTZ T;  2P2U A;  3MUD A;  1SQP G;  3PH0 A;  3HD7 B;  3C8V A;  3D6Z A;  2CK3 H;  1FZC C;  1N7S C;  1DH3 A;  3MTU E;  1SQV J;  2W90 A;  3M9H A;  1H0T B;  2NPS A;  2OYI C;  5GTI H;  4IOI H;  3CXH D;  5KLI B;  1VQ8 P;  1SQB K;  2IPP A;  3CWB E;  3LW5 J;  2H43 A;  3R4Y A;  1OFC X;  1NTK E;  3H1H E;  3O6Q A;  2KB7 P;  4W7Y A;  5AVX B;  1NH4 A;  5KLV E;  1PFI A;  1KIL E;  5APW A;  5AW7 B;  2Q3E A;  4ZKU A;  5AVR B;  3MGN A;  1SQX E;  3KXD A;  2N1T C;  2CPS A;  5CCG D;  2AEF A;  2JEE A;  2Z4E A;  2I1J A;  4K3A A;  1PIX A;  2OYI A;  3PHL A;  2FFD A;  1FAV A;  3TDK A;  1KQF B;  2RKL A;  1PPJ E;  2K9J B;  3C9I A;  4U7J A;  1E5W A;  4I6M C;  2CPB A;  5GTH E;  2YKQ A;  1LT9 C;  1PGQ A;  5KKZ C;  1L0L J;  3PLN A;  2KZI A;  3CCU P;  3RGU A;  4EDF A;  3KHU A;  3CWB G;  1GU4 A;  4PD4 D;  1YYC A;  1D7M A;  4ZMD A;  3U59 A;  3H1H G;  4OVN F;  2QJK B;  1FOS E;  3GW6 A;  2M3B A;  2N1T A;  5KJ7 C;  5KLV G;  4TLF A;  2QE7 H;  1JMM A;  3H1K D;  2IZ1 A;  2ZFC A;  1RF1 C;  2IBZ I;  4LGD E;  1SQX G;  3IFM A;  2OYO A;  3E7K A;  3WUU A;  3CL3 D;  2QEX P;  2ZVN B;  1LT9 A;  1FJP A;  1X8Y A;  1PPJ G;  1LTA C;  3VN0 A;  2QJY C;  1KD1 Q;  1QEX A;  3MZW B;  1CSB A;  2WSS H;  4NPF X;  3USS A;  1X0T A;  3BCC D;  5CJ0 A;  3B5N D;  2D2C C;  4N3Y B;  5KJ7 A;  3LIE A;  3U1A A;  3HD7 C;  1S3J A;  3TNU A;  3H32 A;  1FZG A;  1TU3 F;  1Q7Y Q;  1RF1 A;  3Q5R A;  1FZE A;  2B87 A;  5APY A;  3RK2 B;  1YQ4 C;  2XZR A;  1LTB C;  1EZV I;  3H6P A;  5K5G B;  2O1J A;  1LTS C;  2YXR B;  3AEC C;  2BCC D;  4IFM A;  5H2F E;  1Y8A A;  1JY3 P;  2WZ7 A;  1HUC A;  3TGU J;  3B71 A;  4C7R A;  2AEM A;  1URQ D;  3HD7 A;  3CXH I;  4U3F E;  2XV5 A;  3AEE C;  2E75 B;  5AVT B;  1HJ0 A;  5APX A;  3CCQ P;  1H0T A;  2JJL A;  2H8P D;  2Q3I A;  1QVF O;  2C9L Y;  1NTK D;  4ZNC A;  2IFN A;  1LP1 B;  3KDP B;  3D70 A;  1JMB A;  1GTW A;  5KLV D;  2KSJ A;  2E43 A;  1NTZ K;  2E74 C;  2K1A A;  5KAI E;  1LNQ A;  5E79 E;  3WMM 0;  2ZYD A;  1KYO E;  5CJ4 A;  1U57 A;  2R3C A;  4GDO A;  1LTT C;  1JY2 O;  3JSV C;  4PV1 B;  2QSI A;  1BCC E;  4U3F G;  1KV4 A;  2K9J A;  1RH5 B;  4PD4 I;  2NPS D;  3V4Q A;  3JCU E;  4OGQ D;  1GK4 A;  3HE4 A;  1HGZ A;  3GG2 A;  3Q1M A;  3H1I D;  1AVY A;  1YQ3 C;  2E5T A;  2M8R A;  2KZJ A;  1OW8 A;  2ZT9 D;  5GTH H;  1JNM A;  2FXP A;  3OW2 O;  3P8M C;  4DZO A;  2E76 B;  1U7M A;  3L72 E;  3D71 A;  4N78 E;  1GDT A;  2FYZ A;  3KPE A;  2WPQ A;  4GOE A;  1PP9 D;  5CCG C;  3UIA A;  2Z5I A;  1BCC G;  1R5L A;  2WSE J;  2FYU G;  3CX5 E;  1JEK A;  3CD6 P;  1DX7 A;  4U3F J;  1KIL B;  1X9V A;  5AVY B;  1EC5 A;  1ZRT E;  3RL0 g;  2XNX A;  3Q5P A;  1PGO A;  1JTH B;  2P67 A;  4H13 D;  3NFQ A;  2E75 C;  3GF7 A;  2Y0E A;  3L72 G;  3V4W A;  5CCG A;  3II6 A;  1K73 Q;  2O3J A;  4NPE A;  3RBZ A;  3H1L G;  3SSU A;  2GUV A;  1MKM A;  4RES B;  5KTB A;  2FKW B;  2LXB A;  2VRS A;  2OQQ A;  3T97 B;  2IX7 C;  3FWL A;  5H2F H;  1J1D B;  3L70 E;  4EI2 A;  1S5L X;  2POH A;  2GM4 A;  1GL2 B;  1AQ5 A;  2FYU J;  5KJ7 D;  1L0N E;  2HOD B;  5CHX A;  1BDD A;  4ZKP A;  3K5B A;  5AW5 B;  2HFE D;  3F89 A;  5BU8 B;  2OYH B;  1NU1 G;  4QMA A;  1AVO A;  3HE5 B;  2LR2 A;  1LP1 A;  1USD A;  1SQV E;  2QRX A;  3L72 J;  3VYI A;  1NTM D;  4H44 B;  1JM0 A;  3P32 A;  2HYN A;  1NTZ J;  4RKU J;  3BRT B;  1W2B O;  1IO4 A;  2D2C D;  4DOJ A;  1QL1 A;  3H1L J;  5KAI H;  2XKM A;  2RN0 A;  3HD7 D;  4HH2 A;  1BCC D;  1URQ C;  1OWA A;  1M1J B;  5E79 H;  3E1I A;  3L70 G;  1QVG O;  1NKN A;  4JQ0 D;  1SLQ A;  1EDL A;  3MP7 B;  4R4L A;  1KYO H;  1RY3 A;  1N2D C;  1VQO P;  1Q81 Q;  2IFM A;  1YIJ P;  1L0N G;  4D6T D;  3ABV C;  2ITA A;  5M1B A;  2R5B A;  2IYP A;  3I56 P;  1A02 F;  3GHG B;  3VMZ A;  1E79 H;  4DJG A;  2WVR A;  3JCU H;  1KFN A;  1SFC B;  4DT0 A;  1SQV G;  1KIL C;  1NU1 J;  3G71 P;  4OWF A;  1USE A;  3AED C;  2QM8 A;  1URQ A;  3R2P A;  2KLV A;  1L0L E;  3A5T A;  1M7L A;  3L71 D;  2QJP B;  1T2K C;  1GW3 A;  3CLQ A;  4IFF A;  1YTZ I;  2WSC J;  1QX8 A;  1Q2N A;  3CX5 D;  1IJD B;  3A7O A;  1RE3 C;  2L5G B;  1KC8 Q;  1ZN5 A;  1ZRT D;  4OGQ C;  1ZOY C;  2G3A A;  1KIL A;  1LTI C;  1L0N J;  1NTK K;  2WPR A;  1EQ7 A;  2PP6 A;  2ZT9 C;  1JY3 N;  1J1D C;  1AJY A;  3PTZ A;  5KLV K;  1JTH A;  2NRG A;  1JO5 A;  1SQQ D;  1GL2 C;  3SFE C;  2W83 C;  2B9B A;  3Q2Y A;  1L0L G;  2M0B A;  3AE8 C;  2Q9I A;  4JF7 A;  3FX0 A;  1VQ4 P;  3L74 E;  3CCR P;  2OYH C;  1RE3 A;  2K37 A;  2FFD C;  1WT6 A;  4A7P A;  2N9B A;  1L4A B;  2AXT E;  1BE3 G;  3T97 A;  4H44 C;  1NO4 A;  4L75 A;  3S4R A;  1BGY D;  2WSC H;  2A45 I;  2ZXE B;  1KB9 E;  1FS0 E;  3CCJ P;  1GL2 A;  1U7J A;  4UB6 E;  2HOD A;  2I8D A;  4NPD A;  3RBX A;  3CCS P;  1MZ9 A;  3M9B A;  1M1J C;  3TGU E;  3RK3 E;  1S4X A;  3RK2 D;  3ZDM A;  4H13 C;  1GK6 A;  1IFP A;  2OYH A;  1YBK A;  2KI7 B;  1MV8 A;  3HE5 A;  1T6A A;  3IR9 A;  1HJB A;  3G9R A;  1HGV A;  4C7N B;  3L74 G;  2KS1 B;  3AE5 C;  4WBA A;  3B4S A;  2YMK A;  1EXJ A;  5AVU B;  1SFC C;  1OW6 A;  5B5E E;  3G4S P;  3W67 A;  3AE9 C;  1JCD A;  1M1J A;  3IF4 A;  2JP3 A;  4GT1 A;  2FXO A;  2E75 D;  2QJP C;  1BE3 J;  2QIW A;  5L8R J;  1VQP P;  3LW5 H;  3L73 J;  2KK7 A;  1OW7 A;  1M56 D;  3TGU G;  2W6J H;  3GHG A;  2W27 A;  4PJ0 E;  2HLO A;  3FWN A;  1SVF A;  1KTM A;  1SQP D;  1SFC A;  2YO2 A;  4Y28 J;  1N8R Q;  4Z1M H;  3N4X A;  1L0L D;  1OMI A;  1FDI A;  3CX5 I;  3M06 A;  3CI9 A;  3L74 J;  1HH0 A;  3MD0 A;  4PV1 D;  4HJG H;  1VQ6 P;  2YMY A;  1VPC A;  3A0H E;  2FBW C;  2XDJ A;  5APT A;  2A06 E;  1K05 A;  1S5L E;  2XU6 A;  4L76 A;  1GMJ A;  1XTC C;  1A02 J;  1L4A C;  5KLI C;  2K88 A;  1ZME C;  1PV3 A;  1VL2 A;  3V5B A;  3NTN A;  4WY4 B;  1WRG A;  2E76 D;  1NTM K;  1FZA A;  2E5Y A;  3NXS A;  3D6Y A;  4C46 A;  1HF9 A;  4M3L A;  5AVQ B;  5APQ A;  1XTG B;  4UB8 H;  4AYC A;  1FC2 C;  5BVZ A;  2HPC B;  1KQS O;  1JB0 J;  2WPS A;  1OZH A;  3CWB D;  4H0L B;  3V6I A;  1KFM A;  2W8Z A;  1L4A A;  4LC1 A;  3H1H D;  2A06 G;  1KIL D;  1CZQ A;  1HTL C;  2AXT H;  1SQB J;  3M9Q A;  1UII A;  4AQR D;  3PP5 A;  1SQX D;  3TGU D;  1KB9 H;  2O1K A;  2QJK C;  3RL0 B;  1T2K D;  2LXC B;  3P8C E;  2R32 A;  4UB6 H;  3CCE P;  1ZR2 A;  1IFN A;  4ASW A;  1PPJ D;  2FYU E;  4IL6 X;  4C7N A;  2R3S A;  4GOD A;  1T3J A;  2KS1 A;  4XE5 B;  2MKV A;  2JWA A;  4O9B A;  1MFZ A;  1PP9 J;  1JOC A;  4JYB A;  1RHZ B;  2KOG A;  3S1K A;  5KAF E;  1K04 A;  4XFJ A;  4JPZ B;  2OTL P;  1GL2 D;  4L73 A;  3SWF A;  2M5A B;  1T3U A;  5B5E H;  3FXD A;  2XND H;  1HWT C;  1FZF A;  3FGA D;  3M0A A;  1NTZ E;  1W2E A;  1SQQ K;  3G3Z A;  1M8O B;  1LT1 A;  3H1L E;  3RK2 C;  3AEA C;  4KJM A;  3H1J J;  2WSF J;  1CI6 B;  1AV1 A;  4I7Z B;  4PJ0 H;  2R5D A;  4H44 D;  1RQU A;  3L35 A;  2C0X A;  2W6A A;  1EDK A;  2V4H A;  4YPC A;  3E1R A;  1BSN A;  3I55 P;  3U1C A;  4WY4 C;  5AVV B;  5APU A;  5AVS B;  3RK3 B;  3BAS A;  2V7Q J;  1P84 H;  3AEG C;  4Y99 B;  3PRJ A;  1NU1 E;  2K3R A;  3JC2 2;  3EFG A;  1NTZ G;  2FXM A;  3L75 J;  3A0H H;  2PFX A;  1UIX A;  1PGP A;  4H0L C;  3V2Q A;  1Y9B A;  3Q5S A;  1EZV E;  3A0B H;  1S5L H;  3EQ2 A;  2IBZ G;  3KZI H;  1SFC D;  4B86 A;  4WY4 A;  3GF3 A;  4U3F D;  1S1C X;  2H89 C;  2P1J A;  2LKM A;  5AW1 B;  3AE3 C;  2WSF H;  2WSE H;  1QL2 A;  3RL0 C;  1W5C E;  1NTM J;  5BU5 A;  1RQV A;  2O01 J;  1KZU B;  2YKP A;  5CMZ A;  1KMI Z;  4PV1 C;  2PGD A;  1FDO A;  3O6Q B;  2BEZ F;  3AE4 C;  2V7Q H;  1FZC B;  1N7S B;  1KQL A;  1NAF A;  1IFJ A;  3B8E B;  2KSE A;  4IFD K;  1H8A A;  1N73 B;  1EZV G;  4YXD C;  2KNC B;  3AE1 C;  1KYO D;  3GMA A;  3L36 A;  1SQP K;  1GZL A;  1KOR A;  4CPG A;  1NYH A;  1FZB A;  1L0L K;  2E76 C;  3G6E P;  3BVH A;  2FYU D;  2J58 A;  1JY3 O;  2J5U A;  1VQL P;  2YO3 A;  5AW9 B;  2W6B A;  1K9M Q;  1VF5 B;  1VQ5 P;  2OTJ P;  2YIU B;  1IZN B;  4ASV A;  2L91 A;  1AQT A;  1YJ9 P;  3LID A;  1L4A D;  2ZAE B;  3HRN A;  2KYV A;  1X22 A;  1NAY A;  1LJ2 A;  4PD4 E;  2P10 A;  3F5H A;  3L72 D;  4LLH A;  1FU1 A;  2M5A A;  4N78 D;  3H1K E;  1YJW P;  5AVW B;  5TIS E;  5KAF H;  3RK3 C;  3H1L D;  1LT9 B;  1LWU B;  2H88 C;  5KKZ B;  4Y99 C;  4BWN A;  1ZLL A;  2P58 A;  5AVZ B;  1VQK P;  1SQQ J;  1CI6 A;  2WMM A;  2HG5 D;  1BE3 E;  1OIP A;  4W80 A;  3GLM A;  2B88 A;  2E42 A;  3L73 E;  1ZW0 A;  3TK1 A;  3MIW A;  1OVV A;  1Q82 Q;  3CC4 P;  2GA1 A;  1NU1 D;  4UB8 E;  1J2J B;  3QH9 A;  1OVR A;  3H1K G;  2QJY B;  1SQX K;  3TSI A;  1JY2 P;  3A2A A;  2Q7C A;  4WVZ A;  2IDB A;  3P7K A;  2GUS A;  2YKO A;  3CMA P;  2OGU A;  2H7H A;  3L70 D;  4I1L A;  1X79 B;  3AE7 C;  4K35 A;  1N73 C;  3L73 G;  3BCC G;  1L0N D;  3AEB C;  2M3E A;  4IL6 E;  3VOP A;  4KT0 J;  3SFD C;  5TJH A;  2RMZ A;  4TT3 H;  3S9O A;  1JUN A;  3CCL P;  2JDI H;  1KYO I;  1Z56 A;  2JO1 A;  3VMA A;  1VF5 C;  2UWJ E;  4BRY B;  1SQV D;  2YIU C;  4EIJ A;  3CXH H;  3GHG C;  1FZC A;  2BCC G;  1N7S A;  1N86 A;  3H1K J;  1PL5 A;  1N73 A;  2KNC A;  4WY4 D;  1HBW A;  3VMX A;  3CC7 P;  1NOH A;  3Q3D A;  1SQP J;  2C0W A;  2MJZ A;  5DJU B;  1LTG C;  1R5S A;  5C39 A;  1LWU C;  2G8Y A;  1N7L A;  4GKG A;  1SQB E;  2AXC A;  3HE4 B;  2E74 B;  2BAS A;  1H88 A;  1IFM A;  1SS1 A;  3BCC J;  4H0L D;  1Q86 Q;  3H1I E;  1NTK G;  3CCM P;  3WU2 E;  4R4M A;  1VDF A;  2WWW A;  1OVU A;  2ZVO B;  1LTJ B;  1EXI A;  4YTP C;  2Y9Z A;  2KP8 A;  4PD4 H;  2P7J A;  1P84 E;  3SWY A;  1PP9 E;  3RL0 D;  1LWU A;  3OA7 A;  2BCC J;  3VP8 A;  3VP9 A;  1S72 P;  2QVA A;  2Y0D A;  5TIS H;  1FBM A;  1BE3 D;  1SQB G;  1DD3 A;  1IFI A;  1PGJ A;  3L73 D;  1EDI A;  3A0B E;  3L4F A;  1G1J A;  1Y47 A;  3BRV B;  3KZI E;  4N6J A;  3H1I G;  2ZYG A;  3ITK A;  3AE2 C;  3SWK A;  3H1J E;  1YJN P;  3KYQ A;  3CWB J;  5DJT B;  4JBZ A;  4WB4 A;  3TYY A;  1NTK J;  3H1H J;  1YHQ P;  3AEF C;  2Q1K A;  5KLV J;  1H89 A;  5CCH C;  2FY8 A;  3L74 D;  3VMY A;  2DW3 A;  1PP9 G;  1FE6 A;  3V2R A;  2KIK A;  2SPZ A;  1MFT A;  2JKV A;  3NMD A;  1SQX J;  2IYO A;  2FYU K;  2IZ0 A;  2KLU A;  3OJA B;  1M1K Q;  1IK9 A;  3A3Y B;  4W7Z A;  2WT7 B;  1KB9 D;  3O8Z A;  3QWO C;  3L75 E;  3EFF K;  4GOF A;  3HTK B;  2QA4 P;  3RK3 D;  3H1J G;  5CCH A;  4WWI A;  2ZYA A;  1K8A Q;  5APS A;  4OH8 B;  3H1I J;  4IL6 H;  2QM7 A;  4EYY Q;  1IK7 A;  2WQY C;  4BRY A;  1ZP0 C;  1NTM E;  3L37 A;  2I1K A;  4AUW A;  3MHV A;  1S9K E;  3B5N B;  4RO0 A;  1YI2 P;  4GIF A;  3M91 A;  1G2C B;  3IN6 A;  1LTJ C;  1DIP A;  1LGH B;  1DEE G;  3CC2 P;  1R8E A;  1S2E A;  1SQB D;  3L75 G;  2WIT A;  4D6T E;  2HR3 A;  3CME P;  1WMK A;  2A45 G;  1KQG B;  1NU1 K;  3M0D C;  5AW4 B;  2N9Y B;  3VTP C;  2WTY A;  2KUB A;  1T8Z A;  3C1L A;  2KXP B;  2Y9Y A;  2PRR A;  1VQN P;  1URQ B;  2IBZ E;  2QG4 A;  1NJI Q;  1N7S D;  2J59 M;  1LTJ A;  5AW2 B;  1NTM G;  1RF0 C;  1NGM B;  1PZQ A;  1P84 D;  3WU2 H;  5APV A;  3L71 E;  4L74 A;  3FXE A;  1QGK B;  3HUS B;  5B66 E;  5AW3 B;  1CW5 A;  3M0D A;  1L0N K;  3CCV P;  2AEJ A;  1JCC A;  2A06 D;  4D6T G;  1VF5 D;  2PAJ A;  3V2P A;  4EOT A;  1JY2 N;  3EWK A;  2YNY A;  1RF0 A;  1NKZ B;  3H1J D;  3KQG A;  2N1T D;  1SQV K;  1EDJ A;  2B89 A;  1SQQ E;  2BEQ D;  1OXZ A;  5GTI E;  3WUV A;  4BXL A;  1J1E B;  3L71 G;  2NPS B;  2Q5U A;  3BAT A;  1KB9 I;  4HYT B;  1YIT P;  2Q6Q A;  2YXQ B;  1G1I A;  4OGQ B;  1AA0 A;  2R44 A;  2HPC A;  1DEB A;  4YXW H;  1M57 D;  2ZT9 B;  3CXH E;  2FYN B;  1ZR4 A;  1BCC J;  2NZ2 A;  1BGY E;  2WT7 A;  1VQ9 P;  3L75 D;  3B5N C;  1OX3 A;  1BSH A;  4D6T J;  5AW8 B;  3HTK A;  3OAK A;  2Y0C A;  3P8C D;  1SQQ G;  3N7N A;  2OYI B;  2C9N Y;  2FFD B;  3W68 A;  1BDC A;  5CBN A;  3IAO A;  3TF5 A;  3PJS K;  3V2N A;  2A45 H;  1ZV8 A;  1S9K D;  5CBO A;  3I5C A;  1SP4 A;  1KN7 A;  3B5N A;  1GD2 E;  5AW0 B;  3L71 J;  4KHX A;  1G2C A;  3H25 A;  4I7Z C;  1MUU A;  1BGY G;  2N1T B;  2O01 H;  4H13 B;  2WPV B;  1VQ7 P;  1Q90 D;  5EFW B;  1NTZ D;  1NWQ A;  2RH0 A;  2Z5H A;  3HUS C;  5AW6 B;  2OTK E;  5CCH D;  4RJT A;  2JWD A;  4XA4 A;  1P84 I;  1NHL A;  1ZXG A;  1IFD A;  3AE6 C;  1RE4 C;  2IBZ D;  1GW4 A;  4DCK A;  1NVO A;  1SQP E;  1IC2 A;  2ZJS E;  1HVV A;  1AFO A;  1VQM P;  2OAR A;  1FDM A; 
#chains in the Genus database with same CATH homology
 5E79 H;  5B66 H;  5B5E H;  3JCU H;  3A0B H;  4PJ0 H;  1S5L H;  3KZI H;  4IL6 H;  3WU2 H;  4UB6 H;  5GTI H;  5GTH H;  4UB8 H;  5H2F H;  5KAF H;  5TIS H;  5KAI H;  2AXT H;  3A0H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...