3KZIO

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
243
structure length
243
Chain Sequence
TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Photosystem Q(B) protein 1
total genus 45
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3kziO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3kziO02
3A0HO 5KAFO 5G3AA 1S5LO 5GTHO 5TISO 4IL6O 5B66O 5KAIO 4UB6O 4PJ0O 5GTIO 3A0BO 4UB8O 5B5EO 5H2FO 2AXTO 3WU2O 3KZIO 5G39A 5E79O 5G38A 3JCUO
chains in the Genus database with same CATH superfamily
2R4OA 1GFMA 1YS5A 1T16A 2XTQA 3G7GA 3LK3B 2Y0LA 1H6S1 4FRXA 5KAFO 4FQEA 3TZGA 5AFUK 3POXA 4RL9A 1P4TA 2F1TA 4U9CA 2X27X 3AA6A 2W81C 3SYSA 5GV0A 3V8UA 5DL5A 4AYID 3WI4A 3SZVA 1BH3A 2M07A 4FZMA 3PGUA 3VE1A 4C00A 3T24A 4GHBA 5JDPA 4O3ZA 2XMXA 3BRYA 4D5UA 4AKRB 2M06A 3A2SX 4GF4A 2KZ7B 3DA3A 3POQA 4FSPA 2AXTO 3HOEA 5FVNA 3DWNA 3PF1A 3RBHA 3AA0B 4LSEA 2F1VA 2XG6A 2X9KA 1Q9FA 4PR7A 4B61A 3HW9A 4O3WA 5G39A 4JCHA 2MHLA 5AFUL 2W80C 2R4PA 1QJ9A 3PORA 5IYUA 2KXPB 1ORMA 4KR8A 4K3CA 1IZNA 4O4UA 5D5DA 3PRNA 4AYDC 4KR4A 3VZWX 5DL7A 1GFOA 3BS0A 3LK41 2N2LA 3NSGA 4G75A 4JFBA 4LSIA 4O4XA 4RLCA 3T0SA 3AA7B 2KZ7A 3VZUX 4D64A 2R4NA 4AKRA 3PQUA 5TISO 3LK2B 3UAQA 2R89A 1HXXA 4D65A 2WVPA 4FESA 2FGQX 5G26A 2QTKA 2IWWA 3PQSA 2JQYA 2WJQA 3AAEA 4LSHA 5H2FO 4FZLA 2FGRA 3WU2O 1ZHYA 3KZIO 2Y2XA 1Q9GA 2N2MA 4XNLA 3EMNX 4FZNA 2JMMA 3LK3A 4PUXA 8PRNA 2R88A 3AAEB 2PRNA 5E79O 3UU2A 2F1CX 4GCPA 2XE2A 2KDYA 2XTRA 2YNKA 3SY7A 4N59A 1OSMA 1HXTA 4C69X 1GFPA 3O0EA 4C4VA 3LK2A 4GCQA 4RJXA 2ERVA 4FSOA 3AA7A 5G3AA 1PHOA 3T20A 4N58A 2R4LA 3LK42 4FOZA 4AFKA 4F4BA 3HOLA 4LSFA 1MPFA 1BXWA 1IZNB 1ZHWA 2MNHA 3DZMA 2XE5A 4UB6O 5KAIO 4AUIA 2KXPA 5GTIO 4XNKA 7PRNA 4N75A 2ZFGA 3SY9A 2XE1A 5ADXL 3WI5A 2ZLDA 4AZLA 4O49A 1G90A 2R8AA 3VY8X 3DWOX 4AYMC 3AA0A 2IWVA 1E54A 2LFUA 4RLBA 5DL6A 3KVDD 3AA1A 5G38A 3QRCA 3VZTX 4AYNA 3JCUO 4QQ1A 3UPGA 4O3XB 3VE2A 3SZDA 1QJ8A 1QJPA 2O4VA 5PRNA 3VY9X 3NJTA 3A0HO 4AKMA 4CTDA 4E1TA 2J1NA 3GP6A 3K19A 3FYXA 3AA6B 6PRNA 1GFQA 1T1LA 1S5LO 2GE4A 3BRZA 5GTHO 3C5OA 2WJRA 2Y0KA 2PORA 3POUA 1ZHTA 4IL6O 2K4TA 4E1SA 5B66O 3PGSA 4BUMX 4PJ0O 1BT9A 2KC0A 3DA4A 1ZHXA 2ODJA 4FUVA 5EE2A 3AA1B 1MM5A 3AAAA 3SYBA 3A0BO 4K3BA 1THQA 4UB8O 4FMSA 3HWBA 4RJWA 3JTYA 4N74A 4AYEC 1HXUA 4G76A 5B5EO 2Y7SA 2Y0HA 1GFNA 5ADXK 2J4UP 2LHFA 3QRAA 4FT6A 1ZHZA 4O3YA 3PGRA 4Z3TA 2YPVA 4GCSA 1OPFA 4C4VB 5T5FA 1PRNA 3AAAB 2XE3A 2OMFA 4KRAA 5DL8A 4FRTA 2K0LA 1MM4A
chains in the Genus database with same CATH topology
3A0HO 5KAFO 5G3AA 1S5LO 5GTHO 5TISO 4IL6O 5B66O 5KAIO 4UB6O 4PJ0O 5GTIO 3A0BO 4UB8O 5B5EO 5H2FO 2AXTO 3WU2O 3KZIO 5G39A 5E79O 5G38A 3JCUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H O;  5KAF O;  5G3A A;  1S5L O;  5GTH O;  5TIS O;  4IL6 O;  5B66 O;  5KAI O;  4UB6 O;  4PJ0 O;  5GTI O;  3A0B O;  4UB8 O;  5B5E O;  5H2F O;  2AXT O;  3WU2 O;  3KZI O;  5G39 A;  5E79 O;  5G38 A;  3JCU O; 
#chains in the Genus database with same CATH topology
 2R4O A;  1GFM A;  1YS5 A;  1T16 A;  2XTQ A;  3G7G A;  3LK3 B;  2Y0L A;  1H6S 1;  4FRX A;  5KAF O;  4FQE A;  3TZG A;  5AFU K;  3POX A;  4RL9 A;  1P4T A;  2F1T A;  4U9C A;  2X27 X;  3AA6 A;  2W81 C;  3SYS A;  5GV0 A;  3V8U A;  5DL5 A;  4AYI D;  3WI4 A;  3SZV A;  1BH3 A;  2M07 A;  4FZM A;  3PGU A;  3VE1 A;  4C00 A;  3T24 A;  4GHB A;  5JDP A;  4O3Z A;  2XMX A;  3BRY A;  4D5U A;  4AKR B;  2M06 A;  3A2S X;  4GF4 A;  2KZ7 B;  3DA3 A;  3POQ A;  4FSP A;  2AXT O;  3HOE A;  5FVN A;  3DWN A;  3PF1 A;  3RBH A;  3AA0 B;  4LSE A;  2F1V A;  2XG6 A;  2X9K A;  1Q9F A;  4PR7 A;  4B61 A;  3HW9 A;  4O3W A;  5G39 A;  4JCH A;  2MHL A;  5AFU L;  2W80 C;  2R4P A;  1QJ9 A;  3POR A;  5IYU A;  2KXP B;  1ORM A;  4KR8 A;  4K3C A;  1IZN A;  4O4U A;  5D5D A;  3PRN A;  4AYD C;  4KR4 A;  3VZW X;  5DL7 A;  1GFO A;  3BS0 A;  3LK4 1;  2N2L A;  3NSG A;  4G75 A;  4JFB A;  4LSI A;  4O4X A;  4RLC A;  3T0S A;  3AA7 B;  2KZ7 A;  3VZU X;  4D64 A;  2R4N A;  4AKR A;  3PQU A;  5TIS O;  3LK2 B;  3UAQ A;  2R89 A;  1HXX A;  4D65 A;  2WVP A;  4FES A;  2FGQ X;  5G26 A;  2QTK A;  2IWW A;  3PQS A;  2JQY A;  2WJQ A;  3AAE A;  4LSH A;  5H2F O;  4FZL A;  2FGR A;  3WU2 O;  1ZHY A;  3KZI O;  2Y2X A;  1Q9G A;  2N2M A;  4XNL A;  3EMN X;  4FZN A;  2JMM A;  3LK3 A;  4PUX A;  8PRN A;  2R88 A;  3AAE B;  2PRN A;  5E79 O;  3UU2 A;  2F1C X;  4GCP A;  2XE2 A;  2KDY A;  2XTR A;  2YNK A;  3SY7 A;  4N59 A;  1OSM A;  1HXT A;  4C69 X;  1GFP A;  3O0E A;  4C4V A;  3LK2 A;  4GCQ A;  4RJX A;  2ERV A;  4FSO A;  3AA7 A;  5G3A A;  1PHO A;  3T20 A;  4N58 A;  2R4L A;  3LK4 2;  4FOZ A;  4AFK A;  4F4B A;  3HOL A;  4LSF A;  1MPF A;  1BXW A;  1IZN B;  1ZHW A;  2MNH A;  3DZM A;  2XE5 A;  4UB6 O;  5KAI O;  4AUI A;  2KXP A;  5GTI O;  4XNK A;  7PRN A;  4N75 A;  2ZFG A;  3SY9 A;  2XE1 A;  5ADX L;  3WI5 A;  2ZLD A;  4AZL A;  4O49 A;  1G90 A;  2R8A A;  3VY8 X;  3DWO X;  4AYM C;  3AA0 A;  2IWV A;  1E54 A;  2LFU A;  4RLB A;  5DL6 A;  3KVD D;  3AA1 A;  5G38 A;  3QRC A;  3VZT X;  4AYN A;  3JCU O;  4QQ1 A;  3UPG A;  4O3X B;  3VE2 A;  3SZD A;  1QJ8 A;  1QJP A;  2O4V A;  5PRN A;  3VY9 X;  3NJT A;  3A0H O;  4AKM A;  4CTD A;  4E1T A;  2J1N A;  3GP6 A;  3K19 A;  3FYX A;  3AA6 B;  6PRN A;  1GFQ A;  1T1L A;  1S5L O;  2GE4 A;  3BRZ A;  5GTH O;  3C5O A;  2WJR A;  2Y0K A;  2POR A;  3POU A;  1ZHT A;  4IL6 O;  2K4T A;  4E1S A;  5B66 O;  3PGS A;  4BUM X;  4PJ0 O;  1BT9 A;  2KC0 A;  3DA4 A;  1ZHX A;  2ODJ A;  4FUV A;  5EE2 A;  3AA1 B;  1MM5 A;  3AAA A;  3SYB A;  3A0B O;  4K3B A;  1THQ A;  4UB8 O;  4FMS A;  3HWB A;  4RJW A;  3JTY A;  4N74 A;  4AYE C;  1HXU A;  4G76 A;  5B5E O;  2Y7S A;  2Y0H A;  1GFN A;  5ADX K;  2J4U P;  2LHF A;  3QRA A;  4FT6 A;  1ZHZ A;  4O3Y A;  3PGR A;  4Z3T A;  2YPV A;  4GCS A;  1OPF A;  4C4V B;  5T5F A;  1PRN A;  3AAA B;  2XE3 A;  2OMF A;  4KRA A;  5DL8 A;  4FRT A;  2K0L A;  1MM4 A; 
#chains in the Genus database with same CATH homology
 3A0H O;  5KAF O;  5G3A A;  1S5L O;  5GTH O;  5TIS O;  4IL6 O;  5B66 O;  5KAI O;  4UB6 O;  4PJ0 O;  5GTI O;  3A0B O;  4UB8 O;  5B5E O;  5H2F O;  2AXT O;  3WU2 O;  3KZI O;  5G39 A;  5E79 O;  5G38 A;  3JCU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...