3KZIO

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
243
structure length
243
Chain Sequence
b'TLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 45
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 3kziO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 3kziO02
5GTIO 4PJ0O 2AXTO 5G3AA 1S5LO 3KZIO 4UB6O 5TISO 4IL6O 3JCUO 3A0HO 5G38A 5B5EO 3A0BO 5KAIO 5H2FO 5E79O 5G39A 3WU2O 5B66O 5GTHO 4UB8O 5KAFO
chains in the Genus database with same CATH superfamily
2YNKA 1G90A 4U9CA 4AYMC 1ZHZA 3GP6A 3HW9A 3K19A 4O49A 4AKMA 5KAFO 3A2SX 2R88A 3SY9A 3AA1A 4LSEA 4PJ0O 5G3AA 4D65A 2XTRA 5IYUA 2ZLDA 3JTYA 5PRNA 4C4VA 1GFNA 4RLCA 4JCHA 3AA6A 2M06A 2Y2XA 3NJTA 4LSHA 5TISO 1ORMA 4FSPA 4PUXA 5DL6A 2ZFGA 2XTQA 1YS5A 4IL6O 3PF1A 5DL5A 2FGRA 4AKRB 2WJRA 1GFQA 2R4LA 2OMFA 2M07A 4G76A 4PR7A 4FZMA 4GCSA 4B61A 4C00A 3UAQA 3LK3A 5T5FA 2LFUA 3EMNX 4CTDA 3TZGA 3DWOX 2WJQA 4AFKA 4QQ1A 1OPFA 5ADXK 2IWWA 3SY7A 3VZWX 2R4OA 2FGQX 2XG6A 3PGSA 3BS0A 4FSOA 4FMSA 4O3XB 5FVNA 3POQA 3PQUA 1ZHXA 2W80C 3V8UA 2JMMA 3BRZA 3AAAA 3PQSA 2ODJA 2LHFA 3LK2A 1T16A 2KDYA 4GHBA 3POXA 1THQA 3AA0A 3AA7B 3FYXA 3T20A 1ZHYA 2R89A 2KXPA 2KZ7B 5GV0A 4Z3TA 4KR4A 4K3BA 4FRTA 1Q9GA 3JCUO 1Q9FA 1BXWA 3QRCA 2MHLA 5D5DA 5ADXL 4N59A 2IWVA 4O3WA 3WI4A 3A0BO 1QJ8A 4KRAA 2Y0HA 4FZLA 4XNLA 1H6S1 3UU2A 4AYDC 3PRNA 4O4UA 1IZNA 2O4VA 3AA1B 2KC0A 4AKRA 4O4XA 3WU2O 4GCQA 3VY8X 3VE1A 2K4TA 2XE1A 3DA4A 4E1SA 4C4VB 5B66O 5GTHO 3POUA 5JDPA 2N2MA 3AA6B 4O3YA 2JQYA 3NSGA 2QTKA 3AAEA 3LK42 3UPGA 3DA3A 3DWNA 3DZMA 3RBHA 3VY9X 2Y0KA 1T1LA 2AXTO 2YPVA 3C5OA 4F4BA 2MNHA 5AFUK 5EE2A 4RJWA 2F1VA 3KZIO 2R4PA 4FOZA 4FT6A 3T0SA 8PRNA 2N2LA 2X27X 4D64A 1GFPA 2X9KA 2Y0LA 4FQEA 1GFMA 2GE4A 3HOEA 3A0HO 4AUIA 4N58A 1E54A 2WVPA 2R8AA 3VZUX 5B5EO 3PORA 2F1TA 2R4NA 5H2FO 4N75A 3T24A 1PHOA 4N74A 5G26A 3LK2B 5G39A 3SYSA 2J4UP 5AFUL 4E1TA 4FESA 4GCPA 1MM4A 4AYNA 3AA0B 4O3ZA 7PRNA 5DL8A 1QJ9A 2W81C 4FUVA 5GTIO 1OSMA 3SZVA 3VZTX 2KXPB 3LK41 4D5UA 2Y7SA 4AZLA 2XE2A 2XMXA 1GFOA 4JFBA 3SZDA 3VE2A 4RJXA 1S5LO 4BUMX 1BH3A 3HOLA 2ERVA 3HWBA 3PGRA 4K3CA 4RL9A 4FRXA 5DL7A 3WI5A 2PORA 4G75A 2F1CX 1QJPA 4UB6O 1ZHWA 3BRYA 3QRAA 3G7GA 3SYBA 4C69X 1IZNB 3LK3B 2PRNA 1BT9A 3O0EA 1P4TA 4LSFA 4FZNA 5G38A 3KVDD 1HXUA 2K0LA 1HXXA 1MPFA 2J1NA 3AAEB 1ZHTA 3AA7A 2XE3A 4KR8A 5KAIO 6PRNA 5E79O 2KZ7A 4LSIA 2XE5A 4RLBA 3AAAB 4XNKA 1HXTA 3PGUA 4UB8O 1PRNA 1MM5A 4AYEC 4GF4A 4AYID
chains in the Genus database with same CATH topology
5GTIO 4PJ0O 2AXTO 5G3AA 1S5LO 3KZIO 4UB6O 5TISO 4IL6O 3JCUO 3A0HO 5G38A 5B5EO 3A0BO 5KAIO 5H2FO 5E79O 5G39A 3WU2O 5B66O 5GTHO 4UB8O 5KAFO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GTI O;  4PJ0 O;  2AXT O;  5G3A A;  1S5L O;  3KZI O;  4UB6 O;  5TIS O;  4IL6 O;  3JCU O;  3A0H O;  5G38 A;  5B5E O;  3A0B O;  5KAI O;  5H2F O;  5E79 O;  5G39 A;  3WU2 O;  5B66 O;  5GTH O;  4UB8 O;  5KAF O; 
#chains in the Genus database with same CATH topology
 2YNK A;  1G90 A;  4U9C A;  4AYM C;  1ZHZ A;  3GP6 A;  3HW9 A;  3K19 A;  4O49 A;  4AKM A;  5KAF O;  3A2S X;  2R88 A;  3SY9 A;  3AA1 A;  4LSE A;  4PJ0 O;  5G3A A;  4D65 A;  2XTR A;  5IYU A;  2ZLD A;  3JTY A;  5PRN A;  4C4V A;  1GFN A;  4RLC A;  4JCH A;  3AA6 A;  2M06 A;  2Y2X A;  3NJT A;  4LSH A;  5TIS O;  1ORM A;  4FSP A;  4PUX A;  5DL6 A;  2ZFG A;  2XTQ A;  1YS5 A;  4IL6 O;  3PF1 A;  5DL5 A;  2FGR A;  4AKR B;  2WJR A;  1GFQ A;  2R4L A;  2OMF A;  2M07 A;  4G76 A;  4PR7 A;  4FZM A;  4GCS A;  4B61 A;  4C00 A;  3UAQ A;  3LK3 A;  5T5F A;  2LFU A;  3EMN X;  4CTD A;  3TZG A;  3DWO X;  2WJQ A;  4AFK A;  4QQ1 A;  1OPF A;  5ADX K;  2IWW A;  3SY7 A;  3VZW X;  2R4O A;  2FGQ X;  2XG6 A;  3PGS A;  3BS0 A;  4FSO A;  4FMS A;  4O3X B;  5FVN A;  3POQ A;  3PQU A;  1ZHX A;  2W80 C;  3V8U A;  2JMM A;  3BRZ A;  3AAA A;  3PQS A;  2ODJ A;  2LHF A;  3LK2 A;  1T16 A;  2KDY A;  4GHB A;  3POX A;  1THQ A;  3AA0 A;  3AA7 B;  3FYX A;  3T20 A;  1ZHY A;  2R89 A;  2KXP A;  2KZ7 B;  5GV0 A;  4Z3T A;  4KR4 A;  4K3B A;  4FRT A;  1Q9G A;  3JCU O;  1Q9F A;  1BXW A;  3QRC A;  2MHL A;  5D5D A;  5ADX L;  4N59 A;  2IWV A;  4O3W A;  3WI4 A;  3A0B O;  1QJ8 A;  4KRA A;  2Y0H A;  4FZL A;  4XNL A;  1H6S 1;  3UU2 A;  4AYD C;  3PRN A;  4O4U A;  1IZN A;  2O4V A;  3AA1 B;  2KC0 A;  4AKR A;  4O4X A;  3WU2 O;  4GCQ A;  3VY8 X;  3VE1 A;  2K4T A;  2XE1 A;  3DA4 A;  4E1S A;  4C4V B;  5B66 O;  5GTH O;  3POU A;  5JDP A;  2N2M A;  3AA6 B;  4O3Y A;  2JQY A;  3NSG A;  2QTK A;  3AAE A;  3LK4 2;  3UPG A;  3DA3 A;  3DWN A;  3DZM A;  3RBH A;  3VY9 X;  2Y0K A;  1T1L A;  2AXT O;  2YPV A;  3C5O A;  4F4B A;  2MNH A;  5AFU K;  5EE2 A;  4RJW A;  2F1V A;  3KZI O;  2R4P A;  4FOZ A;  4FT6 A;  3T0S A;  8PRN A;  2N2L A;  2X27 X;  4D64 A;  1GFP A;  2X9K A;  2Y0L A;  4FQE A;  1GFM A;  2GE4 A;  3HOE A;  3A0H O;  4AUI A;  4N58 A;  1E54 A;  2WVP A;  2R8A A;  3VZU X;  5B5E O;  3POR A;  2F1T A;  2R4N A;  5H2F O;  4N75 A;  3T24 A;  1PHO A;  4N74 A;  5G26 A;  3LK2 B;  5G39 A;  3SYS A;  2J4U P;  5AFU L;  4E1T A;  4FES A;  4GCP A;  1MM4 A;  4AYN A;  3AA0 B;  4O3Z A;  7PRN A;  5DL8 A;  1QJ9 A;  2W81 C;  4FUV A;  5GTI O;  1OSM A;  3SZV A;  3VZT X;  2KXP B;  3LK4 1;  4D5U A;  2Y7S A;  4AZL A;  2XE2 A;  2XMX A;  1GFO A;  4JFB A;  3SZD A;  3VE2 A;  4RJX A;  1S5L O;  4BUM X;  1BH3 A;  3HOL A;  2ERV A;  3HWB A;  3PGR A;  4K3C A;  4RL9 A;  4FRX A;  5DL7 A;  3WI5 A;  2POR A;  4G75 A;  2F1C X;  1QJP A;  4UB6 O;  1ZHW A;  3BRY A;  3QRA A;  3G7G A;  3SYB A;  4C69 X;  1IZN B;  3LK3 B;  2PRN A;  1BT9 A;  3O0E A;  1P4T A;  4LSF A;  4FZN A;  5G38 A;  3KVD D;  1HXU A;  2K0L A;  1HXX A;  1MPF A;  2J1N A;  3AAE B;  1ZHT A;  3AA7 A;  2XE3 A;  4KR8 A;  5KAI O;  6PRN A;  5E79 O;  2KZ7 A;  4LSI A;  2XE5 A;  4RLB A;  3AAA B;  4XNK A;  1HXT A;  3PGU A;  4UB8 O;  1PRN A;  1MM5 A;  4AYE C;  4GF4 A;  4AYI D; 
#chains in the Genus database with same CATH homology
 5GTI O;  4PJ0 O;  2AXT O;  5G3A A;  1S5L O;  3KZI O;  4UB6 O;  5TIS O;  4IL6 O;  3JCU O;  3A0H O;  5G38 A;  5B5E O;  3A0B O;  5KAI O;  5H2F O;  5E79 O;  5G39 A;  3WU2 O;  5B66 O;  5GTH O;  4UB8 O;  5KAF O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...