3KZIV

Crystal structure of monomeric form of cyanobacterial photosystem ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
AELTPEVLTVPLNSEGKTITLTEKQYLEGKRLFQYACASCHVGGITKTNPSLDLRTETLALATPPRDNIEGLVDYMKNPTTYDGEQEIAEVHPSLRSADIFPKMRNLTEKDLVAIAGHILVEPKILGDKWGGGKVYY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein 1
publication title Crystal Structure of Monomeric Photosystem II from Thermosynechococcus elongatus at 3.6-A Resolution
pubmed doi rcsb
molecule tags Electron transport
total genus 40
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF14495 Cytochrom_C550 Cytochrome c-550 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3kziV00
1GIWA 3L4OA 1SQVD 5CIHB 3X39A 1RZ6A 1A56A 1NMLA 1GQ1A 3RLMA 3O1YA 2HV4A 1HZVA 1DVVA 3BCCD 3WFEC 4FAVA 1W2LA 2CXBA 1AYGA 1YIQA 1MG2D 1SQXD 1E8EA 3HQ8A 3WFDC 2C1UA 1KV9A 3ZOOA 1N50A 1PPJD 2B10B 4UB6V 5DFSA 1H31B 1DW0A 1OCDA 1SQBD 1AOQA 4WQCA 3A0HV 4KMGA 3SJLA 3TYIA 4FANA 1A8CA 4WQ8A 351CA 1P84D 2C9XB 1CHIA 1C6OA 5B5EV 2ZZS1 3CWBD 1LFMA 4D6TD 1H33A 1NTZD 1CNOA 1RAQA 1WVEC 2GC7D 1JDLA 1I6EA 1CIEA 5CIBB 1BE3D 5CIEB 1NTKD 3PXSA 2DGEA 3H1KD 1NNOA 3CU4A 1U75B 3L71D 2C1VA 2CA3B 1HROA 1HRCA 1QYZA 2FRCA 2ZXYA 1CRHA 1U74B 1WEJF 3CX5W 4EICA 2LIRA 1PP9D 2GC4D 1MZ4A 2YK3A 1CRJA 1KX2A 1CEDA 4AALA 1CTZA 1FI3A 3ZOYA 1HH7A 4PW9B 1FOCA 1NTMD 2AXTV 1ETPA 1DT1A 1E29A 1H9XA 1M6ZA 1CORA 1CYIA 2N18C 4Q5PA 1HZUA 1L0LD 1EZVD 2AIUA 3WFCC 3PH2B 3CYTI 3RMZA 5IY51 1N90A 1CRIA 3L72D 1IQCA 5C0ZA 1I8OA 1S5LV 1DIQC 5KAIV 3VNWA 3WU2V 5DJQC 4H0KA 2V08A 5B6QA 4H0JA 1CC5A 1CSWA 3JBTB 3SVWA 3OA8A 2N9IA 1KYOD 2N18B 4JCGA 1LMSA 2V07A 1KB9D 1H32A 4RSZA 1DW1A 1L0ND 3L75D 5CYTR 2FYNB 2PCCB 1HJ3A 5DJQB 4PJ0V 1N9CA 1F1CA 4XXLA 1DVHA 3L4MA 1B7VA 1GKSA 1NIRA 2B0ZB 3O0RC 1IZL0 1CTJA 3M97X 1C7MA 3NWVA 4FA4A 3SWSA 1SQPD 4V2KA 5AURA 2QJPB 1LC1A 3NBTA 1N15A 4PWAA 4DY9A 3OA8B 1CIFA 2BLFB 1IRVA 4GYDA 1AOFA 3ZBMA 3H1LD 5E79V 1CTYA 3VRDA 1H32B 1GJQA 1CO6A 2BH5X 2ZONG 4U3FD 3H1HD 5TISV 1YTCA 2C2CA 5KLVD 1CRCA 2I8FA 2BPBB 1CCRA 2PACA 1R0QA 1KX7A 1BCCD 4L3GA 5DF5A 3DMIA 3WC8A 4WQAA 4XYDB 1KIBA 1W5CT 3H1JD 4WQDA 4AANA 1FHBA 1CXCA 3NBSA 5CIFB 1DW2A 2CE0A 3HQ6A 2PCBB 1YICA 2GB8B 2MTAC 1H1OA 5EXQA 1CHHA 3C2CA 2B11B 4WQ7A 1CXAA 1CRGA 1COTA 2GIWA 3HQ9A 2YIUB 2VHDA 1H9YA 1CYCA 2D0SA 3CP5A 5B66V 1HJ5A 2EXVA 2IBZD 2ZBOA 3PXWA 1QL4A 4LJIA 4O1QA 4GEDB 3L74D 1FI9A 3ZCFA 1KYOW 1CSXA 5KLIB 1BL9A 1CIHA 1OAEA 451CA 3CXHD 1L9JC 1FI7A 1NMIA 1GDVA 2CA4B 155CA 1YNRA 4AX3A 4AAMA 4FA1A 3KZIV 2OZ1A 2YQBA 3OCDA 1M70A 2ORLA 2MHMA 2LITA 2DVHA 1YFCA 1F1FA 3A9FA 3DP5A 3H1ID 1FJ0A 5GTHV 3MK7C 1DW3A 1NU1D 1L9BC 2L4DA 2BGVX 5CICB 3ORVA 1ZZHA 1I54A 2BCNB 4K3IA 1LC2A 3TGUD 1E2RA 4P4QB 3SXTA 1GU2A 1C52A 1DIIC 3O20A 3A0BV 1CIGA 1YCCA 1C75A 2FYUD 3ZOWA 3ZOXA 2FWLA 1C2NA 1CSUA 1A2SA 1ZRTD 4O1WA 1S6VB 1IO3A 3RN0A 1IRWA 5C9MA 4EIEA 3ZIYA 2C1DA 3MK7B 1CYJA 1I55A 2OZ1B 1K3GA 3PXTA 3OCDB 1AKKA 4AAOA 1HJ4A 1HCMA 4L1QA 4PD4D 4FB1A 2N3YA 4IL6V 4WQBA 2JQRA 1CCHA 4WQ9A 2BCCD 1C2RA 1SQQD 3O5CA 4QAOA 1QN2A 5CIDB 2ZOOA 4Y5RA 1CHJA 2N3BA 1KB0A 1CSVA 3L70D 1J3SA 5KKZB 4FA9A 3DR0A 1LS9A 1FCDC 5GTIV 1EB7A 3WFBC 1RAPA 1MG3D 1BGYD 2D0WA 2C1DB 2CE1A 4L3HA 2B12B 3VYMA 2XTSB 2C8SA 1YEBA 2JTIB 2YCCA 5H2FV 4UB8V 3CX5D 1M60A 1YEAA 4J20A 3HQ7A 5KAFV 3SLEA 4MU8A 1I8PA 1H33B 2AI5A 3RN1A 5CIGB 2BH4X 1RZ5A 4N0KA 4WQEA 1I5TA 1I6DA 1QL3A 4EIDA 3L73D 3CXHW 1C6RA 4NFGB 1VYDA 3WUIA 4FA5A 1C6SA 1K3HA 4EIFA 1H31A 2QJKB 1QKSA 2B4ZA 1CRYA 2N9JA 2QJYB 4YE1A 2A06D
chains in the Genus database with same CATH superfamily
1GIWA 3L4OA 1SQVD 5CIHB 3X39A 1RZ6A 1A56A 1NMLA 1GQ1A 3RLMA 3O1YA 2HV4A 1HZVA 1DVVA 3BCCD 3WFEC 4FAVA 1W2LA 2CXBA 1AYGA 1YIQA 1MG2D 1SQXD 1E8EA 3HQ8A 3WFDC 2C1UA 1KV9A 3ZOOA 1N50A 1PPJD 2B10B 4UB6V 5DFSA 1H31B 1DW0A 1OCDA 1SQBD 1AOQA 4WQCA 3A0HV 4KMGA 3SJLA 3TYIA 4FANA 1A8CA 4WQ8A 351CA 1P84D 2C9XB 1CHIA 1C6OA 5B5EV 2ZZS1 3CWBD 1LFMA 4D6TD 1H33A 1NTZD 1CNOA 1RAQA 1WVEC 2GC7D 1JDLA 1I6EA 1CIEA 5CIBB 1BE3D 5CIEB 1NTKD 3PXSA 2DGEA 3H1KD 1NNOA 3CU4A 1U75B 3L71D 2C1VA 2CA3B 1HROA 1HRCA 1QYZA 2FRCA 2ZXYA 1CRHA 1U74B 1WEJF 3CX5W 4EICA 2LIRA 1PP9D 2GC4D 1MZ4A 2YK3A 1CRJA 1KX2A 1CEDA 4AALA 1CTZA 1FI3A 3ZOYA 1HH7A 4PW9B 1FOCA 1NTMD 2AXTV 1ETPA 1DT1A 1E29A 1H9XA 1M6ZA 1CORA 1CYIA 2N18C 4Q5PA 1HZUA 1L0LD 1EZVD 2AIUA 3WFCC 3PH2B 3CYTI 3RMZA 5IY51 1N90A 1CRIA 3L72D 1IQCA 5C0ZA 1I8OA 1S5LV 1DIQC 5KAIV 3VNWA 3WU2V 5DJQC 4H0KA 2V08A 5B6QA 4H0JA 1CC5A 1CSWA 3JBTB 3SVWA 3OA8A 2N9IA 1KYOD 2N18B 4JCGA 1LMSA 2V07A 1KB9D 1H32A 4RSZA 1DW1A 1L0ND 3L75D 5CYTR 2FYNB 2PCCB 1HJ3A 5DJQB 4PJ0V 1N9CA 1F1CA 4XXLA 1DVHA 3L4MA 1B7VA 1GKSA 1NIRA 2B0ZB 3O0RC 1IZL0 1CTJA 3M97X 1C7MA 3NWVA 4FA4A 3SWSA 1SQPD 4V2KA 5AURA 2QJPB 1LC1A 3NBTA 1N15A 4PWAA 4DY9A 3OA8B 1CIFA 2BLFB 1IRVA 4GYDA 1AOFA 3ZBMA 3H1LD 5E79V 1CTYA 3VRDA 1H32B 1GJQA 1CO6A 2BH5X 2ZONG 4U3FD 3H1HD 5TISV 1YTCA 2C2CA 5KLVD 3D0WA 1CRCA 2I8FA 2BPBB 1CCRA 2PACA 1R0QA 1KX7A 1BCCD 4L3GA 5DF5A 3DMIA 3WC8A 4WQAA 4XYDB 1KIBA 1W5CT 3H1JD 4WQDA 4AANA 1FHBA 1CXCA 3NBSA 5CIFB 1DW2A 2CE0A 3HQ6A 2PCBB 1YICA 2GB8B 2MTAC 1H1OA 5EXQA 1CHHA 3C2CA 2B11B 4WQ7A 1CXAA 1CRGA 1COTA 2GIWA 3HQ9A 2YIUB 2VHDA 1H9YA 1CYCA 2D0SA 3CP5A 5B66V 1HJ5A 2EXVA 2IBZD 2ZBOA 3PXWA 1QL4A 4LJIA 4O1QA 4GEDB 3L74D 1FI9A 3ZCFA 1KYOW 1CSXA 5KLIB 1BL9A 1CIHA 1OAEA 451CA 3CXHD 1L9JC 1FI7A 1NMIA 1GDVA 2CA4B 155CA 1YNRA 4AX3A 4AAMA 4FA1A 3KZIV 2OZ1A 2YQBA 3OCDA 1M70A 2ORLA 2MHMA 2LITA 2DVHA 1YFCA 1F1FA 3A9FA 3DP5A 3H1ID 1FJ0A 5GTHV 3MK7C 1DW3A 1NU1D 1L9BC 2L4DA 2BGVX 5CICB 3ORVA 1ZZHA 1I54A 2BCNB 4K3IA 1LC2A 3TGUD 1E2RA 4P4QB 3SXTA 1GU2A 1C52A 1DIIC 3O20A 3A0BV 1CIGA 1YCCA 1C75A 2FYUD 3ZOWA 3ZOXA 2FWLA 1C2NA 1CSUA 1A2SA 1ZRTD 4O1WA 1S6VB 1IO3A 3RN0A 1IRWA 5C9MA 4EIEA 3ZIYA 2C1DA 3MK7B 1CYJA 1I55A 2OZ1B 1K3GA 3PXTA 3OCDB 1AKKA 4AAOA 1HJ4A 1HCMA 4L1QA 4PD4D 4FB1A 2N3YA 4IL6V 4WQBA 2JQRA 1CCHA 4WQ9A 2BCCD 1C2RA 1SQQD 3O5CA 4QAOA 1QN2A 5CIDB 2ZOOA 4Y5RA 1CHJA 2N3BA 1KB0A 1CSVA 3L70D 1J3SA 5KKZB 4FA9A 3DR0A 1LS9A 1FCDC 5GTIV 1EB7A 3WFBC 1RAPA 1MG3D 1BGYD 2D0WA 2C1DB 2CE1A 4L3HA 2B12B 3VYMA 2XTSB 2C8SA 1YEBA 2JTIB 2YCCA 5H2FV 4UB8V 3CX5D 1M60A 1YEAA 4J20A 3HQ7A 5KAFV 3SLEA 4MU8A 1I8PA 1H33B 2AI5A 3RN1A 5CIGB 2BH4X 1RZ5A 4N0KA 4WQEA 1I5TA 1I6DA 1QL3A 4EIDA 3L73D 3CXHW 1C6RA 4NFGB 1VYDA 3WUIA 4FA5A 1C6SA 1K3HA 4EIFA 1H31A 2QJKB 1QKSA 2B4ZA 1CRYA 2N9JA 2QJYB 4YE1A 2A06D
chains in the Genus database with same CATH topology
1GIWA 3L4OA 1SQVD 5CIHB 3X39A 1RZ6A 1A56A 1NMLA 1GQ1A 3RLMA 3O1YA 2HV4A 1HZVA 1DVVA 3BCCD 3WFEC 4FAVA 1W2LA 2CXBA 1AYGA 1YIQA 1MG2D 1SQXD 1E8EA 3HQ8A 3WFDC 2C1UA 1KV9A 3ZOOA 1N50A 1PPJD 2B10B 4UB6V 5DFSA 1H31B 1DW0A 1OCDA 1SQBD 1AOQA 4WQCA 3A0HV 4KMGA 3SJLA 3TYIA 4FANA 1A8CA 4WQ8A 351CA 1P84D 2C9XB 1CHIA 1C6OA 5B5EV 2ZZS1 3CWBD 1LFMA 4D6TD 1H33A 1NTZD 1CNOA 1RAQA 1WVEC 2GC7D 1JDLA 1I6EA 1CIEA 5CIBB 1BE3D 5CIEB 1NTKD 3PXSA 2DGEA 3H1KD 1NNOA 3CU4A 1U75B 3L71D 2C1VA 2CA3B 1HROA 1HRCA 1QYZA 2FRCA 2ZXYA 1CRHA 1U74B 1WEJF 3CX5W 4EICA 2LIRA 1PP9D 2GC4D 1MZ4A 2YK3A 1CRJA 1KX2A 1CEDA 4AALA 1CTZA 1FI3A 3ZOYA 1HH7A 4PW9B 1FOCA 1NTMD 2AXTV 1ETPA 1DT1A 1E29A 1H9XA 1M6ZA 1CORA 1CYIA 2N18C 4Q5PA 1HZUA 1L0LD 1EZVD 2AIUA 3WFCC 3PH2B 3CYTI 3RMZA 5IY51 1N90A 1CRIA 3L72D 1IQCA 5C0ZA 1I8OA 1S5LV 1DIQC 5KAIV 3VNWA 3WU2V 5DJQC 4H0KA 2V08A 5B6QA 4H0JA 1CC5A 1CSWA 3JBTB 3SVWA 3OA8A 2N9IA 1KYOD 2N18B 4JCGA 1LMSA 2V07A 1KB9D 1H32A 4RSZA 1DW1A 1L0ND 3L75D 5CYTR 2FYNB 2PCCB 1HJ3A 5DJQB 4PJ0V 1N9CA 1F1CA 4XXLA 1DVHA 3L4MA 1B7VA 1GKSA 1NIRA 2B0ZB 3O0RC 1IZL0 1CTJA 3M97X 1C7MA 3NWVA 4FA4A 3SWSA 1SQPD 4V2KA 5AURA 2QJPB 1LC1A 3NBTA 1N15A 4PWAA 4DY9A 3OA8B 1CIFA 2BLFB 1IRVA 4GYDA 1AOFA 3ZBMA 3H1LD 5E79V 1CTYA 3VRDA 1H32B 1GJQA 1CO6A 2BH5X 2ZONG 4U3FD 3H1HD 5TISV 1YTCA 2C2CA 5KLVD 1CRCA 2I8FA 2BPBB 1CCRA 2PACA 1R0QA 1KX7A 1BCCD 4L3GA 5DF5A 3DMIA 3WC8A 4WQAA 4XYDB 1KIBA 1W5CT 3H1JD 4WQDA 4AANA 1FHBA 1CXCA 3NBSA 5CIFB 1DW2A 2CE0A 3HQ6A 2PCBB 1YICA 2GB8B 2MTAC 1H1OA 5EXQA 1CHHA 3C2CA 2B11B 4WQ7A 1CXAA 1CRGA 1COTA 2GIWA 3HQ9A 2YIUB 2VHDA 1H9YA 1CYCA 2D0SA 3CP5A 5B66V 1HJ5A 2EXVA 2IBZD 2ZBOA 3PXWA 1QL4A 4LJIA 4O1QA 4GEDB 3L74D 1FI9A 3ZCFA 1KYOW 1CSXA 5KLIB 1BL9A 1CIHA 1OAEA 451CA 3CXHD 1L9JC 1FI7A 1NMIA 1GDVA 2CA4B 155CA 1YNRA 4AX3A 4AAMA 4FA1A 3KZIV 2OZ1A 2YQBA 3OCDA 1M70A 2ORLA 2MHMA 2LITA 2DVHA 1YFCA 1F1FA 3A9FA 3DP5A 3H1ID 1FJ0A 5GTHV 3MK7C 1DW3A 1NU1D 1L9BC 2L4DA 2BGVX 5CICB 3ORVA 1ZZHA 1I54A 2BCNB 4K3IA 1LC2A 3TGUD 1E2RA 4P4QB 3SXTA 1GU2A 1C52A 1DIIC 3O20A 3A0BV 1CIGA 1YCCA 1C75A 2FYUD 3ZOWA 3ZOXA 2FWLA 1C2NA 1CSUA 1A2SA 1ZRTD 4O1WA 1S6VB 1IO3A 3RN0A 1IRWA 5C9MA 4EIEA 3ZIYA 2C1DA 3MK7B 1CYJA 1I55A 2OZ1B 1K3GA 3PXTA 3OCDB 1AKKA 4AAOA 1HJ4A 1HCMA 4L1QA 4PD4D 4FB1A 2N3YA 4IL6V 4WQBA 2JQRA 1CCHA 4WQ9A 2BCCD 1C2RA 1SQQD 3O5CA 4QAOA 1QN2A 5CIDB 2ZOOA 4Y5RA 1CHJA 2N3BA 1KB0A 1CSVA 3L70D 1J3SA 5KKZB 4FA9A 3DR0A 1LS9A 1FCDC 5GTIV 1EB7A 3WFBC 1RAPA 1MG3D 1BGYD 2D0WA 2C1DB 2CE1A 4L3HA 2B12B 3VYMA 2XTSB 2C8SA 1YEBA 2JTIB 2YCCA 5H2FV 4UB8V 3CX5D 1M60A 1YEAA 4J20A 3HQ7A 5KAFV 3SLEA 4MU8A 1I8PA 1H33B 2AI5A 3RN1A 5CIGB 2BH4X 1RZ5A 4N0KA 4WQEA 1I5TA 1I6DA 1QL3A 4EIDA 3L73D 3CXHW 1C6RA 4NFGB 1VYDA 3WUIA 4FA5A 1C6SA 1K3HA 4EIFA 1H31A 2QJKB 1QKSA 2B4ZA 1CRYA 2N9JA 2QJYB 4YE1A 2A06D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GIW A;  3L4O A;  1SQV D;  5CIH B;  3X39 A;  1RZ6 A;  1A56 A;  1NML A;  1GQ1 A;  3RLM A;  3O1Y A;  2HV4 A;  1HZV A;  1DVV A;  3BCC D;  3WFE C;  4FAV A;  1W2L A;  2CXB A;  1AYG A;  1YIQ A;  1MG2 D;  1SQX D;  1E8E A;  3HQ8 A;  3WFD C;  2C1U A;  1KV9 A;  3ZOO A;  1N50 A;  1PPJ D;  2B10 B;  4UB6 V;  5DFS A;  1H31 B;  1DW0 A;  1OCD A;  1SQB D;  1AOQ A;  4WQC A;  3A0H V;  4KMG A;  3SJL A;  3TYI A;  4FAN A;  1A8C A;  4WQ8 A;  351C A;  1P84 D;  2C9X B;  1CHI A;  1C6O A;  5B5E V;  2ZZS 1;  3CWB D;  1LFM A;  4D6T D;  1H33 A;  1NTZ D;  1CNO A;  1RAQ A;  1WVE C;  2GC7 D;  1JDL A;  1I6E A;  1CIE A;  5CIB B;  1BE3 D;  5CIE B;  1NTK D;  3PXS A;  2DGE A;  3H1K D;  1NNO A;  3CU4 A;  1U75 B;  3L71 D;  2C1V A;  2CA3 B;  1HRO A;  1HRC A;  1QYZ A;  2FRC A;  2ZXY A;  1CRH A;  1U74 B;  1WEJ F;  3CX5 W;  4EIC A;  2LIR A;  1PP9 D;  2GC4 D;  1MZ4 A;  2YK3 A;  1CRJ A;  1KX2 A;  1CED A;  4AAL A;  1CTZ A;  1FI3 A;  3ZOY A;  1HH7 A;  4PW9 B;  1FOC A;  1NTM D;  2AXT V;  1ETP A;  1DT1 A;  1E29 A;  1H9X A;  1M6Z A;  1COR A;  1CYI A;  2N18 C;  4Q5P A;  1HZU A;  1L0L D;  1EZV D;  2AIU A;  3WFC C;  3PH2 B;  3CYT I;  3RMZ A;  5IY5 1;  1N90 A;  1CRI A;  3L72 D;  1IQC A;  5C0Z A;  1I8O A;  1S5L V;  1DIQ C;  5KAI V;  3VNW A;  3WU2 V;  5DJQ C;  4H0K A;  2V08 A;  5B6Q A;  4H0J A;  1CC5 A;  1CSW A;  3JBT B;  3SVW A;  3OA8 A;  2N9I A;  1KYO D;  2N18 B;  4JCG A;  1LMS A;  2V07 A;  1KB9 D;  1H32 A;  4RSZ A;  1DW1 A;  1L0N D;  3L75 D;  5CYT R;  2FYN B;  2PCC B;  1HJ3 A;  5DJQ B;  4PJ0 V;  1N9C A;  1F1C A;  4XXL A;  1DVH A;  3L4M A;  1B7V A;  1GKS A;  1NIR A;  2B0Z B;  3O0R C;  1IZL 0;  1CTJ A;  3M97 X;  1C7M A;  3NWV A;  4FA4 A;  3SWS A;  1SQP D;  4V2K A;  5AUR A;  2QJP B;  1LC1 A;  3NBT A;  1N15 A;  4PWA A;  4DY9 A;  3OA8 B;  1CIF A;  2BLF B;  1IRV A;  4GYD A;  1AOF A;  3ZBM A;  3H1L D;  5E79 V;  1CTY A;  3VRD A;  1H32 B;  1GJQ A;  1CO6 A;  2BH5 X;  2ZON G;  4U3F D;  3H1H D;  5TIS V;  1YTC A;  2C2C A;  5KLV D;  1CRC A;  2I8F A;  2BPB B;  1CCR A;  2PAC A;  1R0Q A;  1KX7 A;  1BCC D;  4L3G A;  5DF5 A;  3DMI A;  3WC8 A;  4WQA A;  4XYD B;  1KIB A;  1W5C T;  3H1J D;  4WQD A;  4AAN A;  1FHB A;  1CXC A;  3NBS A;  5CIF B;  1DW2 A;  2CE0 A;  3HQ6 A;  2PCB B;  1YIC A;  2GB8 B;  2MTA C;  1H1O A;  5EXQ A;  1CHH A;  3C2C A;  2B11 B;  4WQ7 A;  1CXA A;  1CRG A;  1COT A;  2GIW A;  3HQ9 A;  2YIU B;  2VHD A;  1H9Y A;  1CYC A;  2D0S A;  3CP5 A;  5B66 V;  1HJ5 A;  2EXV A;  2IBZ D;  2ZBO A;  3PXW A;  1QL4 A;  4LJI A;  4O1Q A;  4GED B;  3L74 D;  1FI9 A;  3ZCF A;  1KYO W;  1CSX A;  5KLI B;  1BL9 A;  1CIH A;  1OAE A;  451C A;  3CXH D;  1L9J C;  1FI7 A;  1NMI A;  1GDV A;  2CA4 B;  155C A;  1YNR A;  4AX3 A;  4AAM A;  4FA1 A;  3KZI V;  2OZ1 A;  2YQB A;  3OCD A;  1M70 A;  2ORL A;  2MHM A;  2LIT A;  2DVH A;  1YFC A;  1F1F A;  3A9F A;  3DP5 A;  3H1I D;  1FJ0 A;  5GTH V;  3MK7 C;  1DW3 A;  1NU1 D;  1L9B C;  2L4D A;  2BGV X;  5CIC B;  3ORV A;  1ZZH A;  1I54 A;  2BCN B;  4K3I A;  1LC2 A;  3TGU D;  1E2R A;  4P4Q B;  3SXT A;  1GU2 A;  1C52 A;  1DII C;  3O20 A;  3A0B V;  1CIG A;  1YCC A;  1C75 A;  2FYU D;  3ZOW A;  3ZOX A;  2FWL A;  1C2N A;  1CSU A;  1A2S A;  1ZRT D;  4O1W A;  1S6V B;  1IO3 A;  3RN0 A;  1IRW A;  5C9M A;  4EIE A;  3ZIY A;  2C1D A;  3MK7 B;  1CYJ A;  1I55 A;  2OZ1 B;  1K3G A;  3PXT A;  3OCD B;  1AKK A;  4AAO A;  1HJ4 A;  1HCM A;  4L1Q A;  4PD4 D;  4FB1 A;  2N3Y A;  4IL6 V;  4WQB A;  2JQR A;  1CCH A;  4WQ9 A;  2BCC D;  1C2R A;  1SQQ D;  3O5C A;  4QAO A;  1QN2 A;  5CID B;  2ZOO A;  4Y5R A;  1CHJ A;  2N3B A;  1KB0 A;  1CSV A;  3L70 D;  1J3S A;  5KKZ B;  4FA9 A;  3DR0 A;  1LS9 A;  1FCD C;  5GTI V;  1EB7 A;  3WFB C;  1RAP A;  1MG3 D;  1BGY D;  2D0W A;  2C1D B;  2CE1 A;  4L3H A;  2B12 B;  3VYM A;  2XTS B;  2C8S A;  1YEB A;  2JTI B;  2YCC A;  5H2F V;  4UB8 V;  3CX5 D;  1M60 A;  1YEA A;  4J20 A;  3HQ7 A;  5KAF V;  3SLE A;  4MU8 A;  1I8P A;  1H33 B;  2AI5 A;  3RN1 A;  5CIG B;  2BH4 X;  1RZ5 A;  4N0K A;  4WQE A;  1I5T A;  1I6D A;  1QL3 A;  4EID A;  3L73 D;  3CXH W;  1C6R A;  4NFG B;  1VYD A;  3WUI A;  4FA5 A;  1C6S A;  1K3H A;  4EIF A;  1H31 A;  2QJK B;  1QKS A;  2B4Z A;  1CRY A;  2N9J A;  2QJY B;  4YE1 A;  2A06 D; 
#chains in the Genus database with same CATH topology
 1GIW A;  3L4O A;  1SQV D;  5CIH B;  3X39 A;  1RZ6 A;  1A56 A;  1NML A;  1GQ1 A;  3RLM A;  3O1Y A;  2HV4 A;  1HZV A;  1DVV A;  3BCC D;  3WFE C;  4FAV A;  1W2L A;  2CXB A;  1AYG A;  1YIQ A;  1MG2 D;  1SQX D;  1E8E A;  3HQ8 A;  3WFD C;  2C1U A;  1KV9 A;  3ZOO A;  1N50 A;  1PPJ D;  2B10 B;  4UB6 V;  5DFS A;  1H31 B;  1DW0 A;  1OCD A;  1SQB D;  1AOQ A;  4WQC A;  3A0H V;  4KMG A;  3SJL A;  3TYI A;  4FAN A;  1A8C A;  4WQ8 A;  351C A;  1P84 D;  2C9X B;  1CHI A;  1C6O A;  5B5E V;  2ZZS 1;  3CWB D;  1LFM A;  4D6T D;  1H33 A;  1NTZ D;  1CNO A;  1RAQ A;  1WVE C;  2GC7 D;  1JDL A;  1I6E A;  1CIE A;  5CIB B;  1BE3 D;  5CIE B;  1NTK D;  3PXS A;  2DGE A;  3H1K D;  1NNO A;  3CU4 A;  1U75 B;  3L71 D;  2C1V A;  2CA3 B;  1HRO A;  1HRC A;  1QYZ A;  2FRC A;  2ZXY A;  1CRH A;  1U74 B;  1WEJ F;  3CX5 W;  4EIC A;  2LIR A;  1PP9 D;  2GC4 D;  1MZ4 A;  2YK3 A;  1CRJ A;  1KX2 A;  1CED A;  4AAL A;  1CTZ A;  1FI3 A;  3ZOY A;  1HH7 A;  4PW9 B;  1FOC A;  1NTM D;  2AXT V;  1ETP A;  1DT1 A;  1E29 A;  1H9X A;  1M6Z A;  1COR A;  1CYI A;  2N18 C;  4Q5P A;  1HZU A;  1L0L D;  1EZV D;  2AIU A;  3WFC C;  3PH2 B;  3CYT I;  3RMZ A;  5IY5 1;  1N90 A;  1CRI A;  3L72 D;  1IQC A;  5C0Z A;  1I8O A;  1S5L V;  1DIQ C;  5KAI V;  3VNW A;  3WU2 V;  5DJQ C;  4H0K A;  2V08 A;  5B6Q A;  4H0J A;  1CC5 A;  1CSW A;  3JBT B;  3SVW A;  3OA8 A;  2N9I A;  1KYO D;  2N18 B;  4JCG A;  1LMS A;  2V07 A;  1KB9 D;  1H32 A;  4RSZ A;  1DW1 A;  1L0N D;  3L75 D;  5CYT R;  2FYN B;  2PCC B;  1HJ3 A;  5DJQ B;  4PJ0 V;  1N9C A;  1F1C A;  4XXL A;  1DVH A;  3L4M A;  1B7V A;  1GKS A;  1NIR A;  2B0Z B;  3O0R C;  1IZL 0;  1CTJ A;  3M97 X;  1C7M A;  3NWV A;  4FA4 A;  3SWS A;  1SQP D;  4V2K A;  5AUR A;  2QJP B;  1LC1 A;  3NBT A;  1N15 A;  4PWA A;  4DY9 A;  3OA8 B;  1CIF A;  2BLF B;  1IRV A;  4GYD A;  1AOF A;  3ZBM A;  3H1L D;  5E79 V;  1CTY A;  3VRD A;  1H32 B;  1GJQ A;  1CO6 A;  2BH5 X;  2ZON G;  4U3F D;  3H1H D;  5TIS V;  1YTC A;  2C2C A;  5KLV D;  3D0W A;  1CRC A;  2I8F A;  2BPB B;  1CCR A;  2PAC A;  1R0Q A;  1KX7 A;  1BCC D;  4L3G A;  5DF5 A;  3DMI A;  3WC8 A;  4WQA A;  4XYD B;  1KIB A;  1W5C T;  3H1J D;  4WQD A;  4AAN A;  1FHB A;  1CXC A;  3NBS A;  5CIF B;  1DW2 A;  2CE0 A;  3HQ6 A;  2PCB B;  1YIC A;  2GB8 B;  2MTA C;  1H1O A;  5EXQ A;  1CHH A;  3C2C A;  2B11 B;  4WQ7 A;  1CXA A;  1CRG A;  1COT A;  2GIW A;  3HQ9 A;  2YIU B;  2VHD A;  1H9Y A;  1CYC A;  2D0S A;  3CP5 A;  5B66 V;  1HJ5 A;  2EXV A;  2IBZ D;  2ZBO A;  3PXW A;  1QL4 A;  4LJI A;  4O1Q A;  4GED B;  3L74 D;  1FI9 A;  3ZCF A;  1KYO W;  1CSX A;  5KLI B;  1BL9 A;  1CIH A;  1OAE A;  451C A;  3CXH D;  1L9J C;  1FI7 A;  1NMI A;  1GDV A;  2CA4 B;  155C A;  1YNR A;  4AX3 A;  4AAM A;  4FA1 A;  3KZI V;  2OZ1 A;  2YQB A;  3OCD A;  1M70 A;  2ORL A;  2MHM A;  2LIT A;  2DVH A;  1YFC A;  1F1F A;  3A9F A;  3DP5 A;  3H1I D;  1FJ0 A;  5GTH V;  3MK7 C;  1DW3 A;  1NU1 D;  1L9B C;  2L4D A;  2BGV X;  5CIC B;  3ORV A;  1ZZH A;  1I54 A;  2BCN B;  4K3I A;  1LC2 A;  3TGU D;  1E2R A;  4P4Q B;  3SXT A;  1GU2 A;  1C52 A;  1DII C;  3O20 A;  3A0B V;  1CIG A;  1YCC A;  1C75 A;  2FYU D;  3ZOW A;  3ZOX A;  2FWL A;  1C2N A;  1CSU A;  1A2S A;  1ZRT D;  4O1W A;  1S6V B;  1IO3 A;  3RN0 A;  1IRW A;  5C9M A;  4EIE A;  3ZIY A;  2C1D A;  3MK7 B;  1CYJ A;  1I55 A;  2OZ1 B;  1K3G A;  3PXT A;  3OCD B;  1AKK A;  4AAO A;  1HJ4 A;  1HCM A;  4L1Q A;  4PD4 D;  4FB1 A;  2N3Y A;  4IL6 V;  4WQB A;  2JQR A;  1CCH A;  4WQ9 A;  2BCC D;  1C2R A;  1SQQ D;  3O5C A;  4QAO A;  1QN2 A;  5CID B;  2ZOO A;  4Y5R A;  1CHJ A;  2N3B A;  1KB0 A;  1CSV A;  3L70 D;  1J3S A;  5KKZ B;  4FA9 A;  3DR0 A;  1LS9 A;  1FCD C;  5GTI V;  1EB7 A;  3WFB C;  1RAP A;  1MG3 D;  1BGY D;  2D0W A;  2C1D B;  2CE1 A;  4L3H A;  2B12 B;  3VYM A;  2XTS B;  2C8S A;  1YEB A;  2JTI B;  2YCC A;  5H2F V;  4UB8 V;  3CX5 D;  1M60 A;  1YEA A;  4J20 A;  3HQ7 A;  5KAF V;  3SLE A;  4MU8 A;  1I8P A;  1H33 B;  2AI5 A;  3RN1 A;  5CIG B;  2BH4 X;  1RZ5 A;  4N0K A;  4WQE A;  1I5T A;  1I6D A;  1QL3 A;  4EID A;  3L73 D;  3CXH W;  1C6R A;  4NFG B;  1VYD A;  3WUI A;  4FA5 A;  1C6S A;  1K3H A;  4EIF A;  1H31 A;  2QJK B;  1QKS A;  2B4Z A;  1CRY A;  2N9J A;  2QJY B;  4YE1 A;  2A06 D; 
#chains in the Genus database with same CATH homology
 1GIW A;  3L4O A;  1SQV D;  5CIH B;  3X39 A;  1RZ6 A;  1A56 A;  1NML A;  1GQ1 A;  3RLM A;  3O1Y A;  2HV4 A;  1HZV A;  1DVV A;  3BCC D;  3WFE C;  4FAV A;  1W2L A;  2CXB A;  1AYG A;  1YIQ A;  1MG2 D;  1SQX D;  1E8E A;  3HQ8 A;  3WFD C;  2C1U A;  1KV9 A;  3ZOO A;  1N50 A;  1PPJ D;  2B10 B;  4UB6 V;  5DFS A;  1H31 B;  1DW0 A;  1OCD A;  1SQB D;  1AOQ A;  4WQC A;  3A0H V;  4KMG A;  3SJL A;  3TYI A;  4FAN A;  1A8C A;  4WQ8 A;  351C A;  1P84 D;  2C9X B;  1CHI A;  1C6O A;  5B5E V;  2ZZS 1;  3CWB D;  1LFM A;  4D6T D;  1H33 A;  1NTZ D;  1CNO A;  1RAQ A;  1WVE C;  2GC7 D;  1JDL A;  1I6E A;  1CIE A;  5CIB B;  1BE3 D;  5CIE B;  1NTK D;  3PXS A;  2DGE A;  3H1K D;  1NNO A;  3CU4 A;  1U75 B;  3L71 D;  2C1V A;  2CA3 B;  1HRO A;  1HRC A;  1QYZ A;  2FRC A;  2ZXY A;  1CRH A;  1U74 B;  1WEJ F;  3CX5 W;  4EIC A;  2LIR A;  1PP9 D;  2GC4 D;  1MZ4 A;  2YK3 A;  1CRJ A;  1KX2 A;  1CED A;  4AAL A;  1CTZ A;  1FI3 A;  3ZOY A;  1HH7 A;  4PW9 B;  1FOC A;  1NTM D;  2AXT V;  1ETP A;  1DT1 A;  1E29 A;  1H9X A;  1M6Z A;  1COR A;  1CYI A;  2N18 C;  4Q5P A;  1HZU A;  1L0L D;  1EZV D;  2AIU A;  3WFC C;  3PH2 B;  3CYT I;  3RMZ A;  5IY5 1;  1N90 A;  1CRI A;  3L72 D;  1IQC A;  5C0Z A;  1I8O A;  1S5L V;  1DIQ C;  5KAI V;  3VNW A;  3WU2 V;  5DJQ C;  4H0K A;  2V08 A;  5B6Q A;  4H0J A;  1CC5 A;  1CSW A;  3JBT B;  3SVW A;  3OA8 A;  2N9I A;  1KYO D;  2N18 B;  4JCG A;  1LMS A;  2V07 A;  1KB9 D;  1H32 A;  4RSZ A;  1DW1 A;  1L0N D;  3L75 D;  5CYT R;  2FYN B;  2PCC B;  1HJ3 A;  5DJQ B;  4PJ0 V;  1N9C A;  1F1C A;  4XXL A;  1DVH A;  3L4M A;  1B7V A;  1GKS A;  1NIR A;  2B0Z B;  3O0R C;  1IZL 0;  1CTJ A;  3M97 X;  1C7M A;  3NWV A;  4FA4 A;  3SWS A;  1SQP D;  4V2K A;  5AUR A;  2QJP B;  1LC1 A;  3NBT A;  1N15 A;  4PWA A;  4DY9 A;  3OA8 B;  1CIF A;  2BLF B;  1IRV A;  4GYD A;  1AOF A;  3ZBM A;  3H1L D;  5E79 V;  1CTY A;  3VRD A;  1H32 B;  1GJQ A;  1CO6 A;  2BH5 X;  2ZON G;  4U3F D;  3H1H D;  5TIS V;  1YTC A;  2C2C A;  5KLV D;  1CRC A;  2I8F A;  2BPB B;  1CCR A;  2PAC A;  1R0Q A;  1KX7 A;  1BCC D;  4L3G A;  5DF5 A;  3DMI A;  3WC8 A;  4WQA A;  4XYD B;  1KIB A;  1W5C T;  3H1J D;  4WQD A;  4AAN A;  1FHB A;  1CXC A;  3NBS A;  5CIF B;  1DW2 A;  2CE0 A;  3HQ6 A;  2PCB B;  1YIC A;  2GB8 B;  2MTA C;  1H1O A;  5EXQ A;  1CHH A;  3C2C A;  2B11 B;  4WQ7 A;  1CXA A;  1CRG A;  1COT A;  2GIW A;  3HQ9 A;  2YIU B;  2VHD A;  1H9Y A;  1CYC A;  2D0S A;  3CP5 A;  5B66 V;  1HJ5 A;  2EXV A;  2IBZ D;  2ZBO A;  3PXW A;  1QL4 A;  4LJI A;  4O1Q A;  4GED B;  3L74 D;  1FI9 A;  3ZCF A;  1KYO W;  1CSX A;  5KLI B;  1BL9 A;  1CIH A;  1OAE A;  451C A;  3CXH D;  1L9J C;  1FI7 A;  1NMI A;  1GDV A;  2CA4 B;  155C A;  1YNR A;  4AX3 A;  4AAM A;  4FA1 A;  3KZI V;  2OZ1 A;  2YQB A;  3OCD A;  1M70 A;  2ORL A;  2MHM A;  2LIT A;  2DVH A;  1YFC A;  1F1F A;  3A9F A;  3DP5 A;  3H1I D;  1FJ0 A;  5GTH V;  3MK7 C;  1DW3 A;  1NU1 D;  1L9B C;  2L4D A;  2BGV X;  5CIC B;  3ORV A;  1ZZH A;  1I54 A;  2BCN B;  4K3I A;  1LC2 A;  3TGU D;  1E2R A;  4P4Q B;  3SXT A;  1GU2 A;  1C52 A;  1DII C;  3O20 A;  3A0B V;  1CIG A;  1YCC A;  1C75 A;  2FYU D;  3ZOW A;  3ZOX A;  2FWL A;  1C2N A;  1CSU A;  1A2S A;  1ZRT D;  4O1W A;  1S6V B;  1IO3 A;  3RN0 A;  1IRW A;  5C9M A;  4EIE A;  3ZIY A;  2C1D A;  3MK7 B;  1CYJ A;  1I55 A;  2OZ1 B;  1K3G A;  3PXT A;  3OCD B;  1AKK A;  4AAO A;  1HJ4 A;  1HCM A;  4L1Q A;  4PD4 D;  4FB1 A;  2N3Y A;  4IL6 V;  4WQB A;  2JQR A;  1CCH A;  4WQ9 A;  2BCC D;  1C2R A;  1SQQ D;  3O5C A;  4QAO A;  1QN2 A;  5CID B;  2ZOO A;  4Y5R A;  1CHJ A;  2N3B A;  1KB0 A;  1CSV A;  3L70 D;  1J3S A;  5KKZ B;  4FA9 A;  3DR0 A;  1LS9 A;  1FCD C;  5GTI V;  1EB7 A;  3WFB C;  1RAP A;  1MG3 D;  1BGY D;  2D0W A;  2C1D B;  2CE1 A;  4L3H A;  2B12 B;  3VYM A;  2XTS B;  2C8S A;  1YEB A;  2JTI B;  2YCC A;  5H2F V;  4UB8 V;  3CX5 D;  1M60 A;  1YEA A;  4J20 A;  3HQ7 A;  5KAF V;  3SLE A;  4MU8 A;  1I8P A;  1H33 B;  2AI5 A;  3RN1 A;  5CIG B;  2BH4 X;  1RZ5 A;  4N0K A;  4WQE A;  1I5T A;  1I6D A;  1QL3 A;  4EID A;  3L73 D;  3CXH W;  1C6R A;  4NFG B;  1VYD A;  3WUI A;  4FA5 A;  1C6S A;  1K3H A;  4EIF A;  1H31 A;  2QJK B;  1QKS A;  2B4Z A;  1CRY A;  2N9J A;  2QJY B;  4YE1 A;  2A06 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...