3KZZA

Crystal structure of snap-tag bound to its substrate benzylguanine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
158
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPAHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SNAP-tag
total genus 46
structure length 158
sequence length 176
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzzA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzzA01
3H3ZA 3U1DA 5KVRA 1HKQA 4M71A 4BNCA 3EQLF 3KFWX 4KFCA 3ZPLA 1SFEA 3BJ6A 1YYVA 5ILVA 4RGRA 3BPXA 4FX4A 1TQIA 2GXBA 2EK5A 3K1PA 3T8RA 5DD8A 1G3TA 3QP5A 4FT8A 4XLPF 4QWQA 2HZTA 2GA1A 1W7PA 2P8TA 4UXNA 3KLNA 1REPC 4XSXF 5A2QZ 5K1YA 4ZYEA 1UFMA 2FXAA 3IC7A 3VOEA 2QUFA 1C0WA 1B6AA 3WE2A 1JXSA 2ZMEB 4U0YA 5JVTA 5FD5A 4IHSA 2V1DA 1BM9A 1SD7A 2W24A 2RN7A 1SD6A 2F2EA 4CYDA 1QZZA 3F3XA 3R6SA 4D0PA 1YO5C 2MC3A 4UVCA 2ZBKA 1E2XA 3MCZA 2ZMEA 4OIPF 1D8JA 2Z99A 3PFIA 4KMFA 1XDSA 2R7FA 2XAHA 5JFRA 3KEQA 2Z9OA 2L3DA 2VN2A 5HLGA 2HYGD 1WRJA 3RPUA 1D5VA 3BJAA 1H9TA 5DUIA 3E5QA 4KN4X 2FMYA 3KP6A 3WTXC 4MEXF 1PP8F 4AWXB 3BROA 3V4GA 4LK0F 2WWYA 1J2XA 4GXOA 3KP3A 4CGZA 3I53A 2H94A 1R22A 1U2WA 1YIOA 4GYIA 2CFXA 2CSOA 2MA3A 2FBHA 4A6DA 1R58A 3CTAA 4UNOA 2TDXA 4G7OF 1P4XA 2J5PA 1O3SA 4DNCA 1I1GA 3KP4A 4EVIA 5DUKA 2XKPA 4Y17A 1XSXA 4OU0A 3ML6A 2HTSA 5H6QA 4AIJA 2DPDA 2FBIA 2GIVA 5HVQC 5H20A 3K0LA 1XMAA 3TO6A 5L3DA 4RAYA 4CHUA 1HBXG 1RZ4A 3RI4A 4U0VA 2BE5F 2QVOA 5ICGA 2RGVA 2M45A 5LGUA 1USSA 3JTHA 4G9YA 3M8FA 1XMKA 1YW9A 3GZ6A 3V8KA 2FEZA 2DAOA 5D4RA 2G7HA 3GVAA 1HW5A 3GFMA 1BI3A 1FPQA 2AS5F 3DP7A 2HEOA 1G3YA 1MDMA 3MEXA 2UZKA 4BQAA 1S8NA 3C18A 4PGGA 1JHFA 2FSWA 4M6YA 1YS6A 4A5NA 3CUQB 1I1SA 1W5TA 2XROA 3I59B 1DPUA 2M30A 1OKRA 3SZTA 2DBBA 4HF0A 2UWMA 4XSZF 1F5TA 4M9ZA 1FYLA 4IJAA 3L9FA 2FE3A 1J59A 4YIFA 2EJRA 3KZZA 4ESJA 2HYFA 2K4BA 2IPQX 4WXDA 1IN5A 3N4MA 4ON0A 4IHTA 3I5UA 2WC2A 1OR7A 1V4RA 4GCVA 4UHTA 3N97A 4HBLA 2NRAC 5D8LB 2ISYA 1TTYA 4KICA 5DEQA 1WSUA 1ODDA 4IXAA 5E20A 2STTA 3ELKA 1XGMA 1Y0UA 2HOEA 3GYHX 2FU4A 1S6LA 1WQ2A 3K1NA 2FRHA 4OINF 3ZMVA 1LDJA 2V9VA 3RKXA 2G9WA 2EFWA 4ENNA 4YFXF 2PJPA 3TOBA 4L0YB 3GF2A 4HX7A 1ZG5A 1IXRC 2OQRA 1OYYA 3RIRA 2VBZA 2FF4A 1IXSB 2CG4A 2VT2A 3HTUA 2IA0A 2K7LA 2BV6A 3WTZA 4YFKF 3HYIA 4IVNA 2XVCA 2LNBA 1WKMA 3O3KA 4WX9A 3E5XA 1ONVA 4G6QA 1XSDA 2DTRA 1WI9A 1FBSA 1HW2A 5JHUA 5K5RA 1Z6RA 2RVCA 1FWZA 1XB4A 4MGRA 4HOBA 4EM1A 3OOPA 3CJNA 2DU9A 1FNNA 1MGTA 1FX7A 1BN5A 2DT5A 1U3EM 3LAPA 5ILUA 4LK1F 4M72A 1A04A 1ZGJA 1LNWA 3WGGA 5ILSA 4OIOF 4LLGF 5JI6A 4A12A 3KLOA 1O7LA 4LD5A 1MJ9A 3BWGA 3F8BA 5JR3A 2QQBA 3GFIA 2R3SA 2M8EA 3BY6A 1IUYA 1BI0A 2V6CA 1CGPA 4G8XA 3E5UA 1IRGA 4EGYA 2PFBA 2RV8A 4HLXA 4JBAA 5F64A 2IA1A 3TKYA 4L5JA 2LF8A 3F72A 2O03A 2ETHA 2FOKA 2L4MA 4BXUA 2EFQA 3HRSA 3NQOA 3GX4X 2XAQA 3HRTA 3K69A 1Q1HA 1KU7A 3FHZA 1TNTA 2HFHA 2K02A 4KN7X 2A6EF 2QYOA 3E3VA 1VTNC 4PGHA 3K9TA 3ROUA 1FBUA 4KIGA 3SQNA 1KGSA 6PAXA 1F9NA 1ZLJA 4HQEA 2ZNYA 2P5VA 1U78A 1BI1A 4O6JA 4BHCA 3I54A 2RNJA 2Z33A 2Z5UA 4IRGA 2KIMA 4KMUX 1I6XA 4Y13A 3T1BA 4EJTA 4HV5A 5LEKA 3FXRA 4M9SA 1RUOA 4WCGA 4EJOA 3ABUA 2NNYA 2CWEA 2DQRA 3KP7A 2A68F 2DW4A 2AXLA 2Q2EA 5AIQA 1K6OA 2JZYA 3LQRA 5ICFA 2ISZA 4WK8F 2H6BA 2ADUA 2MBFA 5DCMB 2E7WA 4RGSA 4F7ZA 3MWMA 3TO9A 1J9IA 1H0MA 1ULYA 3T5XA 1MJBA 5DD4A 3TDZC 1B9NA 3FM3A 3BDDA 4ZYDA 1XGNA 5FFXA 5CVIA 1GHCA 5LRSA 5J8CA 4U7DA 1EH7A 4KIFA 3IRQA 2DK5A 1UCRA 4M9XA 4HX8A 5BPIA 4A5MA 3RKYA 3CDHA 2HTJA 2P7CB 1IF1A 1SFUA 2QZ8A 4GO1A 4L9NA 3ZMTA 1TLHB 1ZAOA 2VC0A 4MQVA 1JHHA 5BPDA 3H3UA 2EV6A 2IA2A 1ZG1A 3FX3A 3R0JA 1S7OA 2D2WA 3FXUA 4UV8A 1D8KA 2OAZA 1FBQA 1QGPA 4FX0A 1U5TA 2XHKA 1YLFA 3MAJA 3IKVA 4ESBA 4ENJA 3JAMZ 4U88A 3P7NA 3C3WA 5L3GA 3G3ZA 2D1VA 1DDNA 4HDUA 2O8XA 5FO5A 3CUOA 4LMYA 2RDPA 2ZXJA 2A6HF 3HHHA 2GQQA 4KT5C 2XKOA 1IW7F 1FC3A 2E1CA 3DPTA 2CQKA 1LEAA 5CVUA 3KE2A 5IT9Z 1RI7A 1MD0A 1LEBA 3WTSC 3DPLC 3CO7C 1ZREA 3VB2A 2YSRA 3F8MA 2OD5A 3RPQA 3L7WA 2W84A 5FLXK 1UB9A 1KYWA 1SMYF 2W25A 3CO6C 1KYZA 1R23A 4A0XA 1TQPA 3BP8A 5CVJA 1JGSA 1L3LA 2LDUA 3JTGA 2V1XA 4HF2A 2F5CA 1K7AA 2J5OA 1CF7B 1MZBA 3J7AO 5E18F 4FHTA 2KRFA 2JPCA 4IF4A 4A0YA 3K2ZA 3Q5FA 2QENA 5EEGA 1R00A 3HRMA 3I0TA 3QU6A 5ED4A 3LQQA 3WG9A 1W4MA 4LGWA 4G7HF 5E8IA 2L02A 4S05A 3F8CA 4BHBA 3DXJF 5D8KB 3BJOA 3TDUC 1ZRCA 1RIOH 5DYMA 1KA8A 5D5WB 1ZGAA 3KETA 3RJPA 2NAZA 4P55A 1UHWA 1USTA 1W7PD 5D5XB 2Y0MA 4A6EA 2VT3A 1EH8A 1XCVA 3C7JA 1EH6A 2KIUA 2VBXA 1I27A 1QO0D 2BYVE 3GLXA 4M6XA 4XRFA 2MH2A 3TQNA 5LHHA 4LG0B 1IRFA 2HQRA 4CZZA 1J5YA 4YFNF 4KIBA 1TNSA 2OZUA 1V3FA 3VFZA 1IN6A 5EEHA 4IRIA 4I0AA 3L2CA 2PN6A 1ZH5A 4UVBA 2B0LA 2P4WA 3IL2A 1I5ZA 2XAFA 1ZLKA 4LG0A 1TW3A 1ZARA 2XUBA 1YG2A 1X3UA 3EETA 2XAGA 2LSOA 3RYPA 1R1TA 3IWZA 2VC1A 3ZMUA 4KDPA 1XGSA 1KQ8A 3WGHA 1F4KA 5HDGA 2K27A 1ZHFA 5LBQA 2YX7A 3J80Z 1S29A 2X0LA 5CYVA 4PZJA 3I58A 4MEYF 3WTWC 1U6GA 1T6SA 3FMQA 1HXDA 3ECHA 3HTSB 2CO5A 3ISPA 3WE3A 1Z91A 3R4KA 4AD9A 4O5VA 3LA3A 5J8FA 2DK8A 1YTYA 4I01A 3EYIA 1HKSA 1T39A 2CW0F 2HDCA 3E6DA 1OYWA 1S3JA 2HR3A 3I59A 3F6VA 2JPBA 3LWFA 4KYWA 3BOQA 5A2QK 4GGGA 3TO7A 4N9IA 4WWCA 3RTRA 1BC8C 2FQ3A 3MQ0A 2HKOA 1E17A 3S2WA 3I4PA 5LEJA 1HKTA 4Y15A 1SFXA 4OMZA 1J0RA 3LSTA 4I09A 5CJ9A 3HOSA 2M87A 3SZPA 4BH9A 3QP6A 1W5SA 2EFOA 3W6JB 3FMRA 2DI3A 3M9AA 2YU3A 3TGNA 3HIFA 3HRUA 5J6XA 4G6DA 5DV5A 3HSEA 4KUMA 1S7AA 1IN4A 3QOPA 5L3FA 4LLLA 1XDUA 4U7BA 1IXCA 4ETSA 1PDNC 1J7KA 4ENMA 3E6BA 3WODF 2W57A 4G94A 1L0OC 1HQCA 3JW4A 2EB7A 3ZN0A 3ZQ7A 1ZRFA 2FNPA 2QWWA 1YS7A 5E1WA 3P9CA 4HV6A 3GWZA 4K2EA 5LRRA 4I98B 1ON1A 2XRNA 3V7CA 5BMZA 2XAJA 2MD5A 3F6OA 3L09A 2FNAA 3LA2A 1WWXA 2HKXA 2UXNA 3E97A 2XASA 1P2FA 3WTTC 1STZA 3TOAA 2L01A 3COAC 3ZN1A 1K78B 4E70A 2OU2A 3WU1B 4L9JA 1B9MA 4N9HA 2GXGA 4EM2A 3GXOA 4GYGA 3WTUC 2PMUA 4BAYA 1Z1DA 3LFKA 4XLNF 1Z9CA 2O3FA 4B8XA 3J81Z 2X4HA 4RAZA 4YG2F 2HWVA 2G7UA 4P9UA 3I64A 3QPTA 1OYIA 2D1HA 4HX4A 1XGOA 1G3SA 1YQAA 2IW5A 4AIHA 2A07F 5FFZA 5FLXZ 1KU2A 5DDGA 1IAWA 2EFPA 1XCBA 3GFLA 3HSFA 2EV0A 3R0AA 2EFNA 2ZCWA 2VONA 2QBYA 3R61A 1R5HA 2NNNA 4KNYA 2BGCA 3GW2A 3ULQB 2GWRA 4I7HA 2L54A 1NHAA 2YPRA 1ZN2A 1GVJA 1CF7A 3DV8A 3FXQA 1TBXA 3E6CC 2R7DA 4L9VA 3KP2A 2RQPA 2MLKA 4WXCA 1BIBA 4HW0A 3L00A 5AONA 4ASNA 1O7FA 2ESNA 2E7XA 2KJBA 2BEOA 3JSPA 4BYYA 1IN8A 3ABTA 4LJZF 2O0YA 3F22A 2Q0OA 4R8HA 2C6YA 5BS6A 3VODA 4HA8A 2QQAA 3V7SA 2PLYA 3WGIA 4HZFA 1SMTA 1MJAA 2H09A 3SFZA 2STWA 2O6GE 5HS8A 4O3MA 3KZYA 5DCMA 5D5UB 2OA4A 3JSOA 2YR2A 4PCQA 1RNLA 3HOTA 1FY7A 3F21A 1QNTA 1TW2A 2CYYA 4DQ2A 2ZO4A 3V8JA 3CUQA 1BI2A 5L3CA 3M7GA 3IWFA 3V8LA 4KA4A 4HF1A 5L3BA 4TV7A 1OMIA 2H27A 3SXYA 5K5OA 2XGXA 2HQNA 1FYKA 2RC4A 4QLCU 4ZH4F 2FBKA 1SAXA 1H9GA 1FLIA 4IPAA 5D5VB 3I71A 2ZNZA 3F23A 2O61A 1OPCA 4MNUA 2EA4A 2A3SA 4RB3C 3NEUA 3CLOA 1HSJA 2L4AA 4MTEA 3FZVA 3VEPA 2EV5A 2DO7A 2EA2A 2OQGA 4BHPA 3NRVA 2VOOA 1HSTA 2P6SA 4HYEA 1P92A 1BJAA 4N0BA 1YW8A 3ZMZA 2PMHA 2K4JA 2JTVA 2PI0A 5H6RA 1F1ZA 3RYRA 1IN7A 2F5EA 1R5GA 4ENKA 3H92A 4ZYGA 5LHIA 1DUXC 3KEOA 3IHUA 4RS8A 3J81K 5HS9A 3EDPA 4EM0B 3B02A 3DEUA 1GXPA 2V1UA 2W85A 3J80K 4M73A 2Y48A 2XV4S 4RGXA 3E6MA 2MH9A 5HS7A 3ERED 2YX4A 4OIQF 3T8TA 2OZ6A 1P4AA 3FM5A 1FP2A 5ERIA 1PP7U 2ELHA 1K78A 1U5TB 3WTVC 5LGTA 5HDNA 2GZWA 3QPHA 2NS0A 5BOXA 2ESHA 1P4WA 4EJVA 5LGNA 2PQ8A 1QBJA 3HUGA 4UUVA 2XIGA 3DFGA 2KIFA 3M8EA 3WU0A 1J75A 3Q9SA 4P9FA 4UV9A 3D5LA 1U8RA 1Z7UA 5CVRA 5TRDA 1T98A 3ZMDA 3AAFA 2A5YB 4CXFA 3FWEA 1G6NA 5HLIA 2GA2A 1O3QA 4ZYHA 5E8GA 2RKHA 5E1ZB 2VBYA 3PQKA 1BIAA 3EYYA 1U5TC 2Q8KA 3MZYA 2CGPA 4JK1X 1BBYA 4RB2C 2M5WA 1FOKA 1XD7A 2DLLA 2H6CA 3MZHA 1Z05A 4A0ZA 4RB0A 1LDKB 2F5FA 1ON2A 4U0WA 2PG4A 5AIPA 5FB2A 1BC7C 2IRFG 4L5IA 2IJLA 3U9GA 1Z6TA 4HLYA 2VODA 2FMLA 4LB6B 4MHGA 4I0BA 3MFKA 2KJCA 3T0YA 2JRTA 2VXZA 3EUHA 1KU9A 4HDVA 2JSCA 3O6BB 1SD4A 4XBFA 2M1BA 4S04A 1R7JA 3G73A 4MQ9F 1FSEA 4OMYA 3REOA 1KQ9A 3FMSA 4Q4ZF 4MTDA 1G3WA 3W6KB 3GUDA 4M74A 4PDKA 3LAJA 3M1EA 5L3EA 3LA7A 5F6FA 4CICA 3RKWA 1XSVA 2P5LC 4I02A 4EV0A 1B59A 2PBIA 4IRHA 5D4SA 1QPMA 2JT1A 1T2KA 3ZMSA 1K79A 3GZ5A 2P5KA 1YFHA 2DFIA 3KCCA 3DKWA 4HQMA 1QQIA 2QQ9A 4CO8A 2Z3YA 1R1UA 2WTEA 4R1HA 3ECOA 2HGCA 3DQVC 5ICEA 4OIRF 1BOAA 5K5QA 4Q47A 1O57A 5CLSA 5HDKA 2QM3A 3D0SA 2P6TA 5FD6A 3F8NA 4EMSA 1FYMA 1MDMB 4EJUA 1O3TA 3DF8A 2QLZA 1MKMA 2V79A 4Q5SF 5HOOA 1JE8A 4EQQA 5LHGA 2MLGA 3IRRA 1B1BA 3P9KA 4AIKA 2UXXA 5D6EA 3R60A 4P96A 5D6FA 4LLNA 4Q48A 5IT3A 3C1DA 4LB5A 3PQJA 2LF7A 2ZKZA 5CVVA 4LFUA 3B73A 4ZZDA 4OOIA 3F8FA 1LB2A 1AWCA 4NB5A 3WTYC 2COMA 2A69F 3QRFF 3HSRA 1LVAA 3BPVA 1O3RA 3GFJA 4NHJA 1R36A 1IZ1A 1LQ1A 1FP1D 4H0EA 5E17F 3SHFA 2HS5A 1D3YA 2OBPA 1W7PB 2FA5A 1HW1A 5TJJA 4L0ZB 4AVPA 1B4AA 1FSHA 2D45A 4I2OA 3O2PE 4YIIA 1FT9A 1DP7P 2BBYA 5DCFA 3FF5A 3QU3A 1T0FA 2VBWA 2DQLA 1LJ9A 1UHMA 3BZ6A 4G7ZF 1KU3A 2E1NA 1ZG3A 4EGZA 4NQWA 3Q9VA 4WF2A 1ZYRF 1ZRDA 1GXQA 1P6RA 4RB1A 2EWNA 2VE8A 1EV7A 4B09A 2QBYB 1AOYA 1XN7A 4CDGA 3RDIA 5F1RA 4R79A 2F5DA 1RUNA 3QAHA 3GEZA 5FGMA 2P7VB 3K1MA 1DPRA 2KKOA 4UVAA 1R1VA 5BQTA 4JQFA 3P9IA 2LKPA 2A61A 4RGUA 4ZZLA 2Y75A 3IKTA 2IVMA 2VE9A 1KQ0A 3HHGA 4Z2YA 2VOPA 2GAUA 4EJWA 5IT9K 3U2RA 1SD5A 4ESFA 5E1XA 2K86A 2WV0A 4L18B 5KK1A 1FZPB 4WXHA 4L9TA 2ACJA 3GO5A 1QZYA 3ZP5A 3KP5A 3CUQC 1PUEE 3JAMK 1YW7A 3OV8A 4P5OA 1G4DA 2IT0A 1T38A 1TQMA 2ZFWA 2NYXA 1LDDA 5ICCA 2PEXA 2ZJ2A 4A2UA 3V7RA 2IP2A 4HAMA 2DPUA 5HLHA 5LLQA
chains in the Genus database with same CATH superfamily
2FQ4A 4C2TA 3H3ZA 5J4YA 3MHHC 1RC7A 1A1IA 3U1DA 2X1DA 5KVRA 1HKQA 2EN3A 4M71A 5B1AH 4BNCA 3NWTA 3K10A 1HCRA 3EQLF 3KFWX 4KFCA 1OCRH 3ZPLA 1IC8A 3LFUA 3W2WA 2FV4B 1SFEA 2NS7A 4BE1A 1VQ4I 3BJ6A 1YYVA 5ILVA 1P7JA 4RGRA 3ZR8X 3BPXA 4FX4A 3JRIA 2LY9A 1TQIA 2GXBA 3BG7A 2DDAA 2EK5A 4O4KA 2KDZA 3K1PA 1A31A 3T8RA 5DD8A 1KONA 1G3TA 1R49A 1YX5A 3QP5A 5J47A 2W4SA 4BBRJ 3AL0C 4FT8A 4PJMA 5HNHA 1HNWE 4XLPF 4QWQA 1X1AA 2HHHE 2HZTA 2XPVA 4JI4E 4HSTA 2GA1A 1W7PA 2P8TA 4UXNA 1XNRE 5F1JA 2FUG2 4IHYA 3C2GA 3C6KA 3KLNA 1REPC 5IP6A 4RLFA 4XSXF 2ZXWH 5A2QZ 4GEQB 2RAEA 5K1YA 3ONQA 3RZOJ 5BR8E 4WFTA 4DKKA 3OSGA 3VYYA 4ZYEA 2LRDA 1UFMA 2FXAA 3IC7A 3HB9A 3ADLA 3VOEA 2QUFA 3ABKH 3VPRA 4DBQA 4D1QA 1C0WA 1XTAA 1B6AA 3WE2A 2EILH 3BR6A 2YTIA 2MFZA 4IOCF 2EPFA 3JRBA 1TWFJ 3ZQGA 3RKQA 1JXSA 2ZMEB 1FTZA 1AH5A 4U0YA 2CUZA 5JVTA 5FD5A 1W1WE 4IHSA 2V1DA 5EZHA 1F2IG 2EIMH 1BM9A 1SD7A 2W24A 2RN7A 3OR1C 1SD6A 2L6MA 2F2EA 4UY8I 4CYDA 1QZZA 3F3XA 3R6SA 4D0PA 1U0JA 2VIXA 1YO5C 3BT9A 2MC3A 4LFAE 4UVCA 2ZBKA 1E2XA 3MCZA 5IOZA 1W0TA 2X51A 2ZMEA 4OIPF 3K4JA 1D8JA 2Z99A 2ME6A 2M0MA 3PFIA 4DBRA 3D5RC 1MMAA 4KMFA 4B3XA 1XDSA 2R7FA 2XAHA 5JFRA 3KEQA 2Z9OA 2L3DA 2VN2A 5HLGA 2RS6A 4GDFA 4Y52J 1QVTA 1WRJA 2HYGD 2E1MC 3MN2A 3RPUA 1D5VA 2MC4A 3BJAA 1H9TA 2BW3B 4DV2E 1OISA 5DUIA 2GHFA 4CCLA 3E5QA 3GTKJ 9ANTA 4KN4X 2NS8A 2FMYA 3KEYA 4CYCB 4ITVA 3KP6A 3WTXC 4MEXF 2DB2A 1PP8F 1Y39A 4AWXB 3BROA 2JA7J 3CD6I 3PSIA 1FJGE 3CDIA 3DBLB 2NOJB 2LK2A 3V4GA 4LK0F 2WWYA 1W36C 4XLCA 1A1GA 2EMGA 4XNFA 2IXSA 1WHQA 3NAUA 1WGXA 3FDYA 1J2XA 2VXDA 2EBIA 4DR2E 4GXOA 3CC4I 3KP3A 4MO7A 5GPAA 3I53A 4CGZA 1ITYA 2A05A 2H94A 5M3MJ 4C9YA 4JX6A 3PO3J 1R22A 3DWLE 1U2WA 2L7MP 3BCBA 5FKNA 4WPYA 1YIOA 2BY3A 3ZOBA 4GYIA 2CFXA 2CSOA 1X4PA 2MA3A 3OS0A 2FBHA 3OWTA 4A6DA 2JRMA 1R58A 3CTAA 3OYBA 4UNOA 2TDXA 1V5FA 5JVGF 1P4XA 2J5PA 4E7SA 1O3SA 4DNCA 4G7OF 3HOZJ 3CJTB 4M30A 1I1GA 3KP4A 3GCMA 4W97A 4EVIA 2VUMJ 2COBA 2XKPA 5DUKA 1TL8A 2DMTA 1MBHA 4Y17A 5FRMA 2HGHA 1YYOA 1XSXA 4QPOA 1E3OC 3BR0A 3BF2A 4OU0A 3ML6A 4DV0E 2L92A 5TISC 3AG2H 4Y3OA 2O9LA 2GOMA 2HTSA 4C3HJ 4F93B 4NC6A 5H6QA 4AIJA 2DPDA 2FBIA 2GIVA 2DA4A 5HVQC 3P5JA 5H20A 1PKPA 3K0LA 1XMAA 3TO6A 4XMYA 2E2HJ 5L3DA 4RAYA 4CHUA 1HBXG 5F0FA 1RZ4A 3S93A 3RI4A 4U0VA 2BE5F 3BR3A 4BC9A 1VI0A 2QVOA 4B1RA 2CQNA 1T0FC 5LMNE 5ICGA 2RGVA 2OF7A 3FK7A 1MMNA 2E35A 1E3PA 1I94E 1QHGA 3L2RA 2D5VA 4R2CA 2M45A 5LGUA 1USSA 3JTHA 4G9YA 4B3ME 3M8FA 1VQ9I 1XMKA 1YW9A 4DV5E 2M8GX 4IHWA 3GZ6A 3G71I 3V8KA 1BR2A 2FEZA 2DAOA 5D4RA 2G7HA 2JSPA 1ZK8A 2L9SA 3S14J 2LR8A 1JK2A 2LTPA 3GVAA 1HNXE 1HW5A 3GFMA 1TWGJ 4IEJA 1MNDA 1BI3A 1FPQA 1NG7A 3FBNB 2AS5F 2EPMX 3DP7A 4XRMA 1PUFA 3DLLF 1DU0A 3DU5A 1G3YA 2HEOA 4QPQA 1MDMA 1ETWA 2HYJA 3M99B 3MEXA 2UZKA 4BQAA 4O24A 1S8NA 2EE8A 3C18A 5K7HA 2XAUA 1U8BA 2DA6A 4XICA 3GMEA 1RQ0A 1VQMI 3K4KA 1IV8A 1A1JA 1X5WA 2I13A 5GPCA 3DKXA 2EWLA 4PGGA 1FMWA 3OYKA 1HA8A 4IO9F 5KCMA 4RAGA 2XGEA 3OTOE 2M0CA 2IGNA 1T56A 2AHQA 1JHFA 2VQLA 3D5SC 5CFFE 2V1NA 2FSWA 1XNQE 2JYAA 4HG2A 4DZPA 2NOGA 4XONA 2ZMEC 2B3TB 4M6YA 1YS6A 1IJWC 4A5NA 3K70D 1WJAA 3CUQB 2BBGA 2EZHA 1I1SA 1GV5A 1FIPA 3I3LA 2CSHA 2MG4A 2EPPA 1W36D 4V19K 4A69C 3S2HJ 1WHUA 3SJMA 5M5WJ 1W5TA 2XROA 3VK6A 3I59B 3GTGJ 3TEDA 1DPUA 2EMLA 2NVTJ 5E79C 2M30A 1OKRA 3SZTA 4D7NA 1EA3A 4NQWB 1R71A 2DBBA 2EM5A 4HF0A 2UWMA 2JK3A 4XSZF 1F5TA 2PRTA 4M9ZA 1FYLA 4IJAA 1I39A 2LKXA 3L9FA 2FE3A 1YRNB 1EF4A 1TN9A 4B47A 1KYQA 1J59A 4YIFA 2V88A 2HI3A 3ZCOA 2EJRA 3BR5A 3BG5A 3KZZA 4ESJA 2HYFA 2R92J 2K4BA 2IPQX 3U1KA 4WXDA 1IN5A 2L0KA 4FE4A 2EPXA 2L9NA 3N4MA 4ON0A 2ELJA 2KHMA 4IHTA 3I5UA 2WC2A 1OR7A 1V4RA 2R5YB 2PJRA 5IYBJ 3L2WA 2TRTA 3HG9A 4GCVA 4UHTA 3N97A 2E72A 2EZ6A 4HBLA 2HVQA 4BJ6C 1R4NB 2Y0SA 2NRAC 5D8LB 1TT5B 3AG1H 2ISYA 4BY7J 2ZSIB 1RMDA 1MW7A 1TTYA 1T33A 1MBFA 4KICA 2DFHA 5DEQA 1WSUA 1ODDA 2VE7C 4IXAA 2ZSHB 5E20A 1WH7A 2DA7A 2STTA 2FX0A 3K4LA 3ELKA 1XGMA 1Y0UA 2HOEA 3ZRGA 3TQMA 3GYHX 4X8WA 1BW5A 2FU4A 1S6LA 3MKZA 1WQ2A 3K1NA 3A0HC 2FRHA 3LNQA 4C3JJ 4BUPA 4OINF 3CCJI 3ZMVA 1LDJA 2V9VA 3RKXA 2G9WA 4D7MA 2EFWA 4ENNA 3ZOQB 4GKKE 4YFXF 2YUSA 1PDAA 1U9OA 1N36E 2LH9A 2PJPA 1S5LC 3TOBA 2HZDA 1YUIA 1J09A 5F0HA 4L0YB 4RMNA 3GF2A 4HX7A 2EMBA 1AAYA 1ZG5A 1EKZA 4BEHB 2E36A 3BR1A 1UILA 1IXRC 1YE9A 2OQRA 1OYYA 2CRGA 2WV1A 2MSYA 3HPGA 3H9QA 5FKKA 3RIRA 4TUGA 2OCEA 3WHBA 2VBZA 2VJIA 1B72B 2FF4A 2BHZA 4CYCA 1X1BA 2HOAA 1IXSB 2CG4A 3I56I 5FLXC 2E60A 1G2HA 2WAEA 2VT2A 2VF1A 4FETA 1NK2P 3HTUA 1B8IB 3M4OJ 3GTMJ 2IA0A 5GTHC 2DGCA 4G12A 2A6TA 2J7JA 2V85A 4I8OA 1XMXA 2K7LA 3E7LA 2BV6A 2EIJH 4II2A 3JREA 4FISA 4BXFA 4HTGA 3S1RJ 3WTZA 3IV5A 4YFKF 4M3DA 3EPZA 3HYIA 3VSLA 4IVNA 2X6WA 2XVCA 1YJNI 2F4IA 2LNBA 3RQIA 2EN8A 2ENCA 2ZM6E 1WKMA 3O3KA 4JI3E 4WX9A 4P7DA 1OCTC 4OAZA 3E5XA 1ONVA 2YTFA 5IY5H 4YY3E 2L7ZA 4G6QA 1XSDA 3P1XA 1WH5A 3HZJA 2RSIA 3SEQA 3OS2A 4Q35B 1MBKA 2DTRA 4A3EJ 3HOVJ 1TWAJ 4R2QA 1WI9A 3FXJA 4X65E 1FBSA 1HW2A 5JHUA 4LITA 5E3OA 2Y9ZA 1F43A 5K5RA 3RMPA 3H35A 1PUFB 3EQ1A 2NVUB 2QF7A 1Z6RA 1D1CA 2JXPA 1X2MA 3HC7A 2RVCA 1FWZA 3MVPA 1UZCA 4E6KG 1XB4A 1AKHA 3BC8A 1VQPI 1VFCA 4MGRA 4HOBA 1RKWA 2XDVA 4EM1A 3AKZA 4E7JA 3OOPA 1LFUP 2VKEA 2ELYA 3CJNA 3SDGA 1DI2A 2DU9A 1FNNA 1VF9A 4XKCA 1MGTA 5E3NA 1FX7A 4BJTA 1BN5A 2M7QA 3EPJA 2DT5A 1U3EM 2GPIA 3LAPA 3KYDB 4A3IJ 2QSHX 3PSFA 5ILUA 4MIMA 3Q0WA 4LK1F 4M72A 1N34E 2ELKA 3DTIA 5DNYA 1D5YA 1NG6A 2EOFA 1A04A 4OWRB 1ZGJA 1LNWA 2L2OA 3WGGA 2EMYA 5ILSA 4OIOF 1VZ0A 4FCYA 4LLGF 1IBKE 5JI6A 3CMEI 4A12A 2O7OA 2DA3A 2L7FP 3KLOA 2L3JA 3LSPA 1O7LA 4LD5A 3J81C 1MJ9A 3VHTB 3BWGA 2UXBE 5LL6R 3F8BA 5FKOA 4DR7E 5JR3A 2EZKA 2VQGA 2QQBA 3GFIA 3S3MA 2R3SA 1PJSA 1O4XA 2M8EA 2XB5A 4B48A 4CH7A 3VYUB 2H1KA 3BY6A 4XORA 1IUYA 1BI0A 1GQEA 2V6CA 2ZXIA 1CGPA 2E5LE 4G8XA 1YUJA 2CT1A 1R5ID 3E5UA 2MKNA 1D1BA 1IRGA 4AC0A 4EGYA 1V5GA 1VNDA 2IGOA 2PFBA 2RV8A 4HLXA 2K4VA 1WFXA 4JBAA 1YX3A 2AXTC 5F64A 3HOUJ 2L5QA 2IA1A 3TKYA 2JP9A 1BR4A 3FKIJ 4L5JA 2JA8J 2WBSA 2ZC2A 2LF8A 2LUPB 3F72A 5FKLA 2O03A 5B3SH 4X62E 1LUJB 4X6AJ 3C4BA 4JYAE 4GRIA 4KISA 2YU5A 2ETHA 3VYSB 5GAHJ 2FOKA 4D5CA 1HNZE 3Q3SA 2L4MA 4BC7A 2WAFA 4BXUA 2EFQA 3HRSA 2BXYA 3NQOA 3GX4X 1A1KA 2XAQA 3LSIA 3HRTA 3K69A 1Q1HA 2OUMA 1KU7A 3FHZA 1TNTA 1DGWY 2HFHA 4BDZA 2K02A 5EEAA 2HJJA 3HXLA 4KN7X 1A1FA 2QYOA 3OMLA 3E3VA 1VTNC 1V54H 2YSPA 2IHR1 2LJUA 2A5WA 2CTDA 2E1MA 4PUSA 2DDBA 2R7SA 4PGHA 3K4BA 3K9TA 4E7KA 2EPCA 4DUZE 3ROUA 4KZSA 2ENHA 5J1YA 1FBUA 2ZJPF 4KIGA 3SQNA 2E2JJ 1KGSA 3LSKA 4JP0A 6PAXA 3JCUC 4DR1E 1F9NA 1ZLJA 4DYCA 3B6CA 2PMZA 3BQZA 4HQEA 1NEIA 2ZNYA 4KHPE 2P5VA 2RQLA 1U78A 1BI1A 4O6JA 2BVMA 2BXZA 4BHCA 3I54A 1BBOA 2RNJA 3FXKA 2Z33A 2R7XA 2Z5UA 4IRGA 2DTZA 2BY1A 5LD2C 4QSHA 4E7ZA 2KIMA 4AVZA 1U9NA 1IDYA 1SAUA 3LSJA 4KMUX 1I6XA 4LOCA 1SEUA 2M9HA 1YI2I 4Y13A 2AQEA 2HNHA 3IWCA 3OSFA 2KRCA 3T1BA 3UNGC 4EJTA 3S17J 4HV5A 2R1FA 5LEKA 1V55H 5M5YJ 5LLQA 2DA2A 3FXRA 3G6EI 3S1QJ 4M9SA 1RUOA 4WCGA 4EJOA 2IGKA 3ABUA 2Q1ZB 2NNYA 2CWEA 1ZKGA 2DOFA 2NUFA 2DQRA 3KP7A 2VJJA 4IJDA 2A68F 2DW4A 3BG9A 2WCC3 2AXLA 1TF3A 2Q2EA 3H5NA 3MSWA 3HOWJ 5AIQA 1JTXA 1K6OA 4RH8A 2XPWA 2JZYA 2F5VA 3IAM2 4V2GA 3LQRA 5ICFA 1MSEC 3LMMA 1Z7LA 3LSRA 2ISZA 4F9BB 4WK8F 3UK3C 2H6BA 1OFCX 2ADUA 1D0YA 4B3AA 2MBFA 4X9JA 2AQFA 2K9NA 5DCMB 5EG0B 1FOWA 2E7WA 4RGSA 4F7ZA 3MWMA 5F08A 1Y8QB 4XM3A 3M07A 3TO9A 3WU2C 4RDUA 3CMYA 1J9IA 2DN0A 1H0MA 2NA2A 2LUQA 1ULYA 2ID6A 2EM3A 3T5XA 3OMYA 5TGTA 1MJBA 5DD4A 2K5CA 3TDZC 3TMOA 3CCMI 1G59A 3GTQJ 4NXME 4P78A 2E2IJ 3OS1A 1B9NA 3FM3A 4EATA 2W48A 3BDDA 4ZYDA 3ESWB 1XGNA 3KIOA 1QHHD 5FFXA 5CVIA 2N3HA 1GHCA 3HPSA 5LRSA 5J8CA 4U7DA 2XF5A 5AC4A 2VJ4A 3A01A 3OL4A 2VKDA 2QSGX 5M3FJ 2KIQA 3DPUA 2JWOA 2B7VA 4PFPA 5M5XJ 1EH7A 4PFOA 2E1MB 1VQ5I 4KIFA 3IRQA 1BJZA 2DK5A 3CCLI 2VPRA 1UCRA 2WBMA 3THOB 3J7AG 4M9XA 5GAGJ 1QU6A 2EL6A 4HX8A 4RA2A 5BPIA 5KL5A 4A5MA 3FHNA 5K7ZA 3RKYA 3CDHA 2HTJA 2P7CB 1IF1A 2MC6A 1YITI 2EL4A 1SFUA 2QZ8A 3S16J 4AM3A 4DW6A 2GM4A 1UAAA 1QU3A 2EPLX 3ABMH 3QOEA 4GO1A 4L9NA 1STUA 3HQ1A 3ZMTA 4LG3A 1TLHB 1ZAOA 4LF6E 3GLLA 2JVGA 2VC0A 2KFDA 1SR9A 3F6HA 4FK5C 4MQVA 5CPRB 1JHHA 5BPDA 1SANA 2KZGA 4B3RE 3H3UA 5IPAA 2R7VA 2EPRA 3CCUI 1M1EB 2IAIA 2YTDA 2EV6A 2L7KA 2XRLA 1LKXA 4AIDA 4A3FJ 4BDYA 4HNUA 1ETXA 2IA2A 3BZCA 1HF0A 2LO3A 1ZG1A 3FX3A 3R0JA 2L3CA 1S7OA 3EUAA 3OR2C 2D2WA 3FXUA 4UV8A 1D8KA 2OAZA 1FBQA 4CCKA 1QGPA 2EPKX 1MMDA 4FX0A 2Y9YA 4DYQA 2RNGA 1EKEA 1U5TA 5B66C 3H3VK 2BB8A 3IWBA 1TC3C 2R7UA 4LIUA 2XHKA 4CA0A 2DA1A 1BL0A 1YLFA 4GFBA 4XK4A 4N4OB 2K9SA 1JI8A 3K4MA 1S9HA 4NBQA 3MAJA 1IRZA 2YSOA 3IKVA 4ESBA 1IBLE 1I3QJ 3JAMZ 4ENJA 4U88A 3P7NA 4BKXA 5GAEJ 2V9KA 1S7EA 3C3WA 2YU8A 5L3GA 2M1SA 5T6JA 1RR7A 4FQGA 3TW6A 3HTXA 3G3ZA 2CW7A 4BBYA 4R2RA 2D1VA 1DDNA 4HDUA 5K7FA 2O8XA 5FJ8J 5FO5A 3CUOA 2V89A 4LMYA 5KAIC 5HODA 2RDPA 2ZXJA 1WPKA 1CQTA 2HVRA 2UXCE 2A6HF 3HHHA 3OYGA 2GQQA 4KT5C 1T4OA 2XKOA 1IW7F 3M8JA 3OL3A 3PL8A 1FC3A 3JRCA 2E1CA 3THNA 3DPTA 4XIDA 2CQKA 2Y0SN 1LEAA 5CVUA 2K7IA 3KE2A 2VASA 5FLMJ 5IT9Z 1RI7A 2KT0A 1MD0A 3W2AA 1LEBA 3WTSC 1E0EA 4BQOA 3BTCA 1WJDA 3GTJJ 2EJ4A 2EMCA 2ECCA 2JA5J 3DPLC 2EL5A 3CO7C 1ZREA 3FIGA 3JRGA 3DCFA 3F0CA 3VB2A 2EMKA 1Y8RB 3PNVA 3L2VA 2FJ1A 4ZDPA 2YSRA 3F8MA 2OD5A 3H9JA 3ZQQA 3H09A 2KL4A 2W1OA 2EMAA 3RPQA 2HQ5A 5ADZA 2IBDA 3L7WA 4M2ZA 2W84A 3G1OA 4LF4E 1ZGWA 5FLXK 3H9GA 4DZJA 3J7Yp 2BY2A 1SFKA 1X58A 2V86A 1BB8A 2EM9A 1F36A 1UB9A 3NWSA 3CLQA 3H0DA 2EOEA 4DR5E 1KYWA 3T1HE 4ZTFA 5A2QC 3I4MJ 1NTCA 2R5YA 4NDLA 2DMQA 1SMYF 2W25A 3CO6C 1KYZA 3K7AJ 4DV1E 2XF7A 2CU7A 3Q0UA 2HPMA 1R23A 1ETYA 1TQPA 4A0XA 2V6EA 3TBIA 3BP8A 5CVJA 1JGSA 4IS1C 4WSPA 2LY2A 4P1WA 1L3LA 2KMUA 2LDUA 3JTGA 4BCAA 2QQ8A 3CCQI 5JLXA 2V1XA 4UUTA 2E34A 2LE2A 4HF2A 2F5CA 4CCJA 1K7AA 2J5OA 2YRKA 1CF7B 2CMPA 1MZBA 3J7AO 5E18F 2XPUA 4LFCE 4FHTA 2KRFA 2JPCA 4B3TE 4IF4A 2KZVA 2MW8A 4A0YA 5IOYA 2RTXA 3DEWA 2ICWG 4HRIA 3K2ZA 3Q5FA 4BQNA 2ZB9A 1ETOA 2KONA 1HR0E 4NUBA 1P7IA 1W5CC 2QENA 2W00A 4X1EA 5EEGA 2Q8UA 1R00A 4Q28A 2EMWA 3HRMA 2YTEA 3H5AA 3I0TA 3J7YJ 4MLVA 4WSGA 1JGGA 3PUBA 3QU6A 5ED4A 3LQQA 3DF6A 3WG9A 2X9DA 2O8KA 1W4MA 4DV6E 1YYWA 2UUBE 3ZGKA 3DLAA 4LGWA 4G7HF 5IP7J 5E8IA 2JA6J 2L02A 2LV2A 2EOZA 2IGMA 4YIRX 1RKTA 4UB6C 2YPNA 4A3MJ 5AC5A 4S05A 4BQQA 3LSMA 4F54A 3A02A 2E5NA 3CQZJ 2WB1A 3EPHA 3F8CA 4BHBA 3VWBA 3DXJF 5D8KB 5FKMA 3OYAA 2UUZA 2LVSA 2RQQA 3BJOA 3QPSA 3TDUC 1ZRCA 1RIOH 2DODA 2F48A 1D0XA 3QQAA 1WCMJ 5DYMA 1S72I 3BZKA 1KA8A 3VSKA 5D5WB 1ZGAA 4BE0A 4Y4RA 4M9VC 2YS9A 1FJLA 1UN6B 3KETA 3ADIA 1NK3P 3RJPA 2NAZA 4P55A 1UHWA 4PJ0C 2HOTA 2XGCA 1USTA 1WJCA 5DM6F 1W7PD 1IO2A 5IYCJ 2EOOA 5F27A 4HSRA 1DQ3A 2RS7A 4BU2A 5D5XB 5J4VA 2Y0MA 3BTJA 4A6EA 2EOQA 2VT3A 3CESA 1EH8A 3OOUA 5IT9C 1XCVA 3C7JA 2EPOA 4O5GA 1EH6A 2KIUA 2VBXA 1I27A 1QO0D 3JAMC 3OYJA 2BYVE 2O5RA 3GLXA 4M6XA 4XRFA 2MH2A 3ZQLA 3TQNA 2YTGA 1GUUA 4IL6C 5LHHA 1ZQ3P 4LG0B 1IRFA 2HQRA 4CZZA 4JOMA 4DV3E 1JKQC 1J5YA 3ABLH 4YFNF 4KIBA 2DT7B 2QSFX 2V9PA 1TNSA 5FRNA 4O43A 2OZUA 1V3FA 3VFZA 1IN6A 4A3JJ 2KRHA 2WAQN 1X19A 4U87A 5EEHA 4IRIA 4I0AA 3L2CA 2PN6A 3DKYA 1DGCA 2WY8Q 5KNLA 4UVBA 1ZH5A 3EUKL 5J40A 3MHSC 4NZVA 3EPKA 2B0LA 2P4WA 2OTLI 2DJNA 3IL2A 2ZJRF 1UMQA 3VYRB 1I5ZA 1W0UA 3WHCA 1LLMC 2XAFA 3JR9A 1ZLKA 2CV2A 1BA5A 1TWHJ 4WYQB 3ASNH 2CPNA 2A25A 2KHXA 3TP3A 1AU7A 4LG0A 2LRSA 1TW3A 1YIJI 1ZARA 2XUBA 2LC2A 1YG2A 1UJ8A 1KZHA 5C4XJ 3F6GA 1DU6A 1N77A 1X3UA 4XL9A 2JOXA 5EF6A 2R7OA 3EETA 2XAGA 2LSOA 3RYPA 4CCNA 1R1TA 3IWZA 2VC1A 2EN6A 3ZMUA 3PUFA 1HC8A 4KDPA 5LMUE 1XGSA 4PK4A 1A35A 5F04A 1KQ8A 3WGHA 1F4KA 4ZDLA 4RLQA 5HDGA 3PNYA 2LMZA 2ODRD 2X85A 2K27A 1ZHFA 3BTLA 2UV1A 4XN0A 5LBQA 2YX7A 1FOXA 4M3EA 3DTKA 3J80Z 1S29A 1FOYA 2X0LA 4PZJA 3I58A 4NC7A 4MEYF 5CYVA 1X6FA 2I9IA 3WTWC 1U6GA 4E7IA 3W6VA 1T6SA 3FMQA 3DJWA 1HXDA 1D0ZA 3ECHA 2EQ3A 2XF6A 3HTSB 1UHSA 2CO5A 3S3NA 4KWYA 5C44J 3ISPA 2PMZN 3WE3A 1Z91A 3R4KA 1JJ8C 3FXOA 4E4HA 2E71A 3S2DJ 4AD9A 4O5VA 2E19A 4JI7E 3LA3A 4DR4E 5J8FA 1X1PA 4B44A 3PO2J 1WHNA 2DK8A 1YTYA 4I76A 4R2AA 1BW6A 4I01A 2QGUA 3EYIA 1HKSA 1T39A 2ELZA 2QKMB 2F4OB 2CW0F 2HDCA 4F92B 3E6DA 1D1AA 1OYWA 1S3JA 3OYEA 1XX5A 1N75A 2HR3A 3I59A 3F6VA 3MD2A 4HF1A 2JPBA 5A6KA 1L4SA 3LWFA 4JYKA 4KYWA 4BL0B 3UKGA 3ASOH 2YRHA 2IS1A 3BOQA 5A2QK 4GGGA 4YEJA 3I9V2 4A3GJ 3TO7A 4N9IA 2W82A 3RTRA 4WWCA 3G2BA 2NUEA 4BS9A 1BC8C 1J26A 2FQ3A 2X6YA 3MQ0A 2GLOA 2HKOA 3CJRB 1E17A 3S2WA 3BR2A 3JRHA 4J01A 3I4PA 5LEJA 1HKTA 4Y15A 2WBTA 4PSWA 1SFXA 3ADGA 4W1UA 2QKLB 1R4MB 1J0RA 3LSTA 3KZIC 4OMZA 5A69A 4I09A 5CJ9A 3HOSA 5EDNA 2M87A 3SZPA 4BH9A 2VQEE 3QP6A 1W5SA 2EM2A 4LF9E 2EFOA 4ZC3A 3W6JB 2YTPA 1SVMA 2JY9A 3FMRA 2WZOA 2DI3A 2VQCA 3M9AA 2YU3A 3BCAA 1MNMC 3IAS2 3TGNA 3OYNA 2KOUA 3MKLA 2DRPA 2MGQA 3HIFA 3HRUA 5J6XA 3VYXA 4G6DA 4CCOA 1Y0NA 5DV5A 5A6JA 2DCEA 4IQ4A 2EOYA 3HSEA 4KUMA 4LF5E 4XN3A 1S7AA 1ZR9A 4DV7E 1IN4A 1XG1A 3CDLA 4PJJA 2RPCA 1G2FC 3JU0A 1JK1A 4MFDA 1GLNA 2F4VE 2W7NA 4RHBB 2V26A 2WADA 1Z67A 4RAFA 2EM0A 1JUPA 1Z3YA 3QOPA 1A1HA 5L3FA 4J8ZA 4LLLA 3CMAI 4IHXA 1XDUA 2PJRB 3I4NJ 4U7BA 1PVEA 1IXCA 4ETSA 1PDNC 3RZDJ 1J7KA 2Q2EB 4ENMA 3E6BA 2DA5A 2DOEA 4BBSJ 4C30A 3WODF 4XRSG 4NHRA 3BQYA 3Q0VA 1MNEA 4DGWB 5FLVA 2W57A 4G94A 1L0OC 1HQCA 1RETA 3JW4A 1I3AA 2EB7A 3ZN0A 3ZQ7A 5AE1A 4LU9A 1ZRFA 2FNPA 2DSYA 2QWWA 1YS7A 1ZR2A 5E1WA 2H8RA 3P9CA 5KL7A 1K6YA 2X48A 4HV6A 4BEHA 5GADJ 1WI3A 5AE3A 2XSJC 3GWZA 4K2EA 5LRRA 1YYKA 1X3ZB 3CC2I 4I98B 1ON1A 4N4NB 2XRNA 3V7CA 3RCOA 1X3WB 5BMZA 1FIAA 1PJTA 1IUFA 2XAJA 2DMYA 2MD5A 3F6OA 3GBGA 4CSWA 3L09A 4M3GA 2FNAA 3ZQIA 3IH3A 3LA2A 1ACIA 1WWXA 2HKXA 2UXNA 2HVSA 5HLTA 3E97A 1TWCJ 2XASA 1XMQE 4XLAA 2X6XA 1P2FA 2MABA 3WTTC 2VKHA 1STZA 3TOAA 5A6BA 2CQQA 2WB1N 2L01A 2CJJA 1N25A 4ABZA 3COAC 1WJPA 5A6AA 2LOOA 5GTIC 4AU7A 5EGOB 3ZN1A 1RRJA 1K78B 4A93J 3KPHA 4E70A 2OU2A 1Z21A 3WU1B 1VQ8I 2R0QC 1H89C 4ZJZA 2EZIA 1TZLA 4N4RB 2F8BA 1Z0XA 4L9JA 1QZEA 2R7TA 1VQLI 1B9MA 4N9HA 1VQ7I 2JOBA 2GXGA 1LPQA 2R5ZA 4ANJA 1IQOA 1X6EA 3FBIB 3HJEA 1Z77A 4EM2A 2WY7Q 3GXOA 2GLIA 2L9VA 4GYGA 3WTUC 2PMUA 2V4JC 4B3SE 4BAYA 1Z1DA 3LFKA 4XLNF 3VYTB 1Z9CA 1T4NA 2O3FA 4XQFA 1K61A 4B8XA 3J81Z 2X4HA 2DFEA 2XGDA 1IQSA 4RAZA 4YG2F 2HWVA 3HPZA 2G7UA 2V8QB 4P9UA 3I64A 3QPTA 2JWTA 4PSXA 1OYIA 3DU6A 1ETQA 2QEXI 2D1HA 4HX4A 1XGOA 1G3SA 3IP4B 2LBFA 1YQAA 2LKSA 1ENHA 2IW5A 4BJ5C 2IS2A 4AIHA 3J7ZI 4JI8E 1I6HJ 2KPMA 3QPLA 2K40A 4F55A 2A07F 3O8GA 5FFZA 2G0EA 5FLXZ 4FTHA 3LMLA 2EOHA 1KU2A 5DDGA 3NARA 1IAWA 2EOMA 2EFPA 2HQAA 4BXXJ 2FGGA 1XCBA 3GFLA 1AA7A 3HSFA 2EV0A 3R0AA 2OPTA 4IHVA 1GTKA 5KL4A 2EFNA 4L5NC 2ZCWA 3RSNA 2VONA 2DFFA 2QBYA 3R61A 4JI1E 1R5HA 2NNNA 1JTYA 2YWQA 4GZNC 4KNYA 5TSEA 1GV2A 3LSGA 2BGCA 3GW2A 3CCEI 3ULQB 2ENAA 2GOXB 2GWRA 2JMWA 4I7HA 2L54A 3ZQCA 1NHAA 2YPRA 1ZN2A 1GVJA 2LVHA 2ADRA 1CF7A 3L1PA 1VQNI 2EQ0A 3DV8A 3FXQA 1TBXA 3MKYB 1N3GA 4DV4E 3E6CC 2XC7A 4AUXA 4Y7NJ 1UBDC 3H5RA 3OY9A 2R7DA 2MC5A 4L9VA 2Y69H 3KP2A 1IG7A 1BOBA 2YU9J 2R7ZJ 4D5FA 2RQPA 1ERDA 1XS9A 2MLKA 4M3BA 4YHHE 4WXCA 1BIBA 2EMZA 4HW0A 3L00A 1HOMA 5AASA 5AONA 4ASNA 4R2EA 1YSAC 2JPAA 2UXDE 1O7FA 2DOAA 1ZBQA 3K2AA 4ZTJA 3EUHC 1JKRC 4DR6E 2ESNA 1N33E 1JT6A 2E7XA 4UUSA 2KJBA 3SDBA 4JX4A 2BEOA 4HNTA 4F52A 1DP3A 2CUEA 3L2QA 5JHFA 2VQFE 3JSPA 1B8IA 4JI2E 4KT6A 4BYYA 5IXMB 4HEA2 3QYBA 5E3MA 3CJQB 1IN8A 2VJ5A 3ABTA 4LJZF 2DLKA 2O0YA 3T1YE 1XPXA 3F22A 2Q0OA 1RESA 4R8HA 4J19A 2E5ZA 2C6YA 3K6GA 5CQEA 5BS6A 3VODA 4HA8A 2EOJA 2QQAA 4MLOA 3V7SA 2ZFUA 3QODA 3PNTA 1OCZH 2LP0A 2PLYA 3WGIA 4HZFA 1SMTA 1MJAA 2EQRA 2H09A 4G6TB 3SFZA 4LTYA 2STWA 1POGA 1SFOJ 1K4TA 2O6GE 3AV0A 1UHZA 5HS8A 4O3MA 3KZYA 5DCMA 5EG0A 4BE2A 2BHYA 5D5UB 3HL2A 2EOXA 2EQ1A 1O0WA 2MKDA 3RQ4A 2MYSA 3PM1A 2CFOA 1QRYA 2OA4A 3CP8A 2L2NA 1TF6A 1LE8A 1TP4A 3BG3A 2YR2A 4YRVA 3JSOA 4PCQA 1Q1VA 1RNLA 2YTJA 3HOTA 4F3QA 1SVOA 4BY1J 3OYCA 2ODRC 1FY7A 3WG7H 3ZQHA 3F21A 1QNTA 5IP9J 1TW2A 2CYYA 4F6MA 4DQ2A 3M3YJ 2ZO4A 3V8JA 2DXIA 3CUQA 1BI2A 4JI5E 2Z2SB 1JT0A 2X6OA 5L3CA 5KL3A 2VQHA 1K83J 3M7GA 2HC5A 3IWFA 3V8LA 3K4NA 1E3HA 5L3BA 2R7RA 2VKVA 4KA4A 4TV7A 1OMIA 1UG0A 3OYDA 1MH4A 2H27A 1FMVA 3SXYA 4L5EA 5K5OA 2B9SA 2LMDA 4V2FA 2LTRA 2XGXA 2HQNA 3C4TA 1LE8B 3JTZA 2B63J 1JUSA 1FYKA 2RC4A 4QLCU 4ZH4F 4XOTA 2HXIA 2K9QA 2LYCA 4LF8E 2FBKA 1SAXA 3QWLA 1H9GA 1OCOH 1FLIA 4XKVA 2LFBA 4IPAA 4BACA 3CC7I 1R6RA 2UUCE 2IS4A 2JQ7A 1PYVA 5CQGA 5IYDJ 5D5VB 3I71A 2ZNZA 3F23A 3ZQFA 2HOSA 4JV5E 4AYBA 2O61A 5EZGA 4DOZA 1OPCA 2DMNA 2DMPA 4MNUA 5IV8B 2EA4A 1I50J 2A3SA 3NEUA 4RB3C 3CLOA 4ZYAA 3S32A 2L8TA 1HSJA 1X1DA 4UUSB 1MBGA 2L4AA 4MTEA 2EMFA 3FZVA 2JVAA 2EN2A 2EINH 2OTJI 3VEPA 2WAQA 2EV5A 2DO7A 5EJCA 4ZDOA 2EA2A 2OQGA 3W3CA 3HOYJ 1FTTA 4BHPA 3CCYA 3NRVA 3A2KA 3CCVI 1Z3XA 2VOOA 1HSTA 2JJ7A 3ECRA 2DJIA 3OIPA 2P6SA 4HYEA 1P92A 4RM2A 3TW7A 1LFBA 3C6MA 1BJAA 4N0BA 2VRDA 1YW8A 4DMIA 3ZMZA 3GTPJ 2PMHA 2M9AA 3H36A 4IZZA 2K4JA 2JTVA 3X2QH 5H6RA 2PI0A 2DLQA 2LTSA 1F1ZA 3RYRA 1IN7A 2BW3A 2F5EA 2ID3A 2OV7A 5JLWA 1R5GA 3G4SI 4ENKA 1ZBTA 3OYIA 2M3AA 3H92A 2ECBA 3M1CA 2EOSA 4ZYGA 4MLQA 2CV1A 2K85A 4M3FA 5LHIA 5IWAE 4B4CA 4HNVA 1YJ9I 1DUXC 3KEOA 3IHUA 2EN1A 1HDPA 3JRAA 4RS8A 4E7HA 2EOIA 1T08B 3J81K 2LJHA 4X0GA 5HS9A 3S15J 3EDPA 1WJFA 4EM0B 1X6HA 3B02A 3DEUA 2EM8A 1YJWI 2UU9E 1GZ6A 1GXPA 5HNFA 3GZNB 2V1UA 4KJZA 2W85A 3J80K 2R76A 3LLHA 4M73A 2Y48A 3OYLA 2KP6A 2HU9A 5A6BD 2XV4S 4RGXA 3E6MA 2MH9A 5HS7A 3ERED 2YX4A 5B5EC 4D9JA 4OIQF 3T8TA 1MBJA 2OZ6A 3SZGA 1P4AA 1MIJA 4QIWN 3FM5A 1FP2A 5ERIA 3HKZN 5KAFC 1PP7U 2ELHA 3A4CA 1K78A 1U5TB 2M4KA 5KL2A 3WTVC 5LGTA 5HDNA 4OX9E 2QA4I 2GZWA 4R2PA 3QPHA 4I6ZA 2LREA 2NS0A 5BOXA 4IOAF 1ORKA 2ESHA 3D1NI 2JA2A 1P4WA 5C3EJ 1G2DC 4EJVA 2CQ7A 1JKOC 5LGNA 3RPUD 2PQ8A 1QBJA 4R8OA 3HUGA 2EIKH 4UUVA 4XR6A 2XIGA 3DFGA 2ZXHA 1X1CA 2KIFA 2CV0A 2EP3A 3JRFA 2CUJA 2HPIA 3FXMA 3M8EA 1V5EA 3KYCB 4KITB 3WU0A 1J75A 3Q9SA 4P9FA 2H8WA 4UV9A 3D5LA 2MD0A 3KX2A 1U8RA 3CF2A 1XMOE 3HEFA 3MKWB 2M2EA 3IUOA 4Z6YA 1Z7UA 4BMJA 5CVRA 4DJAA 4CZCA 2K9MA 2Y2ZA 5TRDA 1T98A 4CUGA 3ZMDA 3AAFA 5C4JJ 2A5YB 2N8GA 2VI6A 1MEYC 4CXFA 3FWEA 3AUZA 1G6NA 5HLIA 1P47A 3QYFA 2VB6A 2GA2A 1O3QA 2Z16A 2H36X 3IWDA 3B6AA 3DBRB 2RREA 4ZYHA 2DYSH 3H1CA 1ETKA 1A6QA 1WJEA 3PIOF 1A1LA 5E8GA 1MMSA 2RKHA 1MSFC 1OCPA 5BNGA 5H2FC 2YT4A 5E1ZB 1RPWA 2VBYA 1FEXA 2EPAA 2X1CA 2EMIA 3PQKA 4DUYE 3DBHB 1BIAA 5F3WA 3EYYA 1U5TC 2Q8KA 3QG5C 2M7BA 3MZYA 4DIQA 2IEKA 4JK1X 2CGPA 1BBYA 1UELB 2CW8A 2M5WA 3MMYB 4EEFG 1XD7A 4RB2C 3A01B 2DLLA 1FOKA 2H6CA 2Y31A 2EMHA 2MDRA 3MZHA 2LD5A 1Z05A 3VDXA 3ZXSA 2EPZA 1Y6IA 4A0ZA 3K6QA 2IS6A 5CKTA 4F2JC 2L2MA 4M0VA 4RB0A 3KWRA 1LDKB 2EH3A 2F5FA 2VL8A 4Y33A 4IX7A 1H88C 1BBGA 1ON2A 4F9CB 3FXLA 1A6IA 2L9RA 4NC8A 2PG4A 4U0WA 3E0JB 1AHDP 2JR1A 2UUAE 5AIPA 5FB2A 1Y56A 3S8PA 4E7LA 1BC7C 2DYRH 2LLKA 4L5IA 2IJLA 3CCSI 3U9GA 1JKPC 2IRFG 1Z6TA 2CUFA 3E1SA 4HLYA 2VODA 2FMLA 1X2NA 1JUMA 4MHGA 4LB6B 4I0BA 2I5UA 3MFKA 2YTOA 2KJCA 1NCSA 1J5EE 1FKAE 2K3FA 3FK6A 3AL0B 3T0YA 2JRTA 2VXZA 4CCMA 4XRSA 3EUHA 1KU9A 4HDVA 2CQXA 1IV6A 1ZU1A 2JSCA 3O6BB 1SD4A 4UB8C 2DT6A 2ME0A 4XBFA 1DGRM 2M1BA 4S04A 2B7TA 1X4OA 2F4MB 2EM7A 3FKJA 1R7JA 1WZ2A 3G73A 4XLHA 4MQ9F 1FSEA 1T95A 4OMYA 3AFHA 3BBGA 3REOA 1KQ9A 3FMSA 4Q4ZF 2L33A 3O8HA 4A3DJ 2RSMA 4F9AB 2EPUA 4MTDA 3HBLA 1G3WA 3W6KB 1X49A 4LF7E 3GUDA 4M74A 4PDKA 3LAJA 2K9LA 4XKBA 1Y1WJ 4A3CJ 3V42A 3HGYA 3M1EA 2PX9A 3LA7A 5F6FA 4CICA 5L3EA 3RKWA 1XSVA 4DYRA 1QVUA 4II3A 4MFEA 1ZELA 3PIPF 2P5LC 1ZR4A 1N78A 2B7EA 4I02A 4EV0A 1WJBA 2CS3A 2R7QA 1PJQA 1YHQI 1B59A 4OAYA 2PBIA 4IRHA 5D4SA 1QPMA 2JT1A 1T2KA 3ZMSA 1K79A 3GZ5A 2P5KA 2BY0A 1YFHA 3I55I 2DFIA 2JUGA 3C2HA 3KCCA 4NNJA 3DKWA 4HQMA 1QQIA 2D9HA 3LL7A 2YZTA 5B1BH 1UG2A 2QQ9A 2EMXA 3MZ8A 4CO8A 1MH3A 3N05A 2Z3YA 1R1UA 2H1LA 4AYBN 2WTEA 2X1EA 4R1HA 3ECOA 4F6NA 2HGCA 3HPHA 3DQVC 5ICEA 4OIRF 5AE2A 1BOAA 5K5QA 3IH4A 4Q47A 1O57A 3HUGB 5CLSA 5HDKA 2QM3A 2GBYA 2M4GA 4HEIA 3BG6A 4HPQA 3GTLJ 4X66E 3ERMA 3FIWA 3D0SA 4M6VA 2P6TA 2R5ZB 4FE7A 5FD6A 3F8NA 2Z1DA 4EMSA 3SYTA 1MDMB 4EJUA 1FYMA 3U21A 1O3TA 1X47A 3UR3C 3LOCA 1IRXA 2DMUA 4S0HB 5KHDA 1OJLA 3DF8A 1IGNA 4H4KC 1MBEA 1MKMA 2QLZA 2V87A 2V79A 1T8IA 4Q5SF 4A3BJ 5HOOA 1JE8A 2LCEA 4EQQA 1OQYA 5LHGA 3TP0A 2MLGA 3IRRA 1HLVA 1WJ5A 2YTNA 1B1BA 3CP2A 3P9KA 4PJLA 4AIKA 2UXXA 4OOGC 3OYHA 5D6EA 1KJKA 3S1MJ 3L2UA 5EYRA 4R03A 2K3PA 3R60A 4P96A 5D6FA 4LLNA 4Q48A 5IT3A 2KQRA 3C1DA 5EGOA 2B9DA 4LB5A 1N32E 3PQJA 3PJRA 3GTOJ 2E1OA 2EORA 3S1NJ 1YOVB 1QA6A 2LF7A 2ZKZA 5DM7F 1YRNA 2V7FA 1AKHB 1RR8C 5CVVA 4LFUA 1APLC 3IH2A 4J00A 5E3LA 1VQOI 3B73A 2KISA 4ZZDA 4OOIA 3F8FA 1LB2A 2I10A 3A03A 1AWCA 3J7AY 1HDDC 3BTIA 4NB5A 4FASD 2COMA 2A69F 3WTYC 2HDWA 3QRFF 1GDTA 3SEZA 4F91B 1RC9A 3A0BC 3HSRA 2YTQA 4R2SA 1A36A 1LVAA 1LFPA 2LT7A 3FISA 3BPVA 1O3RA 3HKZA 3GFJA 4NXNE 2F6CA 4NHJA 4A3LJ 2M4IA 3JRDA 1R36A 2XSDC 4A3KJ 1IZ1A 1Z1BA 5KL6A 2EM4A 1LQ1A 1FP1D 2GXAA 4H0EA 3CZ6A 5E17F 2DMIA 3SHFA 1ETVA 2HS5A 4C2UA 1D3YA 2OBPA 1W7PB 2QCOA 2FA5A 1HW1A 4X64E 3AG3H 5TJJA 1R9TJ 3CF5F 4L0ZB 4AVPA 2FTXB 1B4AA 1FSHA 1BR1A 4XLEA 2NABA 3F9KA 4C3IJ 2YRMA 4JI6E 5FROA 5DS9A 2D45A 3HOXJ 4I2OA 3C2BA 2BOLA 3BLYA 3O2PE 1FT9A 4YIIA 1YPNA 4XKWA 4R2DA 1DP7P 2BBYA 5DCFA 3FF5A 4QTRA 3S3OA 2VPLA 2LY1A 1IDZA 1WVRA 5LFAA 1NH3A 4LFBE 4B43A 3H0GJ 3QU3A 3CCRI 1T0FA 5GP9A 4K0KE 3G1MA 3K4CA 2VBWA 2R93J 2DQLA 1LJ9A 3PFYA 4LIVA 1UHMA 3BZ6A 3ADJA 2NVYJ 4G7ZF 1KU3A 2M7AA 2E1NA 1ZG3A 2EZLA 4EGZA 3QYEA 1IMUA 4NQWA 2M34A 2OC6A 2XB0X 4BGDA 1ZAAC 2WBUA 3Q9VA 1T4LB 4WF2A 1ZYRF 4XOPA 3K70C 1JJ6C 1ZRDA 2BZTA 1PJRA 4JX5A 3OYFA 1GXQA 1P6RA 4RB1A 3EPLA 2EN4A 5F0CA 5J1UA 2HDDA 1VQKI 2EWNA 2NVQJ 1ZTRA 2HXOA 2VLAA 2EPNA 4TUIA 2VE8A 1G8XA 1EV7A 1P9QC 3AG4H 1OLTA 5DTDA 4B09A 5J1RA 2TCTA 3G1LA 2EM6A 1IBME 4IKFA 2EN7A 2R7WA 1K4SA 2QBYB 2FD5A 1AOYA 4GKJE 3DTEA 1XN7A 4CDGA 3TL4X 1Y1VJ 3RDIA 4JI0E 5F1RA 4R79A 2F5DA 4L8NA 1RUNA 4DR3E 3QAHA 2DIXA 2CH0A 3GEZA 5FGMA 2P7VB 4PJNA 4AQYE 3DEEA 3K1MA 4YELA 1DPRA 2WA0A 2NXNB 3BGHA 1TT0A 2V83A 2KKOA 3OIQA 4UVAA 1R1VA 3HDDA 2JVHA 5BQTA 2LBFB 4JQFA 4RM3A 1GT0C 3P9IA 4RBOA 2LKPA 2A61A 4RGUA 4ZZLA 2KLOA 1YZ9A 1VQ6I 2Y75A 2MDGA 2R4GA 2OCCH 1XC5A 3IKTA 2IVMA 2VE9A 2N8XA 1KQ0A 3HHGA 4Z2YA 4C2MJ 3KYLA 2VOPA 1X3CA 2GAUA 3CMMA 4EJWA 1SC7A 3J80C 2KDOA 2P0WA 2GIZA 5IT9K 3U2RA 3HM5A 2AO9A 3HGGA 1SD5A 1EJ9A 4ESFA 5E1XA 2I8DA 2K86A 2LG4A 2P81A 2WV0A 2Y30A 1A5JA 4L18B 3OYMA 2JN6A 1OCCH 4IQJA 5KK1A 1OR7C 2OJED 2NUGA 2FOWA 1FZPB 1QPIA 2LBSB 4WXHA 4L9TA 2ACJA 1X48A 5J3LA 2JUCA 3GO5A 4I99C 4XLFA 1QZYA 1GVDA 3ZP5A 2N3GA 3KP5A 3OIOA 3W2VA 3BIDA 3CUQC 1PUEE 3JAMK 1MMGA 1YW7A 2NVXJ 3OV8A 4P5OA 1B72A 1G4DA 1H8AC 2BVLA 2IT0A 1T38A 1TQMA 2ZFWA 1WXRA 2NYXA 1LDDA 5ICCA 1SVLA 2PEXA 2ZJ2A 3V7RA 4A2UA 2ZJQF 1B69A 2IP2A 2L2KB 4HAMA 3LSHA 1LVKA 2DPUA 3A1YA 1DQUA 3SFIA 5HLHA 2A6EF
chains in the Genus database with same CATH topology
3H3ZA 3U1DA 5KVRA 1HKQA 4M71A 4BNCA 3EQLF 3KFWX 4KFCA 3ZPLA 1SFEA 3BJ6A 1YYVA 5ILVA 4RGRA 3BPXA 4FX4A 1TQIA 2GXBA 2EK5A 3K1PA 3T8RA 5DD8A 1G3TA 3QP5A 4FT8A 4XLPF 4QWQA 2HZTA 2GA1A 1W7PA 2P8TA 4UXNA 3KLNA 1REPC 4XSXF 5A2QZ 5K1YA 4ZYEA 1UFMA 2FXAA 3IC7A 3VOEA 2QUFA 1C0WA 1B6AA 3WE2A 1JXSA 2ZMEB 4U0YA 5JVTA 5FD5A 4IHSA 2V1DA 1BM9A 1SD7A 2W24A 2RN7A 1SD6A 2F2EA 4CYDA 1QZZA 3F3XA 3R6SA 4D0PA 1YO5C 2MC3A 4UVCA 2ZBKA 1E2XA 3MCZA 2ZMEA 4OIPF 1D8JA 2Z99A 3PFIA 4KMFA 1XDSA 2R7FA 2XAHA 5JFRA 3KEQA 2Z9OA 2L3DA 2VN2A 5HLGA 2HYGD 1WRJA 3RPUA 1D5VA 3BJAA 1H9TA 5DUIA 3E5QA 4KN4X 2FMYA 3KP6A 3WTXC 4MEXF 1PP8F 4AWXB 3BROA 3V4GA 4LK0F 2WWYA 1J2XA 4GXOA 3KP3A 4CGZA 3I53A 2H94A 1R22A 1U2WA 1YIOA 4GYIA 2CFXA 2CSOA 2MA3A 2FBHA 4A6DA 1R58A 3CTAA 4UNOA 2TDXA 4G7OF 1P4XA 2J5PA 1O3SA 4DNCA 1I1GA 3KP4A 4EVIA 5DUKA 2XKPA 4Y17A 1XSXA 4OU0A 3ML6A 2HTSA 5H6QA 4AIJA 2DPDA 2FBIA 2GIVA 5HVQC 5H20A 3K0LA 1XMAA 3TO6A 5L3DA 4RAYA 4CHUA 1HBXG 1RZ4A 3RI4A 4U0VA 2BE5F 2QVOA 5ICGA 2RGVA 2M45A 5LGUA 1USSA 3JTHA 4G9YA 3M8FA 1XMKA 1YW9A 3GZ6A 3V8KA 2FEZA 2DAOA 5D4RA 2G7HA 3GVAA 1HW5A 3GFMA 1BI3A 1FPQA 2AS5F 3DP7A 2HEOA 1G3YA 1MDMA 3MEXA 2UZKA 4BQAA 1S8NA 3C18A 4PGGA 1JHFA 2FSWA 4M6YA 1YS6A 4A5NA 3CUQB 1I1SA 1W5TA 2XROA 3I59B 1DPUA 2M30A 1OKRA 3SZTA 2DBBA 4HF0A 2UWMA 4XSZF 1F5TA 4M9ZA 1FYLA 4IJAA 3L9FA 2FE3A 1J59A 4YIFA 2EJRA 3KZZA 4ESJA 2HYFA 2K4BA 2IPQX 4WXDA 1IN5A 3N4MA 4ON0A 4IHTA 3I5UA 2WC2A 1OR7A 1V4RA 4GCVA 4UHTA 3N97A 4HBLA 2NRAC 5D8LB 2ISYA 1TTYA 4KICA 5DEQA 1WSUA 1ODDA 4IXAA 5E20A 2STTA 3ELKA 1XGMA 1Y0UA 2HOEA 3GYHX 2FU4A 1S6LA 1WQ2A 3K1NA 2FRHA 4OINF 3ZMVA 1LDJA 2V9VA 3RKXA 2G9WA 2EFWA 4ENNA 4YFXF 2PJPA 3TOBA 4L0YB 3GF2A 4HX7A 1ZG5A 1IXRC 2OQRA 1OYYA 3RIRA 2VBZA 2FF4A 1IXSB 2CG4A 2VT2A 3HTUA 2IA0A 2K7LA 2BV6A 3WTZA 4YFKF 3HYIA 4IVNA 2XVCA 2LNBA 1WKMA 3O3KA 4WX9A 3E5XA 1ONVA 4G6QA 1XSDA 2DTRA 1WI9A 1FBSA 1HW2A 5JHUA 5K5RA 1Z6RA 2RVCA 1FWZA 1XB4A 4MGRA 4HOBA 4EM1A 3OOPA 3CJNA 2DU9A 1FNNA 1MGTA 1FX7A 1BN5A 2DT5A 1U3EM 3LAPA 5ILUA 4LK1F 4M72A 1A04A 1ZGJA 1LNWA 3WGGA 5ILSA 4OIOF 4LLGF 5JI6A 4A12A 3KLOA 1O7LA 4LD5A 1MJ9A 3BWGA 3F8BA 5JR3A 2QQBA 3GFIA 2R3SA 2M8EA 3BY6A 1IUYA 1BI0A 2V6CA 1CGPA 4G8XA 3E5UA 1IRGA 4EGYA 2PFBA 2RV8A 4HLXA 4JBAA 5F64A 2IA1A 3TKYA 4L5JA 2LF8A 3F72A 2O03A 2ETHA 2FOKA 2L4MA 4BXUA 2EFQA 3HRSA 3NQOA 3GX4X 2XAQA 3HRTA 3K69A 1Q1HA 1KU7A 3FHZA 1TNTA 2HFHA 2K02A 4KN7X 2A6EF 2QYOA 3E3VA 1VTNC 4PGHA 3K9TA 3ROUA 1FBUA 4KIGA 3SQNA 1KGSA 6PAXA 1F9NA 1ZLJA 4HQEA 2ZNYA 2P5VA 1U78A 1BI1A 4O6JA 4BHCA 3I54A 2RNJA 2Z33A 2Z5UA 4IRGA 2KIMA 4KMUX 1I6XA 4Y13A 3T1BA 4EJTA 4HV5A 5LEKA 3FXRA 4M9SA 1RUOA 4WCGA 4EJOA 3ABUA 2NNYA 2CWEA 2DQRA 3KP7A 2A68F 2DW4A 2AXLA 2Q2EA 5AIQA 1K6OA 2JZYA 3LQRA 5ICFA 2ISZA 4WK8F 2H6BA 2ADUA 2MBFA 5DCMB 2E7WA 4RGSA 4F7ZA 3MWMA 3TO9A 1J9IA 1H0MA 1ULYA 3T5XA 1MJBA 5DD4A 3TDZC 1B9NA 3FM3A 3BDDA 4ZYDA 1XGNA 5FFXA 5CVIA 1GHCA 5LRSA 5J8CA 4U7DA 1EH7A 4KIFA 3IRQA 2DK5A 1UCRA 4M9XA 4HX8A 5BPIA 4A5MA 3RKYA 3CDHA 2HTJA 2P7CB 1IF1A 1SFUA 2QZ8A 4GO1A 4L9NA 3ZMTA 1TLHB 1ZAOA 2VC0A 4MQVA 1JHHA 5BPDA 3H3UA 2EV6A 2IA2A 1ZG1A 3FX3A 3R0JA 1S7OA 2D2WA 3FXUA 4UV8A 1D8KA 2OAZA 1FBQA 1QGPA 4FX0A 1U5TA 2XHKA 1YLFA 3MAJA 3IKVA 4ESBA 4ENJA 3JAMZ 4U88A 3P7NA 3C3WA 5L3GA 3G3ZA 2D1VA 1DDNA 4HDUA 2O8XA 5FO5A 3CUOA 4LMYA 2RDPA 2ZXJA 2A6HF 3HHHA 2GQQA 4KT5C 2XKOA 1IW7F 1FC3A 2E1CA 3DPTA 2CQKA 1LEAA 5CVUA 3KE2A 5IT9Z 1RI7A 1MD0A 1LEBA 3WTSC 3DPLC 3CO7C 1ZREA 3VB2A 2YSRA 3F8MA 2OD5A 3RPQA 3L7WA 2W84A 5FLXK 1UB9A 1KYWA 1SMYF 2W25A 3CO6C 1KYZA 1R23A 4A0XA 1TQPA 3BP8A 5CVJA 1JGSA 1L3LA 2LDUA 3JTGA 2V1XA 4HF2A 2F5CA 1K7AA 2J5OA 1CF7B 1MZBA 3J7AO 5E18F 4FHTA 2KRFA 2JPCA 4IF4A 4A0YA 3K2ZA 3Q5FA 2QENA 5EEGA 1R00A 3HRMA 3I0TA 3QU6A 5ED4A 3LQQA 3WG9A 1W4MA 4LGWA 4G7HF 5E8IA 2L02A 4S05A 3F8CA 4BHBA 3DXJF 5D8KB 3BJOA 3TDUC 1ZRCA 1RIOH 5DYMA 1KA8A 5D5WB 1ZGAA 3KETA 3RJPA 2NAZA 4P55A 1UHWA 1USTA 1W7PD 5D5XB 2Y0MA 4A6EA 2VT3A 1EH8A 1XCVA 3C7JA 1EH6A 2KIUA 2VBXA 1I27A 1QO0D 2BYVE 3GLXA 4M6XA 4XRFA 2MH2A 3TQNA 5LHHA 4LG0B 1IRFA 2HQRA 4CZZA 1J5YA 4YFNF 4KIBA 1TNSA 2OZUA 1V3FA 3VFZA 1IN6A 5EEHA 4IRIA 4I0AA 3L2CA 2PN6A 1ZH5A 4UVBA 2B0LA 2P4WA 3IL2A 1I5ZA 2XAFA 1ZLKA 4LG0A 1TW3A 1ZARA 2XUBA 1YG2A 1X3UA 3EETA 2XAGA 2LSOA 3RYPA 1R1TA 3IWZA 2VC1A 3ZMUA 4KDPA 1XGSA 1KQ8A 3WGHA 1F4KA 5HDGA 2K27A 1ZHFA 5LBQA 2YX7A 3J80Z 1S29A 2X0LA 5CYVA 4PZJA 3I58A 4MEYF 3WTWC 1U6GA 1T6SA 3FMQA 1HXDA 3ECHA 3HTSB 2CO5A 3ISPA 3WE3A 1Z91A 3R4KA 4AD9A 4O5VA 3LA3A 5J8FA 2DK8A 1YTYA 4I01A 3EYIA 1HKSA 1T39A 2CW0F 2HDCA 3E6DA 1OYWA 1S3JA 2HR3A 3I59A 3F6VA 2JPBA 3LWFA 4KYWA 3BOQA 5A2QK 4GGGA 3TO7A 4N9IA 4WWCA 3RTRA 1BC8C 2FQ3A 3MQ0A 2HKOA 1E17A 3S2WA 3I4PA 5LEJA 1HKTA 4Y15A 1SFXA 4OMZA 1J0RA 3LSTA 4I09A 5CJ9A 3HOSA 2M87A 3SZPA 4BH9A 3QP6A 1W5SA 2EFOA 3W6JB 3FMRA 2DI3A 3M9AA 2YU3A 3TGNA 3HIFA 3HRUA 5J6XA 4G6DA 5DV5A 3HSEA 4KUMA 1S7AA 1IN4A 3QOPA 5L3FA 4LLLA 1XDUA 4U7BA 1IXCA 4ETSA 1PDNC 1J7KA 4ENMA 3E6BA 3WODF 2W57A 4G94A 1L0OC 1HQCA 3JW4A 2EB7A 3ZN0A 3ZQ7A 1ZRFA 2FNPA 2QWWA 1YS7A 5E1WA 3P9CA 4HV6A 3GWZA 4K2EA 5LRRA 4I98B 1ON1A 2XRNA 3V7CA 5BMZA 2XAJA 2MD5A 3F6OA 3L09A 2FNAA 3LA2A 1WWXA 2HKXA 2UXNA 3E97A 2XASA 1P2FA 3WTTC 1STZA 3TOAA 2L01A 3COAC 3ZN1A 1K78B 4E70A 2OU2A 3WU1B 4L9JA 1B9MA 4N9HA 2GXGA 4EM2A 3GXOA 4GYGA 3WTUC 2PMUA 4BAYA 1Z1DA 3LFKA 4XLNF 1Z9CA 2O3FA 4B8XA 3J81Z 2X4HA 4RAZA 4YG2F 2HWVA 2G7UA 4P9UA 3I64A 3QPTA 1OYIA 2D1HA 4HX4A 1XGOA 1G3SA 1YQAA 2IW5A 4AIHA 2A07F 5FFZA 5FLXZ 1KU2A 5DDGA 1IAWA 2EFPA 1XCBA 3GFLA 3HSFA 2EV0A 3R0AA 2EFNA 2ZCWA 2VONA 2QBYA 3R61A 1R5HA 2NNNA 4KNYA 2BGCA 3GW2A 3ULQB 2GWRA 4I7HA 2L54A 1NHAA 2YPRA 1ZN2A 1GVJA 1CF7A 3DV8A 3FXQA 1TBXA 3E6CC 2R7DA 4L9VA 3KP2A 2RQPA 2MLKA 4WXCA 1BIBA 4HW0A 3L00A 5AONA 4ASNA 1O7FA 2ESNA 2E7XA 2KJBA 2BEOA 3JSPA 4BYYA 1IN8A 3ABTA 4LJZF 2O0YA 3F22A 2Q0OA 4R8HA 2C6YA 5BS6A 3VODA 4HA8A 2QQAA 3V7SA 2PLYA 3WGIA 4HZFA 1SMTA 1MJAA 2H09A 3SFZA 2STWA 2O6GE 5HS8A 4O3MA 3KZYA 5DCMA 5D5UB 2OA4A 3JSOA 2YR2A 4PCQA 1RNLA 3HOTA 1FY7A 3F21A 1QNTA 1TW2A 2CYYA 4DQ2A 2ZO4A 3V8JA 3CUQA 1BI2A 5L3CA 3M7GA 3IWFA 3V8LA 4KA4A 4HF1A 5L3BA 4TV7A 1OMIA 2H27A 3SXYA 5K5OA 2XGXA 2HQNA 1FYKA 2RC4A 4QLCU 4ZH4F 2FBKA 1SAXA 1H9GA 1FLIA 4IPAA 5D5VB 3I71A 2ZNZA 3F23A 2O61A 1OPCA 4MNUA 2EA4A 2A3SA 4RB3C 3NEUA 3CLOA 1HSJA 2L4AA 4MTEA 3FZVA 3VEPA 2EV5A 2DO7A 2EA2A 2OQGA 4BHPA 3NRVA 2VOOA 1HSTA 2P6SA 4HYEA 1P92A 1BJAA 4N0BA 1YW8A 3ZMZA 2PMHA 2K4JA 2JTVA 2PI0A 5H6RA 1F1ZA 3RYRA 1IN7A 2F5EA 1R5GA 4ENKA 3H92A 4ZYGA 5LHIA 1DUXC 3KEOA 3IHUA 4RS8A 3J81K 5HS9A 3EDPA 4EM0B 3B02A 3DEUA 1GXPA 2V1UA 2W85A 3J80K 4M73A 2Y48A 2XV4S 4RGXA 3E6MA 2MH9A 5HS7A 3ERED 2YX4A 4OIQF 3T8TA 2OZ6A 1P4AA 3FM5A 1FP2A 5ERIA 1PP7U 2ELHA 1K78A 1U5TB 3WTVC 5LGTA 5HDNA 2GZWA 3QPHA 2NS0A 5BOXA 2ESHA 1P4WA 4EJVA 5LGNA 2PQ8A 1QBJA 3HUGA 4UUVA 2XIGA 3DFGA 2KIFA 3M8EA 3WU0A 1J75A 3Q9SA 4P9FA 4UV9A 3D5LA 1U8RA 1Z7UA 5CVRA 5TRDA 1T98A 3ZMDA 3AAFA 2A5YB 4CXFA 3FWEA 1G6NA 5HLIA 2GA2A 1O3QA 4ZYHA 5E8GA 2RKHA 5E1ZB 2VBYA 3PQKA 1BIAA 3EYYA 1U5TC 2Q8KA 3MZYA 2CGPA 4JK1X 1BBYA 4RB2C 2M5WA 1FOKA 1XD7A 2DLLA 2H6CA 3MZHA 1Z05A 4A0ZA 4RB0A 1LDKB 2F5FA 1ON2A 4U0WA 2PG4A 5AIPA 5FB2A 1BC7C 2IRFG 4L5IA 2IJLA 3U9GA 1Z6TA 4HLYA 2VODA 2FMLA 4LB6B 4MHGA 4I0BA 3MFKA 2KJCA 3T0YA 2JRTA 2VXZA 3EUHA 1KU9A 4HDVA 2JSCA 3O6BB 1SD4A 4XBFA 2M1BA 4S04A 1R7JA 3G73A 4MQ9F 1FSEA 4OMYA 3REOA 1KQ9A 3FMSA 4Q4ZF 4MTDA 1G3WA 3W6KB 3GUDA 4M74A 4PDKA 3LAJA 3M1EA 5L3EA 3LA7A 5F6FA 4CICA 3RKWA 1XSVA 2P5LC 4I02A 4EV0A 1B59A 2PBIA 4IRHA 5D4SA 1QPMA 2JT1A 1T2KA 3ZMSA 1K79A 3GZ5A 2P5KA 1YFHA 2DFIA 3KCCA 3DKWA 4HQMA 1QQIA 2QQ9A 4CO8A 2Z3YA 1R1UA 2WTEA 4R1HA 3ECOA 2HGCA 3DQVC 5ICEA 4OIRF 1BOAA 5K5QA 4Q47A 1O57A 5CLSA 5HDKA 2QM3A 3D0SA 2P6TA 5FD6A 3F8NA 4EMSA 1FYMA 1MDMB 4EJUA 1O3TA 3DF8A 2QLZA 1MKMA 2V79A 4Q5SF 5HOOA 1JE8A 4EQQA 5LHGA 2MLGA 3IRRA 1B1BA 3P9KA 4AIKA 2UXXA 5D6EA 3R60A 4P96A 5D6FA 4LLNA 4Q48A 5IT3A 3C1DA 4LB5A 3PQJA 2LF7A 2ZKZA 5CVVA 4LFUA 3B73A 4ZZDA 4OOIA 3F8FA 1LB2A 1AWCA 4NB5A 3WTYC 2COMA 2A69F 3QRFF 3HSRA 1LVAA 3BPVA 1O3RA 3GFJA 4NHJA 1R36A 1IZ1A 1LQ1A 1FP1D 4H0EA 5E17F 3SHFA 2HS5A 1D3YA 2OBPA 1W7PB 2FA5A 1HW1A 5TJJA 4L0ZB 4AVPA 1B4AA 1FSHA 2D45A 4I2OA 3O2PE 4YIIA 1FT9A 1DP7P 2BBYA 5DCFA 3FF5A 3QU3A 1T0FA 2VBWA 2DQLA 1LJ9A 1UHMA 3BZ6A 4G7ZF 1KU3A 2E1NA 1ZG3A 4EGZA 4NQWA 3Q9VA 4WF2A 1ZYRF 1ZRDA 1GXQA 1P6RA 4RB1A 2EWNA 2VE8A 1EV7A 4B09A 2QBYB 1AOYA 1XN7A 4CDGA 3RDIA 5F1RA 4R79A 2F5DA 1RUNA 3QAHA 3GEZA 5FGMA 2P7VB 3K1MA 1DPRA 2KKOA 4UVAA 1R1VA 5BQTA 4JQFA 3P9IA 2LKPA 2A61A 4RGUA 4ZZLA 2Y75A 3IKTA 2IVMA 2VE9A 1KQ0A 3HHGA 4Z2YA 2VOPA 2GAUA 4EJWA 5IT9K 3U2RA 1SD5A 4ESFA 5E1XA 2K86A 2WV0A