3KZZA

Crystal structure of snap-tag bound to its substrate benzylguanine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
158
Chain Sequence
DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPAHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 158
sequence length 176
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzzA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzzA01
2X4HA 2JZYA 2XVCA 3CTAA 2DBBA 4HAMA 1ON1A 2HDCA 2QENA 3F3XA 3SZTA 2JT1A 1AOYA 3IRRA 1G3WA 1TQPA 4RB0A 1LDJA 2XRNA 3LQQA 1QPMA 1IN4A 3EDPA 2VT3A 4MTEA 2H6CA 3NEUA 5ICGA 4KDPA 1FYLA 2CO5A 3BPVA 2CW0F 3HOSA 1D8KA 2ZMEA 5ICCA 3F72A 5H6RA 2HGCA 2W25A 5EEGA 3MWMA 1P4WA 1ZRDA 2A68F 1FZPB 4ESFA 1MJAA 1IRFA 5L3BA 3SQNA 2F5CA 2A3SA 4EVIA 2YPRA 2DK8A 3RIRA 4OMZA 4KT5C 3V8LA 1YS6A 3RKYA 3T1BA 2EWNA 5JVTA 3TO7A 3HHGA 3SZPA 2KJBA 2MH2A 1W7PB 1PDNC 3KEQA 3TO6A 4G6DA 4CICA 5E18F 3K1MA 3MZYA 5HDGA 2HR3A 4N0BA 3VOEA 4F7ZA 1MJ9A 2YR2A 4MHGA 3FHZA 2V1UA 4RAZA 4FT8A 2HYFA 1G3SA 1XGNA 1XSXA 4I2OA 2EA4A 4G7HF 1J75A 1IRGA 3F8FA 3KETA 2HTJA 5L3CA 3ZN0A 4JQFA 3WGHA 2EV0A 5DYMA 1KU7A 3OV8A 3H3ZA 2FNPA 1VTNC 2RC4A 1R1TA 2Y0MA 2XHKA 3EYIA 4A12A 1XMKA 2ESNA 1XCVA 5LLQA 3H92A 1S7OA 1V4RA 2M8EA 1GXQA 5BS6A 1YFHA 2IA0A 4UV9A 2J5OA 1QZYA 4IVNA 3MFKA 3ROUA 1IN7A 3DF8A 1FP1D 3V8KA 3I0TA 3J81Z 4OMYA 1F5TA 4S05A 3IKTA 3B73A 1T2KA 3D0SA 2STTA 5HLGA 1ODDA 2XV4S 2G9WA 1W5TA 3HRTA 4XBFA 1XGMA 5LGTA 1LEAA 3S2WA 2RKHA 2JPBA 3ZMTA 3M8EA 3ABUA 2DW4A 1EH8A 3SFZA 3CUQC 3H3UA 3LA3A 4M72A 2FOKA 2GQQA 2OU2A 2XIGA 5IT9K 2O6GE 2XKOA 2ZCWA 3K69A 5K1YA 2QYOA 3GXOA 1IZ1A 1XB4A 3T0YA 3CO7C 2W84A 3Q5FA 4RB1A 2JRTA 3QU3A 1UHMA 2C6YA 1W7PA 1YQAA 2QM3A 4P96A 6PAXA 3LQRA 2KIUA 2VT2A 4L9TA 1BIBA 2COMA 2KIMA 4ESJA 5IT3A 3I59A 4U0WA 1BI2A 1ZGJA 2EFPA 5E1ZB 3GFIA 2CSOA 2DQRA 3B02A 3ZQ7A 3GZ6A 3J80K 5D8KB 4KNYA 4CGZA 1IW7F 3I64A 2E1CA 4K2EA 1U8RA 4P5OA 3QRFF 3FM5A 4L9JA 1I27A 5FD6A 1LQ1A 4RGXA 1ZHFA 2FSWA 1F1ZA 2HTSA 1ZRCA 3KP5A 2VOPA 3BROA 2HYGD 1QO0D 3KP4A 2OD5A 4EJVA 1ZG1A 1HW5A 2LDUA 2OZUA 4HQEA 2CG4A 3HRUA 3KLNA 2H09A 5FLXK 2A6EF 2Q2EA 3P9IA 4GYGA 4Y17A 2EFOA 1USTA 3FMRA 2PN6A 2VE9A 4G8XA 4U0VA 5TRDA 3WTXC 2DPUA 1K78A 3E5XA 1CF7B 1J7KA 4KICA 2PG4A 2DFIA 2V1XA 3DKWA 2ELHA 1Z9CA 4P9FA 4G9YA 1W7PD 2XAJA 1TLHB 2B0LA 2EV5A 1SAXA 2Z5UA 3F8BA 4M6YA 1U5TC 1V3FA 3GWZA 1HBXG 2GZWA 4R8HA 2K4BA 2D2WA 3QPTA 2M5WA 4BAYA 1YW7A 1SD4A 3JW4A 5ICEA 4EV0A 1T0FA 1BJAA 1MKMA 2WC2A 2BE5F 5DUKA 3U1DA 2Y48A 1BC7C 1KA8A 3C18A 3DQVC 2F2EA 1DDNA 4G6QA 2PLYA 3KP6A 1BI0A 1B9MA 2PBIA 2RDPA 4RAYA 1FC3A 4D0PA 1HQCA 2L3DA 4EM0B 3E5QA 4FX0A 3IC7A 3GFLA 2BEOA 4HA8A 4KFCA 5J6XA 3HSFA 2YSRA 1GVJA 1FSHA 2BV6A 4XSZF 3ZPLA 1UB9A 2CFXA 1R7JA 2F5FA 1YW8A 2ACJA 4YG2F 3DP7A 2W85A 5LHHA 1IN5A 2HOEA 4EJTA 2NYXA 1EH6A 1MGTA 1YTYA 5J8FA 2MLGA 2ZMEB 3F8CA 1Z6TA 2ESHA 3ZMUA 2UXNA 3L2CA 3HIFA 4UVAA 4G7OF 5HS7A 3WTVC 1IAWA 4LJZF 4NHJA 2P5KA 3I5UA 2FF4A 1H9TA 1UCRA 1KQ9A 1R1UA 4Q5SF 3EUHA 1ZARA 5BOXA 2KIFA 4WK8F 3M7GA 3WTZA 3L00A 4IXAA 3MAJA 1R36A 4G94A 3WG9A 5DUIA 1XCBA 1K7AA 5KK1A 3TO9A 2KJCA 2HKOA 3WODF 4JBAA 2XAGA 3GX4X 2WTEA 1Q1HA 1T38A 4QWQA 3D5LA 5D6EA 3ULQB 5A2QK 1J59A 2UZKA 4EM2A 4G7ZF 1YLFA 5BQTA 2PEXA 1ZG5A 2IVMA 3FMQA 2J5PA 2PJPA 1Z7UA 1UHWA 1JXSA 5D5XB 2P6SA 2GXGA 4O6JA 1U3EM 1D5VA 1ZLKA 3DPLC 4Q47A 3CO6C 4Z2YA 1P6RA 2GXBA 2LSOA 1FOKA 1ZGAA 1R1VA 3KE2A 3QOPA 4ZH4F 1D8JA 2DK5A 2V9VA 3ECHA 5H20A 1T6SA 1J9IA 3V7CA 1Z6RA 1O3SA 2MLKA 2QBYA 2FBHA 3WTTC 2QZ8A 1HKTA 1O7LA 3JTHA 2M1BA 4CXFA 2W57A 1FY7A 1BC8C 1XDSA 2H6BA 1B9NA 5HS9A 1REPC 3RI4A 5HLIA 3K2ZA 5H6QA 2XGXA 3ZP5A 4KN4X 1QQIA 4XRFA 2E1NA 5ILSA 4AIJA 2VBWA 5AONA 2LKPA 1PP8F 1O3QA 3GYHX 2VODA 3WTWC 3EYYA 1T98A 2NRAC 2JPCA 4ENJA 2VBXA 2QQ9A 4BHBA 2EFNA 2ZJ2A 1ZYRF 2ZXJA 1SFUA 2GIVA 1IF1A 1JHFA 3KZZA 4QLCU 4HOBA 2RVCA 2NNNA 3FMSA 1U5TB 5HOOA 4CHUA 3JAMK 2DQLA 2K4JA 3CUQA 1B59A 3F6VA 3QP5A 4OIOF 3C3WA 3E6CC 2Z33A 3RKWA 3REOA 5CVVA 4XSXF 1NHAA 3GUDA 4KIGA 1DPRA 5DDGA 1BN5A 2MH9A 4ZYHA 3TOAA 4XLPF 2HQRA 1J5YA 3F22A 3N4MA 4EMSA 3KCCA 3I59B 3HRMA 5LBQA 2PI0A 4UVCA 2ADUA 3MZHA 4RS8A 5LGUA 2DT5A 1Z91A 1LDKB 1OYWA 4HDVA 2Z9OA 3CLOA 1HSJA 2ETHA 1PP7U 4A5NA 4OOIA 3COAC 2NS0A 4LLLA 1FWZA 3IKVA 2EV6A 4ENKA 2IA2A 1GXPA 2LNBA 3MEXA 3F23A 1SMTA 2AS5F 3IWFA 5LEJA 4PGHA 3DPTA 2OAZA 3HUGA 4YFNF 4RB2C 4KUMA 5F64A 5HLHA 1QNTA 2D1HA 5DD4A 1WQ2A 2P5LC 4MEXF 2XASA 3HSRA 1ULYA 1MD0A 1S8NA 2EK5A 4AIKA 3K9TA 4N9IA 3E6BA 3GLXA 2EA2A 3O6BB 4LD5A 1DPUA 2Y75A 5FD5A 1J2XA 1K78B 1G3TA 1YYVA 3V7RA 2Z3YA 4L5IA 2DLLA 3NQOA 1FX7A 2FE3A 1LB2A 2L4MA 3KP7A 1ZH5A 3R0JA 4YFKF 5HVQC 4YIFA 3E97A 1XDUA 2F5EA 5JI6A 4L9VA 1U5TA 1HW1A 4HX4A 2DI3A 2V79A 4EJUA 1C0WA 3BDDA 1FP2A 4M74A 2TDXA 5ICFA 5BMZA 5L3GA 2K27A 4LG0B 1Y0UA 2IPQX 1LNWA 4GCVA 1USSA 3FWEA 2VOOA 1PUEE 1A04A 2HZTA 1KYZA 3EQLF 5CVUA 4NB5A 1KU3A 1ZAOA 1FNNA 4OIRF 3I53A 1RUOA 3ZN1A 3M9AA 3LA2A 3L9FA 1R22A 1QZZA 2HS5A 3Q9VA 2YX7A 4BH9A 5BPIA 1RUNA 4IRIA 2V6CA 3OOPA 4A0YA 1E17A 4BHPA 2KKOA 3GO5A 4ZZLA 1OR7A 2OZ6A 5E8GA 5EEHA 2JTVA 2GWRA 1MDMB 4Y15A 4RGUA 2KRFA 5J8CA 1IN8A 4M6XA 5DEQA 2IRFG 2O61A 4AIHA 2R7FA 3WU0A 5AIQA 3R6SA 3GEZA 1KU9A 5DV5A 4LFUA 5DCMA 2FQ3A 4CYDA 1R5HA 2DU9A 3FM3A 1WKMA 5E1WA 4BQAA 1B6AA 1X3UA 4KYWA 4H0EA 2WWYA 1U2WA 5LEKA 2OQGA 3KZYA 1KGSA 2LF7A 4AVPA 3F21A 2L4AA 1QGPA 2ZFWA 4OU0A 2F5DA 2OQRA 2EJRA 4LGWA 2JSCA 3HOTA 2EB7A 5CVRA 3RPQA 1LDDA 5D8LB 2O8XA 3GF2A 2CGPA 4O5VA 4HV5A 1O3TA 5ED4A 2FEZA 3BY6A 4WXDA 3FX3A 3T8TA 4LG0A 5ILUA 3HSEA 2BBYA 3RYRA 2FMYA 2VBYA 5CVJA 1FT9A 2R3SA 2ZNYA 4HYEA 4FHTA 4YIIA 3P9CA 2FXAA 3F6OA 2HFHA 2FRHA 1ZN2A 2QBYB 3L7WA 4PCQA 1P4XA 1TQIA 1ZRFA 4IF4A 2A61A 2W24A 1SD6A 2K86A 4OIPF 2FU4A 2O03A 5JR3A 2AXLA 2MA3A 4RGRA 4L9NA 1MDMA 4Q48A 5F1RA 1YG2A 2QVOA 2OA4A 5KVRA 5IT9Z 4ASNA 3QP6A 1LEBA 4EM1A 2P4WA 3DXJF 3E3VA 1KQ0A 3HHHA 1TW2A 4PDKA 2PFBA 3LA7A 4HF1A 5TJJA 3KLOA 4HX8A 2V1DA 5LHIA 2RN7A 1FBUA 1R5GA 2Z99A 3CUQB 4LK0F 4RB3C 3P7NA 2FBIA 4UVBA 3BPXA 5E20A 2MBFA 1Z05A 3RYPA 3RTRA 3JSPA 3IHUA 2K7LA 4UHTA 3PFIA 2HEOA 1FBSA 2IJLA 3J80Z 1XD7A 4ON0A 1F9NA 4M73A 4BNCA 4GO1A 2H27A 3W6KB 3V4GA 3MQ0A 1S7AA 1YO5C 3ECOA 3J81K 4HW0A 2QLZA 3P9KA 1XMAA 4ZZDA 5FB2A 1HXDA 4A0XA 2O3FA 3DV8A 1TQMA 3HTUA 2M45A 1G3YA 1OYIA 4U7BA 3VEPA 1LJ9A 4BXUA 1E2XA 1R00A 5FLXZ 2FNAA 3W6JB 4R1HA 4IRGA 3O3KA 5D5WB 1BM9A 3EETA 2A5YB 4PGGA 1O3RA 3DEUA 5F6FA 3CUOA 2RQPA 2D1VA 1UFMA 4MEYF 2PMUA 1O57A 2FA5A 5CVIA 2XAHA 4WF2A 3SXYA 2P7CB 2A07F 5AIPA 1I6XA 2ISZA 1IXRC 2GA2A 4A6DA 5LGNA 3WGIA 5DD8A 1WRJA 1BI3A 1FPQA 3BWGA 1R58A 4FX4A 1K6OA 2L01A 4WX9A 3BJAA 2MD5A 1B4AA 1IUYA 5E1XA 1TBXA 2P6TA 5ERIA 3BP8A 3RJPA 3CJNA 1ONVA 2O0YA 3PQJA 1D3YA 3VODA 1OMIA 2M87A 1WWXA 3E6MA 5E17F 4GYIA 1IXCA 1L0OC 2YU3A 4IHTA 1U6GA 2WV0A 1G6NA 2EFQA 5HS8A 5FFXA 4XLNF 5CYVA 3E6DA 3ISPA 2CYYA 3BOQA 4KMFA 3V7SA 4ETSA 4GXOA 4HX7A 2HQNA 4LK1F 3N97A 3IWZA 2MC3A 4IPAA 3T5XA 4HQMA 3NRVA 3K1NA 4E70A 1H0MA 3TDUC 2M30A 1OKRA 1CGPA 1HKQA 3MCZA 1S6LA 5LHGA 1YIOA 5FFZA 3IL2A 3F8NA 3BJ6A 2VE8A 3QAHA 3KP3A 3HRSA 1IN6A 2L54A 5D4RA 3ZMZA 3RKXA 4ENNA 4IHSA 3WE2A 2EFWA 1P4AA 4WXCA 1BOAA 2VC1A 2CQKA 4MQVA 4Q4ZF 4I98B 5DCFA 3FXUA 1ON2A 3CDHA 1RNLA 2XKPA 2UWMA 4LB6B 3GW2A 1P2FA 5DCMB 3I58A 1MZBA 1O7FA 1SD7A 3SHFA 4IJAA 3FXQA 2QQAA 2ZKZA 4O3MA 5A2QZ 2X0LA 4L0ZB 3TQNA 3TDZC 5JFRA 4ZYEA 5K5OA 1DUXC 2QUFA 3M8FA 1RIOH 3C1DA 4L5JA 4HLXA 4I09A 1IXSB 2G7UA 4M9XA 1XGSA 2NNYA 4I01A 1F4KA 4CZZA 1H9GA 4GGGA 2DTRA 2XUBA 1G4DA 4B8XA 5D4SA 4HBLA 1YW9A 2HKXA 1BIAA 3GFJA 2OBPA 2Q0OA 3G3ZA 4WXHA 1EH7A 3RDIA 3V8JA 4KIFA 4MGRA 3T8RA 4CO8A 4TV7A 1STZA 1RI7A 3R0AA 2ISYA 3J7AO 2VN2A 2P7VB 1AWCA 1FYKA 1SFEA 3HYIA 4EJOA 2CWEA 3K1PA 2BYVE 1JGSA 3I4PA 2ZO4A 2XAFA 3QU6A 3U2RA 4A0ZA 4ENMA 4NQWA 4EGYA 3ML6A 1YS7A 4R79A 1LVAA 1RZ4A 4EQQA 3VFZA 5D5UB 4A5MA 3FXRA 4HZFA 4HDUA 3I54A 1R23A 4N9HA 3GZ5A 2ZBKA 3TGNA 4L18B 3LFKA 3JAMZ 4LMYA 2STWA 5K5QA 3LAJA 4I02A 2GAUA 4A2UA 1W5SA 3M1EA 1I1GA 2G7HA 1U78A 1MJBA 4HF0A 1ZLJA 2P8TA 2E7WA 4P9UA 3DFGA 4UXNA 2RGVA 1XSVA 2QQBA 2R7DA 4M71A 1JE8A 4Y13A 3RPUA 4PZJA 2A6HF 3HTSB 5HDNA 1GHCA 2FBKA 1KYWA 1HW2A 3TKYA 1B1BA 2P5VA 4LLGF 5D6FA 3R60A 1WI9A 2K02A 3L09A 4CDGA 4YFXF 4ZYGA 4U7DA 4I7HA 1L3LA 5LRSA 3I71A 4S04A 5ILVA 1W4MA 3IRQA 5FO5A 3WTYC 1OYYA 4WWCA 3WGGA 1BBYA 4HF2A 4EGZA 2XAQA 4JK1X 5CJ9A 3G73A 3U9GA 1FLIA 4KIBA 2DO7A 3R4KA 4AD9A 4RGSA 2YX4A 3GVAA 4LB5A 5HDKA 1HKSA 1XN7A 4HLYA 3GFMA 1DP7P 2RV8A 3WU1B 5D5VB 1SMYF 1SD5A 2IT0A 4OINF 1QBJA 1EV7A 1SFXA 3JTGA 4EJWA 3E5UA 1T39A 2H94A 4M9SA 4U0YA 3ERED 3WTSC 2ZNZA 4IRHA 4BYYA 1I5ZA 2D45A 1TNTA 4UUVA 4WCGA 2GA1A 2BGCA 2VBZA 2A69F 3PQKA 4B09A 4ESBA 1TTYA 2IP2A 1J0RA 4AWXB 2VONA 2VXZA 1K79A 5BPDA 5E8IA 1Z1DA 3WTUC 1ZREA 2VC0A 3KEOA 3QPHA 5L3EA 1S29A 2HWVA 5L3FA 4ZYDA 5L3DA 2FMLA 3KP2A 1FSEA 1ZG3A 1P92A 2LF8A 5CLSA 3FZVA 5K5RA 3ABTA 2RNJA 4MQ9F 4I0AA 4UNOA 4HV6A 2XROA 5LRRA 1OPCA 1KQ8A 2Q8KA 1XSDA 3KFWX 1S3JA 1KU2A 1FBQA 4UV8A 1JHHA 3ZMSA 4KMUX 1TW3A 5JHUA 3FF5A 3WE3A 2DAOA 3ZMDA 2QWWA 1I1SA 4P55A 2IA1A 4M9ZA 3BJOA 4DQ2A 2E7XA 1CF7A 3JSOA 1WSUA 1TNSA 3TOBA 1HSTA 3ZMVA 2L02A 3C7JA 2IW5A 3LWFA 3AAFA 4OIQF 3K0LA 1BI1A 4KN7X 2DPDA 2UXXA 5FGMA 1XGOA 4MTDA 3BZ6A 4U88A 4DNCA 4KA4A 4L0YB 3R61A 4BHCA 2NAZA 4A6EA 2PMHA 4I0BA 3Q9SA 4LLNA 3VB2A 3ELKA 2PQ8A 4MNUA 3LAPA 3O2PE 3F8MA 1FYMA 3LSTA
chains in the Genus database with same CATH superfamily
2Y2ZA 2R5YB 1TWFJ 4DYCA 2X4HA 3P1XA 1JT0A 2CT1A 2RREA 1P9QC 1HR0E 2JZYA 4XKWA 5B5EC 2GOMA 3K70C 1X1PA 5KL6A 3JREA 2KONA 3PIOF 2XVCA 1JUSA 3CTAA 4ZYAA 2VPRA 5GPAA 2DBBA 4HAMA 5IYDJ 4JI8E 1MNEA 3N05A 4RDUA 2DLKA 1ON1A 5A2QC 1MSFC 2HDCA 2QENA 5B3SH 1HA8A 3F3XA 3IH4A 3W2AA 3SZTA 2JWOA 2JT1A 1AOYA 3AG1H 5EZGA 4N4NB 3D5SC 3IRRA 2N3GA 1G3WA 2DA7A 1YZ9A 1TQPA 4RB0A 1LDJA 2XRNA 3LQQA 1QPMA 1IN4A 3EDPA 5DM6F 2VT3A 2YU8A 4MTEA 2DYRH 2EOQA 2IS6A 1X1DA 1Y0NA 3IWCA 2H6CA 3NEUA 5ICGA 4KDPA 2XGDA 3HEFA 3K4NA 1EJ9A 2DYSH 1FYLA 1MMAA 2CO5A 3BPVA 2CW0F 4C3IJ 2ELZA 3HOSA 1D8KA 2GOXB 5B1BH 2DMUA 2Y9YA 3DJWA 2ZMEA 2B9SA 3H1CA 3FK6A 5B1AH 1O0WA 2MABA 4O43A 2EMIA 2E5NA 5ICCA 5DM7F 1HOMA 3F72A 3MN2A 5H6RA 5A6AA 2HGCA 5KAFC 3MSWA 2W25A 5EEGA 2LVHA 3MWMA 2KDOA 1P4WA 2VLAA 2E5LE 2E1MB 2X85A 1ZRDA 1VF9A 2Z1DA 4C9YA 2L7ZA 2A68F 1FZPB 4ESFA 3EUHC 2MG4A 5JLXA 5LMUE 1QHHD 1MJAA 1UBDC 5IPAA 3HPHA 4BXXJ 1IRFA 2Y30A 3GLLA 3SQNA 5L3BA 4F55A 1TC3C 2F5CA 3PO3J 2JP9A 2DJNA 2XGCA 2A3SA 1TL8A 4EVIA 4HSRA 2YPRA 4QPOA 2DK8A 2JA8J 3RIRA 4OMZA 4KT5C 3V8LA 1YOVB 1AA7A 4F93B 1YS6A 3RKYA 5EYRA 3C2HA 3T1BA 3LSKA 1A1LA 2EWNA 3S93A 5JVTA 3TO7A 3HHGA 3SZPA 2KJBA 2MH2A 1ZU1A 1W7PB 1PDNC 3OSGA 4DKKA 3KEQA 3CZ6A 4A3FJ 1WZ2A 3TO6A 2Y69H 3HGYA 4G6DA 2NABA 4CICA 5E18F 5AE2A 3K1MA 3MZYA 5HDGA 4XONA 2HR3A 4N0BA 3VOEA 4F7ZA 1MJ9A 2YWQA 2YR2A 4MHGA 5KCMA 3FHZA 2JA6J 2V1UA 3BCAA 4RAZA 4FT8A 3HXLA 1YRNB 4NQWB 1B72A 2E2JJ 4HRIA 2M7AA 2DA4A 5GP9A 1RPWA 2A6TA 4LF6E 2E1OA 3QYBA 2DLQA 2HYFA 2QCOA 3MHSC 1G3SA 3B6AA 1XGNA 1XSXA 1VQ8I 1WJDA 4I2OA 2DOFA 3BR2A 2EA4A 4G7HF 1J75A 1IRGA 3F8FA 3KETA 2HTJA 5L3CA 3ZN0A 3EPZA 4JQFA 2L8TA 3AV0A 2LLKA 5FKKA 4BS9A 3WGHA 4XQFA 2EV0A 5DYMA 1KU7A 2CV0A 2ID6A 4AYBA 4L5EA 3OV8A 4FK5C 3H3ZA 2FNPA 5KAIC 2NVXJ 3JAMC 3MKLA 2E2IJ 2EN8A 1VTNC 2OCCH 2DFEA 4PJLA 2RC4A 1R1TA 3MKZA 2K85A 2Y0MA 2XHKA 2W00A 4Y3OA 3EYIA 4A12A 1ETOA 3DBLB 1XMKA 5C3EJ 1X1AA 2ESNA 3I56I 5GADJ 4E7JA 1A1HA 2EZLA 2HOSA 2KDZA 2QSGX 3MZ8A 1ZELA 1XCVA 3ABLH 5LLQA 1GT0C 3H92A 4XMYA 5KHDA 1AKHA 2RQLA 2N8XA 4E7ZA 1S7OA 1V4RA 2KT0A 2YRHA 5F08A 3MKWB 1YITI 5KL5A 4KISA 3BTJA 1IRXA 4BL0B 2EPPA 2M8EA 2VL8A 1WJFA 4FETA 1GXQA 1Q1VA 3SZGA 5BS6A 4DR4E 4BDZA 3G71I 3CC7I 1YFHA 3S1QJ 2IA0A 3BTIA 4UV9A 1WCMJ 2J5OA 2IEKA 1QZYA 5FRNA 4R2QA 4IVNA 3MFKA 2L3CA 3ROUA 1VFCA 2AQFA 2F48A 1IN7A 1UG2A 2ELYA 3DF8A 4MO7A 3UK3C 2ZMEC 1FP1D 3V8KA 4B3AA 1EF4A 3I0TA 3J81Z 2L0KA 2ICWG 1F5TA 4OMYA 4S05A 3IKTA 3B73A 2TRTA 3CF2A 4XKCA 3D0SA 4XN0A 1T2KA 3AL0B 1S7EA 2STTA 1BOBA 5HLGA 1ZBQA 1ODDA 2XV4S 4AU7A 4EEFG 2M9HA 3K6GA 2G9WA 2M0CA 1W5TA 3HRTA 4XBFA 1VNDA 1XGMA 5LGTA 4A3BJ 1PJQA 1LEAA 3K2AA 3S2WA 4PJMA 2RKHA 2JPBA 3LSJA 3ZMTA 3M8EA 1MMDA 3ABUA 4XNFA 3L2WA 4IO9F 2OJED 3B6CA 2DW4A 1EH8A 2XB0X 3SFZA 3CUQC 4B1RA 2QA4I 2E1MA 3H3UA 3LA3A 3LSGA 4M72A 1WHQA 3CC4I 2FOKA 2GQQA 2OU2A 2QSFX 2XIGA 1A1JA 1X48A 5IT9K 4DR3E 2O6GE 5J1YA 4JP0A 2EZIA 2XKOA 2HPMA 2EPAA 4QTRA 2ZCWA 1RC7A 3F6HA 2LREA 3GTOJ 1YYOA 3K69A 5K1YA 2QYOA 3GXOA 2X6OA 1IZ1A 1XB4A 1YYKA 3T0YA 3CO7C 2KPMA 3M4OJ 2OUMA 1FJLA 2W84A 3BGHA 4R2CA 3VYYA 3Q5FA 1QRYA 4RB1A 1X3CA 2JRTA 4XN3A 3QU3A 1UHMA 2C6YA 4NBQA 4AM3A 2B3TB 1W7PA 3HB9A 1YQAA 4QSHA 2QM3A 4P96A 2EMCA 3GCMA 6PAXA 4WSGA 3JRCA 1JJ6C 2EMHA 3LQRA 2KIUA 2VT2A 4DV4E 4RM3A 1POGA 2NS7A 3BR3A 4L9TA 3PL8A 5EEAA 2VUMJ 1NH3A 1I50J 3ZQLA 2VI6A 1RRJA 1BIBA 4R2PA 2COMA 3ADLA 2KIMA 4ESJA 5IT3A 3I59A 4P1WA 4U0WA 1BI2A 1ZGJA 1H89C 1LVKA 1TWCJ 4JI1E 2EFPA 2XPUA 5B66C 4C2MJ 5E1ZB 4DR5E 2E19A 3GFIA 2CSOA 1RESA 3OYGA 1IQSA 1VQMI 2DQRA 2EM7A 2YTEA 3B02A 3ZQ7A 2HPIA 4DBRA 1G59A 3GZ6A 3H5NA 2EN6A 4XK4A 4BE2A 3J80K 3C4TA 3JU0A 5D8KB 4KNYA 2F4MB 4CGZA 2V86A 1IW7F 3I64A 2E1CA 2WAEA 1TWGJ 3I3LA 1BW6A 4K2EA 1U8RA 4GEQB 1D1AA 4P5OA 3QRFF 1SVMA 1QA6A 3FM5A 4L9JA 1TF6A 2DMPA 1I27A 2DMYA 5FD6A 1LQ1A 1YJWI 4RGXA 2ZFUA 4P78A 2QKMB 4BJ5C 1ZHFA 4NC6A 3GBGA 2FSWA 1F1ZA 2EMWA 3BR5A 2MKDA 4DR1E 3OYJA 2HTSA 1ZRCA 1R49A 3ECRA 1HDPA 3KP5A 2VOPA 2I5UA 3BROA 2HYGD 2GIZA 2EMXA 1QO0D 2DCEA 2OD5A 1I3AA 3KP4A 4XICA 4EJVA 1PYVA 1G2HA 2V83A 2WA0A 1ZG1A 2LY9A 2V6EA 2XAUA 3AG2H 1HW5A 1FEXA 2LDUA 2OZUA 1R6RA 4HQEA 1DU6A 2CG4A 4XM3A 3HRUA 3OYHA 2LBSB 2L7MP 1X1CA 3KLNA 2H09A 1NG7A 1JKRC 5FLXK 2EL5A 2L3JA 5CQGA 2A6EF 3QOEA 4DW6A 2Q2EA 1RR8C 1WJCA 4GFBA 3P9IA 4GYGA 4X9JA 2Q8UA 2VB6A 3OR2C 2EQRA 4Y17A 2EFOA 4ZTJA 3HQ1A 2MC5A 1USTA 2YU5A 3CJRB 3FMRA 3DTIA 2PN6A 1XX5A 5LD2C 2VE9A 2HXOA 2EL6A 5FKLA 1EKEA 5DS9A 4G8XA 4U0VA 5TRDA 2D5VA 3WTXC 2DPUA 1YJNI 3BR1A 2ENCA 3F6GA 2PRTA 1BA5A 1K78A 3AG3H 3H5RA 3E5XA 3MMYB 4I6ZA 1CF7B 1J7KA 4KICA 3GTQJ 2PG4A 2DFIA 2V1XA 4D5FA 4LTYA 3DKWA 2DT6A 2ELHA 1Z9CA 4P9FA 2BB8A 4G9YA 1W7PD 1JUPA 4A3EJ 2XAJA 3H9QA 1TLHB 3GTKJ 2DA6A 4FTHA 3FIWA 2O5RA 2L6MA 3S2HJ 4X64E 2B0LA 3ZQHA 1D1CA 1RC9A 4V2FA 1B69A 2EV5A 1SAXA 2EN2A 2Z5UA 3F8BA 4M6YA 1U5TC 1IRZA 1FKAE 1OCRH 1A31A 1V3FA 3GWZA 1HBXG 2DT7B 2GZWA 4R8HA 1P7IA 2K4BA 2D2WA 3QPTA 3PNYA 3L2RA 1B8IB 2WBUA 3KPHA 2M5WA 4BAYA 1YW7A 2OPTA 1E3PA 1SD4A 4AC0A 2LCEA 1UG0A 3JW4A 4MLVA 2ZSHB 2JPAA 2XF5A 5ICEA 2I13A 1ETYA 1T0FA 4EV0A 3CCMI 2CTDA 1BJAA 1MKMA 1AHDP 3DCFA 3M8JA 1KJKA 1T95A 3HPGA 2YUSA 2MD0A 2WC2A 3S15J 2BE5F 2AQEA 2ZJPF 5DUKA 4B4CA 3EPKA 3U1DA 2QEXI 1ITYA 3H5AA 2JA5J 2Y48A 2JRMA 2R5ZB 2KLOA 1BC7C 2FJ1A 2KZGA 3CMAI 3G4SI 2JUCA 1KA8A 3C18A 3DQVC 1PUFA 2CUFA 2EM4A 5J1UA 3O8HA 5LFAA 2F2EA 1DDNA 4G6QA 4WYQB 2PLYA 2V9PA 3KP6A 4DV0E 1BI0A 2K5CA 1B9MA 5DTDA 2PBIA 1LE8A 2RDPA 4RAYA 1K4SA 4XRMA 3CCQI 3HC7A 1FC3A 5EF6A 3A2KA 1A5JA 2EZHA 4D0PA 1HQCA 2EOHA 2L3DA 2VQCA 4EM0B 1VQNI 2EPKX 4LF9E 3E5QA 4FX0A 2WB1N 2L2OA 3IC7A 3GFLA 4PK4A 5J3LA 1WGXA 1AH5A 2BEOA 4HA8A 4KFCA 5J6XA 2BY2A 2YSRA 3HSFA 3OYIA 1GVDA 2EMFA 1W36D 1GVJA 3OYEA 1FSHA 2BV6A 3G1MA 1GZ6A 2K9QA 5LL6R 4CCNA 4XSZF 2JOBA 3KEYA 2UXDE 3BIDA 1RKWA 4CA0A 1OR7C 1ETXA 1UB9A 2CFXA 3ZPLA 3T1YE 1R7JA 4XOPA 2EPRA 2NUGA 2F5FA 1YW8A 2ACJA 2V1NA 4FQGA 4ITVA 2DSYA 4YG2F 3DP7A 2W85A 5LHHA 1Y6IA 4ANJA 1IN5A 2HOEA 3UNGC 4R2EA 2M4KA 5HODA 2YTFA 4LIVA 3D5RC 1VQ4I 1MNDA 3BG9A 4EJTA 5J1RA 2NYXA 1EH6A 1MGTA 3W6VA 1YTYA 2I10A 4NHRA 5J8FA 1A35A 1YYWA 2VJJA 4DV2E 3RQ4A 2QGUA 4BC7A 2MLGA 2YT4A 4B43A 3JRFA 2RTXA 2ZMEB 4D5CA 3F8CA 3LSHA 3MD2A 3KWRA 1Z6TA 2ESHA 2LVSA 3ZMUA 2UXNA 3L2CA 3HIFA 5K7FA 2EBIA 3OYKA 4UVAA 2A25A 2JWTA 4C3JJ 4G7OF 2EMGA 3CCVI 2LOOA 5HS7A 2L9SA 2B9DA 3WTVC 1IAWA 2JK3A 4LJZF 1MEYC 4N4RB 4NHJA 1SVLA 2P5KA 3I5UA 2FF4A 4O5GA 1BJZA 1H9TA 1OFCX 1UCRA 1KQ9A 1R1UA 3FXLA 5FJ8J 2EOYA 2LR8A 4Q5SF 4FASD 3TBIA 1F43A 1YUJA 5EGOA 3EUHA 4DV7E 4YHHE 3DEEA 3FXOA 1ZARA 2L2NA 1BR2A 5IXMB 5BOXA 2KIFA 5F0FA 4WK8F 2RS7A 3M7GA 3WTZA 1U8BA 3L00A 4F2JC 3DLAA 1V54H 4IXAA 3MAJA 1R36A 2LBFA 2HQAA 4WSPA 1ETVA 4G94A 3WG9A 2LJHA 1UN6B 5DUIA 1XCBA 1K7AA 5KK1A 4IHWA 3TO9A 2KJCA 2HKOA 3OYDA 1HNZE 2F5VA 3WODF 1S9HA 4JBAA 2XAGA 2XC7A 3S1NJ 3GX4X 3DKYA 2JN6A 2E35A 2VIXA 2WTEA 1Q1HA 4E7SA 4JI4E 1T38A 4QWQA 2JXPA 3P5JA 4M3GA 3D5LA 5D6EA 3ULQB 4BEHA 5A2QK 1J59A 1TT5B 3HTXA 2JVHA 2YTNA 2E60A 2UUZA 3TP3A 2UZKA 2F4VE 4EM2A 2UXBE 2CQXA 4X8WA 2LT7A 4G7ZF 2JUGA 2EPMX 1YLFA 1JGGA 4Z6YA 4OOGC 5BQTA 2PEXA 1WJEA 1ZG5A 2IVMA 3K70D 3FMQA 1J09A 2J5PA 3KYDB 2PJPA 1Z7UA 1UHWA 4A69C 4A3JJ 5D5XB 1JXSA 2P6SA 3IWBA 2GXGA 2OCEA 2XSJC 1MSEC 4O6JA 1U3EM 4CUGA 4R2DA 1D5VA 1ORKA 1ZLKA 3DPLC 4Q47A 3S32A 2EPLX 2V87A 3CO6C 4Z2YA 4IJDA 1MBJA 1P6RA 3OYAA 4UB6C 2LSOA 2GXBA 3JRGA 2OTLI 3A0HC 1FOKA 1IC8A 3CQZJ 4JX4A 1TN9A 3W3CA 1ZGAA 2W48A 3JR9A 2DMNA 1R1VA 3KE2A 3QOPA 4ZH4F 1D8JA 2DK5A 4MFEA 4OWRB 3BT9A 3A01A 3HOZJ 2V9VA 1N77A 4CCMA 1AKHB 1FMWA 3ECHA 3C4BA 5H20A 3ZRGA 1I94E 1T6SA 5GAHJ 1J9IA 3V7CA 1Z6RA 2W82A 4LG3A 5IP9J 1O3SA 2MLKA 2QBYA 2FBHA 3WTTC 2AXTC 2QZ8A 3BR6A 1BB8A 1OQYA 2L7KA 5F04A 1R9TJ 1HKTA 3OY9A 1N25A 1O7LA 3JTHA 2IBDA 2M1BA 4IHXA 4NXME 5EDNA 1VQ9I 3JRAA 3J81C 1GTKA 1D0ZA 2XDVA 2W57A 1FY7A 3CESA 4CXFA 1Z67A 3I55I 1BC8C 2EOXA 2L2MA 3EPHA 1XDSA 2BHZA 2KHXA 2H6BA 3AFHA 1B9NA 2EM3A 2EMAA 5HS9A 2R0QC 2VRDA 1REPC 1OJLA 2EWLA 4B44A 3RI4A 3DU5A 2VKVA 3K2ZA 1FMVA 2XGXA 5H6QA 2MYSA 4KN4X 5HLIA 3ZP5A 3K10A 1QQIA 3S3NA 5A6BA 3SYTA 3EPJA 4W1UA 4XRFA 2E1NA 4V2GA 1IV6A 5ILSA 1H88C 5M5YJ 4AIJA 2VBWA 2R7UA 5AONA 2WAQA 2HOAA 2E2HJ 2LKPA 1PP8F 1O3QA 3GYHX 2VODA 5FLVA 3WTWC 3CP8A 1T98A 3EYYA 2NRAC 1DQ3A 2JPCA 4ENJA 2VBXA 2QQ9A 4D1QA 3S1RJ 1R4MB 2BVLA 4BHBA 2EFNA 2ZJ2A 1U0JA 4IEJA 1ZYRF 2ZXJA 4BKXA 1OCTC 4IL6C 1T4NA 1SFUA 2GIVA 1IF1A 3RZDJ 2CV2A 1JHFA 3KZZA 4QLCU 4HOBA 5IV8B 2RVCA 2NNNA 3FMSA 4AUXA 3A02A 1U5TB 5HOOA 4CHUA 3JAMK 2DQLA 2K4JA 3JRHA 3CUQA 1T08B 2KMUA 1B59A 2ENHA 2FQ4A 3F6VA 3QP5A 4OIOF 1Z7LA 2V88A 3C3WA 3E6CC 2Z33A 3RKWA 1LLMC 3WHBA 2V8QB 4NZVA 1FIPA 4X1EA 1NCSA 1W0UA 1I3QJ 1MMGA 3REOA 5JLWA 5CVVA 2PMZN 4XSXF 1D0XA 1NHAA 3GUDA 4KIGA 1DPRA 4W97A 4V19K 5DDGA 2IAIA 1WHUA 3SFIA 1UHZA 1BW5A 1IDZA 1BN5A 2MH9A 4F9CB 3RQIA 4ZYHA 3TOAA 1TWHJ 3VYRB 4XLPF 2R7RA 3BCBA 1VQKI 2LFBA 3S3MA 2E5ZA 2HQRA 1J5YA 4UUTA 3F22A 3N4MA 2MW8A 1Y56A 2DMQA 3KCCA 4EMSA 2RS6A 4K0KE 3I59B 2RAEA 3HRMA 4KT6A 5IYCJ 5LBQA 2PI0A 4UVCA 1WXRA 2ADUA 3ZOBA 3MZHA 2YTPA 4RS8A 5LGUA 5TSEA 2DT5A 4NC8A 2ZJQF 5KL7A 3TMOA 1Z91A 1LDKB 1OYWA 2DA5A 4HDVA 2Z9OA 1Z3YA 3CLOA 1HSJA 3FXKA 4BBRJ 5E3MA 4JI0E 5TISC 1A1KA 2ETHA 1XPXA 4HEIA 2ELKA 1PP7U 1XNRE 3DF6A 2GPIA 4A5NA 4OOIA 3COAC 4BDYA 2N8GA 2NS0A 1IV8A 4LLLA 2EN7A 3IAS2 1FWZA 2R7WA 3IKVA 2EV6A 2L9NA 5F27A 4ENKA 4QIWN 2BXYA 3LMMA 2CV1A 1X6FA 2JVAA 2IA2A 1GXPA 2LNBA 3O8GA 3OYBA 5AC4A 2EMKA 1PVEA 1NEIA 3HOXJ 3MEXA 1FTTA 3EUAA 3F23A 2LV2A 2EPFA 3OTOE 2YU9J 4HNTA 5A6BD 1SMTA 2AS5F 2ZXIA 1IBLE 3IWFA 1X4OA 5LEJA 3QG5C 4PGHA 3DPTA 3ADGA 2OAZA 1WFXA 4BY7J 4BC9A 3TL4X 2VQLA 3HUGA 3HKZA 4YFNF 4RB2C 2XRLA 3AKZA 2EMZA 2DJIA 1OCZH 4KUMA 5F64A 1QNTA 2CUEA 2D1HA 2DFHA 2Y0SA 5HLHA 2YRKA 2BOLA 2FX0A 3NWTA 5DD4A 1WQ2A 2FTXB 5ADZA 1MMSA 5EJCA 2P5LC 4MEXF 1ERDA 2XASA 5AC5A 1G8XA 1WH7A 3HSRA 4KJZA 1KZHA 4LF5E 2Q2EB 2VQHA 1ULYA 2HVRA 1MD0A 2YZTA 1S8NA 2EK5A 2KL4A 4AIKA 2EM6A 3K9TA 4J00A 4N9IA 4U87A 3E6BA 4LIUA 2VKDA 5M5WJ 4PJJA 4KWYA 3CLQA 3GLXA 2EA2A 4DUYE 3O6BB 5CFFE 4LD5A 1DPUA 2Y75A 4G12A 5FD5A 1J2XA 4IHVA 4ZDOA 2WZOA 4YY3E 3IUOA 2VQFE 1K78B 3KZIC 4II2A 3DLLF 1OCCH 1G3TA 1YYVA 5K7HA 1S5LC 1BR1A 3V7RA 1WJPA 4F6NA 3OSFA 3FKIJ 1DGWY 2Z3YA 2LK2A 4HPQA 4L5IA 2DLLA 4XOTA 3NQOA 4HSTA 3LSRA 3L2UA 3AUZA 4M9VC 1FX7A 2FOWA 3K4JA 1XS9A 1TT0A 5A69A 4RH8A 5E79C 2FE3A 4CCKA 2L4MA 1LB2A 2LTPA 1ZQ3P 3KP7A 1E0EA 5LMNE 3FK7A 1ZH5A 2EE8A 3MHHC 3ABMH 3VYXA 3R0JA 4YFKF 3BZKA 3OR1C 5HVQC 3OS2A 1OLTA 4Y7NJ 2EIJH 3GTLJ 2JA7J 2DIXA 4YIFA 3MVPA 1X47A 2EOJA 5KL2A 3VDXA 2VJIA 3E97A 3HDDA 1XDUA 2F5EA 3H0GJ 5JI6A 4L9VA 1U5TA 4F9BB 1HW1A 4HX4A 4PSXA 1KYQA 2EOFA 2DI3A 2V79A 4EJUA 1C0WA 4GDFA 3BDDA 4OAZA 2BXZA 2B7EA 1R5ID 3Q0UA 4AYBN 1QU3A 3HPZA 1FP2A 4M74A 3RKQA 1GUUA 4HNVA 4XIDA 4DMIA 2MKNA 2TDXA 4A3LJ 2Z16A 5ICFA 2HNHA 4BGDA 3CCRI 5BMZA 2CQ7A 2COBA 1XMQE 5L3GA 2K27A 4LG0B 1Y0UA 4H4KC 4PSWA 5C44J 2IPQX 2N3HA 2V89A 1YUIA 1PUFB 2EL4A 1LNWA 1RR7A 2DB2A 2WBTA 4GCVA 2KRCA 1USSA 3DKXA 3FWEA 2VOOA 2LMDA 4J19A 1PUEE 1PJTA 3LNQA 3QYEA 1LE8B 1TP4A 1A04A 2HZTA 1KYZA 3EQLF 4DGWB 5E3NA 1YJ9I 1STUA 5CVUA 4NB5A 3DTKA 1KU3A 4DV1E 1ZAOA 4BJTA 2NS8A 1FNNA 4QPQA 4OIRF 2JVGA 3I53A 4IKFA 1RUOA 2K3PA 3LA2A 3M9AA 3ZN1A 3L9FA 4YEJA 4BXFA 1QZZA 1R22A 4A3IJ 1MW7A 2HS5A 2HJJA 2EILH 2DXIA 2L33A 3Q9VA 2IGOA 2YX7A 3J7AG 4BH9A 5BPIA 1RUNA 1IBKE 4OX9E 2DDAA 4IRIA 1FTZA 2V6CA 2CQNA 2GM4A 3VPRA 2IGKA 3OOPA 4A0YA 4R8OA 1SC7A 1E17A 4BHPA 2KKOA 2LY2A 1SFOJ 3GO5A 4XR6A 1SR9A 3ASNH 1G2DC 3ONQA 4B47A 4ZZLA 3TEDA 1OR7A 2OZ6A 5E8GA 3PIPF 4HNUA 5EEHA 2JTVA 2GWRA 4II3A 1MDMB 2R7XA 4Y15A 4RGUA 1MBHA 2KRFA 5E3OA 5J8CA 3TQMA 3RZOJ 2K4VA 4RAGA 3H9JA 1IN8A 2CFOA 4M6XA 5DEQA 2IRFG 1VQ6I 2O61A 4AIHA 2R7FA 4A3GJ 3WU0A 3PJRA 4MLQA 3FKJA 1JI8A 3MKYB 2P0WA 4JV5E 2CSHA 5AIQA 3R6SA 1JTYA 3GEZA 1KU9A 2ZB9A 5DV5A 4LFUA 5DCMA 2FQ3A 3WHCA 3IH3A 2O8KA 4TUGA 2EZKA 4CYDA 1R5HA 1X3ZB 5H2FC 4XLHA 5EGOB 2DU9A 3FM3A 4GRIA 2M1SA 1WKMA 3DBRB 2NVUB 5E1WA 4BQAA 1B6AA 1X3UA 3KIOA 3ZOQB 1WJBA 3SDBA 4DUZE 4KYWA 4H0EA 2O9LA 1VQOI 2WWYA 4HTGA 1PKPA 4I76A 1U2WA 5LEKA 2OQGA 3KZYA 1KGSA 3BG6A 2LF7A 4LF7E 1HCRA 4AVPA 3F21A 2LBFB 4BQQA 3FISA 2L4AA 5IWAE 2UUAE 2NVQJ 1X2NA 3OOUA 1MIJA 4F52A 3QPSA 4M3DA 2H8RA 5FKNA 1QGPA 2ZFWA 4LFAE 4OU0A 3S8PA 2KIQA 1GQEA 2F5DA 2KZVA 2OQRA 2EJRA 2IXSA 1YIJI 4LGWA 5FLMJ 2JSCA 3HOTA 2EB7A 2JSPA 4JI2E 5CVRA 3RPQA 4BEHB 2YTDA 2LKXA 4J8ZA 4BACA 1LFBA 1LDDA 3LSPA 5D8LB 2O8XA 3FBIB 1HF0A 3GF2A 3DTEA 3I4MJ 1ACIA 2JMWA 2CGPA 3OS0A 1X1BA 2BHYA 4O5VA 4HV5A 3H3VK 4I8OA 2WBMA 1O3TA 2HQ5A 5ED4A 2YS9A 2UV1A 2FEZA 1DP3A 4S0HB 2M3AA 1DGRM 1LFPA 4AQYE 3BY6A 5F0CA 2CH0A 4WXDA 3FX3A 3BG3A 3T8TA 4BE0A 4LG0A 2MDGA 3ABKH 1IJWC 5ILUA 4F91B 3CCYA 1DI2A 3IAM2 2M0MA 4A3DJ 3HSEA 2BBYA 3RYRA 3FBNB 1LUJB 4RHBB 2FMYA 2VBYA 4M6VA 1WJ5A 4JI3E 2VASA 5CVJA 3U21A 3OIOA 1FT9A 1HNWE 2R3SA 2EZ6A 4E4HA 1D5YA 3PUFA 3A01B 3D1NI 2VF1A 3OMYA 2WADA 2ZNYA 2LH9A 2ODRC 4HYEA 1N33E 4FHTA 2EOSA 4DV5E 1KONA 2MSYA 4YIIA 3P9CA 1UHSA 2FXAA 3F6OA 3VYTB 2HFHA 2FRHA 1ZN2A 1I39A 2QBYB 2BZTA 1IG7A 2D9HA 3L7WA 3K4CA 3S1MJ 4PCQA 4X65E 1X19A 1MNMC 2EOEA 2UUCE 1P4XA 1TQIA 2E36A 1ZRFA 2MDRA 4IF4A 2A61A 1X5WA 4KZSA 1D0YA 2W24A 5BR8E 3J7Yp 1SD6A 2K86A 4OIPF 4JYKA 3IWDA 2FU4A 1JK2A 4DV3E 2O03A 5JR3A 2AXLA 5IP6A 2EQ1A 4P7DA 1Z1BA 2MA3A 1Y1VJ 5E3LA 2R7SA 2CQQA 4RGRA 4L9NA 2K9MA 4RAFA 1MDMA 3S17J 3HBLA 4Q48A 5F1RA 3WG7H 1YG2A 3RCOA 2QVOA 4DOZA 2OA4A 3C2BA 5KVRA 3E7LA 5IT9Z 4ASNA 1J5EE 2CMPA 2YTJA 1WI3A 4D9JA 3QP6A 1LEBA 3ADJA 4EM1A 2B63J 2DMTA 2P4WA 4X0GA 3X2QH 4D7NA 2OV7A 4JYAE 2NVTJ 1UELB 3DXJF 3E3VA 1KQ0A 2M2EA 3WU2C 1R71A 2B7TA 1TF3A 3HHHA 1TW2A 3C2GA 1S72I 2R7VA 4PDKA 3HL2A 2IS4A 1X3WB 2PFBA 3LA7A 1W36C 2KHMA 4HF1A 5TJJA 3KLOA 4E7LA 3T1HE 2X51A 1IO2A 1ENHA 4HX8A 1WHNA 2V1DA 5LHIA 2RN7A 1FBUA 2Z99A 1R5GA 3CUQB 4LK0F 4RB3C 3ZQQA 3JCUC 4IQJA 1YHQI 2DDBA 3P7NA 2FBIA 2M8GX 4UVBA 3BPXA 1JKOC 5E20A 1MBKA 5CQEA 2EOMA 2MBFA 4BMJA 2V26A 1Z05A 3RYPA 3RTRA 1VQ5I 3AL0C 3A4CA 4IHYA 3M99B 3JSPA 1WVRA 5HNFA 2LE2A 3IHUA 1VQ7I 2E71A 2K7LA 2TCTA 2LYCA 3HGGA 3W2WA 1W0TA 2EN3A 2X1DA 4UHTA 3PFIA 1Y39A 5JVGF 2HEOA 3VHTB 2LG4A 1FBSA 4GKJE 1R4NB 2IJLA 1MBEA 3J80Z 1XD7A 2R93J 2XGEA 3LOCA 4ON0A 1F9NA 4M73A 1Y1WJ 2KP6A 1MMNA 2DTZA 4BNCA 2IS1A 4GO1A 2VXDA 2W1OA 2YTIA 4L5NC 2H27A 1A1FA 3W6KB 3V4GA 2FD5A 5JHFA 3V42A 2K9LA 2LO3A 5F3WA 2CS3A 3MQ0A 1S7AA 3OYLA 2LTRA 2XF6A 1YO5C 3ECOA 1GLNA 2PJRA 2MC6A 3G1LA 4DIQA 3J81K 4CCOA 2XSDC 1AAYA 4HW0A 2QLZA 3P9KA 3RSNA 2YSOA 1JUMA 3CDIA 1XMAA 2WY7Q 1N32E 2RNGA 4ZZDA 2KRHA 3ZGKA 5FB2A 4DR6E 1QVUA 1YE9A 3CMYA 1OISA 1HXDA 3ZQFA 4A0XA 3K4KA 1A36A 4PJNA 2O3FA 3DV8A 2XPVA 3DEWA 1TQMA 3HTUA 3ZQGA 4LF8E 2M45A 3PSIA 1G3YA 1OYIA 3LSMA 3OIQA 2EPOA 4JI7E 4BJ6C 4U7BA 1L4SA 3VEPA 1LJ9A 4XKBA 4BXUA 1E2XA 4BU2A 3FIGA 1R00A 5FLXZ 4YRVA 4NXNE 2FNAA 3C6KA 3W6JB 2CUZA 2J7JA 2HXIA 4R1HA 1BR4A 2MC4A 4IRGA 3O3KA 5D5WB 2QF7A 1BM9A 3EETA 2A5YB 4PGGA 2JY9A 1G2FC 3HUGB 1O3RA 4F6MA 3DEUA 5F6FA 3SEZA 1PJSA 1FIAA 3CUOA 4RLFA 2RQPA 4B3SE 2D1VA 1XMOE 4DYRA 1UFMA 3SEQA 4MEYF 2R4GA 2PMUA 4C3HJ 1O57A 3TP0A 2FA5A 3LSIA 2DA1A 3FXMA 5CVIA 2XAHA 4WF2A 2GLOA 3SXYA 1MBGA 2P7CB 2A07F 5AIPA 1I6XA 4AVZA 2ISZA 1IXRC 2GA2A 1X4PA 2LD5A 4FISA 4A6DA 5LGNA 1H8AC 4BBSJ 1UMQA 3WGIA 4BCAA 3OL4A 3CF5F 1OCPA 3PNTA 3VSKA 2YTQA 5DD8A 4RMNA 3DWLE 2JYAA 1WRJA 1BI3A 1A1IA 2HGHA 1FPQA 3BWGA 5F1JA 1GDTA 4TUIA 1R58A 4FX4A 1YPNA 1MBFA 1K6OA 3J7AY 3S2DJ 2L01A 2R7QA 2MGQA 3BG5A 4WX9A 5J47A 3BJAA 2MD5A 4ZTFA 1B4AA 1IUYA 5E1XA 3M3YJ 1TBXA 2P6TA 1JTXA 4HG2A 2V85A 3K4BA 1W5CC 1N34E 4I99C 5ERIA 3BP8A 2BBGA 2K40A 2L5QA 4R03A 5GAEJ 3RJPA 1VQLI 1NK3P 2VPLA 1V5GA 3CJNA 1U9NA 3U1KA 1ONVA 1F2IG 2O0YA 3PQJA 3ADIA 2Y31A 3GTMJ 4C2UA 1D3YA 3PNVA 4RA2A 3VODA 4BBYA 4X66E 1F36A 1OMIA 4XRSG 2M87A 3CCLI 1WWXA 4J01A 3OL3A 3G1OA 3E6MA 5E17F 2IGNA 4GYIA 2V4JC 2X9DA 3QODA 4WPYA 4E6KG 3CP2A 1IXCA 1JT6A 2DOEA 4RM2A 1L0OC 1ZKGA 2HZDA 2YU3A 5HLTA 1ETKA 4IHTA 1IUFA 1U6GA 2WV0A 4GKKE 1G6NA 2EFQA 2WY8Q 3I9V2 1T33A 1UAAA 3BC8A 5HS8A 2EM2A 5FFXA 4XLNF 1FOXA 5CYVA 3E6DA 1P7JA 2BY0A 2YPNA 5AASA 3ISPA 2R7OA 3FHNA 2CYYA 3BR0A 2DA2A 1HC8A 3BOQA 4KMFA 3V7SA 4ETSA 3K7AJ 5KL4A 4GXOA 4HX7A 4DZPA 3GZNB 2HQNA 5M3FJ 1IDYA 1IGNA 4LK1F 3GMEA 3N97A 1BL0A 3DU6A 2HOTA 5HNHA 3IWZA 4YELA 1PJRA 3K4LA 1UZCA 2MC3A 4ZDPA 2NOGA 4IPAA 3T5XA 1XG1A 4HQMA 2ZJRF 3NRVA 3K1NA 1D1BA 4XLFA 4CH7A 4E70A 2R92J 4M0VA 2XPWA 4Y33A 1H0MA 3TDUC 5FKMA 2M30A 2O7OA 1OKRA 3M1CA 5J4YA 1CGPA 2LJUA 5EG0B 1HKQA 2BW3A 2CW8A 1K4TA 4UB8C 4C2TA 4JI6E 2X6XA 3MCZA 1S6LA 4IOCF 4ABZA 2B7VA 2RSIA 1Z21A 5C4JJ 2H8WA 3G6EI 4B3ME 3UR3C 5LHGA 3THNA 1RKTA 1YIOA 2ID3A 5FFZA 3IL2A 1JJ8C 3F8NA 2GXAA 1QVTA 2GHFA 1W1WE 1YX3A 2ME6A 1ZGWA 3BJ6A 2VE8A 3QAHA 1T8IA 1XTAA 3JTZA 2NA2A 3KP3A 2DODA 3HRSA 2M7BA 1EKZA 1IN6A 2L54A 1V55H 5D4RA 3ZMZA 4EATA 2EM8A 3RKXA 2ME0A 2EM0A 4ENNA 4IHSA 3AG4H 3WE2A 5FRMA 1N78A 2WAQN 2YRMA 2EFWA 4PFPA 1SVOA 3TW6A 2OTJI 5FROA 3CD6I 1P4AA 3QQAA 1TZLA 1BOAA 2VC1A 4WXCA 1E3HA 2WCC3 2CQKA 3Q3SA 2W7NA 1HDDC 4DBQA 4MQVA 2X6YA 4Q4ZF 1UILA 2XF7A 3QPLA 4I98B 5DCFA 4B3RE 2K9NA 3FXUA 2ZC2A 1ON2A 3CDHA 1RNLA 2XKPA 2UWMA 2R5YA 3PM1A 2FGGA 1I6HJ 1FOYA 2EPZA 1HLVA 4LB6B 3GW2A 1P2FA 3CCEI 3EUKL 5DCMB 3I58A 1MZBA 1X58A 2FUG2 1O7FA 3CCSI 2KOUA 1A6IA 1WPKA 1RQ0A 3CC2I 4DJAA 1SD7A 3OYCA 2ADRA 3SHFA 4IJAA 3FXQA 2QQAA 2ZKZA 5IP7J 4O3MA 2EOOA 5A2QZ 2EM9A 2X0LA 4L0ZB 2UXCE 3IH2A 3TQNA 4XLEA 3TDZC 5JFRA 4ZYEA 5K5OA 1DUXC 2KQRA 2QUFA 3M8FA 3CMMA 2NUEA 1RIOH 3C1DA 4L5JA 2M4IA 3LFUA 2VKEA 4HLXA 2KISA 4I09A 1IXSB 2G7UA 4M9XA 1XGSA 2LRDA 1N75A 2X6WA 2NNYA 4KITB 4I01A 3IV5A 1FOWA 1F4KA 1PDAA 3CDLA 3Q0VA 3HOUJ 4M3EA 4CZZA 1EA3A 4XRSA 1H9GA 4GGGA 1DGCA 2DTRA 2EJ4A 2XUBA 1G4DA 4FE4A 1ETQA 4Y4RA 4B8XA 4A3KJ 2K3FA 2EPNA 3BBGA 3J7ZI 5D4SA 2BVMA 4HBLA 1YW9A 2X1EA 3J7YJ 5T6JA 2HKXA 1BIAA 4LOCA 1V5EA 1ZK8A 3GFJA 2OBPA 3BZCA 4Q35B 5FKOA 3OWTA 2Q0OA 3G3ZA 4WXHA 1K6YA 1EH7A 2WAFA 1YX5A 2YSPA 3SDGA 4LFCE 3RDIA 3V8JA 4KIFA 3RMPA 1MH3A 4MIMA 3JRDA 3I4NJ 3BQZA 1X6EA 1O4XA 4MGRA 3T8RA 4CO8A 1FJGE 4TV7A 2V7FA 1STZA 1ZR2A 2LMZA 1RI7A 1K83J 4PFOA 2VJ5A 4M3FA 3M07A 2ZM6E 3HKZN 2EQ0A 2VE7C 3HZJA 1APLC 5GPCA 4N4OB 3R0AA 2Y0SN 2ISYA 3J7AO 2VN2A 1CQTA 2Z2SB 2DN0A 2P7VB 1AWCA 1FYKA 1SFEA 3HYIA 4CYCB 5EG0A 4FE7A 5IYBJ 2EIMH 4EJOA 5GAGJ 2L2KB 2CWEA 2KFDA 3K1PA 3SJMA 2NUFA 2BYVE 2DGCA 1JGSA 3I4PA 1Z77A 2ZO4A 2A05A 1LPQA 2XAFA 3QU6A 3U2RA 4A0ZA 4XLAA 4XKVA 4ENMA 2HI3A 1YRNA 5CPRB 4IOAF 4NQWA 4EGYA 3ML6A 3H0DA 4NUBA 1YS7A 3NWSA 4R79A 1LVAA 2HDDA 1RZ4A 4A93J 4LFBE 1QPIA 4ZJZA 4G6TB 1ZR9A 4EQQA 2CUJA 2WV1A 4D7MA 2EOZA 1BBGA 1AU7A 3VFZA 4NNJA 5D5UB 2E72A 2NVYJ 5GTIC 4PUSA 3DBHB 4A5MA 3FXRA 4HZFA 4HDUA 3I54A 2Y9ZA 3HOYJ 1X49A 5IT9C 1NK2P 2BY1A 1R23A 3L1PA 2DRPA 1IMUA 1JKQC 4RLQA 1P47A 5C4XJ 4N9HA 3GZ5A 2ZBKA 3JRIA 3TGNA 4L18B 2LY1A 1SEUA 4Q28A 3LFKA 2EMBA 3JAMZ 2DA3A 1IBME 2XB5A 3F0CA 4LMYA 3ZR8X 4DYQA 5K5QA 2STWA 2R7TA 3A0BC 3LAJA 3ERMA 3KX2A 4I02A 1YI2I 4X62E 4XL9A 3HPSA 4OAYA 3VWBA 2ZXWH 2GAUA 4A2UA 2RSMA 1W5SA 3M1EA 9ANTA 4O4KA 2V9KA 2H36X 1I1GA 2G7HA 4B48A 1U78A 2QQ8A 1MJBA 3CCUI 2I8DA 2R76A 4HF0A 1ZLJA 3VK6A 2PX9A 4M3BA 2P8TA 3PFYA 2ZXHA 2WB1A 4B3TE 1ZTRA 4F54A 2E7WA 4P9UA 2WBSA 3OYNA 2IHR1 1HNXE 3HM5A 3DFGA 2LRSA 4UXNA 2RGVA 1GV2A 1LFUP 1E3OC 2H1LA 2LP0A 3BLYA 3BF2A 2LC2A 1XSVA 2QQBA 2R7DA 4M71A 1JE8A 1WJAA 4Y13A 5AE3A 3RPUA 2FV4B 4PZJA 2A6HF 3J80C 4R2SA 2X48A 4R2RA 2EM5A 5K7ZA 5HDNA 1ZR4A 3HTSB 1GHCA 1ETWA 5A6KA 3OS1A 3E0JB 4X6AJ 2FBKA 1KYWA 1HW2A 2OC6A 4UUSB 3TKYA 3L2QA 4LF4E 1B1BA 2QSHX 2P5VA 2BY3A 2JQ7A 4LLGF 2F6CA 5D6FA 2EN4A 1V5FA 3R60A 5IY5H 5BNGA 1WI9A 2K02A 3GTJJ 3L09A 1VI0A 2K9SA 3ZCOA 4NDLA 4CDGA 4YFXF 3GTGJ 4M2ZA 3BTLA 4ZYGA 4U7DA 1T4OA 2E1MC 5J4VA 4DR7E 4I7HA 3ZQCA 1Z3XA 5LRSA 1L3LA 2ELJA 1SAUA 4KHPE 1QZEA 3I71A 4ZC3A 4S04A 5ILVA 1W4MA 3IRQA 5J40A 5FO5A 2PJRB 3E1SA 3WTYC 2VQEE 4BQNA 4LU9A 1OYYA 2ODRD 2NOJB 4IQ4A 3NAUA 4WWCA 2IGMA 3WGGA 2UU9E 1BBYA 1NG6A 4HF2A 1SANA 4EGZA 2XAQA 1XMXA 2AO9A 4JK1X 5CJ9A 3H9GA 3G73A 3U9GA 4B3XA 1FLIA 4KIBA 4F3QA 2DO7A 3R4KA 4AD9A 5M5XJ 3EQ1A 4RGSA 2M9AA 1XNQE 2YX4A 3GVAA 1XC5A 4LB5A 3HJEA 3KYLA 5HDKA 4L8NA 5FLXC 1HKSA 1XN7A 4HLYA 3GFMA 3DPUA 2EN1A 1DP7P 3C6MA 2RV8A 3WU1B 5D5VB 1SMYF 5KNLA 1SD5A 4E7IA 2IT0A 2JR1A 4C30A 2K7IA 2HVSA 4OINF 1X2MA 3Q0WA 4F92B 1QBJA 2CPNA 2L92A 4JX6A 1EV7A 1SFXA 2NXNB 4BE1A 3JTGA 2GLIA 2JOXA 4EJWA 1YSAC 3THOB 4XORA 3VSLA 1RMDA 3E5UA 4CYCA 2H94A 1T39A 2E34A 2ECBA 4M9SA 4U0YA 3ERED 4R2AA 3WTSC 1IQOA 2ZNZA 4IRHA 4BYYA 1ZAAC 1LKXA 2DOAA 1N3GA 3JRBA 1I5ZA 3GTPJ 3S16J 2LKSA 4E7HA 2M4GA 3OIPA 3ESWB 3KYCB 2D45A 1TNTA 3S3OA 1JKPC 4UUVA 2EMYA 3CMEI 2L7FP 2JJ7A 3PO2J 2EP3A 4WCGA 2VJ4A 2GA1A 4O24A 4JX5A 5A6JA 3VYUB 3OMLA 3K4MA 2BGCA 2VBZA 3CJQB 2A69F 2CJJA 3PQKA 4B09A 4ESBA 1TTYA 3H36A 4DZJA 2IP2A 2ENAA 1J0RA 4AWXB 2VONA 2A5WA 2VXZA 3BQYA 1K79A 2HHHE 5BPDA 1U9OA 5E8IA 3L2VA 1Z1DA 3WTUC 1ZREA 2LUPB 4JI5E 2VC0A 3KEOA 3QPHA 1OCOH 1T56A 5L3EA 1S29A 1Y8RB 2HWVA 4DV6E 4DR2E 5L3FA 2EOIA 3RPUD 4F9AB 3EPLA 4CCLA 2M34A 4ZYDA 1VQPI 2CRGA 5IOYA 2P81A 4RBOA 1NTCA 5L3DA 3OYFA 2FMLA 3QWLA 2EORA 3H09A 5M3MJ 3HG9A 3KP2A 1FSEA 1ZG3A 1Y8QB 1P92A 4Y52J 2LF8A 4ZDLA 5CLSA 3PSFA 2EINH 2EMLA 3FZVA 2VKHA 5K5RA 3ABTA 2F8BA 2RNJA 2F4OB 2HYJA 1GV5A 2G0EA 2QKLB 1A6QA 4MLOA 4I0AA 4MQ9F 4HV6A 4UNOA 2YTGA 1T4LB 2I9IA 2XROA 2YTOA 5LRRA 2HC5A 1OPCA 3G2BA 4A3MJ 4JOMA 2Q1ZB 1KQ8A 2Q8KA 1XSDA 1RETA 2ZSIB 3A1YA 1S3JA 3KFWX 3UKGA 4BUPA 1KU2A 1FBQA 3TW7A 3HOWJ 4UV8A 4CCJA 4FCYA 5AE1A 5CKTA 1X6HA 4IZZA 3ZXSA 4AIDA 3LL7A 2L9RA 3OYMA 1JHHA 3ZMSA 4KMUX 2CW7A 4BQOA 2R7ZJ 3CCJI 1TW3A 5JHUA 3LLHA 3FF5A 3WE3A 3A03A 4LITA 3W2VA 2EPUA 2DAOA 3ZMDA 2QWWA 4NC7A 1WH5A 2X1CA 4UY8I 5EZHA 1UJ8A 4CZCA 2IS2A 2AHQA 1I1SA 4P55A 2IA1A 4M9ZA 2H1KA 4UUSA 3BJOA 4DQ2A 2E7XA 2JA2A 1CF7A 4PJ0C 3JSOA 2HDWA 1WSUA 5F0HA 1TNSA 3BG7A 2EQ3A 2R1FA 5KL3A 3TOBA 1HSTA 1K61A 2DFFA 2M7QA 3ZMVA 5IOZA 4A3CJ 2L02A 3C7JA 2IW5A 3LWFA 5TGTA 2RPCA 3LMLA 1A1GA 2BW3B 4GZNC 3AAFA 4OIQF 4IX7A 3K0LA 2MFZA 1QU6A 1Z0XA 2DMIA 1BI1A 4HEA2 3HOVJ 2GBYA 2UUBE 2HU9A 4YIRX 3BTCA 1N36E 3QYFA 1DQUA 1MH4A 3K6QA 1T0FC 4KN7X 2DPDA 3PUBA 2UXXA 1B72B 5DNYA 5FGMA 1XGOA 1B8IA 2LTSA 4MTDA 4WFTA 2OF7A 3S14J 2EIKH 3BZ6A 2EH3A 1BBOA 4E7KA 3FXJA 4U88A 3H35A 2L9VA 4MFDA 1VZ0A 4DNCA 4KA4A 2ECCA 3F9KA 3FDYA 4L0YB 4M30A 2RQQA 3NARA 1ZBTA 3ZQIA 2EPXA 3R61A 4BHCA 1M1EB 2NAZA 4A6EA 2PMHA 4I0BA 3ASOH 2F4IA 3Q9SA 1SFKA 2VQGA 4LLNA 1TWAJ 4BY1J 1JK1A 2EPCA 3VB2A 3ELKA 2R5ZA 2PQ8A 4IS1C 4CSWA 4MNUA 2HVQA 3LAPA 3O2PE 1QHGA 3IP4B 4XLCA 2PMZA 5GTHC 1DU0A 1J26A 3VYSB 2W4SA 3F8MA 1FYMA 2CU7A 2LUQA 3CJTB 3LSTA
chains in the Genus database with same CATH topology
2X4HA 2JZYA 2XVCA 3CTAA 2DBBA 4HAMA 1ON1A 2HDCA 2QENA 3F3XA 3SZTA 2JT1A 1AOYA 3IRRA 1G3WA 1TQPA 4RB0A 1LDJA 2XRNA 3LQQA 1QPMA 1IN4A 3EDPA 2VT3A 4MTEA 2H6CA 3NEUA 5ICGA 4KDPA 1FYLA 2CO5A 3BPVA 2CW0F 3HOSA 1D8KA 2ZMEA 5ICCA 3F72A 5H6RA 2HGCA 2W25A 5EEGA 3MWMA 1P4WA 1ZRDA 2A68F 1FZPB 4ESFA 1MJAA 1IRFA 5L3BA 3SQNA 2F5CA 2A3SA 4EVIA 2YPRA 2DK8A 3RIRA 4OMZA 4KT5C 3V8LA 1YS6A 3RKYA 3T1BA 2EWNA 5JVTA 3TO7A 3HHGA 3SZPA 2KJBA 2MH2A 1W7PB 1PDNC 3KEQA 3TO6A 4G6DA 4CICA 5E18F 3K1MA 3MZYA 5HDGA 2HR3A 4N0BA 3VOEA 4F7ZA 1MJ9A 2YR2A 4MHGA 3FHZA 2V1UA 4RAZA 4FT8A 2HYFA 1G3SA 1XGNA 1XSXA 4I2OA 2EA4A 4G7HF 1J75A 1IRGA 3F8FA 3KETA 2HTJA 5L3CA 3ZN0A 4JQFA 3WGHA 2EV0A 5DYMA 1KU7A 3OV8A 3H3ZA 2FNPA 1VTNC 2RC4A 1R1TA 2Y0MA 2XHKA 3EYIA 4A12A 1XMKA 2ESNA 1XCVA 5LLQA 3H92A 1S7OA 1V4RA 2M8EA 1GXQA 5BS6A 1YFHA 2IA0A 4UV9A 2J5OA 1QZYA 4IVNA 3MFKA 3ROUA 1IN7A 3DF8A 1FP1D 3V8KA 3I0TA 3J81Z 4OMYA 1F5TA 4S05A 3IKTA 3B73A 1T2KA 3D0SA 2STTA 5HLGA 1ODDA 2XV4S 2G9WA 1W5TA 3HRTA 4XBFA 1XGMA 5LGTA 1LEAA 3S2WA 2RKHA 2JPBA 3ZMTA 3M8EA 3ABUA 2DW4A 1EH8A 3SFZA 3CUQC 3H3UA 3LA3A 4M72A 2FOKA 2GQQA 2OU2A 2XIGA 5IT9K 2O6GE 2XKOA 2ZCWA 3K69A 5K1YA 2QYOA 3GXOA 1IZ1A 1XB4A 3T0YA 3CO7C 2W84A 3Q5FA 4RB1A 2JRTA 3QU3A 1UHMA 2C6YA 1W7PA 1YQAA 2QM3A 4P96A 6PAXA 3LQRA 2KIUA 2VT2A 4L9TA 1BIBA 2COMA 2KIMA 4ESJA 5IT3A 3I59A 4U0WA 1BI2A 1ZGJA 2EFPA 5E1ZB 3GFIA 2CSOA 2DQRA 3B02A 3ZQ7A 3GZ6A 3J80K 5D8KB 4KNYA 4CGZA 1IW7F 3I64A 2E1CA 4K2EA 1U8RA 4P5OA 3QRFF 3FM5A 4L9JA 1I27A 5FD6A 1LQ1A 4RGXA 1ZHFA 2FSWA 1F1ZA 2HTSA 1ZRCA 3KP5A 2VOPA 3BROA 2HYGD 1QO0D 3KP4A 2OD5A 4EJVA 1ZG1A 1HW5A 2LDUA 2OZUA 4HQEA 2CG4A 3HRUA 3KLNA 2H09A 5FLXK 2A6EF 2Q2EA 3P9IA 4GYGA 4Y17A 2EFOA 1USTA 3FMRA 2PN6A 2VE9A 4G8XA 4U0VA 5TRDA 3WTXC 2DPUA 1K78A 3E5XA 1CF7B 1J7KA 4KICA 2PG4A 2DFIA 2V1XA 3DKWA 2ELHA 1Z9CA 4P9FA 4G9YA 1W7PD 2XAJA 1TLHB 2B0LA 2EV5A 1SAXA 2Z5UA 3F8BA 4M6YA 1U5TC 1V3FA 3GWZA 1HBXG 2GZWA 4R8HA 2K4BA 2D2WA 3QPTA 2M5WA 4BAYA 1YW7A 1SD4A 3JW4A 5ICEA 4EV0A 1T0FA 1BJAA 1MKMA 2WC2A 2BE5F 5DUKA 3U1DA 2Y48A 1BC7C 1KA8A 3C18A 3DQVC 2F2EA 1DDNA 4G6QA 2PLYA 3KP6A 1BI0A 1B9MA 2PBIA 2RDPA 4RAYA 1FC3A 4D0PA 1HQCA 2L3DA 4EM0B 3E5QA 4FX0A 3IC7A 3GFLA 2BEOA 4HA8A 4KFCA 5J6XA 3HSFA 2YSRA 1GVJA 1FSHA 2BV6A 4XSZF 3ZPLA 1UB9A 2CFXA 1R7JA 2F5FA 1YW8A 2ACJA 4YG2F 3DP7A 2W85A 5LHHA 1IN5A 2HOEA 4EJTA 2NYXA 1EH6A 1MGTA 1YTYA 5J8FA 2MLGA 2ZMEB 3F8CA 1Z6TA 2ESHA 3ZMUA 2UXNA 3L2CA 3HIFA 4UVAA 4G7OF 5HS7A 3WTVC 1IAWA 4LJZF 4NHJA 2P5KA 3I5UA 2FF4A 1H9TA 1UCRA 1KQ9A 1R1UA 4Q5SF 3EUHA 1ZARA 5BOXA 2KIFA 4WK8F 3M7GA 3WTZA 3L00A 4IXAA 3MAJA 1R36A 4G94A 3WG9A 5DUIA 1XCBA 1K7AA 5KK1A 3TO9A 2KJCA 2HKOA 3WODF 4JBAA 2XAGA 3GX4X 2WTEA 1Q1HA 1T38A 4QWQA 3D5LA 5D6EA 3ULQB 5A2QK 1J59A 2UZKA 4EM2A 4G7ZF 1YLFA 5BQTA 2PEXA 1ZG5A 2IVMA 3FMQA 2J5PA 2PJPA 1Z7UA 1UHWA 1JXSA 5D5XB 2P6SA 2GXGA 4O6JA 1U3EM 1D5VA 1ZLKA 3DPLC 4Q47A 3CO6C 4Z2YA 1P6RA 2GXBA 2LSOA 1FOKA 1ZGAA 1R1VA 3KE2A 3QOPA 4ZH4F 1D8JA 2DK5A 2V9VA 3ECHA 5H20A 1T6SA 1J9IA 3V7CA 1Z6RA 1O3SA 2MLKA 2QBYA 2FBHA 3WTTC 2QZ8A 1HKTA 1O7LA 3JTHA 2M1BA 4CXFA 2W57A 1FY7A 1BC8C 1XDSA 2H6BA 1B9NA 5HS9A 1REPC 3RI4A 5HLIA 3K2ZA 5H6QA 2XGXA 3ZP5A 4KN4X 1QQIA 4XRFA 2E1NA 5ILSA 4AIJA 2VBWA 5AONA 2LKPA 1PP8F 1O3QA 3GYHX 2VODA 3WTWC 3EYYA 1T98A 2NRAC 2JPCA 4ENJA 2VBXA 2QQ9A 4BHBA 2EFNA 2ZJ2A 1ZYRF 2ZXJA 1SFUA 2GIVA 1IF1A 1JHFA 3KZZA 4QLCU 4HOBA 2RVCA 2NNNA 3FMSA 1U5TB 5HOOA 4CHUA 3JAMK 2DQLA 2K4JA 3CUQA 1B59A 3F6VA 3QP5A 4OIOF 3C3WA 3E6CC 2Z33A 3RKWA 3REOA 5CVVA 4XSXF 1NHAA 3GUDA 4KIGA 1DPRA 5DDGA 1BN5A 2MH9A 4ZYHA 3TOAA 4XLPF 2HQRA 1J5YA 3F22A 3N4MA 4EMSA 3KCCA 3I59B 3HRMA 5LBQA 2PI0A 4UVCA 2ADUA 3MZHA 4RS8A 5LGUA 2DT5A 1Z91A 1LDKB 1OYWA 4HDVA 2Z9OA 3CLOA 1HSJA 2ETHA 1PP7U 4A5NA 4OOIA 3COAC 2NS0A 4LLLA 1FWZA 3IKVA 2EV6A 4ENKA 2IA2A 1GXPA 2LNBA 3MEXA 3F23A 1SMTA 2AS5F 3IWFA 5LEJA 4PGHA 3DPTA 2OAZA 3HUGA 4YFNF 4RB2C 4KUMA 5F64A 5HLHA 1QNTA 2D1HA 5DD4A 1WQ2A 2P5LC 4MEXF 2XASA 3HSRA 1ULYA 1MD0A 1S8NA 2EK5A 4AIKA 3K9TA 4N9IA 3E6BA 3GLXA 2EA2A 3O6BB 4LD5A 1DPUA 2Y75A 5FD5A 1J2XA 1K78B 1G3TA 1YYVA 3V7RA 2Z3YA 4L5IA 2DLLA 3NQOA 1FX7A 2FE3A 1LB2A 2L4MA 3KP7A 1ZH5A 3R0JA 4YFKF 5HVQC 4YIFA 3E97A 1XDUA 2F5EA 5JI6A 4L9VA 1U5TA 1HW1A 4HX4A 2DI3A 2V79A 4EJUA 1C0WA 3BDDA 1FP2A 4M74A 2TDXA 5ICFA 5BMZA 5L3GA 2K27A 4LG0B 1Y0UA 2IPQX 1LNWA 4GCVA 1USSA 3FWEA 2VOOA 1PUEE 1A04A 2HZTA 1KYZA 3EQLF 5CVUA 4NB5A 1KU3A 1ZAOA 1FNNA 4OIRF 3I53A 1RUOA 3ZN1A 3M9AA 3LA2A 3L9FA 1R22A 1QZZA 2HS5A 3Q9VA 2YX7A 4BH9A 5BPIA 1RUNA 4IRIA 2V6CA 3OOPA 4A0YA 1E17A 4BHPA 2KKOA 3GO5A 4ZZLA 1OR7A 2OZ6A 5E8GA 5EEHA 2JTVA 2GWRA 1MDMB 4Y15A 4RGUA 2KRFA 5J8CA 1IN8A 4M6XA 5DEQA 2IRFG 2O61A 4AIHA 2R7FA 3WU0A 5AIQA 3R6SA 3GEZA 1KU9A 5DV5A 4LFUA 5DCMA 2FQ3A 4CYDA 1R5HA 2DU9A 3FM3A 1WKMA 5E1WA 4BQAA 1B6AA 1X3UA 4KYWA 4H0EA 2WWYA 1U2WA 5LEKA 2OQGA 3KZYA 1KGSA 2LF7A 4AVPA 3F21A 2L4AA 1QGPA 2ZFWA 4OU0A 2F5DA 2OQRA 2EJRA 4LGWA 2JSCA 3HOTA 2EB7A 5CVRA 3RPQA 1LDDA 5D8LB 2O8XA 3GF2A 2CGPA 4O5VA 4HV5A 1O3TA 5ED4A 2FEZA 3BY6A 4WXDA 3FX3A 3T8TA 4LG0A 5ILUA 3HSEA 2BBYA 3RYRA 2FMYA 2VBYA 5CVJA 1FT9A 2R3SA 2ZNYA 4HYEA 4FHTA 4YIIA 3P9CA 2FXAA 3F6OA 2HFHA 2FRHA 1ZN2A 2QBYB 3L7WA 4PCQA 1P4XA 1TQIA 1ZRFA 4IF4A 2A61A 2W24A 1SD6A 2K86A 4OIPF 2FU4A 2O03A 5JR3A 2AXLA 2MA3A 4RGRA 4L9NA 1MDMA 4Q48A 5F1RA 1YG2A 2QVOA 2OA4A 5KVRA 5IT9Z 4ASNA 3QP6A 1LEBA 4EM1A 2P4WA 3DXJF 3E3VA 1KQ0A 3HHHA 1TW2A 4PDKA 2PFBA 3LA7A 4HF1A 5TJJA 3KLOA 4HX8A 2V1DA 5LHIA 2RN7A 1FBUA 1R5GA 2Z99A 3CUQB 4LK0F 4RB3C 3P7NA 2FBIA 4UVBA 3BPXA 5E20A 2MBFA 1Z05A 3RYPA 3RTRA 3JSPA 3IHUA 2K7LA 4UHTA 3PFIA 2HEOA 1FBSA 2IJLA 3J80Z 1XD7A 4ON0A 1F9NA 4M73A 4BNCA 4GO1A 2H27A 3W6KB 3V4GA 3MQ0A 1S7AA 1YO5C 3ECOA 3J81K 4HW0A 2QLZA 3P9KA 1XMAA 4ZZDA 5FB2A 1HXDA 4A0XA 2O3FA 3DV8A 1TQMA 3HTUA 2M45A 1G3YA 1OYIA 4U7BA 3VEPA 1LJ9A 4BXUA 1E2XA 1R00A 5FLXZ 2FNAA 3W6JB 4R1HA 4IRGA 3O3KA 5D5WB 1BM9A 3EETA 2A5YB 4PGGA 1O3RA 3DEUA 5F6FA 3CUOA 2RQPA 2D1VA 1UFMA 4MEYF 2PMUA 1O57A 2FA5A 5CVIA 2XAHA 4WF2A 3SXYA 2P7CB 2A07F 5AIPA 1I6XA 2ISZA 1IXRC 2GA2A 4A6DA 5LGNA 3WGIA 5DD8A 1WRJA 1BI3A 1FPQA 3BWGA 1R58A 4FX4A 1K6OA 2L01A 4WX9A 3BJAA 2MD5A 1B4AA 1IUYA 5E1XA 1TBXA 2P6TA 5ERIA 3BP8A 3RJPA 3CJNA 1ONVA 2O0YA 3PQJA 1D3YA 3VODA 1OMIA 2M87A 1WWXA 3E6MA 5E17F 4GYIA 1IXCA 1L0OC 2YU3A 4IHTA 1U6GA 2WV0A 1G6NA 2EFQA 5HS8A 5FFXA 4XLNF 5CYVA 3E6DA 3ISPA 2CYYA 3BOQA 4KMFA 3V7SA 4ETSA 4GXOA 4HX7A 2HQNA 4LK1F 3N97A 3IWZA 2MC3A 4IPAA 3T5XA 4HQMA 3NRVA 3K1NA 4E70A 1H0MA 3TDUC 2M30A 1OKRA 1CGPA 1HKQA 3MCZA 1S6LA 5LHGA 1YIOA 5FFZA 3IL2A 3F8NA 3BJ6A 2VE8A 3QAHA 3KP3A 3HRSA 1IN6A 2L54A 5D4RA 3ZMZA 3RKXA 4ENNA 4IHSA 3WE2A 2EFWA 1P4AA 4WXCA 1BOAA 2VC1A 2CQKA 4MQVA 4Q4ZF 4I98B 5DCFA 3FXUA 1ON2A 3CDHA 1RNLA 2XKPA 2UWMA 4LB6B 3GW2A 1P2FA 5DCMB 3I58A 1MZBA 1O7FA 1SD7A 3SHFA 4IJAA 3FXQA 2QQAA 2ZKZA 4O3MA 5A2QZ 2X0LA 4L0ZB 3TQNA 3TDZC 5JFRA 4ZYEA 5K5OA 1DUXC 2QUFA 3M8FA 1RIOH 3C1DA 4L5JA 4HLXA 4I09A 1IXSB 2G7UA 4M9XA 1XGSA 2NNYA 4I01A 1F4KA 4CZZA 1H9GA 4GGGA 2DTRA 2XUBA 1G4DA 4B8XA 5D4SA 4HBLA 1YW9A 2HKXA 1BIAA 3GFJA 2OBPA 2Q0OA 3G3ZA 4WXHA 1EH7A 3RDIA 3V8JA 4KIFA 4MGRA 3T8RA 4CO8A 4TV7A 1STZA 1RI7A 3R0AA 2ISYA 3J7AO 2VN2A 2P7VB 1AWCA 1FYKA 1SFEA 3HYIA 4EJOA 2CWEA 3K1PA 2BYVE 1JGSA 3I4PA 2ZO4A 2XAFA 3QU6A 3U2RA 4A0ZA 4ENMA 4NQWA 4EGYA 3ML6A 1YS7A 4R79A 1LVAA 1RZ4A 4EQQA 3VFZA 5D5UB 4A5MA 3FXRA 4HZFA 4HDUA 3I54A 1R23A 4N9HA 3GZ5A 2ZBKA 3TGNA 4L18B 3LFKA 3JAMZ 4LMYA 2STWA 5K5QA 3LAJA 4I02A 2GAUA 4A2UA 1W5SA 3M1EA 1I1GA 2G7HA 1U78A 1MJBA 4HF0A 1ZLJA 2P8TA 2E7WA 4P9UA 3DFGA 4UXNA 2RGVA 1XSVA 2QQBA 2R7DA 4M71A 1JE8A 4Y13A 3RPUA 4PZJA 2A6HF 3HTSB 5HDNA 1GHCA 2FBKA 1KYWA 1HW2A 3TKYA 1B1BA 2P5VA 4LLGF 5D6FA 3R60A 1WI9A 2K02A 3L09A 4CDGA 4YFXF 4ZYGA 4U7DA 4I7HA 1L3LA 5LRSA 3I71A 4S04A 5ILVA 1W4MA 3IRQA 5FO5A 3WTYC 1OYYA 4WWCA 3WGGA 1BBYA 4HF2A 4EGZA 2XAQA 4JK1X 5CJ9A 3G73A 3U9GA 1FLIA 4KIBA 2DO7A 3R4KA 4AD9A 4RGSA 2YX4A 3GVAA 4LB5A 5HDKA 1HKSA 1XN7A 4HLYA 3GFMA 1DP7P 2RV8A 3WU1B 5D5VB 1SMYF 1SD5A 2IT0A 4OINF 1QBJA 1EV7A 1SFXA 3JTGA 4EJWA 3E5UA 1T39A 2H94A 4M9SA 4U0YA 3ERED 3WTSC 2ZNZA 4IRHA 4BYYA 1I5ZA 2D45A 1TNTA 4UUVA 4WCGA 2GA1A 2BGCA 2VBZA 2A69F 3PQKA 4B09A 4ESBA 1TTYA 2IP2A 1J0RA 4AWXB 2VONA 2VXZA 1K79A 5BPDA 5E8IA 1Z1DA 3WTUC 1ZREA 2VC0A 3KEOA 3QPHA 5L3EA 1S29A 2HWVA 5L3FA 4ZYDA 5L3DA 2FMLA 3KP2A 1FSEA 1ZG3A 1P92A 2LF8A 5CLSA 3FZVA 5K5RA 3ABTA 2RNJA 4MQ9F 4I0AA 4UNOA 4HV6A 2XROA 5LRRA 1OPCA 1KQ8A 2Q8KA 1XSDA 3KFWX 1S3JA 1KU2A 1FBQA 4UV8A 1JHHA 3ZMSA 4KMUX 1TW3A 5JHUA 3FF5A 3WE3A 2DAOA 3ZMDA 2QWWA 1I1SA 4P55A 2IA1A 4M9ZA 3BJOA 4DQ2A 2E7XA 1CF7A 3JSOA 1WSUA 1TNSA 3TOBA 1HSTA 3ZMVA 2L02A 3C7JA 2IW5A