3KZZA

Crystal structure of snap-tag bound to its substrate benzylguanine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
176
structure length
158
Chain Sequence
b'DCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPAHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 46
structure length 158
sequence length 176
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3kzzA02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3kzzA01
2FXAA 4XRFA 3T5XA 3GFLA 4KN7X 3IHUA 4A0ZA 3BY6A 5FLXK 2JSCA 4U7BA 3WE2A 2BBYA 2EFNA 5LEKA 3R0JA 4L9JA 1ZG1A 2CFXA 1YO5C 2Q2EA 4L9TA 2NAZA 4LG0B 3TOBA 3D0SA 1IN7A 2G7HA 2D1HA 4AD9A 3ZMSA 4F7ZA 2RC4A 4HF1A 3KLOA 2VOPA 1TNSA 4E70A 4OU0A 2DT5A 4I09A 4EM2A 4OINF 4XLNF 4WX9A 1J7KA 2W84A 3IKVA 3RPQA 3F6OA 2WV0A 1BI3A 5D4RA 3WGIA 3M8EA 2GZWA 1C0WA 3F8MA 1KYWA 3PQKA 3CUQC 1LB2A 3W6JB 3FHZA 3TGNA 4R79A 5BOXA 4LGWA 5K5RA 5L3FA 4DQ2A 3R0AA 1G6NA 4TV7A 1HQCA 3BDDA 1FZPB 1P6RA 2AXLA 1GXPA 2RQPA 3GWZA 1YS7A 2D45A 4MEXF 2Q8KA 3K1PA 1O57A 4ZZLA 4CHUA 1T38A 2QENA 3GZ6A 4IJAA 4ESBA 1J75A 3B02A 4G6QA 5IT3A 1ZAOA 5FD6A 2F5FA 3K69A 4RAZA 1FBQA 3D5LA 1B4AA 2G9WA 3QPHA 3I59A 2GQQA 1STZA 3JAMK 2HKXA 4GYIA 3TO6A 2L01A 3FMRA 5E1ZB 1XCBA 1U78A 5CLSA 2FNAA 3GX4X 5DCMB 1XSDA 3KP7A 4MTDA 4LK0F 3WTXC 2MC3A 2QM3A 2RVCA 4MTEA 3T8RA 3QP5A 2H94A 2J5OA 4PGHA 1EV7A 5A2QZ 2V6CA 2DQLA 4KIBA 2E7XA 2K27A 2P7CB 2CQKA 1XGSA 2AS5F 1GXQA 2Z99A 1K7AA 4P9UA 1ZN2A 2DLLA 1LDDA 2GIVA 1BI1A 5CYVA 4M74A 2ZMEB 4UVAA 4GXOA 4N9HA 5F64A 2QBYB 3TKYA 1HW2A 3MAJA 4EQQA 4I98B 1W5TA 2MLKA 1X3UA 3E3VA 1FLIA 3F8FA 1U5TC 1YIOA 4O5VA 5HDNA 4KT5C 2O8XA 5ILUA 3T0YA 3F23A 2R7DA 3U2RA 1OYYA 3ROUA 3BROA 2OA4A 1MJBA 1V4RA 1SFUA 4UV8A 2PFBA 2W85A 4ESFA 2DBBA 2DQRA 2H27A 5LHHA 4O6JA 1LVAA 3QAHA 1R36A 4U0WA 1RI7A 1QO0D 2G7UA 4G7HF 3QU3A 5FGMA 2TDXA 2ESHA 2LF7A 1U8RA 1FYMA 5DDGA 2HWVA 2Z3YA 5ICGA 1DDNA 2OZUA 5HLIA 4UNOA 5DUIA 4BNCA 3RKWA 2F5DA 4XSZF 2XRNA 4I7HA 3KP3A 2M30A 2HEOA 2FE3A 3V8LA 3HHGA 3Q9SA 3DPLC 5JR3A 1F5TA 1FP1D 2JZYA 3FM3A 1IAWA 3H92A 1XSXA 3KEQA 4L5JA 3WU1B 2FMYA 3FMSA 4AIJA 4AVPA 5HVQC 2ZO4A 5LRSA 2P4WA 5K1YA 2NNNA 4CGZA 2ELHA 1HSTA 3J81K 1TBXA 2GXGA 4EM0B 2VN2A 3LFKA 2H6CA 4EV0A 4RB3C 3FMQA 3FXRA 3GW2A 3KFWX 3EQLF 2PMUA 2F5EA 1Z6RA 3CO7C 2DPUA 2IT0A 1FBSA 2EB7A 1A04A 3F6VA 2DTRA 1RIOH 3O2PE 2PQ8A 2ESNA 1MD0A 1QQIA 2A69F 3ZMZA 2DW4A 2XHKA 2K4JA 4NHJA 3DP7A 4FT8A 3G73A 4M73A 2IJLA 5ILSA 2XKPA 4I01A 3MQ0A 5E1WA 3F8CA 5D5WB 3KP4A 2XAJA 1BJAA 4S05A 1O3TA 3R61A 1JHFA 1IN5A 2D1VA 6PAXA 2VC1A 4KFCA 3L09A 3SZPA 3RIRA 4KA4A 1XMKA 2FBHA 2RN7A 4WXDA 4Q5SF 5BPIA 1ZLKA 1Z7UA 2STWA 4AWXB 4LLLA 1HXDA 2A6EF 2GA1A 2ZXJA 1J59A 4QLCU 2V79A 3HRMA 1R58A 3LWFA 2KIFA 1WKMA 1KQ0A 1SD5A 3G3ZA 4YIFA 3GEZA 2J5PA 2VBWA 1SMYF 5D4SA 2KJBA 5D6FA 3GFJA 2QZ8A 3ZP5A 4XBFA 2YPRA 1BC7C 4ZYDA 3KE2A 1XD7A 4BHBA 4P55A 4O3MA 1JE8A 1MGTA 1FSHA 4BYYA 2PJPA 2CYYA 3LA3A 4A6DA 2LDUA 1ZRFA 2LNBA 4WF2A 3PFIA 2UWMA 3J80Z 3BP8A 2RDPA 1ZARA 4FX4A 1J2XA 2QQAA 1IN8A 4MQVA 1QPMA 2QWWA 4L18B 5CJ9A 2F5CA 4KMFA 4MQ9F 4HW0A 3TDZC 3I59B 3RKYA 1QGPA 4PDKA 2KIUA 4BAYA 3GFIA 5K5QA 1SFXA 4WXHA 1EH6A 3H3ZA 4LK1F 1KQ8A 3KP5A 1ZYRF 5DV5A 1FBUA 3NQOA 1HW5A 4B09A 5CVJA 3T1BA 2PBIA 1Q1HA 3KETA 3JTGA 3EETA 5BPDA 1FYLA 1XB4A 4HV5A 3ZMVA 1P4AA 1OPCA 4U7DA 4P9FA 2KKOA 3GZ5A 1W4MA 4GYGA 1TLHB 1D8JA 2C6YA 2VODA 4HX7A 5ED4A 1IUYA 1OKRA 4U0VA 2BYVE 5J8FA 4G6DA 2KRFA 1EH8A 1BBYA 3VOEA 1E17A 3WTVC 3IWFA 1R1UA 2DI3A 4LFUA 3WTSC 3VEPA 1MJAA 3EYYA 3SFZA 2H09A 3U1DA 1ON2A 3V7CA 2QUFA 2IA1A 4Q4ZF 3K9TA 1ZRDA 2QLZA 3L7WA 4MGRA 3ZMTA 1ON1A 1IRFA 5H6RA 5F6FA 2XGXA 1H0MA 1B59A 3F3XA 2CO5A 2EFPA 1TTYA 2V9VA 4UVCA 1I27A 2PG4A 4M72A 4YFXF 1AOYA 2H6BA 2HGCA 1OYIA 2NS0A 4KICA 5LHGA 2ZNZA 2CW0F 4EM1A 1D3YA 3BJ6A 4WK8F 3SZTA 4Y17A 1QZYA 3JTHA 5H20A 1R5HA 5BMZA 3COAC 3MCZA 1UB9A 1FT9A 4LB5A 2HFHA 4HDUA 2DAOA 1IXRC 1RNLA 4G7ZF 3WGHA 1L0OC 1YW9A 4LMYA 4L0YB 4U88A 3I4PA 3CUQA 3BPVA 4RGRA 3SHFA 3BJOA 1J5YA 1Z91A 1G3TA 2VOOA 4IRHA 3HIFA 3GYHX 5L3BA 5DEQA 1OMIA 2OZ6A 5KVRA 3REOA 4IHSA 4KIGA 4LJZF 2P5LC 2MLGA 3KP6A 4M6YA 1SAXA 4RGSA 1S6LA 2UXNA 1XCVA 4A2UA 2W24A 5TRDA 3RJPA 2IW5A 4L9NA 1YS6A 4NQWA 3JSOA 3L2CA 5AIQA 4EGZA 3KCCA 3QP6A 4ZYHA 1U2WA 1KQ9A 4HLYA 2VC0A 5ICEA 5FFZA 2MBFA 4ZYEA 5L3EA 5H6QA 2BV6A 1DP7P 2PI0A 1GHCA 1MDMA 5FLXZ 3TO9A 4EVIA 2HYFA 2L02A 2EFWA 3U9GA 2D2WA 1R00A 1DUXC 4IHTA 4YFNF 3M1EA 3PQJA 4LB6B 1TW3A 3CJNA 3F72A 1DPUA 4IRIA 3IKTA 4KDPA 3K2ZA 4A5MA 3GLXA 5JHUA 3ZMDA 2PN6A 5LEJA 1BIBA 1KU7A 4RGXA 4BQAA 1KU9A 1W7PA 5LGNA 2YX7A 1TW2A 2ZNYA 1JGSA 5DD8A 4OMZA 5L3GA 2VBZA 1TNTA 3FWEA 2FBKA 1CF7B 3DQVC 2VE8A 5DUKA 1WI9A 5E17F 1O3QA 1LEBA 1KA8A 4HYEA 2VE9A 1OYWA 2Y0MA 2ZFWA 1FYKA 1U5TA 3LA2A 4CYDA 4G9YA 1BI2A 2GAUA 3IWZA 3TOAA 3ISPA 5FO5A 2Z33A 4EJWA 3WODF 2NNYA 2X4HA 3E5UA 4CICA 2E1CA 1S3JA 4HZFA 2JRTA 3WTWC 1PP8F 1UCRA 2P6TA 2EJRA 5FD5A 1QZZA 3RKXA 3WTZA 1FX7A 1MJ9A 2K86A 4OIQF 3LSTA 3HOTA 4XSXF 3E6BA 4ESJA 1KU3A 5LBQA 2R7FA 2XVCA 3ZN0A 3RTRA 1SD4A 4CXFA 5D5UB 3JAMZ 2XAQA 1R7JA 3ML6A 3DXJF 5K5OA 1HKSA 1D8KA 4AIHA 1JHHA 2V1DA 3HSFA 1XGOA 3QRFF 3Q9VA 2E7WA 4YFKF 4JBAA 5IT9K 2E1NA 2ZJ2A 4S04A 2V1UA 4ENMA 1R1VA 2KJCA 1SD7A 2ETHA 4M9XA 4OOIA 5F1RA 1IRGA 1W5SA 1K6OA 1I5ZA 3SXYA 5KK1A 2M45A 4PCQA 4MNUA 1B1BA 2WWYA 4IXAA 2DK5A 1I1GA 2ZMEA 4KIFA 4HF0A 2MH2A 1OR7A 5LGTA 4YIIA 1FP2A 4M9ZA 5E8IA 2QBYA 3MEXA 3CLOA 5JI6A 3TO7A 2CG4A 3E6DA 1BC8C 5E20A 3TQNA 2VBXA 1UHMA 2FBIA 4Y15A 4EJUA 3IRQA 2HKOA 1D5VA 3GF2A 3DPTA 2X0LA 2A5YB 5HLGA 2Z9OA 1YW8A 5EEHA 3LQQA 3E5XA 2K7LA 4XLPF 4A0YA 5DYMA 4HQEA 2FQ3A 2ZCWA 1B9NA 1IW7F 3ZQ7A 3QOPA 5CVIA 1R1TA 4FX0A 2W57A 1U6GA 1XMAA 2XASA 2P5KA 3FXUA 1XGMA 3V7RA 5HLHA 3WG9A 2DFIA 5D6EA 2IPQX 3RYRA 2A07F 1J0RA 4HDVA 4GCVA 4Z2YA 4M71A 3W6KB 3I0TA 4N9IA 3E5QA 1PDNC 2MH9A 4CZZA 1ZGJA 1ZG3A 3LAPA 3K1MA 3L00A 3MZHA 1DPRA 3I53A 3HUGA 2XKOA 4KUMA 3C18A 1RUNA 2FEZA 2DU9A 3N4MA 2P7VB 3P7NA 4OIPF 3R60A 2FNPA 2IA0A 1XN7A 1WRJA 5D8LB 1L3LA 1RZ4A 3F21A 2ACJA 2IA2A 2CWEA 4A0XA 1ULYA 2ZKZA 3I5UA 3K1NA 4AIKA 4WXCA 2KIMA 2OBPA 2OD5A 2HTJA 1W7PD 5BS6A 4HOBA 1IXSB 3RYPA 4U0YA 1YYVA 1BIAA 2L4AA 3VB2A 4HA8A 2UXXA 1J9IA 5CVVA 3CO6C 2NRAC 1Z05A 1H9TA 2GWRA 4ZZDA 4M9SA 3ABUA 1KGSA 1K78A 2BE5F 1ODDA 4G8XA 5E18F 3BWGA 1V3FA 4BHPA 1REPC 5BQTA 4ENJA 5A2QK 2OAZA 3EYIA 1AWCA 2DO7A 1S7AA 5TJJA 1ZLJA 3Q5FA 1O7LA 4IPAA 4GGGA 2QVOA 3ELKA 3GVAA 5AONA 3MWMA 4Q48A 4I0AA 2MD5A 5LHIA 1MDMB 1YFHA 3IRRA 3ECHA 3P9KA 3KEOA 3CDHA 3WGGA 5J6XA 1T6SA 1P92A 1KU2A 1FC3A 3C3WA 1ZH5A 2WC2A 2NYXA 3HSRA 1TQMA 3M9AA 5D5XB 3M8FA 2A6HF 1TQPA 2A61A 5L3DA 2MA3A 2DPDA 2VT2A 1W7PB 5EEGA 3C7JA 1T0FA 4PZJA 2COMA 2GA2A 4Q47A 3N97A 2EFOA 2VXZA 3F8BA 1UFMA 3WTYC 2Z5UA 5J8CA 1HBXG 3HRUA 3OOPA 4KNYA 1U5TB 4L0ZB 1G3YA 1XGNA 3CTAA 3RPUA 2HTSA 1ZG5A 1WSUA 3QPTA 2LF8A 1USSA 4EJTA 3BPXA 1PP7U 2K4BA 3TDUC 3HSEA 4OIOF 2WTEA 3KZYA 1IF1A 1T98A 4JK1X 2CSOA 1BN5A 3VFZA 4Y13A 3FXQA 3I71A 1R5GA 3RDIA 1MKMA 3V8KA 3RI4A 4ENNA 2CGPA 4RB2C 2M87A 4IRGA 4BH9A 3HRSA 1TQIA 1LDKB 4A6EA 2PEXA 3V8JA 3ZMUA 4CDGA 2XIGA 2YX4A 2EK5A 3GO5A 1EH7A 3I58A 4BHCA 2L54A 1FY7A 1P4WA 2EA2A 2FF4A 1R22A 2ZBKA 3O6BB 2HS5A 4HBLA 4PGGA 4MHGA 1XDSA 4R1HA 2EV0A 2HDCA 2ADUA 4HX4A 1FSEA 2XV4S 2VBYA 3HYIA 3H3UA 4EJOA 5LLQA 3NRVA 1UHWA 3P9CA 2Y48A 3SQNA 4ON0A 5HS7A 5FB2A 5D5VB 2XAFA 5ICFA 1P2FA 1HSJA 4LD5A 1S7OA 3V4GA 3LA7A 4G94A 2W25A 2EV5A 3HTSB 5ERIA 2R3SA 2HZTA 4LG0A 4KN4X 4LLNA 1R23A 2JTVA 3AAFA 4FHTA 2YSRA 3I54A 2XROA 1B6AA 3WTUC 2ISZA 1WWXA 3J7AO 3QU6A 3S2WA 4KYWA 3T8TA 2PMHA 2LKPA 3F22A 3ABTA 1S29A 2YU3A 2EV6A 2P5VA 2K02A 1FPQA 1BI0A 1FWZA 2QQ9A 3IC7A 5L3CA 2O03A 4QWQA 5LRRA 5D8KB 2RV8A 3IL2A 2L4MA 4IF4A 3GFMA 2IRFG 3OV8A 1T39A 2M5WA 3DV8A 3WTTC 3BJAA 2VT3A 1O7FA 1Z1DA 1ZGAA 1F1ZA 4UHTA 1YLFA 2HQNA 3DEUA 2OU2A 4UUVA 2ISYA 3FX3A 3L9FA 2O61A 2OQRA 3KP2A 5DD4A 4RAYA 4JQFA 1IZ1A 3K0LA 4A5NA 4RB1A 2FA5A 3J80K 1YTYA 3DF8A 3HHHA 5E1XA 2XAGA 2QYOA 3F8NA 2BEOA 1LDJA 2RGVA 5DCMA 3O3KA 4IVNA 1GVJA 1I6XA 1Z9CA 2F2EA 5DCFA 3FF5A 4HQMA 3ZN1A 2GXBA 1I1SA 4UV9A 1G3SA 3ERED 4UVBA 4RB0A 3ULQB 3I64A 1IN6A 4CO8A 4R8HA 3VODA 2O3FA 4HF2A 1XDUA 1CGPA 4I0BA 1YW7A 3M7GA 2DK8A 1IN4A 1K79A 3ECOA 1PUEE 1ZREA 4NB5A 1F4KA 3WE3A 5HOOA 1K78B 2FOKA 3MZYA 4UXNA 1T2KA 3C1DA 3MFKA 4A12A 1HKTA 1WQ2A 1ZRCA 3NEUA 3E6MA 4L5IA 2XUBA 4BXUA 4OMYA 2VONA 2IP2A 5ILVA 3EUHA 1E2XA 2V1XA 2P8TA 3R6SA 3HOSA 2A3SA 1FOKA 1FNNA 2M1BA 5HS8A 3LQRA 2JT1A 5FFXA 5JVTA 2IVMA 3BOQA 4ETSA 2JPBA 1H9GA 4HAMA 5E8GA 4H0EA 2B0LA 3ZPLA 1CF7A 4G7OF 3GUDA 2RKHA 3R4KA 1YG2A 3FM5A 1QBJA 3JSPA 2BGCA 3KZZA 2L3DA 4ASNA 2O0YA 2UZKA 3HTUA 2EWNA 1BOAA 4ZYGA 1RUOA 1G4DA 1LNWA 4D0PA 1USTA 2HOEA 4KMUX 3GXOA 3FZVA 1ZHFA 2JPCA 2FSWA 1ONVA 1KYZA 5HDKA 3P9IA 4YG2F 1O3SA 4M6XA 5CVUA 3KLNA 2LSOA 1Z6TA 5HS9A 3J81Z 1O3RA 4P5OA 2M8EA 4RS8A 3HRTA 1VTNC 4HLXA 3E97A 4HX8A 2P6SA 2Q0OA 2HR3A 4I02A 1B9MA 1SFEA 3DKWA 1BM9A 1F9NA 3JW4A 1QNTA 4MEYF 3E6CC 5LGUA 1S8NA 3CUQB 4P96A 4GO1A 4HV6A 3WU0A 1IXCA 5JFRA 2A68F 4ZH4F 2PLYA 2HYGD 5IT9Z 2EA4A 2FMLA 1LQ1A 4B8XA 1LJ9A 1Y0UA 2RNJA 4OIRF 2HQRA 2STTA 2XAHA 1XSVA 3V7SA 2FRHA 3BZ6A 5HDGA 1YQAA 1NHAA 1SD6A 1MZBA 2FU4A 1LEAA 3B73A 5AIPA 5CVRA 1JXSA 1HW1A 1P4XA 5ICCA 1U3EM 4EMSA 4LLGF 4DNCA 2EFQA 4WCGA 4N0BA 4RGUA 4WWCA 3CUOA 4ENKA 4K2EA 3DFGA 2O6GE 1SMTA 2Y75A 2QQBA 1HKQA 3EDPA 3LAJA 2YR2A 4EJVA 4I2OA 4L9VA 1G3WA 2OQGA 4EGYA
chains in the Genus database with same CATH superfamily
2DMTA 2FXAA 1MBJA 1HDPA 4XRFA 3T5XA 4BMJA 3GFLA 4KN7X 3IHUA 4A0ZA 3BY6A 3FIGA 2MC4A 2JSCA 5FLXK 4U7BA 3WE2A 2F4OB 4W1UA 2BBYA 3G6EI 2EFNA 3ONQA 4HNUA 3CLQA 1RKWA 1G8XA 4J19A 3S17J 2HJJA 4OOGC 1Z77A 2E5ZA 3FXLA 4JX5A 2UV1A 5IPAA 3R0JA 4L9JA 5LEKA 3F6HA 4JI1E 1ZG1A 1FOYA 4BJTA 5IWAE 1QHGA 1XNQE 3JRBA 2KHMA 2AQEA 4FCYA 2HDDA 5J1RA 2CFXA 4F93B 3SEQA 1YO5C 3HM5A 4N4NB 4DR4E 1X6FA 2Q2EA 4L9TA 2NAZA 3BZKA 1X2NA 3G1OA 4LG0B 4A3LJ 3TOBA 3HGYA 3D0SA 4OAYA 1B8IA 1IN7A 1ZBTA 2G7HA 2D1HA 4QIWN 4AD9A 3ZMSA 4DYCA 4F7ZA 3THOB 2RC4A 2RTXA 1B72A 3C4TA 5C44J 3K4JA 4HF1A 4K0KE 3KLOA 2VOPA 1AA7A 1TNSA 1Y0NA 3BG6A 4E70A 3TEDA 4OU0A 2DT5A 4I09A 2LVHA 4EM2A 2NVYJ 4OINF 2YWQA 4CCMA 4XLNF 4WX9A 3ADJA 1J7KA 3OYMA 4JP0A 1XMXA 2W84A 3IKVA 3RPQA 3F6OA 2ODRD 2WV0A 1BI3A 5D4RA 3WGIA 1ZKGA 3M8EA 2GZWA 1C0WA 2QSFX 5KL4A 4PSXA 3OS0A 2NUFA 3F8MA 4ZYAA 2F6CA 1KYWA 1W36D 1GV5A 3CUQC 3PQKA 3KYLA 1RR8C 3SFIA 1HCRA 2YTIA 1LB2A 2EPRA 3W6JB 3S16J 4D5FA 5KL5A 3ZOQB 3FHZA 2HDWA 2EPUA 4X65E 2WAQN 3TGNA 4MO7A 2QKMB 2PMZN 4R79A 4YELA 5BOXA 4LGWA 2R7XA 5K5RA 5L3FA 3MMYB 4DQ2A 3R0AA 1G6NA 5BR8E 3JRFA 4TV7A 1D0ZA 2PJRB 1WJBA 2CJJA 2NOJB 2E1MB 3CJTB 1IBLE 1TF6A 1HQCA 3BDDA 1FZPB 5IOYA 2KQRA 2EN6A 4BE1A 2ELYA 1P6RA 2AXLA 1AHDP 1GXPA 2RQPA 2L7FP 2LC2A 4KITB 3GWZA 1D5YA 1JJ8C 1YS7A 4X0GA 3FXKA 2D45A 4XRMA 1K83J 2L0KA 3BR5A 1Z21A 4BBRJ 4MEXF 2EMFA 4WSGA 4P7DA 3QPLA 2Q8KA 3ADLA 3K1PA 3ZOBA 4BEHB 1IV6A 4RLQA 3CCVI 2QF7A 2EZ6A 1O57A 1I3QJ 4ZZLA 1GVDA 4CHUA 1T38A 2QENA 4A69C 3GZ6A 4IJAA 4ESBA 2V87A 2O7OA 1J75A 3HOVJ 3VHTB 1NCSA 1FOXA 4IX7A 1A1KA 3B02A 4G6QA 4RA2A 5IT3A 1ZAOA 2EOOA 1AKHB 5FD6A 4R2PA 2E2IJ 2K4VA 2F5FA 3K69A 4RAZA 3QYFA 1FBQA 3D5LA 3LFUA 1B4AA 4IEJA 4BACA 2G9WA 1A1IA 3QPHA 3I59A 3IH3A 2GQQA 5GP9A 1STZA 4BQOA 4FETA 3JAMK 2HKXA 2IAIA 2WB1N 4GYIA 3TO6A 2K9QA 2VKVA 2L01A 4ITVA 3H9JA 3FMRA 1ETWA 1JUMA 5E1ZB 4NNJA 1XCBA 1U78A 5CLSA 1VQOI 5K7FA 1S9HA 2FNAA 3GX4X 5DCMB 1DGCA 1XSDA 2RPCA 3KP7A 1UN6B 4MTDA 4LK0F 3WTXC 4N4RB 2Q1ZB 3S8PA 2MC3A 2E5NA 2QM3A 2DOFA 2RVCA 2XPVA 4MTEA 3T8RA 1QHHD 3QP5A 2I10A 3H35A 2R76A 4I76A 3K6QA 4IQJA 1Z3YA 2H8WA 2H94A 3DKYA 4XLFA 2B3TB 2J5OA 4JYAE 3HPGA 5GADJ 4PGHA 1EV7A 5B3SH 5JLWA 5A2QZ 3OYLA 3MSWA 4M9VC 1XS9A 2V6CA 2DQLA 4KIBA 4B3RE 2L2KB 2E7XA 2ZSHB 2X1EA 2K27A 3G2BA 2YT4A 1G2HA 4R2CA 2P7CB 2CQKA 1XGSA 3QWLA 2AS5F 4GZNC 3S2DJ 1GXQA 3Q0WA 2VKDA 2EOYA 2Z99A 1K7AA 4P9UA 1ZN2A 1YUJA 3BR6A 2QCOA 2EN4A 2DLLA 1FMWA 1LDDA 2GIVA 1BI1A 2V4JC 5CYVA 1GZ6A 4BCAA 2NS7A 4M74A 2ZMEB 3L2VA 1YRNA 1K61A 4D7NA 4UVAA 4RHBB 4GXOA 4N9HA 4R2SA 2MSYA 5F64A 2QBYB 3K4MA 1JK1A 3TKYA 1HW2A 5TSEA 3MAJA 4LOCA 3NARA 4EQQA 4I98B 1W5TA 2MLKA 1X3UA 2Y0SA 1WFXA 3E3VA 4A93J 1FLIA 3F8FA 1U5TC 1YIOA 4O5VA 5HDNA 3I4MJ 4KT5C 2O8XA 5ILUA 3T0YA 3F23A 1OQYA 2MABA 4G12A 2R7DA 2VQLA 3U2RA 1JKOC 1A31A 3M4OJ 2GPIA 2YRKA 1OYYA 3DU5A 3ROUA 2DIXA 3PNVA 3BR0A 3BROA 5JLXA 2EPZA 2JOXA 2MKNA 2OA4A 1MJBA 2UU9E 1V4RA 1SFUA 4UV8A 2E1MC 1OCRH 2PFBA 2W85A 3GTMJ 4FE7A 2YRHA 4ESFA 2DBBA 2DQRA 2H27A 2EOFA 4JI0E 5KL3A 1Y56A 5LHHA 2I13A 4CCKA 4O6JA 1E3PA 1LVAA 4IHWA 5IY5H 3QAHA 1R36A 2HZDA 3ABLH 1NG7A 2HXOA 4U0WA 5ADZA 1RI7A 4JI4E 1QO0D 2G7UA 3QOEA 4G7HF 2UUBE 3RQ4A 3D5SC 4J00A 2DJNA 3QU3A 5FGMA 2TDXA 4DBRA 4LU9A 3CCQI 2ESHA 3ZQHA 1IUFA 2LF7A 2BHYA 4M30A 2DJIA 4E7IA 1U8RA 3IWCA 1FYMA 4B43A 5DDGA 2NUEA 4IHYA 2HWVA 2Z3YA 1UG0A 4CCOA 5ICGA 3HQ1A 4F91B 1DDNA 4KJZA 3PIOF 2R7WA 1JI8A 2OZUA 5HLIA 1DGWY 4UNOA 3AFHA 5DUIA 4BNCA 3RKWA 5TGTA 2L7MP 1IDZA 2F5DA 4XSZF 3A1YA 2XGCA 2XRNA 4I7HA 4BDYA 1MNMC 4FQGA 3KP3A 2M30A 5IP9J 4AYBN 2HEOA 2FE3A 5CQGA 3OYCA 1BB8A 3OYEA 2IGNA 3V8LA 2VQFE 3HHGA 3Q9SA 3DPLC 2NUGA 1U9NA 5JR3A 2DCEA 4XN0A 1F5TA 1FP1D 2JZYA 3FM3A 1IAWA 2LTPA 3H92A 1XSXA 3KEQA 1VQPI 3HG9A 4XKBA 4L5JA 3WU1B 1J5EE 1OISA 4YEJA 2HC5A 2DLQA 2EL5A 3MKLA 5B1AH 2FMYA 4FISA 5KL2A 3FMSA 4BS9A 5EYRA 4AIJA 4AVPA 5HVQC 2ZO4A 5LRSA 3DJWA 2P4WA 3SEZA 5K1YA 4LF5E 2NNNA 1OCZH 4CGZA 2IS1A 2ELHA 5IYCJ 2V6EA 1W36C 3RMPA 2EMLA 3OYBA 1HSTA 2E5LE 4D9JA 3J81K 1TBXA 2GXGA 3HXLA 4A3DJ 2JN6A 4EM0B 2VN2A 3LFKA 2BHZA 1WJFA 3LSMA 3MKZA 1KZHA 2H6CA 4CCJA 3CMEI 4FTHA 4EV0A 2OV7A 2X6YA 4RB3C 2LJHA 3FMQA 3IWDA 2CW8A 1VZ0A 3FXRA 3GW2A 4BE0A 1DP3A 2W4SA 3BTLA 3KFWX 3E1SA 3IH2A 3PNYA 4DKKA 1UZCA 3EQLF 3K4CA 2PMUA 2ZMEC 3ASNH 4V2FA 1LFBA 1RESA 2F5EA 1RMDA 1Z6RA 1ZQ3P 3PJRA 2YTPA 3CO7C 2DPUA 2QSGX 2VJ4A 3BBGA 2IT0A 2EM7A 1X3CA 1FBSA 2DA2A 2EB7A 1A04A 3F6VA 3CMAI 2DTRA 3LSJA 1RIOH 2M9HA 5F3WA 5FKKA 3O2PE 2DXIA 2PQ8A 4DV5E 2YS9A 1XTAA 3A2KA 5FLXC 2ESNA 1MD0A 5B66C 1QQIA 2ENHA 1JTXA 2A69F 2FQ4A 3ZMZA 3A03A 2DW4A 2XHKA 4CA0A 2HU9A 2K4JA 4NHJA 3BQYA 3DP7A 4FT8A 3G73A 4M73A 2ZXIA 2COBA 2IJLA 2X6WA 1N36E 5ILSA 2XKPA 3MZ8A 4I01A 3UR3C 1X3WB 1MEYC 2WY7Q 3MQ0A 5KL7A 1A1JA 5E1WA 1QPIA 5FLVA 2UXCE 3F8CA 2OCEA 5D5WB 1IGNA 2LKXA 3FHNA 1FIAA 3CJQB 3KP4A 2XAJA 2ME6A 4EEFG 4B3ME 2EM8A 4YIRX 2JRMA 5M5XJ 1LE8A 5GPAA 1BJAA 2HQ5A 4S05A 1O3TA 3R61A 1JHFA 1FJLA 2LTRA 1IN5A 2VB6A 3HKZN 4XL9A 3CCRI 2EMWA 2D1VA 6PAXA 1T4NA 2VC1A 3ZGKA 4KFCA 4ABZA 3L09A 2H36X 2DFEA 4E7HA 3SZPA 1MBFA 1VF9A 3RIRA 4PJNA 2YTFA 2XF5A 4KA4A 2B9DA 3ADGA 1XMKA 4UUSB 4BQNA 5M5YJ 2FBHA 2RN7A 4WXDA 3LNQA 1N77A 2NXNB 4BY1J 4UY8I 4Q5SF 4JI7E 4GDFA 4DUYE 3A0HC 3U1KA 4XIDA 3OMYA 5CQEA 5BPIA 1ZLKA 1LKXA 1Z7UA 2KFDA 2STWA 4X1EA 4JX4A 4M3BA 4AWXB 1PJQA 4GEQB 3CQZJ 4LLLA 1HXDA 1Z7LA 2A6EF 2GA1A 1P9QC 2ZXJA 1J59A 2EQ3A 3BR3A 4QLCU 3VK6A 4X64E 1HNZE 2V79A 1EKEA 3HRMA 4V2GA 1R58A 3DPUA 3J7AG 1D0YA 3LWFA 5M5WJ 2KIFA 3OOUA 4DR3E 1WKMA 4ZC3A 5GAGJ 2JVHA 4Q28A 1KQ0A 4JI3E 4KT6A 2Q2EB 2V88A 4PJ0C 1SD5A 2JSPA 3G3ZA 4QSHA 4YIFA 5F0HA 2WBMA 3BGHA 2IS2A 3GEZA 2VLAA 2J5PA 2X1DA 1YOVB 2VBWA 1SMYF 3RCOA 4EGYA 3W2VA 5D4SA 3KPHA 5C4JJ 3K4KA 4BJ5C 1MMDA 2KJBA 5D6FA 3GFJA 1B72B 2QZ8A 4WPYA 1TWCJ 3ZP5A 2XPUA 2EMKA 4XBFA 2YPRA 5AC5A 1BC7C 4ZYDA 1A1FA 4CZCA 1WH5A 1STUA 2CUFA 1YJ9I 2HOAA 3A01A 3KE2A 1T08B 1XD7A 2BVMA 2AQFA 1D1BA 3K4NA 2JK3A 4BHBA 4P55A 1ETQA 4WSPA 4LG3A 4O3MA 1JE8A 3BG3A 1HA8A 2A6TA 3ERMA 1MGTA 2LUPB 3RZOJ 2EIMH 2EPAA 1FSHA 1EA3A 4BYYA 2PJPA 2CYYA 2K7IA 2P81A 2L6MA 1YHQI 3JAMC 1BOBA 3FKIJ 3LA3A 2UUAE 3AV0A 2DA5A 4AVZA 2HOSA 1WZ2A 1JKPC 2CQNA 2VJJA 4A6DA 2LDUA 5EEAA 5FROA 1ZRFA 2LNBA 4WF2A 1HOMA 3PFIA 3OL3A 2UWMA 1YX5A 2EMIA 2Y30A 1X1BA 3J80Z 1KJKA 3CF5F 2MYSA 3BP8A 1WJ5A 2BW3A 1X1AA 2HHHE 2RDPA 2UUCE 1ZARA 4FX4A 2LRSA 3LSRA 3CCMI 2FTXB 3OYIA 1J2XA 2QQAA 1Q1VA 2K9LA 1IN8A 4MLVA 3DTIA 4MQVA 4BY7J 1ZU1A 4M3DA 1E3HA 1QPMA 2QWWA 4L18B 5J40A 1OLTA 5CJ9A 2R5YA 2JVAA 1MBGA 2NA2A 1X3ZB 2HNHA 2DMUA 1JUSA 1W1WE 2F5CA 1EKZA 1QRYA 4KMFA 2L3CA 1RKTA 1G2FC 1SVOA 4MQ9F 1MIJA 4HW0A 3TDZC 4L8NA 2YTDA 2B63J 3CMMA 3LSKA 1KONA 1QZEA 5C3EJ 1BBOA 2E34A 3P5JA 2V8QB 2M4KA 2L3JA 5FKNA 2LG4A 3I59B 3RKYA 1QGPA 4PDKA 2KIUA 4BAYA 3JRGA 3GFIA 5K5QA 2YU8A 1SFXA 3FBNB 4WXHA 4GRIA 5FKMA 1EH6A 3H3ZA 3DBHB 3H36A 2DMPA 4LK1F 1KQ8A 3KP5A 1ZYRF 2M4IA 2LKSA 4O4KA 5DV5A 4A3JJ 3HDDA 1FBUA 3NQOA 1HW5A 4MFDA 4B09A 2R7ZJ 5CVJA 2EINH 3S32A 4XMYA 3T1BA 2PBIA 3W6VA 4F52A 4DR5E 2ZFUA 4ANJA 2GLOA 1Q1HA 3KYCB 3KETA 5E3LA 2VL8A 1WHQA 3ABKH 4A3KJ 2JUGA 3JTGA 3GTGJ 3EETA 5BPDA 2N8XA 4PJMA 2FGGA 3JRAA 1FYLA 3J7YJ 3FK7A 1XB4A 4HV5A 2AHQA 2Y9ZA 3H0GJ 3ZMVA 1WJAA 2H8RA 4BBYA 1YYOA 1FJGE 1P4AA 2L5QA 1OPCA 1MBKA 4U7DA 4P9FA 2KKOA 3W2AA 4A3IJ 2F4IA 3GZ5A 1T0FC 2CQXA 1RRJA 2DA3A 1W4MA 4GYGA 3H5NA 4PUSA 4I6ZA 1TLHB 1D8JA 4LTYA 2C6YA 1TWFJ 2VODA 2W00A 4HX7A 5J4YA 5ED4A 4A3EJ 2MD0A 1IUYA 1L4SA 1OKRA 1R49A 3RSNA 4QPQA 2W82A 4U0VA 2BYVE 2LE2A 2DMQA 5J8FA 2JA7J 4XLHA 3S1NJ 2M9AA 4HTGA 2JP9A 2ELKA 1YX3A 4G6DA 1YRNB 4M3GA 4DOZA 2I8DA 2CSHA 2EN2A 2KRFA 1EH8A 1BBYA 4LF7E 4II3A 3VOEA 4CYCA 1E17A 3RKQA 3WTVC 3IWFA 2KLOA 1R1UA 2DI3A 2JA2A 4LFUA 4GFBA 2RS6A 3WTSC 4F54A 2EQ0A 1K6YA 1A1GA 4R03A 3VEPA 1MJAA 3EYYA 1QVTA 2DMNA 3SFZA 4C2UA 2YTGA 4O24A 1T56A 2H09A 3QPSA 3U1DA 3K7AJ 1ON2A 3BTJA 3V7CA 2QUFA 2IA1A 3TP0A 1N33E 4Q4ZF 3K9TA 1IG7A 3AG2H 1ZRDA 2QKLB 2QLZA 3THNA 1J09A 4GKJE 4R2RA 3L7WA 1U8BA 4MGRA 3ZMTA 4FK5C 2XF6A 1ON1A 1P7JA 4D1QA 1IRFA 5H6RA 2LK2A 5F6FA 2XGXA 2O8KA 1H0MA 3OYFA 2YRMA 1B59A 1ZTRA 1VQ8I 3F3XA 2CO5A 2EFPA 1W5CC 1ZR9A 1TTYA 3SDGA 2EH3A 2V9VA 4UVCA 1I27A 2X6OA 3TBIA 3DLLF 4DYQA 2CUZA 3J80C 1D1CA 2PG4A 3CP2A 2ZB9A 4M72A 4YFXF 4BUPA 1AOYA 2H6BA 2HGCA 1OYIA 4A3CJ 3DLAA 2F48A 2ZC2A 2NS0A 4DR1E 2FD5A 4KICA 4Y33A 3GTQJ 3DTEA 5CKTA 2HVSA 5A69A 4PK4A 5LHGA 3EPKA 3Q0VA 4XR6A 3GTKJ 2ZNZA 2CW0F 4EM1A 1D3YA 3BJ6A 1VQ5I 3EPJA 2LT7A 4WK8F 2OF7A 2M1SA 3SZTA 3BCAA 2M7BA 1H88C 4Y17A 1KYQA 1QZYA 3JTHA 1JJ6C 2JA6J 5H20A 1SVLA 1R5HA 4NZVA 1R5ID 5BMZA 3GBGA 4C9YA 3COAC 3MCZA 1ZR4A 1MMAA 1UB9A 1FT9A 3HOYJ 2YZTA 3C6MA 2HOTA 4JX6A 4LB5A 2CFOA 2EZHA 2DAOA 2HFHA 4HDUA 1FKAE 1H89C 3IUOA 3OIPA 1IXRC 3NWSA 1RNLA 2ZJQF 4G7ZF 2R1FA 3W3CA 3WGHA 1NK3P 1PUFA 1L0OC 1YW9A 2F8BA 4LMYA 1WJEA 3VYTB 2LOOA 2VQCA 4XKWA 4L0YB 4U88A 3S3MA 2JA8J 2V26A 5HLTA 3I4PA 3CUQA 3BPVA 4RGRA 3SHFA 3BJOA 4NBQA 2L2MA 1J5YA 2YUSA 1Z91A 3CCEI 1G3TA 2BY2A 4BKXA 2VOOA 2NS8A 4IRHA 4CSWA 3HIFA 4M0VA 3GYHX 5L3BA 4JI8E 5DEQA 2L9SA 5IYDJ 3J7Yp 1OMIA 2OZ6A 5KVRA 3REOA 3C6KA 2BBGA 1WH7A 1TWHJ 4FE4A 1WHUA 3DBLB 3AG3H 5IP6A 4KIGA 4IHSA 4LJZF 2P5LC 2MLGA 3KP6A 2CTDA 4M6YA 1SAXA 4RGSA 3V42A 1S6LA 2UXNA 2DTZA 4MIMA 3OR1C 1XCVA 3GTPJ 4A2UA 2W24A 1X49A 2CUEA 3K4LA 3VPRA 2L33A 5TRDA 3RJPA 5DM7F 1IBKE 2IW5A 4L9NA 1YS6A 3PM1A 4NQWA 5LFAA 2VF1A 3JSOA 2DA7A 5IYBJ 3OIQA 1X6HA 2MG4A 3L2CA 5AIQA 2V7FA 1RETA 4EGZA 2XPWA 3KCCA 4NC7A 4DV3E 3QP6A 4ZYHA 2DYRH 3LMMA 3MD2A 2LD5A 1U2WA 1KQ9A 1OCCH 4JI2E 1HNWE 4HLYA 2VC0A 4LIUA 1SC7A 4XICA 1X19A 5ICEA 2XDVA 5FFZA 4XLEA 1YJWI 1R4MB 2QEXI 2MBFA 4ZYEA 2EM6A 1B69A 1F36A 5L3EA 1A5JA 3DEEA 2PX9A 5H6QA 2EQRA 3HB9A 1WHNA 2BV6A 1DP7P 2PI0A 5BNGA 1GHCA 2DOAA 1MDMA 4DUZE 5FLXZ 3TO9A 4X8WA 4EVIA 2HYFA 5CFFE 1VI0A 1SANA 2L02A 2RQLA 4R2DA 2EFWA 1RC7A 2VQHA 5EJCA 3U9GA 2V9KA 2D2WA 5LD2C 4IJDA 1R00A 1DUXC 1LE8B 4IHTA 4YFNF 1R4NB 3KX2A 2LO3A 3M1EA 3PQJA 4LIVA 1GLNA 4LB6B 1D0XA 4C30A 4C3JJ 3CESA 3OMLA 1TW3A 3JU0A 3CJNA 1GUUA 2K85A 2YPNA 3F72A 1DPUA 4IRIA 3IKTA 1U9OA 5GTHC 3CCUI 1TZLA 2LBFA 4KDPA 3K2ZA 1PJTA 1FTZA 2Z16A 4A5MA 3F9KA 2L9VA 3GLXA 3PUBA 3ZMDA 5JHUA 2EMXA 2JXPA 2PN6A 4XKCA 5LEJA 3L2UA 1BIBA 3PSIA 2B7EA 1KU7A 1IQSA 2LREA 1T8IA 2JUCA 4RGXA 1ENHA 3AKZA 4BQAA 2JQ7A 5IXMB 1KU9A 1W7PA 4UB6C 3AG4H 5LGNA 4M2ZA 5LMUE 3KEYA 2YX7A 1TW2A 3D5RC 1XC5A 3ZQQA 2ZNYA 1JGSA 1UG2A 4OMZA 5DD8A 1UAAA 2EOHA 4B3AA 4LF9E 4TUGA 5L3GA 2VBZA 1TNTA 3FWEA 4LITA 5EF6A 2FBKA 4BXXJ 2X1CA 2EPXA 1CF7B 2M2EA 1M1EB 1UILA 3DQVC 2VE8A 2VXDA 5DUKA 1WI9A 2CRGA 5E17F 3H3VK 1O3QA 2DT6A 1LEBA 4KISA 5AASA 1KA8A 5H2FC 4HYEA 5KAFC 3IV5A 2VE9A 2LY9A 1OYWA 4V19K 2Y0MA 2ZFWA 1FYKA 1U5TA 3LA2A 2YTNA 1XPXA 1HLVA 3ZCOA 2XAUA 4CYDA 4G9YA 1BI2A 2GAUA 2RAEA 3IWZA 1N34E 2CW7A 3TOAA 1WJCA 2R4GA 1VFCA 5AE2A 3KYDB 3ISPA 5FO5A 3EPHA 3EQ1A 1FEXA 4B3TE 3PUFA 2Z33A 4EJWA 3WODF 2NNYA 2X4HA 1V5GA 3E5UA 4CICA 2E1CA 4PJJA 1S3JA 2IEKA 3PSFA 4HZFA 2E1MA 2JRTA 4BU2A 3A01B 2E2JJ 4DR7E 1SR9A 3MHSC 3WTWC 4E4HA 4DBQA 1PP8F 1ZAAC 2EOZA 1HNXE 2K3PA 3DTKA 1UCRA 2P6TA 2EJRA 5FD5A 1ETKA 1QZZA 2LMDA 3RKXA 3BT9A 3WTZA 4BC9A 1MW7A 1UMQA 1FX7A 3CCLI 3GLLA 3L2WA 3S14J 2I5UA 3E7LA 1MJ9A 1WCMJ 2ODRC 2K86A 2ZSIB 1MSEC 1Y1VJ 2ELJA 2UUZA 2E72A 2BY3A 3LSTA 4OIQF 3OYNA 5F0FA 3ZQGA 3HOTA 4XSXF 3E6BA 2LP0A 2Y69H 4ESJA 1LFPA 4A3BJ 1KU3A 1DQ3A 4C3IJ 5LBQA 3CMYA 1LLMC 2R7FA 2XVCA 3ZN0A 3TW7A 1OCOH 5K7ZA 5IOZA 3RTRA 2XGEA 1SD4A 4CXFA 5KCMA 5D5UB 4AIDA 3JAMZ 2XAQA 1R7JA 3ML6A 3DXJF 4HG2A 1HKSA 5K5OA 2FOWA 2EPMX 1D8KA 4AIHA 2DN0A 4J01A 2JA5J 1JHHA 3ZR8X 2V1DA 3HSFA 2MDRA 1XGOA 3MKWB 3QRFF 3Q9VA 2E7WA 4NHRA 4YFKF 2ECBA 2ADRA 4F2JC 2R5YB 2CUJA 4JBAA 4Y3OA 3BTCA 1HF0A 5IT9K 2DMIA 3S93A 2R0QC 2E1NA 2ZJ2A 4S04A 2V1UA 2CV2A 2YTQA 1BA5A 1BR4A 2EPLX 4ENMA 1R1VA 3H5RA 1ZK8A 2KJCA 5F1JA 2VKHA 1SD7A 2ETHA 2Y0SN 4M9XA 4OOIA 3EUHC 5F1RA 2ECCA 4NUBA 1TT0A 1Y8QB 4XLCA 1IRGA 1BW5A 2EMGA 1W5SA 1K6OA 1I5ZA 2L2OA 2CQQA 3SXYA 2EM5A 5KK1A 5FJ8J 2M45A 3HZJA 4UUTA 5IV8B 3DKXA 4PCQA 3EPLA 2JPAA 4MNUA 1DQUA 1B1BA 3BR2A 2NVUB 3CC2I 2WWYA 4HEIA 5AE1A 4NC6A 4IXAA 1N25A 2DK5A 2LUQA 3J7AY 4IHXA 2YTJA 3MN2A 1IV8A 1I1GA 4E7JA 3OIOA 2M0CA 2ZMEA 4JYKA 4KIFA 3K2AA 2N3GA 4HF0A 2MH2A 5F0CA 3OYJA 1OR7A 4IO9F 1BL0A 2CV1A 1XNRE 5LGTA 1N32E 4YIIA 1FP2A 2KRHA 4M9ZA 2JVGA 5E8IA 2QBYA 3OYGA 1ZBQA 2VASA 3MEXA 2LY2A 3CLOA 5JI6A 2CH0A 4NC8A 3OY9A 3H9QA 3TO7A 5E79C 2BXZA 3Q0UA 2CG4A 2VE7C 1SEUA 3E6DA 1W0UA 2WY8Q 1WPKA 1BC8C 5E20A 3TQNA 2IXSA 2VBXA 3I55I 1UHMA 4DR6E 2FBIA 1IC8A 2YU9J 3K70D 4Y15A 4EJUA 3BG7A 3PNTA 3IRQA 4BBSJ 1IMUA 2HKOA 4PJLA 1SVMA 1NH3A 2B9SA 5KL6A 1HDDC 3LLHA 2VQGA 1D5VA 4DV0E 1UELB 4XONA 1DU0A 2M7AA 3GF2A 2FX0A 2XSJC 2R7TA 1IDYA 2HVRA 3DPTA 1BR1A 2X0LA 2WZOA 2A5YB 5HLGA 2Z9OA 1YW8A 1VQ9I 2R7UA 2EL4A 2GOMA 3JRDA 5EEHA 1BW6A 4X62E 3LQQA 3E5XA 3IAS2 3O8HA 2K7LA 3TMOA 4XLPF 4A0YA 5DYMA 1JKRC 3JRIA 1B8IB 1QVUA 1VQ4I 4W97A 2H1KA 1BR2A 2MFZA 3OR2C 4HQEA 4LF4E 2FQ3A 2ZCWA 1TL8A 5A6BA 4LFAE 3BC8A 2DLKA 3FIWA 2XB0X 1B9NA 1IW7F 3B6AA 3ZQ7A 2EN3A 3QOPA 1JT6A 3OWTA 4HEA2 5CVIA 2P0WA 1WVRA 1FTTA 1R1TA 2EN1A 1IQOA 4FX0A 2W57A 2GHFA 2EILH 1U6GA 2HPMA 1XMAA 2GLIA 2EIKH 2XASA 2P5KA 3M1CA 3GTLJ 3FXUA 1XGMA 4ZTJA 3V7RA 5HLHA 3UKGA 3QYEA 1R9TJ 2EOIA 3WG9A 2DFIA 5D6EA 2IPQX 3RYRA 2A07F 1J0RA 4HDVA 3ZXSA 2EPKX 4R8OA 2E71A 4GCVA 1ZELA 2K3FA 4Q35B 4Z2YA 4M71A 1T4OA 3QODA 1OCTC 3BQZA 2Y9YA 3W6KB 3I0TA 4N9IA 5EGOA 5AE3A 2GIZA 3E5QA 3LSIA 4HPQA 1PDNC 4M3FA 2OJED 1MSFC 2MH9A 2MC6A 2TRTA 2B7TA 2BB8A 4CZZA 1ZGJA 1X4PA 4DV1E 1A6IA 1FOWA 4L5EA 1ZG3A 3LAPA 1YUIA 3K1MA 3L00A 3MZHA 1DPRA 3I53A 3HUGA 2K5CA 2DT7B 1NEIA 4B3SE 2XKOA 2RNGA 4KUMA 1R71A 3C18A 1RUNA 4C2MJ 2EM2A 3OYAA 2KISA 2FEZA 2DU9A 3CP8A 2OPTA 3N4MA 2P7VB 4Y52J 3P7NA 3A02A 3BLYA 4OIPF 3R60A 2FNPA 2IA0A 4DYRA 1XN7A 4BXFA 1YIJI 1WRJA 5D8LB 1L3LA 1RZ4A 3F21A 2ACJA 4DIQA 4AM3A 2IA2A 2CWEA 1N78A 1P47A 2ZJRF 2BY0A 4KWYA 4A0XA 1ULYA 2WAQA 4OAZA 2X48A 2BVLA 2BOLA 2PMZA 2ZKZA 3I5UA 3ZRGA 3K1NA 4AIKA 1VQKI 1RQ0A 4WXCA 2KIMA 2OBPA 3NWTA 1DI2A 2OD5A 1YI2I 3L2RA 2KP6A 2HTJA 3VSLA 4F3QA 1W7PD 1W0TA 5BS6A 4HOBA 1IXSB 3RYPA 2EIJH 2M3AA 2EMCA 1LFUP 2L9RA 4U0YA 3BF2A 2ENCA 1YYVA 1BIAA 2L4AA 3FKJA 3VB2A 5GTIC 4F9CB 4XK4A 4HA8A 1X58A 3L1PA 4IS1C 2UXXA 4PFOA 1YPNA 4RM2A 1J9IA 3UNGC 5CVVA 3CO6C 2NRAC 9ANTA 1Z05A 1H9TA 2EORA 2GWRA 5F08A 4ZZDA 4M9SA 3LOCA 5A6JA 2XRLA 3ABUA 4B3XA 1TWGJ 1KGSA 4A3FJ 2NVQJ 3RZDJ 1K78A 3AG1H 3G71I 3WHCA 4XORA 2HYJA 3X2QH 2BE5F 5HNHA 2G0EA 4ZJZA 1ODDA 4G8XA 5E18F 3PL8A 4HSRA 3BWGA 2MDGA 1A6QA 1V3FA 3ZQFA 4BHPA 1REPC 5BQTA 4ENJA 2KDOA 4EATA 2NABA 3UK3C 2KT0A 1Z0XA 4HNTA 2W7NA 3TW6A 2OAZA 3LL7A 5A2QK 4ZTFA 4YHHE 1XMOE 1NTCA 3VSKA 5FLMJ 4DV2E 3EYIA 2M34A 4C3HJ 1AWCA 2WB1A 3T1HE 2DO7A 4FASD 3H0DA 4X66E 1S7AA 1ZLJA 1O7LA 4IPAA 5TJJA 3Q5FA 2LCEA 4XN3A 4GGGA 5KAIC 2K9NA 1A1HA 2QVOA 3ELKA 3GVAA 5AONA 1LUJB 1AH5A 2R7OA 1XG1A 2WV1A 3MWMA 2R7RA 1GDTA 4XRSA 4Q48A 5J3LA 4I0AA 1T33A 2MD5A 3C2BA 5LHIA 5IP7J 1MDMB 1YFHA 1X48A 3IRRA 3ECHA 2DB2A 3P9KA 2Z1DA 3KEOA 5EG0A 1F43A 3CDHA 3WGGA 3HPZA 4C2TA 5KHDA 3C2HA 4F92B 5J6XA 2JR1A 1T6SA 3JRHA 4P78A 1P92A 1KU2A 1FC3A 5LMNE 2UXDE 4AQYE 3C3WA 3HOXJ 1K4TA 1ZH5A 1V54H 2WC2A 3D1NI 2K40A 2NYXA 3HL2A 3DU6A 4CH7A 2LBFB 2GXAA 2EMBA 2WBTA 3HSRA 1TQMA 3ECRA 2DSYA 3M9AA 5D5XB 3W2WA 2H1LA 3M8FA 2RREA 4BQQA 4RH8A 2A6HF 1TQPA 2A61A 4CUGA 5L3DA 3PO3J 2MA3A 3IAM2 1I39A 4CCNA 2DPDA 3VYYA 3T1YE 3BCBA 1WI3A 2VT2A 1W7PB 5EEGA 3J7ZI 3C7JA 1T0FA 4PZJA 1EF4A 3HPSA 4F6MA 2COMA 3OYDA 5KNLA 2GA2A 4TUIA 4Q47A 3N97A 2X85A 2FJ1A 2EFOA 2EZLA 2VXZA 2KRCA 3H5AA 1MNEA 4P1WA 2LFBA 3J81C 3FXOA 1YYKA 3F8BA 1UFMA 4M6VA 3Q3SA 3K70C 3WTYC 2YTEA 2Z5UA 5J8CA 2LMZA 3DF6A 3G1MA 1HBXG 3HEFA 3HRUA 3OOPA 4KNYA 1S5LC 1RR7A 2VKEA 1U5TB 4L0ZB 1X1CA 4RDUA 1TC3C 1YZ9A 3RQIA 3SYTA 1RPWA 1V5EA 3GTOJ 2L9NA 3HOWJ 4XKVA 1G3YA 3H9GA 3JR9A 3HJEA 2DFHA 1VQ7I 3ASOH 1XGNA 2WBUA 3EPZA 4F55A 3CTAA 3RPUA 2DRPA 1GT0C 2HTSA 5M3MJ 2R92J 3PO2J 1WGXA 1ZG5A 5IT9C 1WSUA 1S7EA 4RAFA 2CT1A 3QPTA 2JWTA 2LF8A 4XQFA 2M0MA 3ZQLA 1APLC 1USSA 3QG5C 1H8AC 2W1OA 2KPMA 3OL4A 5HNFA 4EJTA 2L2NA 2L7KA 2VPRA 1A36A 3BPXA 3S3OA 2CMPA 1PP7U 4L5NC 2QA4I 3B6CA 2MKDA 2XB5A 2K4BA 1IO2A 3TDUC 3HSEA 4OIOF 2LRDA 2KIQA 2WTEA 2NVXJ 2DA4A 3KZYA 2IS4A 1IF1A 2WAFA 1T98A 2QQ8A 4JK1X 4ZDLA 1Z3XA 4JI5E 2CSOA 1BN5A 1YITI 1X1PA 1WXRA 3VFZA 2L92A 1TWAJ 4XOTA 2R5ZA 4AU7A 4DR2E 3BR1A 4Y13A 3OS1A 5FKOA 3FXQA 3OYKA 2JWOA 3IWBA 4WFTA 3I71A 1F2IG 1V5FA 1R5GA 3RDIA 1MKMA 4M3EA 3JRCA 3V8KA 3RI4A 1RC9A 5EZGA 2AXTC 1BBGA 4ENNA 4AYBA 2CGPA 5T6JA 2DA1A 4RB2C 2M87A 4IRGA 2BXYA 1VQNI 4BH9A 3HRSA 1TQIA 3VWBA 3L2QA 2R93J 1LDKB 4A6EA 2PEXA 3V8JA 3ZMUA 4CDGA 3S1MJ 2V85A 3F6GA 2YSPA 2YX4A 1I50J 1TP4A 2EK5A 3GO5A 4B48A 3VYXA 5A6BD 1EH7A 3ADIA 3CCJI 3I58A 4BHCA 2ZXHA 4RMNA 2L54A 1FY7A 1O0WA 4O5GA 1U0JA 1P4WA 2DOEA 2EA2A 2FF4A 1R22A 3MHHC 2R7SA 4IOAF 2ZBKA 3O6BB 2HS5A 4HBLA 4MFEA 4PGGA 4MHGA 4XRSG 2ID6A 4BDZA 3JTZA 1XDSA 3LMLA 2JOBA 4R1HA 1AU7A 1EJ9A 1PKPA 1UHZA 2E60A 3M07A 4CCLA 2EV0A 4II2A 2O9LA 2UXBE 2HDCA 2GOXB 3FK6A 2BZTA 1ZGWA 2KHXA 2ADUA 2IGOA 4HX4A 5A6KA 4B4CA 3PIPF 2Q8UA 2VJ5A 1FSEA 4HSTA 2XV4S 2OUMA 2VBYA 3HYIA 3H3UA 4EJOA 5F04A 3NRVA 5LLQA 2F4MB 2EPCA 1SFKA 4AUXA 4NDLA 4KZSA 3G1LA 2DA6A 1UHWA 3DCFA 3K6GA 1X1DA 3P9CA 4BE2A 2Y48A 1X47A 3SQNA 3TQMA 5J4VA 4ON0A 2I9IA 2HQAA 5HS7A 5FB2A 4LFCE 3TL4X 2LYCA 2XAFA 5D5VB 5GPCA 5ICFA 4DV7E 1P2FA 1HSJA 4IOCF 1MBHA 2CQ7A 2DMYA 4LD5A 4N4OB 1S7OA 1DGRM 3V4GA 3LA7A 4G94A 2W25A 4QPOA 2KONA 2RS7A 4HNVA 2EV5A 2VQEE 4RM3A 3HTSB 5ERIA 2R3SA 1SAUA 2KOUA 2HZTA 5GAHJ 3S1QJ 4DZPA 2L8TA 4LG0A 4KN4X 4DZJA 4LLNA 1R23A 3LSGA 2JTVA 3AAFA 4FHTA 4MLOA 4LFBE 5E3OA 3CCSI 1ORKA 2YSRA 3EUAA 3I54A 2XROA 1ERDA 1B6AA 3WTUC 1Y1WJ 2ELZA 2ISZA 2M7QA 2IS6A 1NG6A 1WWXA 3J7AO 1PVEA 4F6NA 3QU6A 1TF3A 3S2WA 1Z1BA 2DYSH 4KYWA 3E0JB 4BC7A 1Y39A 2R7QA 3T8TA 1WJDA 2EZKA 2PMHA 4E7SA 1LPQA 3CDLA 1JT0A 2LKPA 2WCC3 3F22A 2A25A 3FXJA 3ABTA 1S29A 2V9PA 2YU3A 3HKZA 5FKLA 2GM4A 5DNYA 2EOMA 2EV6A 3C4BA 2WBSA 1MH4A 2P5VA 1PJSA 2K02A 4I99C 3S3NA 1FPQA 2Z2SB 1QU3A 1BI0A 1FWZA 3GCMA 3FDYA 3CJRB 1HR0E 2M8GX 3SZGA 2ICWG 4Y4RA 2QQ9A 4ZDPA 2DFFA 4H4KC 3I56I 1DU6A 1AAYA 3IC7A 3HOUJ 2Y2ZA 1OFCX 3K10A 4LF6E 3M8JA 2V1NA 5L3CA 2FV4B 4JI6E 2O03A 4QWQA 4F9BB 3S15J 5LRRA 2EOSA 5D8KB 2RV8A 2ZXWH 2PJRA 2EN8A 3IL2A 1UBDC 2L4MA 4IF4A 2HPIA 3GFMA 2IRFG 4KHPE 2RQQA 3OV8A 5B1BH 5M3FJ 1T39A 1G59A 3CD6I 1XX5A 2M5WA 4Z6YA 2CV0A 2HGHA 3ZQIA 2EMHA 3FISA 2J7JA 3N05A 2IBDA 3S1RJ 3DV8A 3WTTC 2CS3A 2CPNA 4ZDOA 4D5CA 1X2MA 1I6HJ 4DJAA 2A05A 3BJAA 2VT3A 2WADA 1O7FA 1Z1DA 1ZGAA 1F1ZA 1HC8A 4UHTA 1YLFA 3M99B 4BEHA 5E3MA 5EGOB 2NVTJ 4E7ZA 3CC4I 2HQNA 1QU6A 4LF8E 3DEUA 2IHR1 2OU2A 4UUVA 2ISYA 2OTJI 2QSHX 4IZZA 1IRZA 1G2DC 3FX3A 3L9FA 1E3OC 4D7MA 3A4CA 4A3MJ 2O61A 2EM4A 1IBME 4IQ4A 2LBSB 2OQRA 1AKHA 3KP2A 5DD4A 3TP3A 4RAYA 3QQAA 4JQFA 3HUGB 1IZ1A 3K0LA 1GTKA 4A5NA 2EOEA 1ETOA 1GQEA 2BW3B 2LJUA 2YSOA 4IL6C 1UHSA 4RB1A 3CF2A 2V86A 2FA5A 3J80K 2KDZA 1YTYA 3DF8A 3HHHA 5LL6R 2OTLI 2PRTA 1VNDA 2CU7A 3O8GA 5E1XA 2XAGA 2GBYA 2QYOA 2JY9A 4R2AA 3F8NA 2HVQA 2BEOA 2MC5A 1LDJA 2L7ZA 2KMUA 2RGVA 5DCMA 1MBEA 5A2QC 2EE8A 1T4LB 2LVSA 2QGUA 4O43A 2Y31A 3O3KA 4Y7NJ 5DS9A 4IVNA 1GVJA 1I6XA 3BTIA 2NOGA 4QTRA 5JVGF 1Z9CA 1VQ6I 2F2EA 4E7LA 5DCFA 2RSIA 3FF5A 4HRIA 4HQMA 3ZN1A 2ENAA 1QA6A 2GXBA 1I1SA 4UV9A 3KWRA 1G3SA 3ERED 1OR7C 4RB0A 4UVBA 3DEWA 3H1CA 2FUG2 5HODA 1IRXA 3ULQB 3IH4A 3I64A 3PFYA 2W48A 4PSWA 1IN6A 5EZHA 4CO8A 1YJNI 5EDNA 4R8HA 3GZNB 2D5VA 3VODA 3OTOE 2O3FA 4HF2A 1XDUA 1X5WA 1CGPA 4I0BA 1YW7A 3M7GA 5GAEJ 3OSGA 1N3GA 2X51A 2EMZA 2EOJA 5AC4A 2DK8A 1IN4A 2N8GA 4XOPA 4DGWB 1K79A 1ITYA 1JK2A 3LSHA 3ECOA 1PUEE 1ZREA 1POGA 5C4XJ 4AC0A 2JJ7A 4NB5A 1F4KA 3WE3A 1XMQE 2RSMA 4A3GJ 5HOOA 4J8ZA 2LV2A 1K78B 4NXNE 2FOKA 2TCTA 2DDBA 3MZYA 2XF7A 5JHFA 4UXNA 1T2KA 2EOQA 3C2GA 2WAEA 3C1DA 2LY1A 1MH3A 2IGMA 1ETVA 2E1OA 2HXIA 3MFKA 4A12A 3H09A 1PDAA 4BJ6C 3OYHA 1HKTA 1WQ2A 3RPUD 4B44A 1ZRCA 4B47A 4JOMA 1JGGA 1D1AA 2LLKA 2VJIA 3KZIC 3NEUA 2KZVA 2WA0A 3E6MA 4L5IA 4B1RA 1JKQC 3P1XA 1YSAC 4XNFA 2XUBA 4BXUA 4OMYA 2VONA 2IP2A 5ILVA 2XSDC 3EUHA 1YYWA 3BG9A 2ID3A 1E2XA 2V1XA 3WHBA 2V89A 2P8TA 3R6SA 3HOSA 1VQMI 2A3SA 1FOKA 1A35A 1FNNA 3S2HJ 4DV4E 4X9JA 3JREA 3LSPA 2M1BA 4CYCB 3HBLA 2DDAA 5HS8A 1MMGA 3LQRA 2JT1A 1V55H 5EG0B 5FFXA 3GMEA 4DW6A 2A5WA 5JVTA 2IVMA 3BOQA 4ETSA 1SFOJ 1R6RA 1T95A 2JPBA 1H9GA 2BY1A 4HAMA 1O4XA 5E8GA 4H0EA 1TN9A 2B0LA 3ZPLA 1CF7A 4G7OF 1PJRA 2EQ1A 3GUDA 4NXME 2EMAA 2RKHA 3R4KA 3AL0B 2ZJPF 2O5RA 1YG2A 3FM5A 2MGQA 4WYQB 1QBJA 4S0HB 2BGCA 2KL4A 3KZZA 2L3DA 3JSPA 1ZR2A 1A1LA 1NK2P 2XGDA 2EPFA 4ASNA 2O0YA 3GTJJ 1LVKA 2E35A 2UZKA 3HTUA 2IGKA 2X9DA 3I9V2 1X6EA 3HGGA 2KZGA 2DODA 1BJZA 2EMYA 2EWNA 3OS2A 4UB8C 1BOAA 1WJPA 2E19A 3VYUB 1K4SA 5E3NA 5K7HA 4ZYGA 1RUOA 1G4DA 1LNWA 4GKKE 5DM6F 2VRDA 1J26A 2EBIA 4D0PA 1USTA 2HOEA 4KMUX 1IJWC 3GXOA 3FZVA 3NAUA 1ZHFA 4PFPA 3WG7H 2JPCA 4RAGA 1S72I 3SDBA 1JUPA 3MKYB 4RBOA 3WU2C 2FSWA 2OCCH 1ONVA 1KYZA 4RLFA 3ESWB 3K4BA 2YTOA 3JCUC 5HDKA 3P9IA 4YG2F 4E6KG 1PYVA 3F0CA 1O3SA 4IKFA 2ME0A 4M6XA 2K9SA 5CVUA 2LH9A 2EL6A 2LTSA 3BG5A 2EPPA 2EPOA 1ETYA 2VUMJ 3KLNA 3DWLE 3SJMA 1Z67A 2LSOA 1Z6TA 4YRVA 2EN7A 3I3LA 5HS9A 3HC7A 5F27A 3A0BC 2EM3A 3J81Z 4F9AB 1O3RA 2N3HA 4P5OA 2M8EA 1UJ8A 4YY3E 4RS8A 5TISC 3HRTA 1OJLA 5FRNA 3QYBA 1VTNC 3HTXA 5J1UA 4HLXA 3E97A 4HX8A 1GV2A 4U87A 2P6SA 2K9MA 2Q0OA 1JTYA 2HR3A 3CZ6A 4I02A 3KIOA 1PUFB 4OX9E 4I8OA 1B9MA 1SFEA 3DBRB 2JYAA 2V83A 3DKWA 3HOZJ 1N75A 1BM9A 1F9NA 3CDIA 3JW4A 2YU5A 1QNTA 4MEYF 2D9HA 3BIDA 2MW8A 3E6CC 1TT5B 5LGUA 1S8NA 3CUQB 2LR8A 4P96A 3M3YJ 4GO1A 4HV6A 3WU0A 1IXCA 3FBIB 5JFRA 2A68F 3OSFA 4BGDA 4ZH4F 1P7IA 2PLYA 4IHVA 1Y8RB 2HYGD 2X6XA 5IT9Z 2R7VA 2EA4A 2FMLA 1LQ1A 1X4OA 3ZQCA 4B8XA 2DGCA 1I3AA 1VQLI 3EUKL 1LJ9A 1Y0UA 3FXMA 5DTDA 3G4SI 2RNJA 4OIRF 2EZIA 2HQRA 2R5ZB 2EPNA 2STTA 1OCPA 2M4GA 2XAHA 2VIXA 4X6AJ 1XSVA 2B7VA 2XC7A 3VYRB 4MLQA 3HPHA 1ETXA 5J1YA 3V7SA 1FMVA 2FRHA 3BZ6A 2F4VE 4JV5E 2ZM6E 3AUZA 1CQTA 5HDGA 5B5EC 1YQAA 2VPLA 1NHAA 1SD6A 2HI3A 3VYSB 1MZBA 2FU4A 2E36A 1LEAA 4BL0B 2EOXA 2EWLA 3B73A 4NQWB 2JMWA 3BZCA 5AIPA 5CVRA 1JXSA 1E0EA 4DMIA 1HW1A 1P4XA 1FIPA 2EM0A 4DV6E 5ICCA 1U3EM 1ACIA 4EMSA 4LLGF 3U21A 2EP3A 4R2QA 4DNCA 2EFQA 4WCGA 3VDXA 3MVPA 3I4NJ 4R2EA 4N0BA 4RGUA 5CPRB 1MMSA 4WWCA 2EM9A 3CUOA 2AO9A 3ABMH 5A6AA 4ENKA 3AL0C 4K2EA 3DFGA 2VI6A 3CCYA 4OWRB 5J47A 4E7KA 2O6GE 1SMTA 1MMNA 1YE9A 2Y75A 3CC7I 4XM3A 2QQBA 4UUSA 2F5VA 1I94E 1HKQA 3IP4B 3EDPA 1Y6IA 5FRMA 3LAJA 1MNDA 2YR2A 4EJVA 4I2OA 4L9VA 2EJ4A 1G3WA 4XLAA 4G6TB 2E2HJ 2OQGA 2OC6A 2XIGA
chains in the Genus database with same CATH topology
2FXAA 4XRFA 3T5XA 3GFLA 4KN7X 3IHUA 4A0ZA 3BY6A 5FLXK 2JSCA 4U7BA 3WE2A 2BBYA 2EFNA 5LEKA 3R0JA 4L9JA 1ZG1A 2CFXA 1YO5C 2Q2EA 4L9TA 2NAZA 4LG0B 3TOBA 3D0SA 1IN7A 2G7HA 2D1HA 4AD9A 3ZMSA 4F7ZA 2RC4A 4HF1A 3KLOA 2VOPA 1TNSA 4E70A 4OU0A 2DT5A 4I09A 4EM2A 4OINF 4XLNF 4WX9A 1J7KA 2W84A 3IKVA 3RPQA 3F6OA 2WV0A 1BI3A 5D4RA 3WGIA 3M8EA 2GZWA 1C0WA 3F8MA 1KYWA 3PQKA 3CUQC 1LB2A 3W6JB 3FHZA 3TGNA 4R79A 5BOXA 4LGWA 5K5RA 5L3FA 4DQ2A 3R0AA 1G6NA 4TV7A 1HQCA 3BDDA 1FZPB 1P6RA 2AXLA 1GXPA 2RQPA 3GWZA 1YS7A 2D45A 4MEXF 2Q8KA 3K1PA 1O57A 4ZZLA 4CHUA 1T38A 2QENA 3GZ6A 4IJAA 4ESBA 1J75A 3B02A 4G6QA 5IT3A 1ZAOA 5FD6A 2F5FA 3K69A 4RAZA 1FBQA 3D5LA 1B4AA 2G9WA 3QPHA 3I59A 2GQQA 1STZA 3JAMK 2HKXA 4GYIA 3TO6A 2L01A 3FMRA 5E1ZB 1XCBA 1U78A 5CLSA 2FNAA 3GX4X 5DCMB 1XSDA 3KP7A 4MTDA 4LK0F 3WTXC 2MC3A 2QM3A 2RVCA 4MTEA 3T8RA 3QP5A 2H94A 2J5OA 4PGHA 1EV7A 5A2QZ 2V6CA 2DQLA 4KIBA 2E7XA 2K27A 2P7CB 2CQKA 1XGSA 2AS5F 1GXQA 2Z99A 1K7AA 4P9UA 1ZN2A 2DLLA 1LDDA 2GIVA 1BI1A 5CYVA 4M74A 2ZMEB 4UVAA 4GXOA 4N9HA 5F64A 2QBYB 3TKYA 1HW2A 3MAJA 4EQQA 4I98B 1W5TA 2MLKA 1X3UA 3E3VA 1FLIA 3F8FA 1U5TC 1YIOA 4O5VA 5HDNA 4KT5C 2O8XA 5ILUA 3T0YA 3F23A 2R7DA 3U2RA 1OYYA 3ROUA 3BROA 2OA4A 1MJBA 1V4RA 1SFUA 4UV8A 2PFBA 2W85A 4ESFA 2DBBA 2DQRA 2H27A 5LHHA 4O6JA 1LVAA 3QAHA 1R36A 4U0WA 1RI7A 1QO0D 2G7UA 4G7HF 3QU3A 5FGMA 2TDXA 2ESHA 2LF7A 1U8RA 1FYMA 5DDGA 2HWVA 2Z3YA 5ICGA 1DDNA 2OZUA 5HLIA 4UNOA 5DUIA 4BNCA 3RKWA 2F5DA 4XSZF 2XRNA 4I7HA 3KP3A 2M30A 2HEOA 2FE3A 3V8LA 3HHGA 3Q9SA 3DPLC 5JR3A 1F5TA 1FP1D 2JZYA 3FM3A 1IAWA 3H92A 1XSXA 3KEQA 4L5JA 3WU1B 2FMYA 3FMSA 4AIJA 4AVPA 5HVQC 2ZO4A 5LRSA 2P4WA 5K1YA 2NNNA 4CGZA 2ELHA 1HSTA 3J81K 1TBXA 2GXGA 4EM0B 2VN2A 3LFKA 2H6CA 4EV0A 4RB3C 3FMQA 3FXRA 3GW2A 3KFWX 3EQLF 2PMUA 2F5EA 1Z6RA 3CO7C 2DPUA 2IT0A 1FBSA 2EB7A 1A04A 3F6VA 2DTRA 1RIOH 3O2PE 2PQ8A 2ESNA 1MD0A 1QQIA 2A69F 3ZMZA 2DW4A 2XHKA 2K4JA 4NHJA 3DP7A 4FT8A 3G73A 4M73A 2IJLA 5ILSA 2XKPA 4I01A 3MQ0A 5E1WA 3F8CA 5D5WB 3KP4A 2XAJA 1BJAA 4S05A 1O3TA 3R61A 1JHFA 1IN5A 2D1VA 6PAXA 2VC1A 4KFCA 3L09A 3SZPA 3RIRA 4KA4A 1XMKA 2FBHA 2RN7A 4WXDA 4Q5SF 5BPIA 1ZLKA 1Z7UA 2STWA 4AWXB 4LLLA 1HXDA 2A6EF 2GA1A 2ZXJA 1J59A 4QLCU 2V79A 3HRMA 1R58A 3LWFA 2KIFA 1WKMA 1KQ0A 1SD5A 3G3ZA 4YIFA 3GEZA 2J5PA 2VBWA 1SMYF 5D4SA 2KJBA 5D6FA 3GFJA 2QZ8A 3ZP5A 4XBFA 2YPRA 1BC7C 4ZYDA 3KE2A 1XD7A 4BHBA 4P55A 4O3MA 1JE8A 1MGTA 1FSHA 4BYYA 2PJPA 2CYYA 3LA3A 4A6DA 2LDUA 1ZRFA 2LNBA 4WF2A 3PFIA 2UWMA 3J80Z 3BP8A 2RDPA 1ZARA 4FX4A 1J2XA 2QQAA 1IN8A 4MQVA 1QPMA 2QWWA 4L18B 5CJ9A 2F5CA 4KMFA 4MQ9F 4HW0A 3TDZC 3I59B 3RKYA 1QGPA 4PDKA 2KIUA 4BAYA 3GFIA 5K5QA 1SFXA 4WXHA 1EH6A 3H3ZA 4LK1F 1KQ8A 3KP5A 1ZYRF 5DV5A 1FBUA 3NQOA 1HW5A 4B09A 5CVJA 3T1BA 2PBIA 1Q1HA 3KETA 3JTGA 3EETA 5BPDA 1FYLA 1XB4A 4HV5A 3ZMVA 1P4AA 1OPCA 4U7DA 4P9FA 2KKOA 3GZ5A 1W4MA 4GYGA 1TLHB 1D8JA 2C6YA 2VODA 4HX7A 5ED4A 1IUYA 1OKRA 4U0VA 2BYVE 5J8FA 4G6DA 2KRFA 1EH8A 1BBYA 3VOEA 1E17A 3WTVC 3IWFA 1R1UA 2DI3A 4LFUA 3WTSC 3VEPA 1MJAA 3EYYA 3SFZA 2H09A 3U1DA 1ON2A 3V7CA 2QUFA 2IA1A 4Q4ZF 3K9TA 1ZRDA 2QLZA 3L7WA 4MGRA 3ZMTA 1ON1A 1IRFA 5H6RA 5F6FA 2XGXA 1H0MA 1B59A 3F3XA 2CO5A 2EFPA 1TTYA 2V9VA 4UVCA 1I27A 2PG4A 4M72A 4YFXF 1AOYA 2H6BA 2HGCA 1OYIA 2NS0A 4KICA 5LHGA 2ZNZA 2CW0F 4EM1A 1D3YA 3BJ6A 4WK8F 3SZTA 4Y17A 1QZYA 3JTHA 5H20A 1R5HA 5BMZA 3COAC 3MCZA 1UB9A 1FT9A 4LB5A 2HFHA 4HDUA 2DAOA 1IXRC 1RNLA 4G7ZF 3WGHA 1L0OC 1YW9A 4LMYA 4L0YB 4U88A 3I4PA 3CUQA 3BPVA 4RGRA 3SHFA 3BJOA 1J5YA 1Z91A 1G3TA 2VOOA 4IRHA 3HIFA 3GYHX 5L3BA 5DEQA 1OMIA 2OZ6A 5KVRA 3REOA 4IHSA 4KIGA 4LJZF 2P5LC 2MLGA 3KP6A 4M6YA 1SAXA 4RGSA 1S6LA 2UXNA 1XCVA 4A2UA 2W24A 5TRDA 3RJPA 2IW5A 4L9NA 1YS6A 4NQWA 3JSOA 3L2CA 5AIQA 4EGZA 3KCCA 3QP6A 4ZYHA 1U2WA 1KQ9A 4HLYA 2VC0A 5ICEA 5FFZA 2MBFA 4ZYEA 5L3EA 5H6QA 2BV6A 1DP7P 2PI0A 1GHCA 1MDMA 5FLXZ 3TO9A 4EVIA 2HYFA 2L02A 2EFWA 3U9GA 2D2WA 1R00A 1DUXC 4IHTA 4YFNF 3M1EA 3PQJA 4LB6B 1TW3A 3CJNA 3F72A 1DPUA 4IRIA 3IKTA 4KDPA 3K2ZA 4A5MA 3GLXA 5JHUA 3ZMDA 2PN6A 5LEJA 1BIBA 1KU7A 4RGXA 4BQAA 1KU9A 1W7PA 5LGNA 2YX7A 1TW2A 2ZNYA 1JGSA 5DD8A 4OMZA 5L3GA 2VBZA 1TNTA 3FWEA 2FBKA 1CF7B 3DQVC 2VE8A 5DUKA 1WI9A 5E17F 1O3QA 1LEBA 1KA8A 4HYEA 2VE9A 1OYWA 2Y0MA 2ZFWA 1FYKA 1U5TA 3LA2A 4CYDA 4G9YA 1BI2A 2GAUA 3IWZA 3TOAA 3ISPA 5FO5A 2Z33A 4EJWA 3WODF 2NNYA 2X4HA 3E5UA 4CICA 2E1CA 1S3JA 4HZFA 2JRTA 3WTWC 1PP8F 1UCRA 2P6TA 2EJRA 5FD5A 1QZZA 3RKXA 3WTZA 1FX7A 1MJ9A 2K86A 4OIQF 3LSTA 3HOTA 4XSXF 3E6BA 4ESJA 1KU3A 5LBQA 2R7FA 2XVCA 3ZN0A 3RTRA 1SD4A 4CXFA 5D5UB 3JAMZ 2XAQA 1R7JA 3ML6A 3DXJF 5K5OA 1HKSA 1D8KA 4AIHA 1JHHA 2V1DA 3HSFA 1XGOA 3QRFF 3Q9VA 2E7WA 4YFKF 4JBAA 5IT9K 2E1NA 2ZJ2A 4S04A 2V1UA 4ENMA 1R1VA 2KJCA 1SD7A 2ETHA 4M9XA 4OOIA 5F1RA 1IRGA 1W5SA 1K6OA 1I5ZA 3SXYA 5KK1A 2M45A 4PCQA 4MNUA 1B1BA 2WWYA 4IXAA 2DK5A 1I1GA 2ZMEA 4KIFA 4HF0A 2MH2A 1OR7A 5LGTA 4YIIA 1FP2A 4M9ZA 5E8IA 2QBYA 3MEXA 3CLOA 5JI6A 3TO7A 2CG4A 3E6DA 1BC8C 5E20A 3TQNA 2VBXA 1UHMA 2FBIA 4Y15A 4EJUA 3IRQA 2HKOA 1D5VA 3GF2A 3DPTA 2X0LA 2A5YB 5HLGA 2Z9OA 1YW8A 5EEHA 3LQQA 3E5XA 2K7LA 4XLPF 4A0YA 5DYMA 4HQEA 2FQ3A 2ZCWA 1B9NA 1IW7F 3ZQ7A 3QOPA 5CVIA 1R1TA 4FX0A 2W57A 1U6GA 1XMAA 2XASA 2P5KA 3FXUA 1XGMA 3V7RA 5HLHA 3WG9A 2DFIA 5D6EA 2IPQX 3RYRA 2A07F 1J0RA 4HDVA 4GCVA 4Z2YA 4M71A 3W6KB 3I0TA 4N9IA 3E5QA 1PDNC 2MH9A 4CZZA 1ZGJA 1ZG3A 3LAPA 3K1MA 3L00A 3MZHA 1DPRA 3I53A 3HUGA 2XKOA 4KUMA 3C18A 1RUNA 2FEZA 2DU9A 3N4MA 2P7VB 3P7NA 4OIPF 3R60A 2FNPA 2IA0A 1XN7A 1WRJA 5D8LB 1L3LA 1RZ4A 3F21A 2ACJA 2IA2A 2CWEA 4A0XA 1ULYA 2ZKZA 3I5UA 3K1NA 4AIKA 4WXCA 2KIMA 2OBPA 2OD5A 2HTJA 1W7PD 5BS6A 4HOBA 1IXSB 3RYPA 4U0YA 1YYVA 1BIAA 2L4AA 3VB2A 4HA8A 2UXXA 1J9IA 5CVVA 3CO6C 2NRAC 1Z05A 1H9TA 2GWRA 4ZZDA 4M9SA 3ABUA 1KGSA 1K78A 2BE5F 1ODDA 4G8XA 5E18F 3BWGA 1V3FA 4BHPA 1REPC 5BQTA 4ENJA 5A2QK 2OAZA 3EYIA 1AWCA 2DO7A 1S7AA 5TJJA 1ZLJA 3Q5FA 1O7LA 4IPAA 4GGGA 2QVOA 3ELKA 3GVAA 5AONA 3MWMA 4Q48A 4I0AA 2MD5A 5LHIA 1MDMB 1YFHA 3IRRA 3ECHA 3P9KA 3KEOA 3CDHA 3WGGA 5J6XA 1T6SA 1P92A 1KU2A 1FC3A 3C3WA 1ZH5A 2WC2A 2NYXA 3HSRA 1TQMA 3M9AA 5D5XB 3M8FA 2A6HF 1TQPA 2A61A 5L3DA 2MA3A 2DPDA 2VT2A 1W7PB 5EEGA 3C7JA 1T0FA 4PZJA 2COMA 2GA2A 4Q47A 3N97A 2EFOA 2VXZA 3F8BA 1UFMA 3WTYC 2Z5UA 5J8CA 1HBXG 3HRUA 3OOPA 4KNYA 1U5TB 4L0ZB 1G3YA 1XGNA 3CTAA 3RPUA 2HTSA 1ZG5A 1WSUA 3QPTA 2LF8A 1USSA 4EJTA 3BPXA 1PP7U 2K4BA 3TDUC 3HSEA 4OIOF 2WTEA 3KZYA 1IF1A 1T98A 4JK1X 2CSOA 1BN5A 3VFZA 4Y13A 3FXQA 3I71A 1R5GA 3RDIA 1MKMA 3V8KA 3RI4A 4ENNA 2CGPA 4RB2C 2M87A 4IRGA 4BH9A 3HRSA 1TQIA 1LDKB 4A6EA 2PEXA 3V8JA 3ZMUA 4CDGA 2XIGA 2YX4A 2EK5A 3GO5A 1EH7A 3I58A 4BHCA 2L54A 1FY7A 1P4WA 2EA2A 2FF4A 1R22A 2ZBKA 3O6BB 2HS5A 4HBLA 4PGGA 4MHGA 1XDSA 4R1HA 2EV0A 2HDCA 2ADUA 4HX4A 1FSEA 2XV4S 2VBYA 3HYIA 3H3UA 4EJOA 5LLQA 3NRVA 1UHWA 3P9CA 2Y48A 3SQNA 4ON0A 5HS7A 5FB2A 5D5VB 2XAFA 5ICFA 1P2FA 1HSJA 4LD5A 1S7OA 3V4GA 3LA7A 4G94A 2W25A 2EV5A 3HTSB 5ERIA 2R3SA 2HZTA 4LG0A 4KN4X 4LLNA 1R23A 2JTVA 3AAFA 4FHTA 2YSRA 3I54A 2XROA 1B6AA 3WTUC 2ISZA 1WWXA 3J7AO 3QU6A 3S2WA 4KYWA 3T8TA 2PMHA 2LKPA 3F22A 3ABTA 1S29A 2YU3A 2EV6A 2P5VA 2K02A 1FPQA 1BI0A 1FWZA 2QQ9A 3IC7A 5L3CA 2O03A 4QWQA 5LRRA 5D8KB 2RV8A 3IL2A 2L4MA 4IF4A 3GFMA 2IRFG 3OV8A 1T39A 2M5WA 3DV8A 3WTTC 3BJAA 2VT3A 1O7FA 1Z1DA 1ZGAA 1F1ZA 4UHTA 1YLFA 2HQNA 3DEUA 2OU2A 4UUVA 2ISYA 3FX3A 3L9FA 2O61A 2OQRA 3KP2A 5DD4A 4RAYA 4JQFA 1IZ1A 3K0LA 4A5NA 4RB1A 2FA5A 3J80K 1YTYA 3DF8A 3HHHA 5E1XA 2XAGA 2QYOA 3F8NA 2BEOA 1LDJA 2RGVA 5DCMA 3O3KA 4IVNA 1GVJA 1I6XA 1Z9CA 2F2EA 5DCFA 3FF5A 4HQMA 3ZN1A 2GXBA 1I1SA 4UV9A 1G3SA 3ERED 4UVBA 4RB0A 3ULQB 3I64A 1IN6A 4CO8A 4R8HA 3VODA 2O3FA 4HF2A 1XDUA 1CGPA 4I0BA 1YW7A 3M7GA 2DK8A 1IN4A 1K79A 3ECOA 1PUEE 1ZREA 4NB5A 1F4KA 3WE3A 5HOOA 1K78B 2FOKA 3MZYA 4UXNA 1T2KA 3C1DA 3MFKA 4A12A 1HKTA 1WQ2A 1ZRCA 3NEUA 3E6MA 4L5IA 2XUBA 4BXUA 4OMYA 2VONA 2IP2A 5ILVA 3EUHA 1E2XA 2V1XA 2P8TA 3R6SA 3HOSA 2A3SA 1FOKA 1FNNA 2M1BA 5HS8A 3LQRA 2JT1A 5FFXA 5JVTA 2IVMA 3BOQA 4ETSA 2JPBA 1H9GA 4HAMA 5E8GA 4H0EA 2B0LA 3ZPLA 1CF7A 4G7OF 3GUDA 2RKHA 3R4KA 1YG2A 3FM5A 1QBJA 3JSPA 2BGCA 3KZZA 2L3DA 4ASNA 2O0YA 2UZKA 3HTUA 2EWNA 1BOAA 4ZYGA 1RUOA 1G4DA 1LNWA 4D0PA 1USTA 2HOEA 4KMUX 3GXOA 3FZVA 1ZHFA 2JPCA 2FSWA 1ONVA 1KYZA 5HDKA 3P9IA 4YG2F 1O3SA 4M6XA 5CVUA 3KLNA 2LSOA 1Z6TA 5HS9A 3J81Z 1O3RA 4P5OA 2M8EA 4RS8A 3HRTA 1VTNC 4HLXA 3E97A 4HX8A 2P6SA 2Q0OA 2HR3A 4I02A 1B9MA 1SFEA 3DKWA 1BM9A 1F9NA 3JW4A 1QNTA 4MEYF 3E6CC 5LGUA 1S8NA 3CUQB 4P96A 4GO1A 4HV6A 3WU0A 1IXCA 5JFRA 2A68F 4ZH4F 2PLYA 2HYGD 5IT9Z 2EA4A 2FMLA 1LQ1A 4B8XA 1LJ9A 1Y0UA 2RNJA 4OIRF 2HQRA 2STTA 2XAHA 1XSVA 3V7SA 2FRHA 3BZ6A 5HDGA 1YQAA 1NHAA 1SD6A 1MZBA 2FU4A 1LEAA 3B73A