3L00A

Crystal structure of benzylated snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
156
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SNAP-tag structure
rcsb
molecule keywords SNAP-tag
molecule tags Transferase
source organism Homo sapiens
total genus 47
structure length 156
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l00A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3l00A01
2X4HA 4CXFA 2ZO4A 3HRMA 1K6OA 1UCRA 1TTYA 3KP2A 4WK8F 1ZREA 3TKYA 3K1MA 2F5CA 1DDNA 2ZNZA 3U2RA 4ON0A 2PEXA 5BS6A 1OKRA 2OZ6A 1MDMB 2QBYA 4OOIA 1F9NA 4U0WA 3WTZA 2XAGA 2E1CA 4ENJA 1EV7A 2W84A 3GYHX 3TO9A 4HDVA 5E1WA 4L18B 1OMIA 1BJAA 1MD0A 2BBYA 4KN4X 2O0YA 4UXNA 1XMKA 2NRAC 3F6VA 1FY7A 5E18F 2KIFA 4RB1A 2M45A 3V7RA 4L9TA 2KJBA 5J8FA 2UWMA 3M9AA 3JSPA 5BPDA 4YIFA 4IJAA 2GZWA 5E20A 2QBYB 5HS9A 3S2WA 4KMFA 2L4MA 5ICGA 4G7HF 4WXDA 1SD4A 4Q4ZF 1HKQA 3T8RA 3F8BA 4GYGA 2HDCA 4OMYA 2ZCWA 4XRFA 4KYWA 2D1HA 3Q9SA 1G3WA 1OR7A 3WTWC 1FBQA 1MGTA 3TGNA 1LEBA 2OD5A 2PQ8A 4UUVA 2FBIA 2P8TA 2QQ9A 3O6BB 4GYIA 3LA2A 4EM2A 5HOOA 2KKOA 4Q47A 1IUYA 3DP7A 1R5HA 2EWNA 4LLLA 2FBHA 4KFCA 1B4AA 3D5LA 4UNOA 4UVAA 1ON1A 1XSVA 4N9IA 2K27A 2Y48A 1RI7A 5LRSA 2WWYA 4LB5A 1WSUA 2DBBA 2OBPA 4WXCA 4QLCU 5JR3A 2HQNA 4LMYA 2XIGA 1TW2A 2A61A 2Y0MA 2XAFA 4M6XA 4OU0A 2QLZA 4I02A 3H3UA 1OYYA 2ISYA 2PLYA 5FB2A 2VOPA 1S3JA 2LKPA 3F23A 1R5GA 4IRIA 1GXPA 3O2PE 3ZMVA 3HRTA 2P7CB 3HUGA 2V1DA 1MJBA 1B1BA 3BDDA 1FWZA 3CUQA 1BIBA 3I53A 2VE9A 2H94A 2DT5A 5ICEA 1B9MA 3QAHA 2PI0A 4MNUA 1P2FA 4ESBA 3C1DA 4A0YA 1S6LA 2RVCA 3MZYA 1UHWA 3E6MA 5IT9K 1YS7A 1H9GA 2STTA 3C3WA 3GZ5A 1Z6RA 1RUNA 2IRFG 2HWVA 1R22A 3RTRA 3BOQA 2A3SA 2FBKA 4HV6A 2LNBA 2L54A 3GFIA 1EH7A 1J0RA 1X3UA 3ECHA 2PFBA 1K7AA 3IHUA 1Z1DA 1H9TA 2P6SA 3SZTA 4WX9A 3FMSA 1G3TA 4HQEA 4YG2F 5JFRA 1WWXA 3BWGA 2VBXA 3WGGA 2L01A 2XAJA 4L9NA 1BBYA 1W5TA 2ZJ2A 1PUEE 4BAYA 1J7KA 1MJ9A 1ZYRF 3HHGA 1WKMA 1FSEA 1D8JA 1JGSA 3U9GA 3V8KA 2CQKA 2ZBKA 3CJNA 1D3YA 1KU3A 3TDZC 3VEPA 2XGXA 3WTVC 1O57A 1DPUA 3ZPLA 4OIRF 1HSTA 3NQOA 2JT1A 5A2QZ 1FP2A 2CYYA 2FMYA 2C6YA 3IL2A 3R61A 4JQFA 2FXAA 1ZGJA 3KCCA 5IT9Z 5D5VB 3DFGA 3CTAA 1YTYA 3E3VA 2BV6A 4PZJA 4EJVA 3N97A 1O3TA 1G3YA 1ZN2A 3RYPA 4OINF 3IKTA 3JAMK 4DNCA 4G6QA 1FX7A 4MEYF 3SQNA 4BH9A 3JSOA 1RZ4A 1FLIA 1LVAA 1XSXA 3J7AO 5D4RA 1KA8A 3V4GA 2OQGA 5H6RA 1LDDA 2DPDA 3CO7C 4S04A 2XRNA 3P7NA 3E6CC 1HW5A 2Q2EA 4OMZA 4BHPA 5FLXZ 2D45A 1QPMA 4L9VA 1XMAA 2HGCA 4EMSA 2LDUA 1QZZA 3L7WA 3K1NA 1C0WA 5LEKA 5AONA 4G9YA 2Q8KA 1MZBA 3B02A 3I59B 1P4AA 1Z6TA 2XKPA 4LG0B 4M73A 1BC7C 2CSOA 2XHKA 4IRGA 2GXGA 4U7DA 2EV5A 1V3FA 3FMRA 3PQKA 3F8CA 2UZKA 1OYIA 3BPVA 4M74A 1ONVA 1REPC 2G7HA 2DLLA 1T38A 3LAPA 2YSRA 4E70A 1OYWA 2HYFA 2K86A 3KP5A 2Z9OA 1U8RA 1LQ1A 4LLGF 2H6CA 1F4KA 1SMTA 3BP8A 2NNNA 2HQRA 2M87A 3GFMA 2E1NA 2DFIA 3H92A 3IRRA 2GIVA 4I0AA 4KUMA 3SXYA 2XV4S 4LJZF 4CHUA 1E2XA 1O3RA 4MQVA 2CFXA 5F64A 2IT0A 3DEUA 1QGPA 2ADUA 1IZ1A 3LA7A 1IRGA 3BJOA 3FMQA 1ZRCA 4ASNA 4EJUA 1IN7A 3RPQA 5IT3A 4IHSA 3WODF 4Y13A 1SFUA 2A6EF 1FPQA 1JHFA 2FNAA 2P7VB 2ETHA 5F1RA 3ZQ7A 3TOAA 1YIOA 3GFJA 4HOBA 4HYEA 2OZUA 3RIRA 4GCVA 2M5WA 3FXQA 1B6AA 1H0MA 4I09A 2HFHA 3QP6A 1T39A 3E5XA 2ZMEA 2OU2A 3HIFA 5DD8A 4LK1F 1O3SA 4H0EA 4I2OA 2YX4A 3HYIA 3MCZA 1ZAOA 3FX3A 3F21A 5D8LB 2XASA 2D1VA 1KU7A 1QO0D 2OAZA 3CUOA 4M9SA 3WU0A 2VC0A 2NS0A 3RYRA 4ZYDA 3FWEA 4ZH4F 1XCBA 2HKXA 2ZNYA 3NRVA 1FBSA 3H3ZA 3KLNA 2V9VA 3WGIA 2BYVE 1R7JA 3KETA 1WRJA 2UXXA 2RC4A 3F8FA 2RGVA 4HBLA 2RNJA 3F3XA 1YW9A 3MFKA 3Q5FA 1I5ZA 4B8XA 2HOEA 2MLGA 1S8NA 2X0LA 4RAZA 2MH9A 4EJWA 3DPTA 4RGRA 4P9UA 3GVAA 4MEXF 3K1PA 4KA4A 4I7HA 2DTRA 5FFXA 2IA1A 4CGZA 1HW1A 3HRUA 4BNCA 2PN6A 5L3BA 4P55A 2QYOA 4EVIA 3K9TA 5FFZA 3ROUA 1W5SA 2FRHA 2H09A 1XDSA 4HX7A 1T6SA 2CG4A 4O6JA 2XAQA 2A68F 4AIJA 2L02A 3CLOA 4ZZDA 2LF7A 5D8KB 1U3EM 4GXOA 4YIIA 3TQNA 3T8TA 4P96A 1NHAA 2HKOA 2RDPA 1G4DA 3RPUA 3IWZA 1LEAA 1IF1A 1FZPB 4Q5SF 4IRHA 3R0JA 1ZG1A 2BGCA 1TQPA 2F5FA 1AOYA 3C7JA 1IRFA 3E5UA 5FGMA 2ZFWA 1RUOA 2Z3YA 2FA5A 3K2ZA 3WE3A 4D0PA 5LRRA 2DK8A 5CVJA 4N0BA 1W7PA 4JBAA 1G6NA 1KU9A 4A6DA 2PMHA 3DKWA 2K4JA 1KGSA 3JTHA 4EGZA 2RKHA 1B9NA 1SFXA 1BC8C 3QOPA 3G73A 1BI3A 3NEUA 2GA2A 2LF8A 4A0ZA 2VOOA 4AWXB 3HOSA 5BMZA 1ZRFA 3MWMA 4TV7A 1LDKB 2W24A 4FX0A 2O03A 3WTXC 3FXUA 1DUXC 4L0ZB 4JK1X 1W7PB 5ICFA 1TLHB 3T1BA 2JPCA 4G7ZF 3C18A 2IPQX 3M7GA 5L3FA 2G7UA 3RI4A 4KMUX 2L3DA 4RGXA 5A2QK 2FE3A 2R7DA 2QQAA 4R79A 3SFZA 3Q9VA 2M30A 4QWQA 3W6JB 2XAHA 3RJPA 5HLGA 5JI6A 3HRSA 1Z9CA 4BXUA 3L00A 3CUQB 2O6GE 2HZTA 2EV6A 2ZKZA 3MZHA 2Z5UA 5EEHA 5CLSA 4MQ9F 2KRFA 3E5QA 3R0AA 4YFKF 4HV5A 5HS7A 2A07F 2QQBA 3T5XA 4YFNF 1IW7F 4OIOF 3FM3A 2FQ3A 3GLXA 4UHTA 4LK0F 3HTUA 4RS8A 5JVTA 1IXCA 1YG2A 4G7OF 2QUFA 3AAFA 5FD6A 1WI9A 3ECOA 5FLXK 2WC2A 3FZVA 2Y75A 1XB4A 2EA4A 2V1XA 3GO5A 3FM5A 1HXDA 2IW5A 1SFEA 1HW2A 4S05A 4A6EA 1U5TA 3KP7A 4XSXF 2HTSA 1R23A 1YO5C 1J5YA 4G94A 4KN7X 4LD5A 5L3CA 3WTSC 4KIGA 2HS5A 3KZYA 1KQ8A 4A2UA 3QU3A 2FU4A 2W85A 1ZLJA 3KFWX 2VC1A 1G3SA 3PFIA 1QQIA 3P9CA 2PBIA 1HKSA 2XVCA 1J75A 4CDGA 4FT8A 3GXOA 4G8XA 2MBFA 1HSJA 4EM0B 3R6SA 3VB2A 5DDGA 2VT2A 5AIPA 4I98B 1SAXA 3EYYA 2R3SA 1F1ZA 2W25A 4IF4A 4LFUA 3FHZA 3FF5A 1D8KA 1CF7A 2M1BA 3TO7A 1YFHA 5ICCA 1J59A 4U0VA 2MA3A 4ZYHA 3RKWA 5HLHA 2O61A 2XROA 1XDUA 1JHHA 3ZMZA 5K1YA 3ELKA 2HTJA 2JTVA 1PP8F 3RKYA 4WWCA 4F7ZA 2MC3A 3LSTA 3CDHA 2DU9A 2COMA 2IP2A 2V1UA 1E17A 2EJRA 2P5VA 1TW3A 4HLYA 4L9JA 1R1VA 1ZH5A 3LFKA 2P5KA 2RN7A 4OIPF 1FYLA 3EYIA 5LEJA 1L0OC 1D5VA 1A04A 5BPIA 2EA2A 5HDNA 2W57A 2GXBA 1TNSA 2J5PA 3B73A 3I4PA 5L3DA 3VOEA 1FNNA 2DK5A 5DCMA 1MJAA 2QVOA 2DO7A 2QM3A 1ZHFA 4L5JA 5KVRA 5LGNA 2IA2A 3BY6A 3DF8A 3IC7A 4IVNA 5E8GA 1QNTA 1IXSB 1FT9A 5DEQA 2F5EA 3I58A 4BYYA 5K5QA 1FYKA 2F2EA 3L2CA 2DI3A 1PP7U 5E8IA 2K4BA 5AIQA 4B09A 3LAJA 2O8XA 1FBUA 2B0LA 3GZ6A 3F6OA 4ESJA 3TO6A 1R1UA 3M8EA 3L9FA 5DD4A 1XGNA 1FC3A 1TBXA 3GEZA 1UFMA 5TRDA 4EJTA 3TDUC 2DAOA 2KJCA 4GO1A 1RIOH 2HEOA 3MEXA 1XD7A 2FF4A 3EDPA 3KP4A 3PQJA 4K2EA 1S29A 5LGTA 1RNLA 3GF2A 1MDMA 5CVIA 3N4MA 1Z05A 3EETA 5DUIA 2H27A 1PDNC 4I0BA 4M9XA 2AXLA 1XGMA 4RGSA 3ZP5A 1S7AA 1SD6A 4PDKA 2HYGD 2CGPA 5E1ZB 4O3MA 3I0TA 1JE8A 1U78A 4WCGA 3SZPA 2DQLA 2MLKA 2PJPA 2KIMA 4A5NA 3F8NA 2V79A 3O3KA 4HF0A 2V6CA 1USSA 5ILSA 1T98A 1U6GA 4LB6B 1I27A 5LGUA 1W4MA 5H6QA 3JTGA 1R58A 2ZMEB 3QP5A 2YU3A 3REOA 4AIKA 5E1XA 5HDGA 1K78A 4XSZF 3GW2A 4UV9A 1IN6A 4PGHA 4M9ZA 1QBJA 1IN5A 2Z33A 2KIUA 2OA4A 1EH6A 4HW0A 1KQ0A 3J81K 5J8CA 3V7CA 4EM1A 1HQCA 4HX4A 4IXAA 1L3LA 2BEOA 3KLOA 3EQLF 1IN4A 2QWWA 4ETSA 1BIAA 3ML6A 4P9FA 4AIHA 3J80Z 1O7FA 1K78B 4Z2YA 3HSFA 2GWRA 1FP1D 2CO5A 3LQQA 1Z91A 1YQAA 4P5OA 4FHTA 2MH2A 4DQ2A 3I54A 4KDPA 1YS6A 2GA1A 3ISPA 4EV0A 3L09A 5ILUA 4CZZA 1ZGAA 2Q0OA 1F5TA 2DW4A 3U1DA 4CO8A 3WTUC 2BE5F 2PG4A 3CUQC 2M8EA 3DXJF 4AVPA 2FEZA 1V4RA 1P4WA 3ZMSA 1R1TA 1CGPA 4GGGA 2EV0A 1YW8A 2FSWA 3ZMDA 4HQMA 1KU2A 3KP6A 1BOAA 3I5UA 3OOPA 1DP7P 3F22A 1BI0A 4NB5A 3M1EA 2K02A 3CO6C 2AS5F 1DPRA 3ZN1A 4MGRA 3IRQA 3F8MA 4I01A 1UHMA 2YR2A 1IN8A 1BI1A 3MQ0A 2O3FA 4IHTA 2YPRA 1IXRC 4WXHA 3MAJA 3J81Z 4XLNF 1YYVA 2EFWA 1LNWA 4MTEA 4ESFA 1TNTA 1FOKA 4YFXF 1QZYA 5HVQC 1O3QA 4KNYA 4WF2A 2QENA 3LWFA 2JZYA 2ACJA 5D4SA 3ERED 3I71A 1KYWA 3BPXA 2DPUA 4Y17A 4KIFA 5E17F 1R36A 5L3EA 3BZ6A 2F5DA 4HF2A 3E6BA 1XGOA 1J9IA 2A5YB 2UXNA 1ZRDA 4HX8A 3KP3A 3KEQA 4ENNA 3WE2A 3ZN0A 1GHCA 4MHGA 5ILVA 2NYXA 4M71A 4LGWA 5HS8A 1TQMA 2RV8A 1Q1HA 2NNYA 2NAZA 1ZG5A 1J2XA 4FX4A 1O7LA 2H6BA 4XLPF 2ISZA 4PGGA 4G6DA 5DV5A 4ZYEA 1Y0UA 1SD5A 1BM9A 1U5TC 5ERIA 2P6TA 4Y15A 4ZZLA 2IA0A 1B59A 2TDXA 4U7BA 1P6RA 1USTA 4UVBA 4R1HA 3R60A 3RDIA 4U0YA 4HDUA 3V7SA 2IVMA 1ODDA 5CJ9A 4IPAA 5CVUA 3P9KA 3K0LA 4EGYA 4ENMA 2VBZA 1LB2A 5K5RA 2XKOA 5LHGA 5HDKA 2WTEA 1KYZA 2ZXJA 5TJJA 1ZARA 2EB7A 3DPLC 3HHHA 1HBXG 2WV0A 5CVVA 2VN2A 1T0FA 4EQQA 3VFZA 1GXQA 5DYMA 5FD5A 3ULQB 5L3GA 1I6XA 4M72A 1XN7A 1LJ9A 4MTDA 2EK5A 6PAXA 4HLXA 1ZLKA 3SHFA 4KICA 3FXRA 1YW7A 1S7OA 1GVJA 3HSRA 4LLNA 3WTTC 1SD7A 3K69A 4L0YB 4A12A 1U2WA 3V8LA 2P5LC 2GAUA 4N9HA 3HOTA 2EFQA 4RGUA 3BJ6A 5EEGA 1IAWA 4HZFA 4BHCA 5D5UB 3OV8A 4O5VA 3V8JA 3HTSB 2STWA 1KQ9A 1ZG3A 1Z7UA 3I64A 3QRFF 3JW4A 2XUBA 3W6KB 2L4AA 4A5MA 3QU6A 2RQPA 2VE8A 5LHIA 3ZMTA 3HSEA 1MKMA 2HR3A 1ON2A 4U88A 4NHJA 4EJOA 3R4KA 4OIQF 2PMUA 3P9IA 3DV8A 1R00A 3KZZA 5ED4A 1U5TB 1P4XA 4CICA 3IWFA 3GUDA 2ESHA 1XCVA 2A6HF 3BROA 1W7PD 1LDJA 1AWCA 5CYVA 5J6XA 4HA8A 1YLFA 1SMYF 4NQWA 4ENKA 2A69F 2EFPA 1JXSA 3I59A 1XGSA 3GWZA 4CYDA 4LG0A 2JRTA 3KEOA 2J5OA 2JSCA 3COAC 3ZMUA 1EH8A 1T2KA 5BOXA 3F72A 2D2WA 2GQQA 4PCQA 3DQVC 3KE2A 4RB2C 4RB0A 5DUKA 2JPBA 3E6DA 5LLQA 3GX4X 3D0SA 5LBQA 3WU1B 2G9WA 2VXZA 1P92A 1CF7B 2DQRA 3TOBA 2VBYA 5D6EA 1OPCA 2K7LA 5JHUA 4RB3C 1BI2A 3T0YA 1FYMA 4UVCA 4AD9A 5KK1A 3G3ZA 2IJLA 4HF1A 3GFLA 3BJAA 4ZYGA 2VT3A 3IKVA 3ABUA 4XBFA 5DCFA 3WG9A 5D6FA 3RKXA 5H20A 2VODA 3LQRA 1UB9A 2FNPA 1BN5A 2EFOA 2R7FA 3VODA 3JAMZ 5D5WB 4KT5C 2MD5A 3ABTA 5BQTA 5DCMB 2ESNA 1ULYA 3WTYC 4UV8A 4HAMA 5K5OA 5CVRA 1FSHA 4R8HA 2E7XA 2Z99A 3QPHA 2E7WA 1I1GA 1I1SA 3LA3A 5D5XB 4A0XA 2CW0F 4BQAA 3E97A 5LHHA 1K79A 2FOKA 2FMLA 4RAYA 2EFNA 3WGHA 5HLIA 3J80K 2OQRA 2LSOA 2ELHA 5FO5A 4L5IA 4KIBA 4BHBA 2VONA 4Q48A 2QZ8A 2VBWA 1WQ2A 2YX7A 3EUHA 1VTNC 3M8FA 4M6YA 1HKTA 2CWEA 1TQIA 3QPTA 5F6FA 1XSDA 2P4WA 1STZA
chains in the Genus database with same CATH superfamily
4HTGA 2X4HA 1RPWA 4CXFA 2ZO4A 3HRMA 2FTXB 1K6OA 5FKNA 1UCRA 2QA4I 1TTYA 2YTOA 1XG1A 3KP2A 4WK8F 3HPSA 1A5JA 4U87A 1N75A 2VRDA 1BB8A 3CJTB 3F6GA 1ZREA 2JXPA 5AE1A 3TKYA 3K1MA 3OL3A 3OWTA 2F5CA 1NH3A 1DDNA 5J4YA 3S3OA 4JP0A 2KPMA 2ZNZA 2CQNA 1QU3A 5KL3A 3U2RA 4GEQB 4ON0A 2PEXA 5BS6A 1OKRA 2JPAA 2OZ6A 3J7AY 3OYCA 3VYXA 3S15J 1T4LB 3M99B 1MNDA 2DRPA 1MDMB 2VPRA 2N8XA 2DGCA 2W7NA 3S8PA 2QBYA 3FKJA 3QYFA 4OOIA 5AC5A 2PMZN 1F9NA 2EPKX 2V8QB 4U0WA 2LY2A 3F0CA 3WTZA 1VQMI 3I56I 2XAGA 2E1CA 1DGWY 4ENJA 1EV7A 2W84A 2DA1A 3TO9A 3GYHX 2XB0X 4HDVA 5E1WA 4L18B 5CPRB 1NG7A 1BBGA 1E3PA 1OMIA 3CLQA 1J26A 3ZOBA 4XLCA 1TP4A 2VJIA 2GOXB 2YSPA 3OIOA 3QPSA 4F54A 5T6JA 1BJAA 4BY7J 2X9DA 1MD0A 2BBYA 1NG6A 4KN4X 2O0YA 4UXNA 4RBOA 1XMKA 2NRAC 3F6VA 5E3MA 5DNYA 3MHHC 1FY7A 4BC7A 5E18F 3K7AJ 5ADZA 2KIFA 4RB1A 2EL4A 1HNZE 2M45A 3V7RA 4L9TA 4V2FA 2KJBA 3IV5A 1V55H 5J8FA 1FIPA 3P5JA 2UWMA 3M9AA 3JSPA 1ETVA 2EMBA 4R8OA 5BPDA 5HNHA 4YIFA 2W1OA 2Q8UA 3QQAA 4IJAA 2GZWA 4OAZA 5E20A 4DR2E 4C9YA 4A3CJ 4JI1E 2QBYB 5HS9A 1D0ZA 1IDYA 3S2WA 1O4XA 4KMFA 2L4MA 4C3JJ 2GOMA 4W1UA 5ICGA 2YU8A 1V54H 2EMKA 4G7HF 4WXDA 1SD4A 5B66C 2EORA 4Q4ZF 1HKQA 5C3EJ 3T8RA 4B3TE 3HKZA 2ZXIA 3F8BA 4GYGA 3M07A 2HDCA 2R76A 4OMYA 1GZ6A 2ZCWA 4XRFA 3KYDB 2KL4A 4KYWA 2VIXA 2MC4A 4FETA 2D1HA 3Q9SA 3VDXA 1G3WA 4F9AB 3ZRGA 2H1LA 1OR7A 3A0BC 3WTWC 3T1HE 2W48A 5FKOA 4PSXA 1FBQA 1MGTA 3C2BA 3THOB 3TGNA 1Y56A 3BZKA 1LEBA 3GCMA 2OD5A 3QYBA 5IYCJ 2PQ8A 4UUVA 2FBIA 2MFZA 2RNGA 3CC4I 1WJPA 2P8TA 2OV7A 4P78A 2QQ9A 3CMMA 3ERMA 2EILH 3O6BB 4GYIA 2LY1A 2IS2A 2Y9ZA 3IWCA 4JX6A 3LA2A 1WZ2A 3ECRA 3BTJA 4EM2A 5HOOA 2KKOA 4P1WA 4Q47A 5KNLA 3DLAA 3DEEA 3DP7A 1R5HA 1IUYA 2EWNA 4LLLA 2HZDA 2FBHA 4M3EA 5F27A 4KFCA 1B4AA 3BR0A 1XMXA 3D5LA 2EMAA 4J8ZA 2K85A 4H4KC 4BU2A 3L2VA 2NOGA 3HM5A 4E7IA 3G2BA 5IP9J 1U8BA 4DV5E 1IV8A 3BCAA 4UNOA 3QPLA 4UVAA 1VQ8I 1ON1A 1XSVA 4N9IA 2K27A 2Y48A 3MKLA 4V2GA 2H36X 1G59A 4EATA 2EMCA 1RI7A 4B43A 2ELZA 4X64E 5LRSA 2WWYA 4LB5A 2DOAA 4FISA 3G1MA 1WSUA 2NVTJ 1EA3A 2B7EA 3FBIB 2DBBA 2OBPA 2EZHA 1RQ0A 1I94E 1JI8A 4WXCA 2CUFA 2EPMX 4QLCU 2ZC2A 5JR3A 2HQNA 2N3HA 4LMYA 4LF9E 2XIGA 2LTRA 1TW2A 2A61A 2Y0MA 1X3WB 3OYLA 2DN0A 2XAFA 4PFOA 4M6XA 1UHZA 3CCVI 2EZ6A 3HDDA 3SEQA 4FASD 4OU0A 3CCUI 1X49A 2QLZA 4I02A 3C4TA 1Z3XA 3H3UA 4JI4E 1OYYA 2ISYA 5A6BD 2PLYA 5FB2A 2VOPA 1S3JA 2IGKA 2LKPA 2L8TA 3F23A 1R5GA 2OC6A 3OY9A 1VQNI 4IRIA 1IRZA 1GUUA 3W3CA 2MC6A 4XOPA 1GXPA 2ZJQF 2Y0SN 3ABLH 3PJRA 1YHQI 3O2PE 2F4IA 3ZMVA 3HRTA 2DXIA 3K4NA 4Y3OA 2HJJA 2R5YB 1T4NA 1T0FC 2IXSA 2P7CB 3CCJI 3QODA 2HVRA 4WFTA 3HUGA 2V1DA 1MJBA 3TL4X 2EM6A 3KWRA 1B1BA 1MIJA 3BDDA 2YUSA 4IOCF 1FWZA 3MKZA 2MDGA 3CUQA 2EMWA 1BIBA 3CDIA 1ZAAC 1G2HA 5CQGA 3I53A 2VE9A 2H94A 3U1KA 4F6NA 3S32A 2DT5A 4MLVA 5ICEA 1B9MA 3QAHA 3SFIA 3EUKL 2EM5A 3QG5C 1A1FA 3W2AA 2PI0A 4MNUA 1OCPA 2ADRA 4E7ZA 1P2FA 3EUAA 1A6IA 2V89A 4ESBA 4LTYA 3HC7A 1OQYA 3C1DA 4A0YA 3OYGA 2NVXJ 1S6LA 4B3XA 1ITYA 1OLTA 5HODA 3S2HJ 2RVCA 3MZYA 1UHWA 1QHHD 4JI8E 3E6MA 2UUAE 2TCTA 3CD6I 5IT9K 2EMGA 1YS7A 2KRHA 2M9HA 2LRSA 1H9GA 4CZCA 2STTA 2LT7A 3C3WA 3GZ5A 3AG2H 1Z6RA 2M4KA 2KHMA 2O7OA 2F4OB 4X1EA 3OYBA 3HUGB 1RUNA 2VI6A 5FROA 4IO9F 2KP6A 3PUFA 2IRFG 2YTGA 5EF6A 2HWVA 1R22A 3RTRA 3BOQA 3LLHA 2A3SA 2R7RA 2FBKA 4UUSA 4HV6A 5IY5H 2LNBA 2EOXA 4RDUA 1X1DA 2L54A 2LKSA 3GFIA 5B1BH 1EH7A 2CUZA 4ZTFA 3TW6A 1ENHA 1J0RA 1X3UA 3ECHA 2PFBA 3S1MJ 1QVUA 4ZTJA 3DEWA 1K7AA 1EJ9A 3IHUA 2L3CA 4FK5C 2NS8A 3M4OJ 1Z1DA 2LMZA 4DR1E 3T1YE 3BR5A 1VF9A 5GAGJ 4A3MJ 1H9TA 4N4RB 2PMZA 1SC7A 2P6SA 1FTZA 3SZTA 4WX9A 3ADJA 2M9AA 3CESA 3FMSA 1MMNA 1I50J 4Z6YA 3AKZA 1G3TA 3G4SI 4HQEA 5FLMJ 5KL5A 4E7KA 4XORA 4BXFA 4YG2F 5JFRA 4MLQA 1WWXA 3BWGA 2VBXA 3WGGA 1PJQA 2L01A 2L7FP 4RMNA 1MNEA 2XAJA 4L9NA 3S3NA 1BBYA 1W5TA 2ZJ2A 2XSJC 1PUEE 1ZQ3P 4BAYA 2OTJI 5E3OA 1J7KA 1MJ9A 2JOBA 4O24A 1ZYRF 2YT4A 3HHGA 2D9HA 3MD2A 1WKMA 1FSEA 3ZXSA 1D8JA 1JGSA 3U9GA 1VQ5I 1MMAA 2R7WA 3V8KA 2FJ1A 2CQKA 3HPGA 2YTIA 2ZBKA 3CJNA 1D3YA 1KU3A 3TDZC 2BXYA 1GTKA 4LF4E 1TWHJ 3VEPA 3D1NI 3PSIA 4DZPA 2E60A 2XGXA 3WTVC 1ETWA 1O57A 1DPUA 3A1YA 3ZPLA 4OIRF 4K0KE 2EMHA 1HSTA 1HDPA 3NQOA 1NCSA 2JT1A 4R2SA 3VWBA 3DU5A 5A2QZ 2BZTA 1OCZH 3CP2A 3RKQA 5EGOA 2R92J 2WV1A 1FP2A 2CYYA 4F9CB 5DS9A 2XPVA 2XSDC 2FMYA 2C6YA 3GTQJ 3IL2A 3R61A 4JQFA 3S14J 2FXAA 1ZGJA 2DIXA 3U21A 4X0GA 3KCCA 5KL7A 5IT9Z 2EN7A 4CH7A 5D5VB 4L5NC 2R1FA 1UZCA 3DFGA 3H9QA 3CTAA 1RC7A 4YHHE 1YTYA 4IJDA 3E3VA 2JN6A 2BV6A 4PZJA 4DV1E 4IHVA 4EJVA 3AG3H 3CCQI 3N97A 1O3TA 4R2DA 2M0MA 1G3YA 1ZN2A 3RYPA 4DOZA 4OINF 3IKTA 2NUEA 2HVQA 1B72A 3CCRI 1H89C 3JAMK 1VNDA 4DNCA 4G6QA 5C44J 3LSGA 4XKCA 1ETXA 4O4KA 1EKEA 1FX7A 4MEYF 3CCYA 1YOVB 3SQNA 2LUPB 2E34A 4BH9A 3HQ1A 3JSOA 1MBFA 2LTSA 1RZ4A 1FLIA 3JRCA 2BB8A 1LVAA 4Q28A 1XNQE 1XSXA 1MMSA 2VL8A 2ENAA 2PJRA 1IBME 2VKHA 2YTEA 3J7AO 5D4RA 1KA8A 5EGOB 3GTMJ 2VKDA 1B8IB 3V4GA 2OQGA 5H6RA 5A2QC 2I9IA 1LDDA 2Q1ZB 2DPDA 3CO7C 4S04A 2KZGA 2XRNA 3P7NA 1VQ4I 1LFPA 3IAS2 3LFUA 1Y39A 4M3BA 3E6CC 1XMOE 1HW5A 1SVOA 2Q2EA 4ZDLA 4OMZA 4BHPA 4HSTA 1BR4A 1Z1BA 1N3GA 2XB5A 4YELA 3MHSC 5FLXZ 1CQTA 2OPTA 2D45A 4LF7E 4CSWA 3EPHA 1QPMA 2EOFA 4L9VA 1XMAA 4FQGA 2HGCA 2R7XA 4BS9A 4EMSA 2LDUA 1QZZA 3L7WA 4CCNA 1WGXA 1ZKGA 3BTIA 3K1NA 1C0WA 4NQWB 2EIMH 3BR1A 1D5YA 5LEKA 5AONA 2EMXA 4G9YA 2Q8KA 1MZBA 3B02A 3I59B 1P4AA 1Z6TA 2DDAA 2XKPA 4LITA 2EOJA 4RH8A 3A02A 4LG0B 3WHCA 4M73A 1BC7C 2F8BA 4BKXA 1W5CC 2CSOA 2XHKA 4IRGA 4BL0B 2GXGA 3BTLA 4U7DA 2PJRB 2EV5A 1V3FA 2UUBE 2HXIA 1IGNA 1APLC 4AC0A 3DCFA 1POGA 3L2RA 3FMRA 3PQKA 2EQ3A 3F8CA 4XLFA 2UZKA 1OYIA 2QKLB 2Y0SA 3BPVA 4M74A 1ONVA 1ZTRA 1REPC 3OMLA 2M7QA 4BY1J 1YYOA 2QSHX 1JK2A 2G7HA 2DLLA 2F6CA 2KFDA 2V9KA 3QWLA 3LAPA 3HL2A 1T38A 2YSRA 3CCMI 4E70A 1OYWA 4B3SE 2ZXWH 2HYFA 3OYIA 3C4BA 2K86A 4NHRA 2EQ1A 3KP5A 1X1PA 2Z9OA 4KHPE 1U8RA 4WSPA 1LQ1A 2JJ7A 4LLGF 2H6CA 1AA7A 3HPHA 5AE2A 1F4KA 1A1IA 5FLXC 1SMTA 4II2A 1YX5A 3BP8A 1VI0A 2H8WA 2NNNA 2HQRA 2VKEA 4Y33A 2M87A 2EPAA 3DF6A 2JY9A 2L9NA 4DUZE 1Y8QB 2IGMA 4I6ZA 3GFMA 2Y9YA 2E1NA 2EM7A 4BXXJ 2DFIA 1D1CA 2B7VA 3D5RC 4BE1A 3H92A 3IRRA 1XS9A 2L92A 2HU9A 2GIVA 1N77A 4TUIA 4I0AA 4KUMA 3K2AA 3SXYA 1QU6A 2XV4S 1ZR4A 4LJZF 4CHUA 1TWGJ 1E2XA 1O3RA 3PNTA 4R2RA 4MQVA 2Y31A 2CFXA 5F64A 2IT0A 3DEUA 3UNGC 3CMEI 1QGPA 4QSHA 2ADUA 4BE0A 1QPIA 1BOBA 1IZ1A 1WJEA 2V85A 1KONA 2R7OA 3LA7A 1IRGA 4R2PA 3BJOA 3FMQA 2G0EA 4NXME 1ZRCA 4JX5A 1SEUA 1X4PA 1VQ7I 3DTKA 2O9LA 1LUJB 4ASNA 4EJUA 3J7ZI 1IN7A 3RPQA 5H2FC 5IT3A 4IHSA 3WODF 4XMYA 4Y13A 1SFUA 2A6EF 2JA7J 3AV0A 2WCC3 1JT0A 1PVEA 1FKAE 1FPQA 1IRXA 2WAQA 1MEYC 5J47A 2LR8A 1JHFA 2EIJH 2FNAA 3B6AA 4A3DJ 2YTJA 2E5LE 2P7VB 4HNVA 2E71A 3O8GA 3PL8A 1WI3A 2ETHA 5F1RA 5IP7J 4RA2A 1XTAA 2OTLI 2LYCA 1IBLE 1H88C 3ZQ7A 4D7MA 1RMDA 3TOAA 2AO9A 3H5RA 1HNXE 3FHNA 1RKTA 2E1MA 4DR4E 4PUSA 1YIOA 3GFJA 4HOBA 4HYEA 1A35A 2K3PA 2CW8A 5A6BA 2OZUA 1KZHA 2V26A 1E0EA 2RPCA 1VQ9I 3RIRA 4GCVA 4DGWB 2M5WA 4R2CA 2CU7A 3FXQA 5CQEA 2CV2A 1B6AA 2XRLA 3DTEA 2AQEA 4HG2A 1H0MA 1FTTA 4I09A 4YEJA 2HFHA 3TMOA 2H8RA 4GFBA 2GPIA 4MLOA 1QZEA 4LG3A 3QP6A 1T39A 2IHR1 3E5XA 4DV4E 4YY3E 2DA4A 2ZMEA 3GTJJ 2OU2A 3BR6A 3HIFA 5DD8A 4LK1F 1O3SA 3KX2A 2CV0A 1ERDA 4MIMA 2M4GA 4H0EA 4I2OA 2YX4A 3LNQA 2WBTA 3HYIA 2VPLA 2EN6A 1IDZA 3MCZA 2BY3A 1ZAOA 2YTDA 1W0UA 4JI3E 2LBFA 2RREA 3FX3A 4AVZA 2JA2A 3RCOA 3F21A 5D8LB 4BE2A 4CYCA 3PO3J 1OFCX 1OR7C 2XASA 2D1VA 4GZNC 1N34E 9ANTA 1KU7A 1QO0D 2OAZA 3CUOA 3HJEA 3KEYA 4XLHA 3OYAA 2CMPA 4M9SA 4F2JC 3WU0A 4BACA 3I3LA 2VC0A 2NS0A 2OUMA 3RYRA 4ZYDA 3AFHA 2XGCA 3FWEA 4ZH4F 1QA6A 4DIQA 2R0QC 1VQPI 1IBKE 1XCBA 1DP3A 3JRFA 3VHTB 2HKXA 2ZNYA 3IP4B 2VJ5A 3NRVA 1FBSA 3H3ZA 3KLNA 2V9VA 2V1NA 3M1CA 3WGIA 2CUEA 1VZ0A 2W00A 4A3JJ 2ICWG 2K7IA 2BYVE 2DJIA 1R7JA 4B3ME 3I9V2 5F0HA 2VE7C 3KETA 1WRJA 2MYSA 2RC4A 2UXXA 2HVSA 3F8FA 2JA6J 2E2HJ 2XF7A 4A3BJ 2EINH 2RGVA 4HBLA 4XKBA 2RNJA 3F3XA 1YW9A 2DMYA 3GTPJ 1IQSA 2CQQA 3MFKA 3S16J 2VXDA 3Q5FA 1I5ZA 1Y1VJ 4B8XA 3GTLJ 2JRMA 4BGDA 2GLIA 2F5VA 3MZ8A 3VYSB 4JYAE 2R7QA 2M7BA 3CCEI 2HOEA 4BDZA 5GTHC 1S72I 2EWLA 3ADGA 4I76A 4BC9A 1WJ5A 2MLGA 4CYCB 1S8NA 2X0LA 4RAZA 1P7JA 4XK4A 2MH9A 4EJWA 5DM7F 3DPTA 2J7JA 4RGRA 4F93B 2F4MB 4P9UA 3OYNA 3GVAA 5LMNE 1R71A 1I6HJ 4MEXF 1X6EA 2NVQJ 3K1PA 2BY1A 4KA4A 4I7HA 2DTRA 5FFXA 1DU0A 2IA1A 1W1WE 4CGZA 1HW1A 3HRUA 2A5WA 2DOEA 4BNCA 2BW3A 3MN2A 2PN6A 2LY9A 3BTCA 3MKWB 5L3BA 2E5ZA 2BHZA 4RM3A 4P55A 2QYOA 1MBKA 1RRJA 2O8KA 3ADIA 4EVIA 3HEFA 1X1AA 3IWDA 3K9TA 4KISA 4XKVA 5FFZA 3ROUA 4DYQA 1W5SA 2FRHA 2OJED 3BG3A 1ETQA 1JUSA 2VQFE 4D5CA 3N05A 3OR1C 1JTXA 4CCJA 4JI7E 2H09A 4NUBA 2L3JA 1N36E 3OIPA 2VJJA 1XDSA 1FMVA 1T6SA 4HX7A 1X48A 2WZOA 1NEIA 2CG4A 4O6JA 2XAQA 2A68F 2JUGA 4BBRJ 1LKXA 3DBRB 4AIJA 3QOEA 2L02A 1K4SA 3CLOA 1E3OC 3LOCA 2CQ7A 4ZZDA 2LF7A 2LG4A 2NA2A 1QVTA 1E3HA 2QGUA 5D8KB 5FJ8J 1U3EM 4GXOA 4YIIA 3TQNA 3VYRB 3T8TA 1XMQE 4P96A 1NHAA 2LKXA 1U9OA 2HKOA 2RDPA 1WJDA 1G4DA 4LF8E 3RPUA 3P1XA 3X2QH 5KAIC 3UKGA 2EN3A 1P47A 2VQEE 2BW3B 4HNTA 3IWZA 1LEAA 5EYRA 1IF1A 1FOXA 1FZPB 4Q5SF 2KZVA 3LL7A 3R0JA 4IRHA 3SDBA 5LD2C 3BQYA 3RQ4A 2BGCA 1ZG1A 4ZDOA 3J7AG 2DA7A 1A1HA 2GIZA 1TQPA 2M0CA 2F5FA 2AXTC 1AOYA 1R9TJ 1A31A 3C7JA 3W2VA 5LMUE 3FK7A 5J3LA 3KIOA 1IRFA 3RSNA 2CS3A 2X6YA 2K40A 3E5UA 5FGMA 2ZFWA 2DA3A 2Z3YA 1RUOA 3UR3C 2FA5A 1V5GA 2LRDA 3K2ZA 1IUFA 3WE3A 1RESA 4D0PA 5C4XJ 1HF0A 2XPWA 3A03A 5LRRA 2EMFA 4CA0A 3A01A 4DR6E 2DK8A 3OL4A 2B3TB 5CVJA 2JVAA 4N0BA 3OYEA 2WAEA 2EBIA 4Y7NJ 3HBLA 1SR9A 1W7PA 2UU9E 4JBAA 2EJ4A 4A3LJ 1G6NA 2LP0A 2CPNA 3RQIA 3I55I 1KU9A 1P9QC 4A6DA 2PMHA 3DKWA 2K4JA 1S9HA 1KGSA 3JTHA 2EZIA 4EGZA 2RKHA 1B9NA 1LPQA 1OCCH 1SFXA 1BC8C 3JR9A 3QOPA 1F36A 4KT6A 3KYCB 3G73A 1BI3A 4KITB 2JVHA 3UK3C 3NEUA 2GA2A 2LF8A 1D1AA 4A0ZA 2VOOA 3LSHA 2MD0A 4AWXB 3HOSA 5BMZA 4CUGA 1ZRFA 3HOZJ 2EOMA 3MWMA 2JP9A 4TV7A 5KL4A 5BR8E 1JGGA 4R2QA 2RQQA 1MSEC 4CCMA 1LDKB 2LO3A 2MDRA 3FDYA 1PJTA 2L0KA 3GZNB 1LFUP 2DMTA 2W24A 4KJZA 4FX0A 3ZQGA 3A01B 2WY8Q 1WHQA 2ELYA 3NAUA 2DJNA 1R5ID 4GRIA 2CT1A 3H5AA 2O03A 2QQ8A 4QIWN 3WTXC 5EG0A 3FXUA 5EJCA 3BQZA 2YWQA 1DUXC 4L0ZB 4JK1X 1W7PB 5ICFA 2EIKH 1TLHB 3T1BA 5M5WJ 3L2UA 4XOTA 2JPCA 1ZR2A 4G7ZF 3C18A 4B3AA 2XGDA 2IPQX 3OYHA 1X1CA 3CF2A 1TZLA 5FLVA 3M7GA 5L3FA 2E1OA 2B9SA 1X3CA 2G7UA 2H1KA 4LF5E 1IG7A 1STUA 4M6VA 3RI4A 4KMUX 2MSYA 2L3DA 3K10A 2XDVA 3IAM2 4RGXA 5A2QK 1JKQC 2EOQA 1Q1VA 2FE3A 3J81C 2R7DA 4RLFA 2IEKA 5DM6F 2QQAA 3JRDA 4D5FA 1HLVA 3FKIJ 2HGHA 2VQCA 4R79A 3OYMA 2JA8J 4XN0A 3QYEA 3SFZA 2YTNA 3Q9VA 3J7YJ 3OYDA 4P7DA 2K3FA 1DGCA 2M30A 4QWQA 3W6JB 3F6HA 1I3AA 2XAHA 1XC5A 3RJPA 4A3KJ 2DDBA 3E0JB 3TP0A 1XX5A 5HLGA 1ZR9A 3H0GJ 4B4CA 5JI6A 3HRSA 1Z9CA 4BXUA 2LJUA 3BBGA 1YSAC 3L00A 3CUQB 5EG0B 3IH2A 2O6GE 2EN4A 2M3AA 5K7FA 2HZTA 2VJ4A 2EV6A 3A4CA 2ZKZA 3MZHA 2EPPA 2Z5UA 1PJRA 1YUJA 1GV5A 5CLSA 5EEHA 4MQ9F 2KRFA 5GP9A 2YTPA 3DKYA 2DLQA 3CQZJ 3E5QA 3R0AA 3PFYA 2R7ZJ 4YFKF 3EQ1A 4HV5A 2K9MA 5HS7A 2A07F 1T08B 2EMYA 2QQBA 4Y4RA 3T5XA 2KOUA 4YFNF 1IW7F 1RKWA 2M8GX 4OIOF 3C6KA 3FM3A 2FQ3A 3K4LA 2HI3A 3GLXA 2LBSB 2VQHA 4UHTA 4LK0F 2FOWA 3HTUA 4C2UA 1GLNA 1JJ6C 4RS8A 5JVTA 1IXCA 4JI5E 1YG2A 1WHNA 2B63J 4IQJA 4G7OF 2L5QA 2HYJA 3AG4H 3BG6A 2QUFA 3WHBA 3AAFA 5IP6A 5FD6A 4E7SA 3S93A 4XRSG 1WI9A 1KYQA 3ECOA 5FLXK 5A6JA 2WC2A 4UUSB 3FZVA 4C3HJ 4Q35B 2Y75A 2LOOA 3J7Yp 3OS2A 2V86A 4II3A 3G1LA 3DTIA 1YYWA 1XB4A 2EA4A 5J4VA 2V1XA 2LH9A 3CJRB 3FM5A 3GO5A 4AQYE 4C3IJ 3S1QJ 1HXDA 4UUTA 2IW5A 4KZSA 1SFEA 5GTIC 1HW2A 4S05A 4A6EA 1HNWE 1YYKA 2JMWA 1VFCA 3M3YJ 1WHUA 4OAYA 1X47A 2EOEA 1YRNA 1U5TA 2XF6A 2FQ4A 4C30A 2A6TA 2DMIA 5KCMA 2PRTA 3KP7A 2WA0A 4XSXF 2HTSA 1UHSA 1R23A 1YO5C 1J5YA 4JI2E 4G94A 1IQOA 4KN7X 5AC4A 4ITVA 4LD5A 4PJJA 5L3CA 4D9JA 4DV6E 2O5RA 3WTSC 2AQFA 4KIGA 1UN6B 2P81A 2HS5A 3KZYA 5A69A 1KQ8A 2WB1N 2ODRC 2F48A 2EM4A 3SJMA 2HDWA 3QU3A 2FU4A 4A2UA 5LL6R 1Y6IA 2KRCA 2W85A 2MW8A 1V5EA 1ZLJA 1GVDA 2X6WA 3ASOH 3KFWX 2VC1A 1G3SA 1X19A 3PFIA 2KDZA 2YRMA 2DOFA 1QQIA 3P9CA 1AAYA 2COBA 2PBIA 1HKSA 1IJWC 2DFEA 4BBYA 3DWLE 3H36A 2K9NA 3DU6A 5EZGA 4HNUA 2XVCA 1J75A 1K83J 4AM3A 2IS6A 4XLAA 4CDGA 4FE4A 4FT8A 5JHFA 3GXOA 1D1BA 2I10A 4G8XA 5FRNA 2MBFA 1IC8A 1HSJA 3VPRA 4EM0B 2NS7A 3R6SA 3VB2A 5DDGA 2VT2A 5AIPA 1SVMA 4I98B 3C2HA 4N4NB 1SAXA 3EYYA 2R3SA 2L9SA 1F1ZA 3OSGA 3HOUJ 2W25A 1L4SA 1YUIA 2BOLA 4IF4A 4LFUA 3FHZA 3O8HA 4L8NA 3EPLA 2KDOA 3FF5A 2LK2A 3FXOA 2DODA 2EN1A 1D8KA 2VQLA 1CF7A 2M1BA 3TO7A 1G2FC 2DMUA 1YFHA 1IV6A 5ICCA 5K7ZA 1J59A 4U0VA 2MA3A 4ZYHA 1LFBA 3S1RJ 3RKWA 5HLHA 2O61A 2XROA 1R4MB 1XDUA 3NWTA 4BDYA 2IGNA 1R4NB 4JOMA 2V4JC 2X6XA 1JHHA 4B1RA 3ZMZA 1Y0NA 1JKRC 1Z3YA 3ELKA 5K1YA 4BJTA 3VYUB 2M4IA 2V9PA 4XICA 5HLTA 2HTJA 2JTVA 1PP8F 2MKDA 3RKYA 3Q0VA 2YRKA 4WWCA 4F7ZA 3H9GA 2MC3A 5FKLA 3LSTA 3LSIA 4J00A 3ZGKA 4YRVA 3CDHA 2DU9A 2COMA 3K6GA 1XNRE 4PJMA 4DV0E 2IP2A 3CC2I 1B72B 2V1UA 5M3FJ 1MBEA 1E17A 4EEFG 5J1YA 1UILA 2RS6A 2JOXA 3K4KA 4R2AA 1TT0A 5JLWA 2EJRA 2EMIA 3HGYA 2P5VA 3F9KA 1AHDP 1TW3A 2X6OA 2YPNA 4HLYA 3DBHB 2DLKA 4JV5E 4L9JA 4IEJA 1QHGA 4M3GA 1UG0A 3CCLI 3RZDJ 1R1VA 1JK1A 1UMQA 3S2DJ 1K4TA 1ZH5A 3LFKA 1SVLA 2P5KA 3OSFA 2CQXA 1JUPA 3LMLA 4NDLA 2RN7A 3W2WA 1YI2I 4OIPF 1Z0XA 2Z2SB 1FYLA 3EYIA 1JT6A 5LEJA 1KJKA 3HOXJ 3BG5A 2RTXA 4IHXA 1L0OC 1D5VA 2KHXA 4E7HA 2YU5A 1A04A 3LSPA 3AUZA 5BPIA 2EA2A 5HDNA 2W57A 2GXBA 1TNSA 2Q2EB 4A69C 4BQOA 1TWFJ 2J5PA 3B73A 3G1OA 3I4PA 5L3DA 3VOEA 2DMQA 1FNNA 2DK5A 1FJGE 2CRGA 2V83A 5DCMA 5IV8B 1M1EB 1MJAA 2QVOA 2CFOA 2DO7A 2QM3A 2ZB9A 1ZHFA 2UUZA 3EUHC 4L5JA 5KVRA 1VQOI 2UUCE 1SFKA 3SZGA 5LGNA 2IA2A 3BY6A 3DF8A 4LOCA 3IC7A 3WG7H 4IVNA 2XC7A 5E8GA 3ASNH 2GLOA 2GHFA 2RSMA 2HHHE 2EZLA 3ZR8X 1QNTA 2CV1A 1IXSB 1FT9A 4M0VA 5DEQA 3THNA 2F5EA 3K4MA 2ZMEC 3I58A 4BYYA 4D1QA 4IQ4A 3CCSI 5K5QA 2EMLA 1N32E 1ETOA 1UG2A 2L7ZA 2F2EA 1FYKA 3L2CA 4DV2E 2DI3A 2LD5A 2KT0A 1PP7U 2EOZA 3A0HC 2CW7A 2YTQA 2M34A 5E8IA 2K4BA 4XIDA 5AIQA 4B09A 3LAJA 2E2IJ 3BT9A 2O8XA 1FBUA 4IHWA 2EM9A 2B0LA 4A3EJ 2NXNB 4IL6C 1WPKA 3JRGA 3GZ6A 3F6OA 1RETA 3V42A 4BEHA 4ESJA 3TO6A 1X1BA 1BL0A 3VYYA 3KZIC 3CMAI 4F3QA 5E79C 1R1UA 1WCMJ 1PUFA 2ECBA 4XONA 3M8EA 4XR6A 3S1NJ 3L9FA 2KISA 5DD4A 1YJWI 1TF3A 2ENCA 2L6MA 1XGNA 4RLQA 1VQ6I 1FC3A 1TBXA 3GEZA 5BNGA 5M3MJ 3JRAA 3HGGA 4DV3E 1DQUA 4MFEA 1WJAA 4F52A 1UFMA 4G6TB 1J5EE 1YPNA 4J01A 1VQKI 2ELJA 1X58A 2HOSA 5TRDA 2R7TA 5HNFA 4EJTA 4IX7A 2MABA 4M3DA 4I8OA 3TDUC 2V6EA 2DAOA 2KJCA 2LC2A 1ZBTA 2RAEA 4GO1A 4AIDA 1RIOH 3OOUA 2LLKA 2HEOA 3MEXA 3JCUC 2I13A 3ONQA 1FIAA 1XD7A 3JRBA 2JQ7A 2FF4A 4JYKA 3EDPA 3KP4A 3PQJA 2HPMA 2EPRA 2KONA 4RHBB 4K2EA 4BEHB 1S29A 3CC7I 2F4VE 3BLYA 4X9JA 5LGTA 1RNLA 2RSIA 4TUGA 2HNHA 3GF2A 3IH4A 1MDMA 5CVIA 3N4MA 2M1SA 1Z05A 3EETA 5DUIA 1HDDC 1PDNC 2H27A 4A3GJ 4OX9E 2ZJRF 3OS0A 4I0BA 2ZSIB 4M9XA 3EPKA 2AXLA 1XGMA 4RGSA 3ZP5A 5IXMB 5EDNA 4UB6C 4R2EA 2HXOA 2JK3A 1WH5A 1A1GA 1S7AA 1YX3A 1SD6A 2YU9J 4IS1C 1X4OA 4XLEA 1OCRH 3Q0UA 4JX4A 2R5ZA 1MH3A 4PDKA 2EZKA 2HYGD 2DYRH 2CGPA 5E1ZB 3BR3A 3IWBA 4O3MA 3I0TA 5J1UA 1JE8A 1U78A 4WCGA 3SZPA 2DQLA 4E6KG 2MLKA 2WBUA 3OMYA 1AU7A 2JWTA 2BVMA 2ID6A 2PJPA 2W4SA 3FXJA 2JR1A 4M2ZA 2E1MB 2KIMA 2ME0A 2EPLX 1B69A 4A5NA 4RAFA 4E7LA 3F8NA 2Z1DA 4UB8C 3LSRA 2V79A 3O3KA 3BF2A 4HF0A 2V6CA 2EOYA 2Y2ZA 1USSA 5ILSA 1A1LA 4LIUA 2K9SA 1T98A 1U6GA 4LB6B 4DR7E 1I27A 5LGUA 1W4MA 1Y1WJ 5H6QA 3JTGA 1R58A 2WB1A 2ZMEB 1DQ3A 5AASA 3QP5A 2VASA 2YU3A 3ZQLA 4IKFA 3REOA 4AIKA 5E1XA 5HDGA 1K78A 2IGOA 1OCTC 3L2QA 2ME6A 4XSZF 1U0JA 2NVYJ 3OYKA 3GW2A 4GDFA 4UV9A 1IN6A 2LBFB 2R5ZB 3OIQA 4FTHA 4PGHA 4X8WA 4M9ZA 1QBJA 1IN5A 4DBRA 2Z33A 2KIUA 2L9RA 2OA4A 1UJ8A 1BA5A 2EQ0A 5CFFE 1IO2A 2DCEA 4F55A 2EPUA 1EH6A 4HW0A 3I4NJ 3FXKA 1KQ0A 5B5EC 3J81K 2E2JJ 1J09A 1YITI 2R7SA 2R4GA 3Q3SA 2BHYA 1MH4A 5J8CA 3K4CA 2JVGA 4ZDPA 4F92B 3V7CA 1Z67A 3BG7A 1HQCA 1WH7A 3GMEA 4EM1A 4DKKA 2DA2A 4HX4A 4IXAA 2ECCA 1L3LA 2EPCA 4G12A 1WXRA 1MMGA 5A6AA 2BEOA 1T33A 3KLOA 4FCYA 3EQLF 2OCEA 5E3LA 2ODRD 1IN4A 2K4VA 1MBJA 2QWWA 4ETSA 3H3VK 5KL2A 1BIAA 3ML6A 3LSMA 4RAGA 5GADJ 4P9FA 4AIHA 3J80Z 2DA5A 1O7FA 3S3MA 1XPXA 1A36A 3H09A 5JVGF 1ZELA 1N78A 1K78B 2B9DA 2L7KA 2EL6A 2XF5A 3MSWA 2HQ5A 2L2OA 3L2WA 1FOYA 4Z2YA 2DYSH 3HSFA 2GWRA 4XL9A 5F04A 5TGTA 1FP1D 2CO5A 3LQQA 2EN2A 1BR2A 3OS1A 1G8XA 1Z91A 1YQAA 4P5OA 4FHTA 2MH2A 2ZSHB 4DQ2A 5F3WA 3I54A 4KDPA 4DR3E 3Q0WA 4NC6A 4JI6E 1YS6A 3ZQQA 2UXBE 4HSRA 2GA1A 3ISPA 4EV0A 3L09A 5FKMA 2K9QA 2EP3A 3DLLF 1BW6A 5ILUA 4AYBN 4CZZA 1ZGAA 2Q0OA 3PUBA 4OWRB 3DKXA 1F5TA 2XAUA 1T8IA 1ZU1A 3H9JA 2DW4A 3ABKH 3U1DA 4CO8A 1IMUA 3ESWB 4W97A 4QPQA 2BE5F 3WTUC 4M30A 3AL0B 2PG4A 2YS9A 2DFHA 3IUOA 3CUQC 2M8EA 3DXJF 4AVPA 1F2IG 2FEZA 4PK4A 2YZTA 1V4RA 2EPFA 1P4WA 4C2TA 3ZMSA 1R1TA 2DTZA 2K9LA 4GGGA 1YW8A 2EV0A 2FSWA 1CGPA 4JI0E 3HOVJ 3PIPF 3ZMDA 1WVRA 1P7IA 4HQMA 4CCKA 2LVHA 1KU2A 3TBIA 4BMJA 3CMYA 1X6FA 3KP6A 2KMUA 2FX0A 4MFDA 2L2KB 1BOAA 4M9VC 1PJSA 1SAUA 4FE7A 5IPAA 3GTKJ 3I5UA 3OOPA 3J80C 1DP7P 4X62E 4ANJA 1BI0A 2GBYA 3F22A 2N3GA 4DR5E 4NB5A 3M1EA 2K02A 3CO6C 1W0TA 1BJZA 3GBGA 1DPRA 2WADA 2AS5F 3ZN1A 4MGRA 3BIDA 3IRQA 3F8MA 2IBDA 4I01A 1UHMA 2WY7Q 2YR2A 2L33A 4LFAE 1IN8A 1WJCA 1BI1A 3HOYJ 4LFBE 3MQ0A 2O3FA 2R7UA 2CTDA 3FBNB 4IHTA 2LREA 2YPRA 4DJAA 2EL5A 4F91B 2EPXA 1IXRC 2R5YA 4WXHA 2A05A 3OR2C 3MAJA 5C4JJ 3J81Z 3OTOE 4XLNF 1YYVA 2NOJB 2EFWA 1LNWA 2NUGA 4MTEA 1A1JA 3ZCOA 4O43A 1BBOA 4ESFA 1FEXA 1TNTA 5JLXA 1FOKA 4YFXF 1QZYA 1GT0C 5KL6A 2QSFX 5TISC 2FD5A 5HVQC 1O3QA 4RM2A 4KNYA 4WF2A 2QENA 3VSLA 4NXNE 3BR2A 2LMDA 2PX9A 3LWFA 5F0CA 4HEA2 2D5VA 2JZYA 2ACJA 5D4SA 3IH3A 4X65E 3ERED 3I71A 1KYWA 4B3RE 3BPXA 2X1CA 1D0XA 1HR0E 2HOAA 2DPUA 4Y17A 2Y30A 1S7EA 4PSWA 4KIFA 2VF1A 5E17F 1R36A 5L3EA 1GV2A 2TRTA 3OYJA 3BZ6A 2F5DA 2EE8A 4HF2A 3E6BA 2DA6A 2MG4A 1XGOA 1YJ9I 1F43A 1J9IA 2A5YB 2UXNA 1ZRDA 2MKNA 2LTPA 4HX8A 3KP3A 2DB2A 3KEQA 4ENNA 2RQLA 3WE2A 3ZN0A 2DFFA 2DMNA 3GLLA 1GHCA 3MMYB 3RMPA 4MHGA 5ILVA 2VB6A 1FJLA 2NYXA 3PNYA 4M71A 4LGWA 1DU6A 1WJFA 1GDTA 5HS8A 4DW6A 1ETKA 2LCEA 1WFXA 1H8AC 2JUCA 1U9NA 1TQMA 4PJNA 2RV8A 1Q1HA 1BR1A 1I3QJ 1MNMC 3EPZA 2NNYA 2NAZA 3M8JA 4YIRX 2EPNA 2HPIA 3H5NA 5E3NA 4N4OB 1ZG5A 2YRHA 1J2XA 4FX4A 1O7LA 2H6BA 4XLPF 2R93J 2ISZA 4PGGA 4G6DA 5B1AH 3ZQFA 5DV5A 3H0DA 4ZYEA 5EEAA 1Y0UA 2IAIA 5B3SH 1SD5A 1BM9A 1U5TC 1MMDA 2LUQA 4DUYE 4QTRA 1DGRM 5ERIA 1R49A 2EM3A 3K70C 2P6TA 3MVPA 4Y15A 4BJ5C 1W36C 3PM1A 4ZZLA 1ZK8A 2IA0A 1B59A 2TDXA 4U7BA 1P6RA 1USTA 1JUMA 4UVBA 1YJNI 4R1HA 4XM3A 2QSGX 3R60A 3RDIA 4U0YA 3BC8A 3S17J 4HDUA 4NBQA 4PJLA 3V7SA 2EPZA 2IVMA 1ODDA 4XRSA 3C6MA 1RC9A 1K61A 5CJ9A 4V19K 2IS1A 4CCOA 2HOTA 2E19A 4IPAA 3P9KA 5CVUA 3K0LA 2NVUB 4EGYA 4ENMA 2VBZA 2WAQN 1LB2A 2IS4A 1T56A 1ZGWA 4ZJZA 5K5RA 3DBLB 2XKOA 3LSKA 1TWCJ 3MKYB 5LHGA 1YZ9A 1JKOC 1TF6A 5HDKA 1RR7A 2WTEA 1YIJI 4Y52J 4IOAF 3CP8A 2EN8A 4DV7E 3HPZA 4D7NA 2B7TA 1KYZA 2ZXJA 3ZQCA 5TJJA 4AUXA 5F1JA 1ZARA 2EB7A 3DPLC 3HHHA 3DJWA 3VK6A 1HBXG 2WV0A 2QF7A 2VN2A 1T0FA 5CVVA 4EQQA 5F08A 1D0YA 3K4JA 3VFZA 2V7FA 1GXQA 5DYMA 3K6QA 5FD5A 3ULQB 4ZYAA 5L3GA 1I6XA 4M72A 3DPUA 1XN7A 1LJ9A 1LVKA 4QPOA 2JWOA 2ZXHA 2E5NA 2EK5A 2X85A 4MTDA 4PFPA 6PAXA 3H1CA 3BCBA 2E36A 4HLXA 5FRMA 1ZLKA 5IOYA 3SHFA 3CZ6A 4KICA 3FXRA 1A6QA 4LFCE 3JRHA 1YW7A 4E7JA 1S7OA 3TW7A 1GVJA 1BW5A 1TN9A 2FGGA 3HSRA 1NTCA 4LLNA 1JJ8C 2V88A 3WTTC 3FK6A 1HA8A 1SD7A 4BBSJ 3K69A 4IZZA 2HC5A 2E72A 4L0YB 4A12A 1U2WA 3V8LA 2P5LC 2GAUA 4N9HA 3E1SA 4XKWA 1RR8C 1V5FA 3HOTA 3TQMA 2ZFUA 4BCAA 2EFQA 2WBMA 3FXMA 4RGUA 3KYLA 3BJ6A 5GAEJ 4WPYA 5EEGA 1IAWA 4HZFA 4B48A 4BHCA 3G6EI 2EM2A 3ZQIA 5GPCA 5D5UB 3RPUD 3OV8A 4O5VA 3V8JA 3HTSB 2STWA 1KQ9A 1ZG3A 1Z7UA 3I64A 1G2DC 3QRFF 2K5CA 4HRIA 5TSEA 2X51A 3JW4A 4B47A 4F9BB 3HTXA 3LSJA 2M2EA 4WSGA 2XUBA 3W6KB 5IYBJ 2L4AA 4A5MA 4HPQA 3QU6A 2QCOA 2RQPA 4XRMA 2OCCH 2VE8A 4B44A 5LHIA 3ZMTA 2LJHA 3HSEA 4X66E 3ZQHA 5DTDA 1MKMA 2AHQA 2HR3A 2QKMB 2ZM6E 4WYQB 4PJ0C 1ON2A 2KQRA 4U88A 4NHJA 4EJOA 1UELB 3R4KA 4OIQF 1B8IA 4HEIA 2PMUA 5EZHA 3P9IA 2CJJA 1SFOJ 1HCRA 3DV8A 4A3IJ 1R00A 2FUG2 2JSPA 2CUJA 3CJQB 3KZZA 3PSFA 2EPOA 4C2MJ 5ED4A 3HG9A 1U5TB 1YRNB 1LLMC 4DBQA 3ZOQB 1S5LC 1P4XA 4CICA 3IWFA 3GUDA 1ZBQA 4AYBA 1X2NA 2KIQA 4BQQA 2ESHA 2Z16A 1XCVA 2A6HF 3GTOJ 3BROA 1MBHA 1W7PD 2E35A 2FV4B 4GKKE 1LDJA 2DT6A 3TP3A 1AWCA 5CYVA 5J6XA 3FISA 4L5EA 4HA8A 1YLFA 2DSYA 4AU7A 1ETYA 1JTYA 1TL8A 1SMYF 3A2KA 4NQWA 2HQAA 4ENKA 3JU0A 2EOIA 4XN3A 2A69F 2EFPA 3NARA 4DMIA 3L1PA 3SYTA 1JXSA 3B6CA 3HKZN 3I59A 2GM4A 1XGSA 1Z77A 3GWZA 4CYDA 1R6RA 4LG0A 2L7MP 5GAHJ 2EM8A 3SDGA 5KHDA 2M7AA 4ABZA 4BQNA 2MC5A 2JRTA 4NNJA 2ELKA 3KPHA 3KEOA 1OCOH 2J5OA 2X48A 2JSCA 4M3FA 3COAC 2W82A 3ZMUA 1EH8A 1T2KA 5BOXA 3BZCA 4E4HA 4J19A 3F72A 2R7VA 2D2WA 2L2MA 2GQQA 2JA5J 4PCQA 1UAAA 5A6KA 1NK3P 3DQVC 1FOWA 5IWAE 4CCLA 1PYVA 2ZJPF 4NC7A 1Z21A 3KE2A 5GPAA 4RB2C 4RB0A 5DUKA 2JPBA 3E6DA 5LLQA 5IT9C 1UBDC 3PO2J 3GX4X 1N25A 1DI2A 1MW7A 5IYDJ 3D0SA 4NZVA 2BVLA 2P0WA 5LBQA 1NK2P 1T4OA 3WU1B 2LE2A 2G9WA 2VXZA 3AG1H 3W6VA 2NABA 1P92A 1CF7B 5K7HA 3I4MJ 1EKZA 2DQRA 5J40A 5AE3A 3TOBA 2VBYA 5D6EA 1N33E 2EOOA 4O5GA 1OPCA 4DYCA 1YE9A 2K7LA 5JHUA 4UY8I 4RB3C 3PNVA 3RZOJ 1BI2A 3T0YA 1FYMA 1X6HA 1FMWA 3FIGA 2VLAA 4UVCA 4AD9A 2VKVA 1Z7LA 3VYTB 4A3FJ 5KK1A 2N8GA 3G3ZA 2BBGA 2IJLA 4HF1A 2E1MC 1JKPC 2EM0A 3GFLA 3BJAA 3CF5F 3G71I 5F0FA 4ZYGA 4F6MA 3HB9A 2I8DA 2BY2A 2VT3A 4NC8A 3IKVA 4KWYA 3ABUA 3CDLA 4LIVA 1T95A 1MBGA 2LVSA 2WAFA 3NWSA 1TWAJ 1X2MA 2CH0A 2HDDA 4OOGC 1AH5A 3BG9A 4XBFA 3H35A 5DCFA 2Y69H 2LFBA 4X6AJ 5IOZA 3BGHA 5M5XJ 3JREA 3WG9A 1K6YA 5D6FA 3RKXA 2A25A 3HOWJ 3ADLA 2EOHA 2UV1A 5H20A 2L9VA 2X1DA 2VODA 4DZJA 3LQRA 3HXLA 4XQFA 4I99C 1UB9A 1WJBA 3WU2C 4BJ6C 1LE8A 2QEXI 2FNPA 1BN5A 5LFAA 2EFOA 3PIOF 2V87A 1Y8RB 2R7FA 3VODA 2BY0A 3JAMZ 5D5WB 3VSKA 1GQEA 4KT5C 5FKKA 2EMZA 2MD5A 3ABTA 2EOSA 1ACIA 3EPJA 2VUMJ 5BQTA 4R03A 4S0HB 2YTFA 5DCMB 2ESNA 3GTGJ 1O0WA 2ENHA 1ULYA 2YSOA 3SEZA 3WTYC 4UV8A 1OJLA 4HAMA 1I39A 2LV2A 1VQLI 5K5OA 4IHYA 5CVRA 1A1KA 3FIWA 1FSHA 2MGQA 4R8HA 2E7XA 1AKHA 2WBSA 2Z99A 3QPHA 3JRIA 1HC8A 2E7WA 2KLOA 3FXLA 2JYAA 2NUFA 2VQGA 4LU9A 1PDAA 2DT7B 1I1GA 1I1SA 1X3ZB 1TC3C 3K4BA 1OISA 3LA3A 2X1EA 4MO7A 5D5XB 1X5WA 2XGEA 4A0XA 2L2NA 1HOMA 5KAFC 2BXZA 2CW0F 4BQAA 3E97A 4DYRA 5LHHA 1K79A 1PKPA 2FOKA 2FMLA 4RAYA 2UXCE 1ORKA 5CKTA 1QRYA 2CSHA 4XNFA 2EFNA 3WGHA 1LE8B 1MSFC 2EQRA 5HLIA 1SANA 2RS7A 3J80K 2OQRA 3LMMA 2LSOA 2ELHA 3K70D 1W36D 2EH3A 2OF7A 2I5UA 3C2GA 5FO5A 1PUFB 4A93J 3OYFA 4L5IA 3ABMH 3JAMC 2UXDE 4KIBA 4BHBA 1TT5B 2VONA 4Q48A 2DMPA 2QZ8A 4ZC3A 3HZJA 2ID3A 4GKJE 5M5YJ 3D5SC 3AL0C 2VBWA 1WQ2A 2YX7A 3EUHA 4LF6E 5J1RA 1VTNC 3M8FA 1AKHB 4M6YA 4BUPA 1HKTA 2CWEA 1TQIA 3QPTA 2XPUA 3TEDA 2GXAA 5F6FA 3JTZA 1XSDA 2P4WA 3E7LA 1STZA 1EF4A
chains in the Genus database with same CATH topology
2X4HA 4CXFA 2ZO4A 3HRMA 1K6OA 1UCRA 1TTYA 3KP2A 4WK8F 1ZREA 3TKYA 3K1MA 2F5CA 1DDNA 2ZNZA 3U2RA 4ON0A 2PEXA 5BS6A 1OKRA 2OZ6A 1MDMB 2QBYA 4OOIA 1F9NA 4U0WA 3WTZA 2XAGA 2E1CA 4ENJA 1EV7A 2W84A 3GYHX 3TO9A 4HDVA 5E1WA 4L18B 1OMIA 1BJAA 1MD0A 2BBYA 4KN4X 2O0YA 4UXNA 1XMKA 2NRAC 3F6VA 1FY7A 5E18F 2KIFA 4RB1A 2M45A 3V7RA 4L9TA 2KJBA 5J8FA 2UWMA 3M9AA 3JSPA 5BPDA 4YIFA 4IJAA 2GZWA 5E20A 2QBYB 5HS9A 3S2WA 4KMFA 2L4MA 5ICGA 4G7HF 4WXDA 1SD4A 4Q4ZF 1HKQA 3T8RA 3F8BA 4GYGA 2HDCA 4OMYA 2ZCWA 4XRFA 4KYWA 2D1HA 3Q9SA 1G3WA 1OR7A 3WTWC 1FBQA 1MGTA 3TGNA 1LEBA 2OD5A 2PQ8A 4UUVA 2FBIA 2P8TA 2QQ9A 3O6BB 4GYIA 3LA2A 4EM2A 5HOOA 2KKOA 4Q47A 1IUYA 3DP7A 1R5HA 2EWNA 4LLLA 2FBHA 4KFCA 1B4AA 3D5LA 4UNOA 4UVAA 1ON1A 1XSVA 4N9IA 2K27A 2Y48A 1RI7A 5LRSA 2WWYA 4LB5A 1WSUA 2DBBA 2OBPA 4WXCA 4QLCU 5JR3A 2HQNA 4LMYA 2XIGA 1TW2A 2A61A 2Y0MA 2XAFA 4M6XA 4OU0A 2QLZA 4I02A 3H3UA 1OYYA 2ISYA 2PLYA 5FB2A 2VOPA 1S3JA 2LKPA 3F23A 1R5GA 4IRIA 1GXPA 3O2PE 3ZMVA 3HRTA 2P7CB 3HUGA 2V1DA 1MJBA 1B1BA 3BDDA 1FWZA 3CUQA 1BIBA 3I53A 2VE9A 2H94A 2DT5A 5ICEA 1B9MA 3QAHA 2PI0A 4MNUA 1P2FA 4ESBA 3C1DA 4A0YA 1S6LA 2RVCA 3MZYA 1UHWA 3E6MA 5IT9K 1YS7A 1H9GA 2STTA 3C3WA 3GZ5A 1Z6RA 1RUNA 2IRFG 2HWVA 1R22A 3RTRA 3BOQA 2A3SA 2FBKA 4HV6A 2LNBA 2L54A 3GFIA 1EH7A 1J0RA 1X3UA 3ECHA 2PFBA 1K7AA 3IHUA 1Z1DA 1H9TA 2P6SA 3SZTA 4WX9A 3FMSA 1G3TA 4HQEA 4YG2F 5JFRA 1WWXA 3BWGA 2VBXA 3WGGA 2L01A 2XAJA 4L9NA 1BBYA 1W5TA 2ZJ2A 1PUEE 4BAYA 1J7KA 1MJ9A 1ZYRF 3HHGA 1WKMA 1FSEA 1D8JA 1JGSA 3U9GA 3V8KA 2CQKA 2ZBKA 3CJNA 1D3YA 1KU3A 3TDZC 3VEPA 2XGXA 3WTVC 1O57A 1DPUA 3ZPLA 4OIRF 1HSTA 3NQOA 2JT1A 5A2QZ 1FP2A 2CYYA 2FMYA 2C6YA 3IL2A 3R61A 4JQFA 2FXAA 1ZGJA 3KCCA 5IT9Z 5D5VB 3DFGA 3CTAA 1YTYA 3E3VA 2BV6A 4PZJA 4EJVA 3N97A 1O3TA 1G3YA 1ZN2A 3RYPA 4OINF 3IKTA 3JAMK 4DNCA 4G6QA 1FX7A 4MEYF 3SQNA 4BH9A 3JSOA 1RZ4A 1FLIA 1LVAA 1XSXA 3J7AO 5D4RA 1KA8A 3V4GA 2OQGA 5H6RA 1LDDA 2DPDA 3CO7C 4S04A 2XRNA 3P7NA 3E6CC 1HW5A 2Q2EA 4OMZA 4BHPA 5FLXZ 2D45A 1QPMA 4L9VA 1XMAA 2HGCA 4EMSA 2LDUA 1QZZA 3L7WA 3K1NA 1C0WA 5LEKA 5AONA 4G9YA 2Q8KA 1MZBA 3B02A 3I59B 1P4AA 1Z6TA 2XKPA 4LG0B 4M73A 1BC7C 2CSOA 2XHKA 4IRGA 2GXGA 4U7DA 2EV5A 1V3FA 3FMRA 3PQKA 3F8CA 2UZKA 1OYIA 3BPVA 4M74A 1ONVA 1REPC 2G7HA 2DLLA 1T38A 3LAPA 2YSRA 4E70A 1OYWA 2HYFA 2K86A 3KP5A 2Z9OA 1U8RA 1LQ1A 4LLGF 2H6CA 1F4KA 1SMTA 3BP8A 2NNNA 2HQRA 2M87A 3GFMA 2E1NA 2DFIA 3H92A 3IRRA 2GIVA 4I0AA 4KUMA 3SXYA 2XV4S 4LJZF 4CHUA 1E2XA 1O3RA 4MQVA 2CFXA 5F64A 2IT0A 3DEUA 1QGPA 2ADUA 1IZ1A 3LA7A 1IRGA 3BJOA 3FMQA 1ZRCA 4ASNA 4EJUA 1IN7A 3RPQA 5IT3A 4IHSA 3WODF 4Y13A 1SFUA 2A6EF 1FPQA 1JHFA 2FNAA 2P7VB 2ETHA 5F1RA 3ZQ7A 3TOAA 1YIOA 3GFJA 4HOBA 4HYEA 2OZUA 3RIRA 4GCVA 2M5WA 3FXQA 1B6AA 1H0MA 4I09A 2HFHA 3QP6A 1T39A 3E5XA 2ZMEA 2OU2A 3HIFA 5DD8A 4LK1F 1O3SA 4H0EA 4I2OA 2YX4A 3HYIA 3MCZA 1ZAOA 3FX3A 3F21A 5D8LB 2XASA 2D1VA 1KU7A 1QO0D 2OAZA 3CUOA 4M9SA 3WU0A 2VC0A 2NS0A 3RYRA 4ZYDA 3FWEA 4ZH4F 1XCBA 2HKXA 2ZNYA 3NRVA 1FBSA 3H3ZA 3KLNA 2V9VA 3WGIA 2BYVE 1R7JA 3KETA 1WRJA 2UXXA 2RC4A 3F8FA 2RGVA 4HBLA 2RNJA 3F3XA 1YW9A 3MFKA 3Q5FA 1I5ZA 4B8XA 2HOEA 2MLGA 1S8NA 2X0LA 4RAZA 2MH9A 4EJWA 3DPTA 4RGRA 4P9UA 3GVAA 4MEXF 3K1PA 4KA4A 4I7HA 2DTRA 5FFXA 2IA1A 4CGZA 1HW1A 3HRUA 4BNCA 2PN6A 5L3BA 4P55A 2QYOA 4EVIA 3K9TA 5FFZA 3ROUA 1W5SA 2FRHA 2H09A 1XDSA 4HX7A 1T6SA 2CG4A 4O6JA 2XAQA 2A68F 4AIJA 2L02A 3CLOA 4ZZDA 2LF7A 5D8KB 1U3EM 4GXOA 4YIIA 3TQNA 3T8TA 4P96A 1NHAA 2HKOA 2RDPA 1G4DA 3RPUA 3IWZA 1LEAA 1IF1A 1FZPB 4Q5SF 4IRHA 3R0JA 1ZG1A 2BGCA 1TQPA 2F5FA 1AOYA 3C7JA 1IRFA 3E5UA 5FGMA 2ZFWA 1RUOA 2Z3YA 2FA5A 3K2ZA 3WE3A 4D0PA 5LRRA 2DK8A 5CVJA 4N0BA 1W7PA 4JBAA 1G6NA 1KU9A 4A6DA 2PMHA 3DKWA 2K4JA 1KGSA 3JTHA 4EGZA 2RKHA 1B9NA 1SFXA 1BC8C 3QOPA 3G73A 1BI3A 3NEUA 2GA2A 2LF8A 4A0ZA 2VOOA 4AWXB 3HOSA 5BMZA 1ZRFA 3MWMA 4TV7A 1LDKB 2W24A 4FX0A 2O03A 3WTXC 3FXUA 1DUXC 4L0ZB 4JK1X 1W7PB 5ICFA 1TLHB 3T1BA 2JPCA 4G7ZF 3C18A 2IPQX 3M7GA 5L3FA 2G7UA 3RI4A 4KMUX 2L3DA 4RGXA 5A2QK 2FE3A 2R7DA 2QQAA 4R79A 3SFZA 3Q9VA 2M30A 4QWQA 3W6JB 2XAHA 3RJPA 5HLGA 5JI6A 3HRSA 1Z9CA 4BXUA 3L00A 3CUQB 2O6GE 2HZTA 2EV6A 2ZKZA 3MZHA 2Z5UA 5EEHA 5CLSA 4MQ9F 2KRFA 3E5QA 3R0AA 4YFKF 4HV5A 5HS7A 2A07F 2QQBA 3T5XA 4YFNF 1IW7F 4OIOF 3FM3A 2FQ3A 3GLXA 4UHTA 4LK0F 3HTUA 4RS8A 5JVTA 1IXCA 1YG2A 4G7OF 2QUFA 3AAFA 5FD6A 1WI9A 3ECOA 5FLXK 2WC2A 3FZVA 2Y75A 1XB4A 2EA4A 2V1XA 3GO5A 3FM5A 1HXDA 2IW5A 1SFEA 1HW2A 4S05A 4A6EA 1U5TA 3KP7A 4XSXF 2HTSA 1R23A 1YO5C 1J5YA 4G94A 4KN7X 4LD5A 5L3CA 3WTSC 4KIGA 2HS5A 3KZYA 1KQ8A 4A2UA 3QU3A 2FU4A 2W85A 1ZLJA 3KFWX 2VC1A 1G3SA 3PFIA 1QQIA 3P9CA 2PBIA 1HKSA 2XVCA 1J75A 4CDGA 4FT8A 3GXOA 4G8XA 2MBFA 1HSJA 4EM0B 3R6SA 3VB2A 5DDGA 2VT2A 5AIPA 4I98B 1SAXA 3EYYA 2R3SA 1F1ZA 2W25A 4IF4A 4LFUA 3FHZA 3FF5A 1D8KA 1CF7A 2M1BA 3TO7A 1YFHA 5ICCA 1J59A 4U0VA 2MA3A 4ZYHA 3RKWA 5HLHA 2O61A 2XROA 1XDUA 1JHHA 3ZMZA 5K1YA 3ELKA 2HTJA 2JTVA 1PP8F 3RKYA 4WWCA 4F7ZA 2MC3A 3LSTA 3CDHA 2DU9A 2COMA 2IP2A 2V1UA 1E17A 2EJRA 2P5VA 1TW3A 4HLYA 4L9JA 1R1VA 1ZH5A 3LFKA 2P5KA 2RN7A 4OIPF 1FYLA 3EYIA 5LEJA 1L0OC 1D5VA 1A04A 5BPIA 2EA2A 5HDNA 2W57A 2GXBA 1TNSA 2J5PA 3B73A 3I4PA 5L3DA 3VOEA 1FNNA 2DK5A 5DCMA 1MJAA 2QVOA 2DO7A 2QM3A 1ZHFA 4L5JA 5KVRA 5LGNA 2IA2A 3BY6A 3DF8A 3IC7A 4IVNA 5E8GA 1QNTA 1IXSB 1FT9A 5DEQA 2F5EA 3I58A 4BYYA 5K5QA 1FYKA 2F2EA 3L2CA 2DI3A 1PP7U 5E8IA 2K4BA 5AIQA 4B09A 3LAJA 2O8XA 1FBUA 2B0LA 3GZ6A 3F6OA 4ESJA 3TO6A 1R1UA 3M8EA 3L9FA 5DD4A 1XGNA 1FC3A 1TBXA 3GEZA 1UFMA 5TRDA 4EJTA 3TDUC 2DAOA 2KJCA 4GO1A 1RIOH 2HEOA 3MEXA 1XD7A 2FF4A 3EDPA 3KP4A 3PQJA 4K2EA 1S29A 5LGTA 1RNLA 3GF2A 1MDMA 5CVIA 3N4MA 1Z05A 3EETA 5DUIA 2H27A 1PDNC 4I0BA 4M9XA 2AXLA 1XGMA 4RGSA 3ZP5A 1S7AA 1SD6A 4PDKA 2HYGD 2CGPA 5E1ZB 4O3MA 3I0TA 1JE8A 1U78A 4WCGA 3SZPA 2DQLA 2MLKA 2PJPA 2KIMA 4A5NA 3F8NA 2V79A 3O3KA 4HF0A 2V6CA 1USSA 5ILSA 1T98A 1U6GA 4LB6B 1I27A 5LGUA 1W4MA 5H6QA 3JTGA 1R58A 2ZMEB 3QP5A 2YU3A 3REOA 4AIKA 5E1XA 5HDGA 1K78A 4XSZF 3GW2A 4UV9A 1IN6A 4PGHA 4M9ZA 1QBJA 1IN5A 2Z33A 2KIUA 2OA4A 1EH6A 4HW0A 1KQ0A 3J81K 5J8CA 3V7CA 4EM1A 1HQCA 4HX4A 4IXAA 1L3LA 2BEOA 3KLOA 3EQLF 1IN4A 2QWWA 4ETSA 1BIAA 3ML6A 4P9FA 4AIHA 3J80Z 1O7FA 1K78B 4Z2YA 3HSFA 2GWRA 1FP1D 2CO5A 3LQQA 1Z91A 1YQAA 4P5OA 4FHTA 2MH2A 4DQ2A 3I54A 4KDPA 1YS6A 2GA1A 3ISPA 4EV0A 3L09A 5ILUA 4CZZA 1ZGAA 2Q0OA 1F5TA 2DW4A 3U1DA 4CO8A 3WTUC 2BE5F 2PG4A 3CUQC 2M8EA 3DXJF 4AVPA 2FEZA 1V4RA 1P4WA 3ZMSA 1R1TA 1CGPA 4GGGA 2EV0A 1YW8A 2FSWA 3ZMDA 4HQMA 1KU2A 3KP6A 1BOAA 3I5UA 3OOPA 1DP7P 3F22A 1BI0A 4NB5A 3M1EA 2K02A 3CO6C 2AS5F 1DPRA 3ZN1A 4MGRA 3IRQA 3F8MA 4I01A 1UHMA 2YR2A 1IN8A 1BI1A 3MQ0A 2O3FA 4IHTA 2YPRA 1IXRC 4WXHA 3MAJA 3J81Z 4XLNF 1YYVA 2EFWA 1LNWA 4MTEA 4ESFA 1TNTA 1FOKA 4YFXF 1QZYA 5HVQC 1O3QA 4KNYA 4WF2A 2QENA 3LWFA 2JZYA 2ACJA 5D4SA 3ERED 3I71A 1KYWA 3BPXA 2DPUA 4Y17A 4KIFA 5E17F 1R36A 5L3EA 3BZ6A 2F5DA 4HF2A 3E6BA 1XGOA 1J9IA 2A5YB 2UXNA 1ZRDA 4HX8A 3KP3A 3KEQA 4ENNA 3WE2A 3ZN0A 1GHCA 4MHGA 5ILVA 2NYXA 4M71A 4LGWA 5HS8A 1TQMA 2RV8A 1Q1HA 2NNYA 2NAZA 1ZG5A 1J2XA 4FX4A 1O7LA 2H6BA 4XLPF 2ISZA 4PGGA 4G6DA 5DV5A 4ZYEA 1Y0UA 1SD5A 1BM9A 1U5TC 5ERIA 2P6TA 4Y15A 4ZZLA 2IA0A 1B59A 2TDXA 4U7BA 1P6RA 1USTA 4UVBA 4R1HA 3R60A 3RDIA 4U0YA 4HDUA 3V7SA 2IVMA 1ODDA 5CJ9A 4IPAA 5CVUA 3P9KA 3K0LA 4EGYA 4ENMA 2VBZA 1LB2A 5K5RA 2XKOA 5LHGA 5HDKA 2WTEA 1KYZA 2ZXJA 5TJJA 1ZARA 2EB7A 3DPLC 3HHHA 1HBXG 2WV0A 5CVVA 2VN2A 1T0FA 4EQQA 3VFZA 1GXQA 5DYMA 5FD5A 3ULQB 5L3GA 1I6XA 4M72A 1XN7A 1LJ9A 4MTDA 2EK5A 6PAXA 4HLXA 1ZLKA 3SHFA 4KICA 3FXRA 1YW7A 1S7OA 1GVJA 3HSRA 4LLNA 3WTTC 1SD7A 3K69A 4L0YB 4A12A 1U2WA 3V8LA 2P5LC 2GAUA 4N9HA 3HOTA 2EFQA 4RGUA 3BJ6A 5EEGA 1IAWA 4HZFA 4BHCA 5D5UB 3OV8A 4O5VA 3V8JA 3HTSB 2STWA 1KQ9A 1ZG3A 1Z7UA 3I64A 3QRFF 3JW4A 2XUBA 3W6KB 2L4AA 4A5MA 3QU6A 2RQPA 2VE8A 5LHIA 3ZMTA 3HSEA 1MKMA 2HR3A 1ON2A 4U88A 4NHJA 4EJOA 3R4KA 4OIQF 2PMUA 3P9IA 3DV8A 1R00A 3KZZA 5ED4A 1U5TB 1P4XA 4CICA 3IWFA 3GUDA 2ESHA 1XCVA 2A6HF 3BROA 1W7PD 1LDJA 1AWCA 5CYVA 5J6XA 4HA8A 1YLFA 1SMYF 4NQWA 4ENKA 2A69F 2EFPA 1JXSA 3I59A 1XGSA 3GWZA 4CYDA 4LG0A 2JRTA 3KEOA 2J5OA 2JSCA 3COAC 3ZMUA 1EH8A 1T2KA 5BOXA 3F72A 2D2WA 2GQQA 4PCQA 3DQVC 3KE2A 4RB2C 4RB0A 5DUKA 2JPBA 3E6DA 5LLQA 3GX4X 3D0SA 5LBQA 3WU1B 2G9WA 2VXZA 1P92A 1CF7B 2DQRA 3TOBA 2VBYA 5D6EA 1OPCA 2K7LA 5JHUA 4RB3C 1BI2A 3T0YA 1FYMA 4UVCA 4AD9A 5KK1A 3G3ZA 2IJLA 4HF1A 3GFLA 3BJAA 4ZYGA 2VT3A 3IKVA 3ABUA 4XBFA 5DCFA 3WG9A 5D6FA 3RKXA 5H20A 2VODA 3LQRA 1UB9A 2FNPA 1BN5A 2EFOA 2R7FA 3VODA 3JAMZ 5D5WB 4KT5C 2MD5A 3ABTA 5BQTA 5DCMB 2ESNA 1ULYA 3WTYC 4UV8A 4HAMA 5K5OA 5CVRA 1FSHA 4R8HA 2E7XA 2Z99A 3QPHA 2E7WA 1I1GA 1I1SA 3LA3A 5D5XB 4A0XA 2CW0F 4BQAA 3E97A 5LHHA