3L00A

Crystal structure of benzylated snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
156
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SNAP-tag
total genus 47
structure length 156
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l00A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3l00A01
2D1VA 1XMKA 4EGZA 2YU3A 2PBIA 3Q5FA 1U5TB 1UCRA 2MBFA 2L54A 1QQIA 1U2WA 2QQ9A 5TRDA 3V4GA 2HGCA 1B4AA 2K4BA 1ZHFA 4EJTA 4BXUA 2JZYA 3GEZA 1R00A 2V6CA 3J81Z 2OU2A 3FXRA 4RAYA 1FPQA 4YFXF 4R8HA 3I4PA 3CJNA 3J7AO 1P92A 3QRFF 2QBYA 4JQFA 1ZREA 1Q1HA 3M7GA 2O03A 2HTSA 5FO5A 4Q4ZF 2ZJ2A 2KKOA 3ELKA 2JPBA 1QNTA 3ROUA 3R60A 1OYYA 4OMYA 3R4KA 4LMYA 1Z05A 3GXOA 1EH8A 2J5OA 5EEHA 1LNWA 1TW2A 5LHIA 5DCMA 1IN6A 1USTA 3E6BA 1TNSA 2M5WA 2KIFA 1JGSA 2JRTA 2XAGA 4HZFA 5FLXZ 1ZG5A 2VXZA 2LF8A 3N4MA 3KE2A 1R5HA 4E70A 3EUHA 4KICA 3RPUA 1GXPA 4HLYA 4YIIA 2ZMEA 3MFKA 4IVNA 4M9XA 5DUKA 3I53A 3IRRA 3E6CC 3C7JA 4LB6B 2GXBA 4LLGF 3BP8A 4LB5A 2IW5A 2EA4A 4GGGA 2NNYA 4O6JA 2CFXA 1ZARA 3WTUC 1YS7A 4BAYA 1A04A 1YTYA 1DPUA 2L3DA 2H27A 2BEOA 4EM2A 4PCQA 1TBXA 3ZPLA 1OYWA 3RI4A 3BJAA 3FZVA 4ESFA 1FT9A 3QOPA 2MLGA 4BHPA 1Z7UA 2ESNA 1BC7C 5H20A 5DV5A 3CO7C 3IWFA 3L7WA 2PJPA 4Y17A 3J81K 1OMIA 2LDUA 2HYFA 1XDUA 1FNNA 3HRMA 2VT3A 1OR7A 3DPTA 5D4RA 2OD5A 4I98B 1WI9A 3LA7A 4QLCU 1KU2A 1Y0UA 2P5KA 4MEYF 5CJ9A 4LK1F 2FA5A 3K1PA 3HSEA 3HSRA 4UV9A 2DFIA 2JTVA 3GZ5A 1IXCA 4OU0A 4ON0A 1LDKB 1W4MA 2STTA 4LFUA 4MQ9F 4MHGA 4UVBA 3RDIA 4H0EA 1BI3A 1SD4A 1O3RA 2RV8A 2FQ3A 5HVQC 4RB2C 5FFXA 2ADUA 2EFPA 4ZZDA 1GHCA 5ICFA 3M1EA 3J80K 2GQQA 2PLYA 1O7FA 2G9WA 1QZYA 2AS5F 3KP3A 3K1NA 4ZH4F 4PDKA 2A5YB 3JSOA 1FYKA 1ZLJA 2MH9A 5LGUA 1R5GA 5ERIA 4WK8F 3TDUC 4BQAA 3K9TA 3ZN1A 2O0YA 3R0AA 1MZBA 2CWEA 2G7UA 2FF4A 2K27A 2ZO4A 3JW4A 2RC4A 1PP8F 1G4DA 5D8LB 2OQRA 5L3EA 1YW7A 1ZN2A 4RGRA 3HRTA 1BI2A 2IJLA 4GCVA 1SAXA 2QZ8A 3R6SA 1MDMA 3MWMA 4R1HA 3L9FA 5HS8A 3RIRA 3EYIA 3OV8A 4B09A 2F5DA 2O6GE 2K02A 2A68F 5CLSA 1BJAA 3QU3A 5H6RA 5BPDA 4YFKF 2MH2A 5HDGA 3KP2A 4ESBA 2ACJA 1ZGJA 2A61A 4XBFA 1S7OA 2W25A 1MJBA 2CG4A 1KA8A 2E7WA 2UWMA 1FX7A 2HTJA 2CGPA 4A6EA 3RKYA 2R7DA 4LG0A 5D5UB 1KU7A 2A07F 2DQRA 4Q5SF 2H09A 1IRGA 4P9FA 3DPLC 4RB0A 4CICA 1Z6TA 2EK5A 2ZBKA 3E5UA 4RS8A 2LKPA 1DPRA 1WQ2A 4JBAA 1DUXC 2J5PA 1DDNA 2QLZA 3ULQB 1IXSB 1IW7F 3BZ6A 2ZMEB 2HQNA 3DKWA 5D5XB 4KMFA 2IA2A 3I59A 5LEKA 4L0ZB 3IC7A 4OIQF 4HDVA 3PQKA 4GO1A 4KA4A 2F5EA 3ECOA 3JAMK 3FXQA 1SD5A 2XUBA 2IRFG 5ILUA 1F9NA 3CUQC 4KT5C 5F64A 2FNPA 5F1RA 2STWA 3ABTA 1TQIA 3F3XA 3J80Z 3G3ZA 1I1SA 2VODA 1U6GA 1RUOA 5E17F 5D4SA 3LFKA 3WODF 3IRQA 1ZH5A 3LA2A 4HF0A 1R1VA 4G94A 3V7SA 3ZP5A 4L18B 2GAUA 1FYMA 2VBYA 2F5FA 2LF7A 2E1CA 3C1DA 2O61A 1R7JA 1CF7B 2P5VA 4RB3C 1SD6A 4IF4A 3ZMVA 4HBLA 1D8JA 2K4JA 1FP1D 3HOTA 1K78A 2OBPA 1P6RA 3KP7A 4RGXA 1BBYA 4AIHA 1USSA 2M30A 3MQ0A 2YX4A 1FZPB 5KK1A 1T0FA 2B0LA 4R79A 1RZ4A 5ICCA 2YR2A 4U7DA 3HUGA 4BH9A 1TLHB 3U2RA 3KP6A 2M1BA 2A6HF 1SD7A 5J6XA 1ONVA 4FT8A 3HOSA 1HKSA 2VOOA 1XSXA 2VBWA 2MA3A 1F4KA 1LVAA 2EV5A 3ZN0A 2A6EF 3EDPA 3ERED 5FFZA 3WE3A 5JVTA 3WU1B 1EV7A 2DK5A 3Q9VA 4KYWA 1R22A 3U9GA 1XDSA 3E5QA 5JFRA 2P8TA 1HKQA 2Z5UA 1Z6RA 4L9JA 1U78A 1WKMA 4EQQA 1R23A 4A0ZA 3R61A 2RNJA 4HQEA 4I01A 5BPIA 1G6NA 2QWWA 1K7AA 2DO7A 3MCZA 5ILSA 5LBQA 3TO7A 2M8EA 3IKTA 1L0OC 5L3BA 4A6DA 2OQGA 3REOA 1I5ZA 5L3CA 1YIOA 2OAZA 3BDDA 4A2UA 3JAMZ 3T8RA 3M8EA 4OIPF 3HSFA 2A3SA 4KIBA 1W7PB 2ZKZA 3W6KB 1JE8A 4EMSA 3I71A 5FD6A 3M9AA 4LJZF 1R1UA 5D5VB 4XSZF 2ZNZA 2RN7A 3VOEA 1V4RA 3WG9A 3TGNA 4L5IA 2H6BA 4ZYEA 3SFZA 4JK1X 3TO9A 1LJ9A 2XKPA 5D8KB 3ML6A 2ZFWA 4ESJA 3K0LA 3GFMA 3C18A 3TDZC 4AVPA 1I6XA 2ETHA 2Q2EA 2Z99A 5HLHA 3ZMUA 2ZXJA 3HHHA 3F22A 2DPUA 3DV8A 4GXOA 4L0YB 4WX9A 2HFHA 2DLLA 1LDDA 3GFJA 2RQPA 2V1XA 2EJRA 3I54A 3P9KA 3COAC 1XB4A 3FWEA 5L3DA 1IAWA 4KN7X 5ED4A 1K78B 3RKXA 3ZMSA 3T1BA 1XSDA 4HLXA 3LQRA 3MZYA 1I1GA 5KVRA 2XASA 1CF7A 1ZRFA 2BV6A 3WE2A 4BNCA 1S6LA 3H3UA 3MAJA 4RGSA 3RYPA 3FHZA 1AOYA 5AIPA 3C3WA 3HIFA 2FMYA 2FBIA 1O3SA 4ZZLA 2FBKA 1MGTA 2GIVA 3LAJA 2Z33A 1MJ9A 4Y15A 3QPTA 5E20A 2ISZA 2VE9A 3P9IA 5HS7A 1FBSA 5BOXA 3WTSC 5F6FA 2DI3A 3E97A 3FM5A 5D6FA 3WTVC 1LQ1A 1XN7A 4LGWA 3FX3A 4M74A 4U0WA 3ZQ7A 2HR3A 3F8CA 4XLNF 1T39A 1FBUA 4A12A 2Y75A 4KIFA 1FOKA 2XAHA 5HDKA 4BYYA 5LHGA 4IRGA 5LEJA 1ZGAA 1YFHA 2FU4A 4UVCA 4HA8A 1IN4A 5LGTA 4AWXB 1F1ZA 4HW0A 2XGXA 4HX8A 5IT9K 2IA1A 4HF2A 1H0MA 2QBYB 2O8XA 2EFOA 2HEOA 3EETA 1J2XA 2EFNA 1HBXG 4M72A 4LG0B 4EJOA 3I58A 5H6QA 4IHSA 2OA4A 2CYYA 2JT1A 3HHGA 1W5SA 3DEUA 4G7OF 5A2QZ 5FGMA 3WTTC 2Y0MA 1F5TA 2HWVA 2VC0A 4AD9A 3T0YA 5HS9A 3FXUA 4HF1A 1U5TA 2OZ6A 4UXNA 1P4WA 1ON2A 3BPVA 3QAHA 2XROA 1T2KA 4I02A 1TTYA 1S7AA 1G3YA 2HOEA 4XRFA 4A0XA 2P5LC 3HYIA 3I64A 3KP5A 2QYOA 1R58A 5E1XA 1VTNC 4ETSA 3MZHA 4IPAA 2XAFA 2W24A 4IJAA 3G73A 4RGUA 1LEAA 2L01A 5BMZA 1JHHA 4L9VA 3RTRA 4WCGA 2Z3YA 2P7CB 4PGHA 4PGGA 2VONA 3E3VA 1IN8A 5AIQA 1ZRCA 1PUEE 4KN4X 3VB2A 1KU3A 1JHFA 2BYVE 3QP6A 4EM1A 2E1NA 4HYEA 5E18F 5CVIA 1S29A 1MD0A 3F8FA 1E2XA 2Q0OA 2QQAA 3KP4A 4HAMA 4RAZA 2DU9A 5BS6A 1S3JA 3CLOA 1XMAA 3RKWA 3V7RA 1IZ1A 2DAOA 4CDGA 2FSWA 5DD4A 5K5OA 1XD7A 1O57A 4U0VA 4I7HA 2R7FA 3BPXA 4M73A 2EB7A 2F5CA 3W6JB 3V8LA 2PI0A 3WGGA 4KFCA 1IRFA 4CYDA 4FHTA 4MTDA 1KQ8A 4G6DA 3FMQA 1YS6A 4WXDA 4HOBA 3HTUA 3CUQB 1SFEA 1G3TA 1BIBA 3GX4X 5IT9Z 3NQOA 4MQVA 2M87A 4EM0B 3F8NA 4FX4A 4I0AA 4HX7A 2K7LA 5K1YA 1CGPA 1XCBA 3WTZA 4OMZA 4Q47A 3LQQA 1V3FA 2EV6A 4BHCA 2TDXA 2QM3A 2IPQX 2EFWA 2F2EA 4EGYA 1SFUA 4IHTA 4BHBA 1RI7A 2EA2A 3WTYC 1FC3A 2HYGD 2KJBA 4KIGA 4XSXF 1ZLKA 3E6DA 5E1ZB 1HW1A 5AONA 1D3YA 2P6TA 3ABUA 5L3GA 3GFLA 1FLIA 1QO0D 4G6QA 5EEGA 4UUVA 3IWZA 4WF2A 4M71A 3KEQA 2IVMA 4OOIA 3RJPA 1J9IA 3GYHX 3F8BA 1U8RA 2UXXA 3SQNA 2C6YA 1TQPA 2AXLA 2VT2A 4CZZA 4YIFA 3CO6C 1Z91A 3DF8A 3I59B 2PFBA 1QPMA 3FMRA 3HRUA 2HDCA 3O3KA 2JPCA 4MGRA 1O3TA 2DK8A 5LRSA 1HSTA 3ECHA 5IT3A 2XAQA 3KCCA 5CVRA 2HS5A 1EH7A 3F6VA 5DYMA 1B1BA 4P55A 2JSCA 2EV0A 1XGNA 1BN5A 1J7KA 3SHFA 5JHUA 1SFXA 3GUDA 4MTEA 3F6OA 4N9IA 1FWZA 2QQBA 3B02A 1AWCA 5LGNA 2GA1A 1UB9A 3JTGA 2E7XA 2RKHA 1FSHA 3IL2A 4UVAA 3T8TA 3I5UA 2L4MA 2UXNA 2VBZA 2ESHA 1W5TA 2P7VB 4K2EA 1IF1A 4QWQA 1YO5C 1T98A 1C0WA 4CHUA 2KRFA 3GW2A 3ZMTA 1T6SA 4A0YA 2WTEA 4XLPF 2WWYA 1QGPA 2DT5A 4M9SA 1D5VA 3BROA 3Q9SA 1RUNA 2BE5F 2VOPA 2HKOA 2V1UA 1B9NA 2D45A 2D1HA 2VN2A 4KDPA 4HV5A 2CO5A 1YYVA 1MJAA 4Z2YA 1W7PA 1HQCA 5ICGA 2IT0A 4HDUA 2IP2A 2ISYA 4U7BA 1YW9A 3N97A 2PQ8A 3DXJF 5HOOA 1LEBA 1FBQA 5D6EA 1D8KA 3LSTA 1BI0A 4U0YA 3F21A 3V7CA 2XHKA 3H3ZA 3RYRA 4OINF 2X0LA 1H9TA 2NAZA 2W84A 1IN7A 3BJ6A 2DBBA 4CGZA 1HXDA 4G7ZF 3BJOA 5BQTA 4I09A 3B73A 2P4WA 4M6YA 2ZCWA 1ZAOA 3JSPA 3HTSB 3VFZA 4EVIA 2P6SA 1H9GA 1BC8C 1RIOH 3TQNA 3I0TA 2NYXA 5JR3A 2FMLA 4LLLA 4O3MA 1UHWA 2PMHA 1LB2A 2WC2A 4DNCA 2BGCA 1OKRA 2FBHA 4HV6A 3E5XA 2CQKA 1P2FA 5LLQA 2FOKA 5CVUA 2QUFA 3LA3A 2PG4A 1B59A 3BOQA 3PQJA 2DTRA 2CSOA 4N0BA 4EJWA 3GO5A 2NNNA 5DD8A 3U1DA 4KNYA 4IRIA 3DQVC 2NS0A 2ZNYA 2GXGA 3P7NA 1FY7A 2EWNA 1STZA 3VEPA 2MC3A 4FX0A 5K5RA 1PP7U 3GZ6A 1OPCA 1P4AA 2HQRA 2LSOA 3AAFA 2KJCA 1TNTA 2DQLA 1XSVA 3GFIA 2O3FA 5ICEA 2VC1A 3V8KA 3M8FA 4EJVA 5HLIA 3L2CA 2UZKA 1O7LA 4L9TA 4HX4A 4UNOA 3WU0A 3SXYA 2QVOA 4WXCA 2HKXA 1MKMA 2MD5A 2YPRA 1L3LA 4ZYGA 1U3EM 5J8FA 1KQ0A 4A5MA 5CVVA 4AIJA 3NEUA 1IN5A 1PDNC 2YSRA 5E8GA 5DCMB 4KUMA 1ULYA 2HZTA 1FSEA 4MNUA 4GYGA 2VE8A 1BI1A 2FE3A 4P9UA 4LD5A 4IRHA 3IKVA 4L5JA 2V1DA 3LWFA 2WV0A 2ELHA 1OYIA 2RGVA 1K79A 2Q8KA 2KIMA 3CTAA 6PAXA 3TOBA 4EV0A 3S2WA 1WSUA 1UFMA 4OIRF 4D0PA 1G3SA 1P4XA 5K5QA 1KYZA 2K86A 3O6BB 4G8XA 3O2PE 2EFQA 1ZG3A 1J0RA 1TW3A 4Q48A 5J8CA 3GLXA 4TV7A 3WTWC 3NRVA 3K1MA 2V79A 4NQWA 5DEQA 1YQAA 2CW0F 4M6XA 4WWCA 4GYIA 1T38A 4O5VA 4PZJA 2Z9OA 3FM3A 5HLGA 2MLKA 1HW5A 3GF2A 3HRSA 5E8IA 1ODDA 2D2WA 4U88A 4I0BA 4OIOF 1SMTA 4N9HA 3WGIA 1KQ9A 4ENNA 4P5OA 1MDMB 5DCFA 1B9MA 2LNBA 1RNLA 2Y48A 4F7ZA 1QZZA 3OOPA 4ZYDA 2G7HA 2KIUA 3KETA 3BWGA 1XCVA 2BBYA 3PFIA 3CUOA 3SZPA 2PMUA 3BY6A 1SMYF 3KLOA 2V9VA 2FRHA 2QENA 1Z1DA 1GXQA 4G7HF 3TO6A 1Z9CA 3QU6A 3MEXA 3GWZA 3H92A 2XKOA 3K69A 3KZYA 1HW2A 1IUYA 3KLNA 1TQMA 4LLNA 2M45A 3WGHA 4YFNF 4I2OA 4M9ZA 3QPHA 4KMUX 1GVJA 4DQ2A 4Y13A 1QBJA 1KYWA 1G3WA 4IXAA 1ZRDA 2W85A 2XAJA 2H6CA 3L00A 3L09A 2VBXA 5ILVA 2PEXA 3D0SA 4UV8A 1U5TC 1I27A 1XGMA 4WXHA 5D5WB 3KEOA 3JTHA 5HDNA 2R3SA 3KFWX 2L4AA 5DDGA 5CVJA 1B6AA 2GZWA 3QP5A 5FB2A 4NB5A 5E1WA 2FEZA 1W7PD 3D5LA 1IXRC 1FP2A 4S04A 4ENMA 2H94A 3IHUA 3SZTA 1LDJA 4RB1A 1HKTA 5TJJA 4G9YA 1WRJA 3FMSA 4P96A 3T5XA 1E17A 2XVCA 1K6OA 4CO8A 4YG2F 3ZMDA 3F23A 5DUIA 1YLFA 3CUQA 1WWXA 2RVCA 1ZG1A 4ASNA 4LK0F 3GVAA 2XIGA 4ZYHA 4NHJA 1ON1A 4EJUA 1ZYRF 1UHMA 4ENJA 1KGSA 3V8JA 3FF5A 3VODA 1R1TA 2XRNA 3F8MA 4ENKA 5LHHA 3EQLF 3WTXC 4A5NA 3DP7A 3TOAA 1O3QA 1S8NA 1EH6A 5FLXK 2OZUA 2PN6A 4S05A 2W57A 1YW8A 1R36A 1BIAA 5CYVA 3RPQA 2NRAC 4CXFA 2YX7A 3TKYA 5A2QK 1REPC 1FYLA 1XGOA 4UHTA 1J59A 2L02A 2IA0A 1HSJA 3KZZA 5FD5A 2FXAA 1JXSA 2GA2A 1BM9A 2FNAA 3R0JA 3CDHA 1DP7P 3ISPA 1KU9A 2XV4S 1BOAA 4L9NA 1X3UA 2DPDA 4B8XA 1J5YA 3K2ZA 4HQMA 3ZMZA 2X4HA 2GWRA 3EYYA 3P9CA 5LRRA 4AIKA 5L3FA 4MEXF 2COMA 2A69F 1XGSA 2DW4A 3LAPA 1YG2A 3DFGA 2RDPA 1NHAA 1J75A 3E6MA 3F72A 5JI6A
chains in the Genus database with same CATH superfamily
4LOCA 5M3MJ 1F43A 2D1VA 1XMKA 4DBQA 4EGZA 2DYRH 1IJWC 1Z3YA 3A02A 2YU3A 3ADIA 2PBIA 3Q5FA 1U5TB 5FLVA 1UCRA 2MBFA 3MZ8A 1JUMA 3PFYA 1M1EB 2L54A 3ABMH 4F93B 1QQIA 3BBGA 1U2WA 1PVEA 3BTCA 3WG7H 3O8GA 2YSPA 2EPUA 1UMQA 2QQ9A 5TRDA 3OR1C 3V4GA 3CMAI 2HGCA 2ENAA 1G2DC 3HG9A 1B4AA 2K4BA 4BL0B 1ZHFA 1W5CC 4RDUA 3OY9A 3BZKA 4EJTA 2EMCA 1QA6A 4Y33A 4OX9E 2ZJPF 2JQ7A 2B7VA 3VYXA 2R5ZB 1IMUA 4BXUA 1LE8A 2JZYA 3GEZA 3HPHA 1R00A 1TC3C 3CCSI 2V6CA 3J81Z 4M3BA 2TCTA 5KHDA 3G6EI 3LSPA 1T0FC 3IWDA 2OU2A 3FXRA 4XRMA 1HLVA 2PMZA 4RAYA 1FPQA 1XMXA 2MG4A 1HR0E 2EOXA 2VKDA 4YFXF 4R8HA 3I4PA 3CJNA 5F08A 3J7AO 1VQ7I 1P92A 3QRFF 9ANTA 2QBYA 1TT5B 3L2UA 2HOTA 2LC2A 2EJ4A 1G2FC 3HBLA 4JQFA 3KWRA 1W0UA 1MBGA 1ZREA 1Q1HA 3M7GA 1ITYA 2O03A 2HTSA 5FO5A 4BEHB 5E3MA 1ERDA 3M4OJ 2LRSA 1WJCA 4Q4ZF 2ZJ2A 3HOWJ 2KKOA 3ELKA 2JPBA 1QNTA 2JOBA 1APLC 2NVUB 3ROUA 1W0TA 4WSGA 3A1YA 3R60A 1OYYA 4OMYA 4IHXA 3LMMA 2YRMA 3ZQGA 3R4KA 3ZXSA 3OS0A 5KL4A 4CA0A 2XF7A 1OCOH 4LMYA 4E7HA 3PUBA 2FJ1A 2VB6A 4UUSA 3KEYA 1V5FA 2M1SA 1Z05A 4UB6C 3GXOA 1AU7A 1Z67A 1CQTA 1EH8A 3GTOJ 1ETKA 1PJRA 3D5RC 1FJGE 2J5OA 3ASOH 4LFBE 1Y8RB 5EEHA 4IOAF 1LNWA 2V7FA 2WZOA 3FBNB 4X64E 2K9SA 3IAM2 5E79C 3TQMA 1TW2A 3A01B 5LHIA 1Y1VJ 5DCMA 4D9JA 1IN6A 3JREA 1USTA 2MGQA 1TNSA 2LG4A 2KIFA 1JGSA 2JRTA 3E6BA 2XAGA 2M5WA 4HZFA 3ZGKA 4Y7NJ 3C2HA 5FLXZ 3EPHA 3S3OA 2I5UA 4C2UA 1ZG5A 1LLMC 2EM6A 3A01A 4BY1J 2VXZA 2LT7A 3M1CA 2Y9YA 2LF8A 3QPLA 1JJ6C 1JK1A 1UHSA 2DA1A 3N4MA 3KE2A 1R5HA 5FKNA 2CQ7A 3OR2C 3EUHA 4KICA 3RPUA 4E70A 4F92B 2LYCA 3TW6A 3AKZA 2P81A 3DCFA 3LSRA 1GXPA 4HLYA 1Y56A 1R6RA 3K4LA 2F4MB 4YIIA 2ZMEA 2EN8A 2A05A 1AHDP 2ZXIA 2DXIA 2EM8A 3MFKA 3G4SI 3GTPJ 2EM9A 4ABZA 1MW7A 4HSTA 3S2HJ 4BCAA 1WGXA 4IVNA 4B3RE 4M9XA 1IRZA 1MBHA 2L3CA 5DUKA 3I53A 3OYAA 2J7JA 3IRRA 2JK3A 3EUKL 1OCRH 3E6CC 3C7JA 5A6BD 4E7LA 2EOYA 4LB6B 2O5RA 4KZSA 2GXBA 3QG5C 3CP8A 4LLGF 3BP8A 1X19A 2IW5A 4LB5A 1JKRC 2EA4A 2ZC2A 2GPIA 2Q8UA 4A3BJ 4GGGA 1GDTA 2NNYA 2EIMH 4O6JA 2MABA 2DODA 2CFXA 2KHXA 2E71A 4O24A 2K40A 1HDDC 1ZARA 2VKEA 3WTUC 2EZKA 5BNGA 4A3FJ 3CCVI 1YS7A 2EIJH 5M3FJ 4BAYA 1A04A 2PRTA 1YTYA 1DPUA 3PIOF 3OTOE 2L3DA 5GP9A 4G6TB 3H5AA 5B1BH 2H27A 2V88A 5E3NA 3CCRI 2X6WA 2BEOA 2JVAA 3BR1A 3S1QJ 5F27A 5FLMJ 4EM2A 4PCQA 3F6HA 1TBXA 3WU2C 4FETA 3ZPLA 1OYWA 3RI4A 2E5LE 3BJAA 2ZSHB 1PDAA 3FZVA 4ESFA 1S7EA 1FT9A 3J7YJ 3QOPA 2MLGA 4BHPA 4X66E 1Z7UA 3OYNA 2UUBE 2ESNA 2LY9A 4AU7A 1BC7C 2CV1A 3S17J 3BCAA 4C3IJ 3PNVA 5H20A 5DV5A 3CO7C 3IWFA 3ABKH 3L7WA 2LTPA 2XPWA 1LPQA 2PJPA 3GBGA 3G71I 3UKGA 4Y17A 2VJ5A 4DR2E 4F6MA 3J81K 1OMIA 4NXNE 2LDUA 2HYFA 1XDUA 2O8KA 1FNNA 3UK3C 3HRMA 2EOFA 2VT3A 1OR7A 5KAIC 3DEWA 3DPTA 4KITB 2B63J 5D4RA 2OD5A 4I98B 2ENHA 5TSEA 1WI9A 4XLAA 3LA7A 4NC6A 4BJ5C 4QLCU 2BBGA 4P7DA 2DT6A 3HOUJ 1X47A 3FIGA 1I94E 1KU2A 1Y0UA 2P5KA 2YZTA 1P7IA 4XLFA 2R7XA 4MEYF 5CJ9A 4LK1F 1IGNA 1XNRE 1X3ZB 2FA5A 3K1PA 2HJJA 4NUBA 3RSNA 3GZNB 1NH3A 3HSEA 3HSRA 4JYAE 2BVMA 4M3EA 4UV9A 2DFIA 2JTVA 3GZ5A 1N25A 4HRIA 1IXCA 3PM1A 1W36D 3ONQA 4DR3E 2QKLB 4OU0A 2EPXA 1ZELA 1LDKB 4ON0A 1W4MA 3GMEA 2STTA 1MMNA 2GXAA 2JPAA 4LFUA 4MQ9F 1A1LA 2EL6A 2WB1A 1EKZA 2HU9A 1I6HJ 3C4BA 5M5WJ 4HEA2 4MHGA 1SANA 1ZQ3P 2DYSH 4UVBA 4V19K 2WAQA 1K6YA 3VSKA 2LBSB 3RDIA 1S72I 1BI3A 1WJBA 4H0EA 4CCMA 1SD4A 5DTDA 1BL0A 5T6JA 1IBLE 1O3RA 2RV8A 2FQ3A 5HVQC 2XC7A 4RB2C 3BG3A 5FFXA 1T33A 2ADUA 1F36A 3ASNH 4GFBA 2XSJC 2RSMA 2EFPA 2E1MC 4ZZDA 5ICFA 1GHCA 1J5EE 1BA5A 5KL7A 4B3TE 3M1EA 3J80K 2GQQA 1YOVB 2PLYA 2EOMA 1O7FA 2G9WA 3J7ZI 1QZYA 2AS5F 3KP3A 3ERMA 3K1NA 1X6HA 2XF5A 2EE8A 2GLIA 4ZH4F 4R2EA 4PDKA 2A5YB 2Z1DA 3JSOA 1FYKA 1JGGA 2EPAA 1ZLJA 2MH9A 2MKNA 4GRIA 5LGUA 1HNWE 4B1RA 1R5GA 5GTIC 5ERIA 3PNTA 1AKHA 4M0VA 4WK8F 2XRLA 3TDUC 3M8JA 2Y9ZA 3S93A 2JA7J 3K2AA 4A3EJ 1MSFC 4DKKA 4BQAA 5C4XJ 3L2WA 4GKKE 3K9TA 3ZN1A 1GV5A 2O0YA 3R0AA 1MZBA 2CWEA 4RM3A 2G7UA 1A31A 2FF4A 2K27A 1O4XA 2ZO4A 3JW4A 4XKBA 2RC4A 3E7LA 2LFBA 3NAUA 1PP8F 1G4DA 5D8LB 2OQRA 5L3EA 1YW7A 1ZN2A 5K7ZA 4RGRA 3HRTA 3LSJA 2F5VA 2EMGA 1BI2A 3A2KA 2IJLA 4GCVA 1SAXA 2QZ8A 3R6SA 1MDMA 3THOB 3H9QA 3MWMA 4R1HA 2EPNA 5KAFC 3L9FA 5HS8A 1D1AA 3THNA 2XPUA 3RIRA 2HGHA 3EYIA 2DGCA 3OV8A 4B09A 2K9NA 3AFHA 1P9QC 2F5DA 4BEHA 2O6GE 2K02A 3DBLB 2VI6A 2KZVA 2A68F 4Z6YA 5CLSA 1BJAA 1V54H 5J1YA 3QU3A 5H6RA 5J4YA 4MLOA 2VQLA 5BPDA 2NXNB 4YFKF 4XICA 2MH2A 1YSAC 5HDGA 3KP2A 1FEXA 4ESBA 4DGWB 2ACJA 1YJNI 1ZGJA 3H3VK 3Q0WA 2B9DA 2A61A 2JRMA 2OF7A 2RREA 1S7OA 4XBFA 1JT0A 2W25A 4LG3A 2HI3A 1MJBA 1TWGJ 2CG4A 4BE0A 1VNDA 2MKDA 2YU5A 4KHPE 5F0FA 2L9NA 2BY1A 1P47A 1KA8A 2EM2A 3D1NI 3E0JB 2E7WA 1OCTC 2UWMA 1FX7A 2ECCA 2HTJA 3SDGA 2CGPA 4A6EA 2OCCH 4ZJZA 3L1PA 3RKYA 2R7DA 2CUJA 4LG0A 5D5UB 1KU7A 5A69A 2A07F 3S14J 2DQRA 2VASA 4Q5SF 2H09A 2EOJA 1IRGA 5AE2A 3S15J 1YYOA 4P9FA 3DPLC 2CS3A 3AUZA 4RB0A 1FOXA 1ZBTA 4CICA 3FXJA 2NS8A 2M9AA 1Z6TA 3AL0B 2DA7A 3ADGA 4BBSJ 5F04A 3JRGA 2L7ZA 3OYBA 2EK5A 2DTZA 4HPQA 1WHNA 2YTGA 2ZBKA 3JR9A 3E5UA 4F55A 3BCBA 2JOXA 2Y31A 2LKPA 3ESWB 4RS8A 5FRMA 2RSIA 2IHR1 4G12A 4F9BB 4PJLA 1DPRA 2E35A 1FKAE 1S5LC 1WQ2A 4JBAA 3OIQA 5EEAA 4XLHA 1DUXC 2L0KA 2J5PA 1DDNA 4IHYA 2I8DA 1ETVA 2QLZA 3EUAA 3TL4X 3ULQB 1IXSB 1IW7F 2JVHA 3BZ6A 3P5JA 3MKZA 2ZMEB 2HQNA 1MBJA 2M9HA 3DKWA 5D5XB 2R7RA 1A5JA 4X1EA 4KMFA 2VQCA 3ZR8X 2IA2A 1X4PA 5JLWA 1K83J 2KQRA 1ACIA 4F6NA 4MFDA 2MDGA 2YTIA 3K10A 3I59A 3VYRB 3CCYA 2BOLA 5LEKA 4L0ZB 1A6IA 2RQQA 2JN6A 3IC7A 4OIQF 1X3CA 2CUFA 4LF8E 2EH3A 3OMYA 4HDVA 5GAHJ 2YTNA 3PQKA 4GO1A 4KA4A 2F5EA 1Z1BA 4GKJE 2MC4A 2NA2A 2E2IJ 3ECOA 3JAMK 2GM4A 3EUHC 3FXQA 4YIRX 4J00A 1SD5A 2LOOA 4HNTA 2LRDA 1YX3A 2XUBA 2IRFG 2K7IA 2OCEA 5ILUA 4PFPA 5HNHA 5B5EC 1OCCH 1F9NA 3CUQC 4D7MA 3LLHA 2EMWA 4OAYA 4KT5C 3K4JA 5F64A 1A1IA 4J8ZA 4X62E 4H4KC 4C2MJ 2FNPA 5F1RA 3OYDA 2M0CA 1E0EA 2UUAE 2STWA 1FOWA 3ABTA 2YTDA 1XNQE 1TQIA 3F3XA 3J80Z 3G3ZA 1I1SA 3FIWA 2I10A 2HHHE 5ADZA 1SVMA 2VODA 1U6GA 2N3HA 2D9HA 1RUOA 5E17F 3IUOA 2JVGA 2LTSA 2KPMA 1VQOI 5D4SA 3LFKA 3WODF 3IRQA 4FK5C 1ZH5A 3LA2A 4WSPA 4HF0A 1HCRA 1R1VA 4G94A 2YTQA 3V7SA 2DMIA 1HA8A 3S8PA 3ZP5A 2XB5A 1BR1A 5FKOA 5C3EJ 4L18B 2W4SA 2GAUA 1FYMA 2VBYA 2F5FA 2LF7A 2CSHA 2E1CA 3JRFA 3C1DA 4QPQA 2O61A 1R7JA 5EZHA 4RBOA 1CF7B 4XN3A 2EPKX 2P5VA 3P1XA 4RB3C 4C2TA 3VSLA 1VFCA 1SD6A 3H1CA 4IF4A 3QOEA 3SZGA 1GUUA 2VPRA 3ZMVA 4BC7A 5KL2A 4B3ME 2WY7Q 4HBLA 1D8JA 4XONA 1QPIA 2K4JA 1FP1D 3BF2A 3HOTA 1K78A 2OBPA 3HKZA 1P6RA 2DN0A 2Q2EB 2E1MA 3KP7A 4RGXA 1BBYA 4AIHA 1USSA 2M30A 4DOZA 3MQ0A 2CQQA 2YX4A 1X4OA 2HOSA 1FZPB 5KK1A 1ORKA 1T0FA 2B0LA 3H9GA 2MFZA 2LBFB 5JLXA 3UNGC 1NG7A 4R79A 1FTTA 3HB9A 1RZ4A 2LH9A 4L8NA 3TBIA 4A3LJ 2ELJA 4MLQA 2MDRA 3ECRA 2UXDE 5ICCA 5E3OA 2YR2A 2JXPA 3OIPA 4U7DA 2JWTA 4AQYE 3HUGA 1RR8C 2XGCA 4ZDOA 4BH9A 1TLHB 2PX9A 3U2RA 2CFOA 4L5NC 4LITA 3KP6A 1MEYC 2M1BA 2A6HF 1SD7A 5J6XA 1HC8A 1ONVA 2VXDA 4FT8A 2K9QA 3DTIA 4ZYAA 3HOSA 1HKSA 2VJJA 2VOOA 1XSXA 2VBWA 2MA3A 1F4KA 2IGOA 1LVAA 2EV5A 3L2VA 3FXLA 3ZN0A 2A6EF 3CQZJ 3EDPA 3ERED 5FFZA 2R7TA 3I56I 2EPPA 3WE3A 3PO2J 5JVTA 3WU1B 1EV7A 2DK5A 3QODA 1VQPI 3HJEA 1WJ5A 2A5WA 3Q9VA 2FGGA 2Q1ZB 3HEFA 4KYWA 2FQ4A 1R22A 3U9GA 1X49A 2UUCE 3ZRGA 1XDSA 3VYSB 1G8XA 5CQGA 3E5QA 4LF5E 5JFRA 3PUFA 3HOZJ 3M3YJ 2P8TA 1HKQA 1GLNA 4JYKA 2YPNA 2Z5UA 2BHYA 1BR4A 2UUZA 1Z6RA 4L9JA 1TN9A 1RKWA 1Z0XA 1VQ9I 4N4NB 4JI1E 5J1UA 5IXMB 1U78A 3DU6A 1WKMA 4EQQA 1FIAA 1R23A 4HSRA 4A0ZA 1MBEA 2RNJA 2DDAA 3R61A 4HQEA 1SFOJ 2R7VA 4I01A 5BPIA 2EPRA 1EA3A 1EJ9A 4LIUA 1G6NA 1HDPA 2QWWA 2DO7A 1K7AA 3MCZA 2X51A 4XOPA 5ILSA 3C6KA 5LBQA 3DBHB 4HG2A 3TO7A 3K6GA 2M8EA 3WHCA 4IKFA 3HTXA 5FJ8J 2WAFA 4GDFA 2H1KA 4DYRA 3RZOJ 1XMOE 3I3LA 3AL0C 5CFFE 1POGA 2JA2A 3IKTA 1L0OC 5L3BA 5FKMA 4A6DA 3K4BA 1VQMI 2OQGA 3REOA 1I5ZA 5L3CA 1YIOA 4B47A 2OAZA 3BDDA 4A2UA 3JAMZ 4IHWA 3T8RA 2L5QA 3M8EA 4OIPF 2XSDC 3BQYA 3HSFA 2A3SA 4KIBA 5KCMA 3MKYB 1W7PB 2ZKZA 3W6KB 1JE8A 4EMSA 2JA8J 3I71A 5FD6A 2HVRA 5B1AH 1IDZA 3RZDJ 2RS7A 2ID6A 3M9AA 4LJZF 1R1UA 4F9AB 3CDIA 2YS9A 2V83A 4Q35B 2NUFA 2EMZA 5D5VB 3C2BA 1Z7LA 4XSZF 5LD2C 2YTEA 1KZHA 2ZNZA 2CMPA 2ZSIB 1A1HA 1DU6A 2RN7A 4UY8I 4IZZA 4B43A 3VOEA 1V4RA 2CW8A 3WG9A 1I50J 3K7AJ 3TGNA 5EGOB 1YHQI 4L5IA 1V55H 2AQEA 2X1CA 4XLCA 1L4SA 2H6BA 4ZYEA 2GBYA 3SFZA 1I3AA 2JSPA 2KFDA 4BE2A 2L9VA 2EOOA 3X2QH 4JK1X 2EN2A 2EBIA 3AG2H 1N3GA 3TO9A 1LJ9A 2XKPA 3OL4A 2JA6J 3HM5A 5D8KB 3MVPA 2JYAA 4DV5E 4IO9F 4LF6E 2WCC3 1XPXA 3ML6A 2ZFWA 4ESJA 2L6MA 4CCKA 3H9JA 3LSHA 3K0LA 3GFMA 1ETYA 3C18A 2EOSA 3TDZC 2DLQA 2CTDA 4RM2A 1I6XA 4A69C 3G1LA 4AVPA 2ETHA 2E1MB 2Q2EA 4OAZA 4R2SA 1D1CA 2F48A 2GLOA 4I6ZA 1DGRM 2Z99A 5HLHA 1J26A 3ZMUA 2ZXJA 3HHHA 3F22A 2CQNA 3MHSC 2DPUA 3DV8A 4GXOA 1YRNB 4L0YB 1MNDA 4WX9A 3H35A 1WZ2A 2BVLA 1NK3P 1BBGA 2HFHA 2JP9A 2DLLA 1LDDA 3GFJA 2LBFA 2RQPA 2LVSA 2V1XA 4X9JA 1WPKA 2EJRA 1D1BA 3I54A 3KYLA 3P9KA 2FV4B 3COAC 1N75A 2RNGA 5FKLA 1XB4A 2DMUA 4NC8A 3FWEA 3RMPA 5L3DA 1N77A 4BXXJ 4MIMA 4XORA 1IAWA 1HOMA 2ODRC 4KN7X 5ED4A 1K78B 3OYGA 2CV2A 3RKXA 3B6CA 3ZMSA 4CCNA 2CJJA 4WPYA 2DSYA 3H0GJ 3T1BA 2CRGA 3CCQI 2YWQA 3JRCA 2EM3A 1XSDA 4HLXA 2GOXB 3LQRA 3PO3J 1LUJB 2IS6A 3MZYA 1I1GA 3UR3C 2EMAA 5KVRA 4E4HA 2XASA 1CF7A 3OYIA 1ZRFA 4R2QA 2BV6A 3OYLA 2EWLA 4DV4E 5A2QC 2VL8A 3WE2A 5JI6A 1D5YA 4QPOA 2EINH 4BNCA 1S6LA 2YU8A 3L2RA 3LSMA 1X6EA 3H3UA 3HPGA 1PYVA 3MAJA 1RPWA 4RGSA 3RYPA 3FHZA 1GVDA 1AOYA 4BJ6C 5AIPA 2ZXWH 2RAEA 3C3WA 3HIFA 3JU0A 1KYQA 2LE2A 2AQFA 2FMYA 2FBIA 4E7SA 4A3KJ 3ZQLA 1O3SA 2WADA 3BT9A 4FQGA 2M7BA 3GTJJ 4ZZLA 3ZQCA 2VRDA 2LUPB 2FBKA 1MGTA 2DMTA 4I99C 2GIVA 3LAJA 4D1QA 3IWBA 3A4CA 1XC5A 5AE1A 1QU3A 4F9CB 2DLKA 2Z33A 4PK4A 3OL3A 1MJ9A 4RLQA 4Y15A 4BMJA 5IP7J 2K4VA 2JA5J 1UHZA 3QPTA 5E20A 4BXFA 4DYCA 4BQOA 1TWCJ 2VE9A 2ISZA 2EPFA 2MSYA 3P9IA 2K9LA 5HS7A 2EMKA 1FBSA 5JVGF 2B9SA 4BGDA 4R8OA 1ZTRA 3TP3A 2DA6A 2EMIA 2X48A 1KONA 5BOXA 1YJ9I 2NABA 1PUFA 3WTSC 4IQJA 5F6FA 3PJRA 4LTYA 2DI3A 5TGTA 1EKEA 3E97A 3FM5A 3TW7A 5D6FA 4CYCA 3WTVC 4IHVA 2NVTJ 1LQ1A 5FKKA 1B72A 1XN7A 4LGWA 4PSWA 2WY8Q 4XIDA 4NNJA 3FX3A 4M74A 2HVSA 1A35A 2K5CA 4XLEA 2OTJI 4U0WA 2ELYA 2VIXA 3ZQ7A 2HR3A 3F8CA 4MFEA 4XLNF 4D5CA 1T39A 1FBUA 4FCYA 1GQEA 4A12A 2Y75A 4DV2E 2NUGA 2EL5A 4KIFA 4RA2A 2YU9J 3FKJA 3DPUA 3MN2A 1FOKA 2XAHA 5HDKA 1ENHA 4AYBA 2QKMB 3CC7I 4UUTA 3J80C 3BQZA 3F9KA 4BYYA 4DBRA 1A1KA 5LHGA 3DWLE 2O9LA 1IBME 4IRGA 5LEJA 1ZGAA 2B7TA 1T4LB 4NXME 1YFHA 2E5NA 1SC7A 2ZMEC 2FU4A 5CKTA 2Y69H 1I3QJ 4UVCA 4JI7E 5C44J 5EG0A 4HA8A 4Y52J 1IN4A 5LGTA 4AWXB 1F1ZA 3SEQA 1R9TJ 2JUGA 4DZPA 2R7ZJ 4HW0A 2XGXA 4HX8A 5IT9K 2IA1A 3CF2A 4HF2A 1H0MA 1MIJA 2VPLA 5HLTA 2M4IA 2QBYB 2O8XA 2EFOA 3W3CA 4JI4E 1T56A 4LF7E 5F1JA 2HEOA 3EETA 1J2XA 2EFNA 3FDYA 1HBXG 4M72A 4Y3OA 2YSOA 4LG0B 4XRSG 2KOUA 3HPSA 2IGNA 4EJOA 3I58A 2W7NA 3K70C 2W48A 1GTKA 2UXCE 5H6QA 4IHSA 1JI8A 1SAUA 2OA4A 2BY0A 4JX6A 1LE8B 2CYYA 2R5ZA 3VYYA 2JT1A 2DT7B 2EOHA 2V86A 3VHTB 4F2JC 3HHGA 1W5SA 3DEUA 4ANJA 4G7OF 3MSWA 1H8AC 5A2QZ 2LCEA 1MSEC 5FGMA 1XG1A 3W2VA 3WTTC 5IT9C 1VQLI 2Y0MA 3BR5A 3LOCA 2HXIA 2HWVA 2VC0A 4AD9A 3KPHA 2CU7A 3LSIA 2ME0A 3CMYA 1F5TA 2EP3A 3T0YA 5HS9A 3FXUA 3H36A 4HF1A 1B8IA 3E1SA 1U5TA 2OZ6A 4JX4A 4UXNA 1W36C 1P4WA 2R5YB 1ON2A 2TRTA 2XB0X 3Q0UA 3GTLJ 3BPVA 3QAHA 2XROA 3HOXJ 1T2KA 1NCSA 1YE9A 4I02A 1QZEA 2H8WA 3BC8A 1TTYA 1S7AA 2YRKA 2YTFA 1G3YA 2DFHA 4YEJA 2HOEA 2WBMA 3ZQFA 2L7FP 4XRFA 2KL4A 1I39A 4A0XA 1R71A 4GZNC 1DI2A 2P5LC 2KDOA 5J47A 3HYIA 2MC6A 5AASA 2E5ZA 3I64A 3KP5A 2QYOA 1R58A 1IDYA 2DJIA 1LFBA 1ZR4A 5E1XA 1VTNC 3PSIA 1Q1VA 4ETSA 2R92J 2A25A 3MZHA 2V89A 4IPAA 1NTCA 2BZTA 2XAFA 2W24A 3KYDB 4CZCA 3FHNA 4J19A 2EMFA 5EZGA 2L33A 4IJAA 1T95A 2DOEA 3GTQJ 2EN4A 4BE1A 3L2QA 2RPCA 4AVZA 3G73A 2EOEA 3J7Yp 1JKPC 4RGUA 1LEAA 3ZOQB 5KL3A 2L01A 5BMZA 1JHHA 3DBRB 4L9VA 3RTRA 4WCGA 2Z3YA 2P7CB 4PGHA 2IGKA 4DYQA 5J1RA 4PGGA 2DMQA 2VONA 1YITI 3LMLA 1OLTA 3E3VA 1IN8A 4X65E 5AIQA 4F54A 2FTXB 1ZRCA 1X2NA 4DUYE 1WJEA 2L9SA 2VJ4A 3RKQA 3NWSA 3OS2A 2EN1A 3BG9A 2EMLA 2UU9E 1PUEE 2EILH 1IQOA 1O0WA 4KN4X 3VB2A 1KU3A 1JHFA 3I4MJ 2BYVE 3QP6A 4DV6E 4EM1A 3I55I 1WJDA 3S3MA 3T1YE 2E1NA 4HYEA 5E18F 5CVIA 1S29A 1QU6A 1ZK8A 1V5EA 1MD0A 4PJNA 3F8FA 1TF6A 3DTKA 2W00A 4E7ZA 5BR8E 2K3PA 1N33E 1E2XA 2Q0OA 2LTRA 2QQAA 3TMOA 3KP4A 4HAMA 1JUSA 4RAZA 4BQNA 4C3JJ 1WHUA 2L9RA 1UELB 2DU9A 3BR3A 1S3JA 3CLOA 1XMAA 5BS6A 2DMNA 3RKWA 3V7RA 1IZ1A 1LFUP 3RPUD 5FROA 2DAOA 2LJUA 4C30A 4CDGA 2FSWA 4EEFG 5DD4A 4P78A 3K70D 5K5OA 1JKQC 1XD7A 1X48A 1O57A 2KIQA 4XK4A 4U0VA 4I7HA 5IV8B 4B3XA 1STUA 5C4JJ 4JV5E 2R7FA 1VF9A 3BPXA 4M73A 2R76A 3K6QA 1WFXA 4OOGC 3OYMA 3CZ6A 2V85A 4R2AA 2EB7A 3CDLA 2HDWA 2F5CA 3QYFA 3W6JB 3V8LA 2V4JC 2PI0A 3PSFA 3WGGA 5FRNA 4KFCA 2KDZA 1MMSA 5GPCA 1DGWY 1FOYA 1IRFA 1V5GA 2WBSA 4NC7A 2X6OA 4CYDA 2DMPA 1WI3A 4FHTA 4MTDA 1A1JA 1KQ8A 4G6DA 1AH5A 3FMQA 4IJDA 3PNYA 5FLXC 2X85A 1B8IB 1YS6A 4WXDA 4HOBA 3HTUA 3CUQB 1SFEA 1SVLA 1G3TA 1BIBA 2H36X 3GX4X 5IT9Z 3NQOA 4MQVA 1TT0A 4R2PA 3MKLA 4R2RA 2M87A 4EM0B 2QEXI 5DNYA 3F8NA 4FX4A 4I0AA 3MKWB 1VQ4I 2LREA 4HX7A 1QHGA 2K7LA 5K1YA 1Y1WJ 2LJHA 3T1HE 5GADJ 3ZQHA 1CGPA 1XCBA 2CUZA 3WTZA 4BACA 4BC9A 2LP0A 4OMZA 4Q47A 3LQQA 3AG3H 1V3FA 1X1DA 4QTRA 5B3SH 2EV6A 5A6KA 4M3DA 4BHCA 1J09A 4M6VA 3WHBA 4XR6A 2TDXA 3NWTA 1A36A 2QM3A 2F6CA 2IPQX 3BTLA 2EFWA 3JRAA 2F2EA 2EM4A 2X9DA 1LFPA 2KT0A 4EGYA 3FISA 2F4VE 5EDNA 1OQYA 2LKSA 1SFUA 5LMUE 2MW8A 5J40A 4IHTA 5LFAA 2NOGA 3A03A 4V2FA 3CESA 4RAGA 4FASD 4BHBA 2OV7A 1RI7A 1TL8A 1U0JA 2E1OA 1MH4A 2E19A 2EA2A 4DV1E 5IPAA 3WTYC 1FC3A 1PKPA 2E2HJ 3OYFA 2QA4I 3AG1H 3EQ1A 5GPAA 2M0MA 3TP0A 4CCJA 3JTZA 4B3SE 2HYGD 1DQ3A 2KJBA 2N3GA 3H5NA 4KIGA 4XSXF 2H1LA 1ZLKA 4KWYA 2HNHA 5A6BA 3E6DA 5E1ZB 2DRPA 3OOUA 2DCEA 2ZXHA 4DR7E 1IUFA 1HW1A 2X6XA 3EPZA 1D3YA 2BY3A 2VQHA 5AONA 3OYKA 3IV5A 2P6TA 4BDYA 3QWLA 3ABUA 3JRBA 5L3GA 1VQ8I 2XPVA 3A0BC 3SFIA 3GFLA 4IOCF 5DS9A 1BW5A 1FLIA 3HQ1A 1QO0D 3C4TA 4EATA 1VQ5I 2Z2SB 2E60A 4G6QA 5EEGA 4ZDPA 4UUVA 2N8XA 3IWZA 1B72B 2WV1A 4WF2A 4M71A 3KEQA 2IVMA 4OOIA 4CYCB 3HGGA 5H2FC 3RJPA 2LY1A 1J9IA 3H09A 4IL6C 3GYHX 1DQUA 3F8BA 1U8RA 2UXXA 2V26A 3S3NA 1ZBQA 4DR1E 1SVOA 4PJ0C 2BXYA 4LIVA 2EPOA 2PJRA 1BOBA 3SQNA 5HODA 2C6YA 1TQPA 2AXLA 4B4CA 2VT2A 4CZZA 4YIFA 3CO6C 3VPRA 1Z91A 3DF8A 3I59B 2PFBA 2EN6A 1QPMA 5F0CA 4LF4E 1A1FA 3FMRA 3HRUA 4AIDA 1TZLA 2HDCA 2HDDA 3O3KA 1X5WA 2L7MP 2JPCA 4MGRA 1VZ0A 4YHHE 1O3TA 2O7OA 4S0HB 1X3WB 3HXLA 2KRHA 4A3MJ 2DK8A 3S32A 5LRSA 4TUGA 4XN0A 4K0KE 1HSTA 5KL6A 1BBOA 3ECHA 5IT3A 2XAQA 3KCCA 4B3AA 4M30A 4JI0E 1SEUA 2ZFUA 2DA5A 1VQNI 5CVRA 2HS5A 1EH7A 3SJMA 2EZ6A 1QHHD 4X8WA 3F6VA 1R4NB 2UXBE 2R5YA 3RCOA 3OWTA 4II3A 5DYMA 1FTZA 1N32E 3BTJA 2QCOA 4UUSB 1G2HA 1B1BA 3ABLH 3K4MA 4DJAA 1R5ID 3W2AA 2CPNA 4P55A 5DM6F 2WBUA 3QQAA 5IY5H 4AC0A 2VUMJ 5EJCA 2JSCA 2EV0A 1XGNA 1BN5A 1J7KA 3SHFA 4IEJA 2L92A 1OISA 5LL6R 2EM5A 5JHUA 2ZJRF 5EF6A 1SFXA 3GUDA 4MTEA 3F6OA 3G1OA 4N9IA 1FWZA 4M3FA 1MBFA 2QQBA 3B02A 3LSGA 4B44A 1AWCA 5LGNA 2LO3A 4RH8A 2EZLA 1P7JA 2GA1A 4XKCA 4BUPA 1UB9A 2E7XA 3JTGA 2RKHA 4E7KA 3IL2A 3VYUB 1FSHA 4UVAA 1BB8A 3T8TA 3MHHC 3S16J 3BIDA 5M5YJ 1GV2A 3I5UA 5CQEA 4PSXA 3VDXA 2L4MA 2UXNA 2VBZA 3CLQA 1AA7A 1PJSA 3S1NJ 2JY9A 2VQEE 2Y0SA 1YRNA 2ESHA 1W5TA 2P7VB 4K2EA 2ID3A 2HYJA 4GEQB 4BJTA 1IF1A 4QWQA 1X1AA 1YO5C 2DIXA 4NDLA 1T98A 3DEEA 3LSKA 1WJFA 1C0WA 1WH7A 1K4TA 4CHUA 3FKIJ 2KRFA 2CT1A 4FE4A 4XMYA 1W1WE 3GW2A 1RESA 1TP4A 3ZMTA 1T6SA 4A0YA 2RQLA 2WTEA 4XLPF 4WYQB 2WWYA 1QGPA 1Z3XA 2DT5A 4C3HJ 4M9SA 4BKXA 2EQRA 1D5VA 4DR5E 3BROA 4DMIA 3Q9SA 1JTXA 2GIZA 1RUNA 2K9MA 1NG6A 2BE5F 2VOPA 1IV8A 4LF9E 1ETQA 4BU2A 1OJLA 1AKHB 1F2IG 2HKOA 2V1UA 3SYTA 4JI8E 1B9NA 3SEZA 2D45A 2W82A 4BBRJ 2D1HA 2VN2A 2KISA 4KDPA 4KJZA 5AC4A 4CCLA 2WAQN 4HV5A 1ZU1A 4QIWN 1ZGWA 2CO5A 2K3FA 3BR0A 2EORA 1YYVA 1MJAA 3MMYB 1DU0A 4Z2YA 1W7PA 2NOJB 3BLYA 1HQCA 2VJIA 5ICGA 4I76A 1MMGA 2IEKA 2IT0A 4HDUA 2IP2A 2FUG2 2ISYA 4PUSA 4XOTA 4U7BA 1YW9A 2D5VA 2PJRB 3JRIA 3N97A 2KONA 2EZIA 3KYCB 2R7QA 2BW3A 2FX0A 2PQ8A 4XL9A 3DXJF 4ZTFA 3CCLI 2ICWG 2IS1A 3EPLA 5HOOA 1LEBA 2DA3A 1FBQA 2YTJA 2R7SA 4DIQA 1N36E 5EYRA 1RKTA 2EQ1A 2WBTA 5D6EA 4TUIA 3HL2A 1D8KA 3M99B 2KP6A 1RQ0A 4O5GA 3CMMA 3LSTA 1BI0A 2LUQA 3K4KA 4U0YA 3F21A 1Y8QB 3V7CA 4PFOA 4I8OA 2IXSA 1OFCX 5F3WA 1E3PA 2IS4A 1RR7A 2XHKA 3H3ZA 3I4NJ 3RYRA 2JJ7A 4U87A 4OINF 3DLLF 2X0LA 1H9TA 1EF4A 2QSFX 5IOZA 2NAZA 2W84A 1IN7A 2M7QA 1YUIA 2OJED 3BJ6A 2DBBA 2OTLI 4CGZA 1HXDA 2ENCA 4G7ZF 3BJOA 5BQTA 2PMZN 1UG2A 2JUCA 4I09A 3B73A 3M07A 3DJWA 2VLAA 2P4WA 3RQIA 4M6YA 3ZCOA 2ZCWA 1ZAOA 2VKVA 3JSPA 2YT4A 3HTSB 3VFZA 1H89C 4EVIA 4OWRB 2DMYA 2P6SA 4DW6A 2JR1A 1FMWA 4CUGA 4HEIA 3J7AG 1H9GA 1D0ZA 3OIOA 1RIOH 1BC8C 3TQNA 3I0TA 4RHBB 2NYXA 1UAAA 1WJPA 4M2ZA 5JR3A 2FMLA 4LLLA 4O3MA 3HUGB 1UHWA 2PMHA 1LB2A 1JJ8C 2IBDA 2WC2A 4DNCA 2BGCA 1OKRA 4ZC3A 2FBHA 4BY7J 3CCMI 4BDZA 2KMUA 1YI2I 1IG7A 4HV6A 3E5XA 2HVQA 4W1UA 2DA4A 1QVTA 1XS9A 2L2MA 2L2OA 2EQ0A 2X1EA 2CQKA 1P2FA 2VQFE 5LLQA 2FOKA 3CF5F 2YTOA 5CVUA 2QUFA 3LA3A 2PG4A 1B59A 4ZTJA 2R7OA 2GOMA 3PQJA 2LK2A 2DTRA 2YTPA 2CSOA 4N0BA 4E6KG 1N78A 2COBA 2IS2A 2BHZA 4EJWA 1ZR2A 3GO5A 2NVYJ 2NNNA 3D5SC 2LMZA 3Q0VA 5J4VA 5DD8A 3U1DA 2P0WA 4QSHA 4KNYA 4IRIA 3DQVC 5EGOA 2NS0A 2ZNYA 2V87A 4UB8C 2YRHA 3JRHA 3KX2A 2ELZA 4N4RB 2EPMX 2AXTC 2GXGA 3P7NA 1BW6A 1FY7A 2EWNA 1MH3A 1Y6IA 1STZA 4CCOA 4CSWA 3TEDA 1H88C 3ADJA 3VEPA 3BGHA 3OYJA 3LNQA 2R1FA 2MC3A 1KJKA 4DV3E 4FX0A 5K7HA 3LL7A 2RTXA 1HNXE 5K5RA 1PP7U 3C2GA 1T4NA 3DKXA 3GZ6A 1OPCA 1P4AA 2LKXA 4DV0E 1WVRA 5DM7F 2HQRA 3OMLA 3VYTB 5EG0B 2Y0SN 2LSOA 1TWFJ 3C6MA 3HZJA 4N4OB 3AAFA 1UZCA 2KJCA 1YUJA 3BG7A 1TNTA 5HNFA 4XQFA 2DQLA 1XSVA 3GFIA 1ETWA 1PJTA 3FXOA 2DJNA 2O3FA 5ICEA 1VQKI 2EMYA 2VC1A 3V8KA 4X0GA 2HPIA 3M8FA 4EJVA 5HLIA 5CPRB 2CV0A 3L2CA 2UZKA 1O7LA 2HOAA 4L9TA 4HX4A 4UNOA 3WU0A 3SXYA 2I9IA 1SFKA 5GAEJ 4F3QA 2QVOA 1NK2P 1XTAA 1XMQE 4WXCA 2HKXA 1MKMA 1Y0NA 2MD5A 2QGUA 3F0CA 4F52A 2YPRA 3CJTB 1L3LA 2RS6A 3O8HA 4ZYGA 1U3EM 3OSGA 5LMNE 2EOQA 4JI3E 5J8FA 1MMDA 1KQ0A 4A93J 2KRCA 2EN7A 4A5MA 2XGDA 5CVVA 3AG4H 3HDDA 2R0QC 2EOIA 4AIJA 5TISC 3NEUA 4HNVA 1IN5A 1PDNC 1IBKE 2YSRA 5E8GA 5DCMB 4KUMA 2E36A 4IX7A 2Y2ZA 2GHFA 1ULYA 2HZTA 1FSEA 1UN6B 4MNUA 3JRDA 4L5EA 4GYGA 3KIOA 2VE8A 3FK7A 1BI1A 2EOZA 4WFTA 4BS9A 4DUZE 2FD5A 2FE3A 4BBYA 5JHFA 1WXRA 4P9UA 4LD5A 2BY2A 4IRHA 3CCJI 4JI5E 3IKVA 4L5JA 2V1DA 4P1WA 4V2GA 2H8RA 2EMHA 3LWFA 4XM3A 4PJJA 1UILA 3QYEA 2WV0A 1ZKGA 2ELHA 3IP4B 2OUMA 1OYIA 3G2BA 2RGVA 3V42A 1K79A 4AUXA 2Q8KA 2KIMA 3CTAA 6PAXA 4Q28A 3RQ4A 3TOBA 4EV0A 3S2WA 1WSUA 1UFMA 4OIRF 1MNMC 1AAYA 4LFCE 4D0PA 4JP0A 1B69A 2CH0A 1G3SA 4D7NA 2Y30A 3CP2A 1P4XA 5K5QA 1KYZA 1UJ8A 2K86A 3O6BB 2L2KB 4G8XA 3O2PE 1IC8A 4A3JJ 2HC5A 3EPJA 1FIPA 3FK6A 4XRSA 1R49A 2EFQA 1E3OC 5IP6A 2OC6A 1X1BA 3ADLA 2X6YA 1ZG3A 1J0RA 1TW3A 3PIPF 4Q48A 5J8CA 3GLXA 4TV7A 4A3GJ 3WTWC 1IV6A 3NRVA 1T8IA 3K1MA 1X1PA 2V79A 2M7AA 2UV1A 4NQWA 3ZOBA 5DEQA 3FXKA 1YQAA 1RC9A 2CW0F 1U9NA 4M6XA 4GYIA 4WWCA 3CC4I 4Y4RA 1XX5A 1T38A 4O5VA 4PZJA 2Z9OA 4MLVA 3A0HC 1YJWI 3DF6A 4O4KA 4NQWB 3FM3A 5HLGA 2MLKA 4FTHA 2VKHA 1HW5A 2BXZA 3GF2A 3HRSA 5E8IA 2R4GA 4NZVA 1T08B 2CUEA 1ODDA 2Z16A 5J3LA 4JI6E 2M34A 2D2WA 4U88A 4I0BA 4F91B 3CC2I 2MYSA 1D0YA 2AHQA 2KLOA 4OIOF 2A6TA 2HZDA 3GTKJ 4M9VC 1SMTA 4N9HA 1SR9A 3WGIA 4R2CA 3CCEI 3HOVJ 1KQ9A 1WCMJ 4ENNA 5AE3A 4NBQA 2R7UA 2V1NA 3KZIC 4IQ4A 4P5OA 3OYEA 1MDMB 4A3DJ 5DCFA 5A6AA 5IWAE 1B9MA 2LNBA 2EM0A 1FMVA 1OR7C 2E72A 1RNLA 5A6JA 1JUPA 1DGCA 2Y48A 2DA2A 4F7ZA 1QZZA 3OOPA 4ZYDA 2QSHX 2CW7A 3SDBA 4YY3E 2KHMA 2R7WA 2G7HA 2XAUA 1BJZA 1YYKA 1YPNA 1R4MB 2KIUA 4XKVA 3LFUA 3DLAA 4J01A 4KT6A 2NS7A 3QPSA 2X1DA 3KETA 3BWGA 1XCVA 2BBYA 2YUSA 3PFIA 3CUOA 3SZPA 2BB8A 2VF1A 2WB1N 4NHRA 2PMUA 3BY6A 3HKZN 5KNLA 1PUFB 1SMYF 2HPMA 3KLOA 1TWHJ 1RETA 2LMDA 3MD2A 3NARA 2V9VA 2K85A 2FRHA 1Z1DA 1GXQA 2QENA 3HC7A 4G7HF 3TO6A 1Z9CA 1A1GA 1YZ9A 3QU6A 3CD6I 3MEXA 3GWZA 3JCUC 3QYBA 3H92A 2L2NA 5IOYA 2XKOA 3K69A 3KZYA 2IGMA 3VWBA 2DB2A 2EMBA 1HW2A 1N34E 4XNFA 4FISA 3U1KA 3GTGJ 2IAIA 1IUYA 3IH3A 1ZR9A 1GZ6A 2DOAA 3KLNA 1TQMA 4LLNA 1X1CA 2M45A 2MD0A 4W97A 2DFEA 3WGHA 2EN3A 3IWCA 1E3HA 1X6FA 1IRXA 4R2DA 4YFNF 3HGYA 4HTGA 4I2OA 4M9ZA 3QPHA 4KMUX 1GVJA 1GT0C 3ZQIA 4DQ2A 4Y13A 4RAFA 1QBJA 4BQQA 1U9OA 1KYWA 3W6VA 2ODRD 4LU9A 1UBDC 1G3WA 1ZAAC 3BR2A 4II2A 4IXAA 1ZRDA 3F6GA 2W85A 1YYWA 2ECBA 2AO9A 2H6CA 2XAJA 4PJMA 3L00A 3L09A 2VBXA 5ILVA 2M4KA 2PEXA 2E34A 3D0SA 2N8GA 4UV8A 2CQXA 2DDBA 5B66C 1U5TC 1I27A 1XGMA 4WXHA 3BG6A 1X58A 5D5WB 3KEOA 2F8BA 2B7EA 3JTHA 5HDNA 2R3SA 2V9PA 1JKOC 2KZGA 3IH4A 2L3JA 2FOWA 3KFWX 2V8QB 1K61A 3S1RJ 2L4AA 2QF7A 3HPZA 1WH5A 5DDGA 3W2WA 5CVJA 2VE7C 4ZDLA 4ITVA 1B6AA 1MBKA 3OSFA 2GZWA 2F4IA 3QP5A 5FB2A 4KISA 4LFAE 4NB5A 5E1WA 5IP9J 4D5FA 1ETXA 2FEZA 3I9V2 5AC5A 2XGEA 4RLFA 1W7PD 2DOFA 1IXRC 1FP2A 3D5LA 4S04A 1G59A 4ENMA 3G1MA 1S9HA 2H94A 3IHUA 3GLLA 2EZHA 4DV7E 4MO7A 3S2DJ 3SZTA 1LDJA 4B48A 4RB1A 4M3GA 1NEIA 2XDVA 4HNUA 1TF3A 2LY2A 1HKTA 2ME6A 3DKYA 4CH7A 5TJJA 2OPTA 4G9YA 1WRJA 3FMSA 4P96A 1VI0A 3T5XA 1E17A 4IS1C 1FJLA 2XVCA 1WJAA 3BG5A 2EQ3A 4C9YA 1K6OA 1JTYA 4O43A 4CO8A 3J7AY 3DU5A 4YG2F 5IYBJ 3BZCA 2EMXA 4A3CJ 2E2JJ 3CCUI 1IO2A 4E7JA 2V9KA 3PL8A 3ZMDA 3F23A 3EPKA 4FE7A 5DUIA 3IH2A 2B3TB 2EIKH 1YLFA 2LV2A 3CUQA 2QQ8A 3AV0A 1WWXA 2RVCA 3CJRB 3FXMA 1ZG1A 1HF0A 4YELA 4ASNA 1ETOA 5E3LA 3K4NA 4LK0F 3GVAA 4X6AJ 2WAEA 2XIGA 4ZYHA 5GTHC 3OYCA 2LLKA 4NHJA 3ZQQA 1ON1A 2MC5A 1LKXA 1X2MA 4EJUA 1ZYRF 2LVHA 1UHMA 4ENJA 2VQGA 4R03A 1OCZH 1KGSA 2F4OB 2EL4A 3J81C 3V8JA 1RRJA 2XF6A 3FF5A 3VODA 4DZJA 2ELKA 2EPZA 1R1TA 3H5RA 2XRNA 3F8MA 4YRVA 2ADRA 4ENKA 5LHHA 3EQLF 3B6AA 3WTXC 4A5NA 3K4CA 3DP7A 3TOAA 1VQ6I 4JI2E 3N05A 1O3QA 2W1OA 4AM3A 1BR2A 3H0DA 2L8TA 1S8NA 3S1MJ 3DTEA 1LVKA 4AYBN 3CMEI 2ZJQF 2M4GA 1EH6A 1TWAJ 2EM7A 3GCMA 2NVXJ 2OZUA 5FLXK 2PN6A 1A6QA 2W57A 1YW8A 4S05A 1R36A 1BIAA 5CYVA 3RPQA 5GAGJ 4CXFA 2YX7A 3TKYA 5A2QK 2NRAC 1REPC 1PJQA 4DR6E 2JWOA 1FYLA 5K7FA 1XGOA 1Z77A 3IAS2 2HQAA 2M8GX 4UHTA 1YIJI 1T4OA 1YX5A 1J59A 5KL5A 2L02A 2IA0A 1HSJA 1MNEA 1UG0A 3KZZA 5IYDJ 5FD5A 2FXAA 1JXSA 1MMAA 2M2EA 2GA2A 1BM9A 1OCPA 2FNAA 2L7KA 3BR6A 2EPCA 2G0EA 3CJQB 3R0JA 4A3IJ 3CDHA 2ZB9A 3OYHA 2M3AA 1DP7P 3ISPA 1Y39A 4E7IA 1KU9A 2NVQJ 2XV4S 2WA0A 2I13A 1BOAA 4L9NA 1X3UA 4JX5A 5F0HA 2BW3B 2DFFA 4JOMA 1J5YA 4B8XA 2DPDA 3K2ZA 4HQMA 1QVUA 3ZMZA 1IQSA 3U21A 1QRYA 2X4HA 1RMDA 2HXOA 2LD5A 1K4SA 1D0XA 2V6EA 1WHQA 2GWRA 2JMWA 3EYYA 3P9CA 2ZM6E 2NUEA 1U8BA 2EPLX 1JT6A 5M5XJ 3Q3SA 1JK2A 1Z21A 5LRRA 3OS1A 2R93J 4AIKA 5L3FA 4MEXF 2COMA 3FBIB 2HQ5A 3VK6A 4RMNA 2A69F 1XGSA 2DW4A 3LAPA 3GTMJ 1YG2A 3JAMC 3DFGA 2RDPA 3BTIA 1NHAA 4DR4E 1J75A 1RC7A 3E6MA 3F72A 4XKWA 1DP3A 5IYCJ 2LR8A 3HOYJ 2QSGX 3BOQA 1HNZE
chains in the Genus database with same CATH topology
2D1VA 1XMKA 4EGZA 2YU3A 2PBIA 3Q5FA 1U5TB 1UCRA 2MBFA 2L54A 1QQIA 1U2WA 2QQ9A 5TRDA 3V4GA 2HGCA 1B4AA 2K4BA 1ZHFA 4EJTA 4BXUA 2JZYA 3GEZA 1R00A 2V6CA 3J81Z 2OU2A 3FXRA 4RAYA 1FPQA 4YFXF 4R8HA 3I4PA 3CJNA 3J7AO 1P92A 3QRFF 2QBYA 4JQFA 1ZREA 1Q1HA 3M7GA 2O03A 2HTSA 5FO5A 4Q4ZF 2ZJ2A 2KKOA 3ELKA 2JPBA 1QNTA 3ROUA 3R60A 1OYYA 4OMYA 3R4KA 4LMYA 1Z05A 3GXOA 1EH8A 2J5OA 5EEHA 1LNWA 1TW2A 5LHIA 5DCMA 1IN6A 1USTA 3E6BA 1TNSA 2M5WA 2KIFA 1JGSA 2JRTA 2XAGA 4HZFA 5FLXZ 1ZG5A 2VXZA 2LF8A 3N4MA 3KE2A 1R5HA 4E70A 3EUHA 4KICA 3RPUA 1GXPA 4HLYA 4YIIA 2ZMEA 3MFKA 4IVNA 4M9XA 5DUKA 3I53A 3IRRA 3E6CC 3C7JA 4LB6B 2GXBA 4LLGF 3BP8A 4LB5A 2IW5A 2EA4A 4GGGA 2NNYA 4O6JA 2CFXA 1ZARA 3WTUC 1YS7A 4BAYA 1A04A 1YTYA 1DPUA 2L3DA 2H27A 2BEOA 4EM2A 4PCQA 1TBXA 3ZPLA 1OYWA 3RI4A 3BJAA 3FZVA 4ESFA 1FT9A 3QOPA 2MLGA 4BHPA 1Z7UA 2ESNA 1BC7C 5H20A 5DV5A 3CO7C 3IWFA 3L7WA 2PJPA 4Y17A 3J81K 1OMIA 2LDUA 2HYFA 1XDUA 1FNNA 3HRMA 2VT3A 1OR7A 3DPTA 5D4RA 2OD5A 4I98B 1WI9A 3LA7A 4QLCU 1KU2A 1Y0UA 2P5KA 4MEYF 5CJ9A 4LK1F 2FA5A 3K1PA 3HSEA 3HSRA 4UV9A 2DFIA 2JTVA 3GZ5A 1IXCA 4OU0A 4ON0A 1LDKB 1W4MA 2STTA 4LFUA 4MQ9F 4MHGA 4UVBA 3RDIA 4H0EA 1BI3A 1SD4A 1O3RA 2RV8A 2FQ3A 5HVQC 4RB2C 5FFXA 2ADUA 2EFPA 4ZZDA 1GHCA 5ICFA 3M1EA 3J80K 2GQQA 2PLYA 1O7FA 2G9WA 1QZYA 2AS5F 3KP3A 3K1NA 4ZH4F 4PDKA 2A5YB 3JSOA 1FYKA 1ZLJA 2MH9A 5LGUA 1R5GA 5ERIA 4WK8F 3TDUC 4BQAA 3K9TA 3ZN1A 2O0YA 3R0AA 1MZBA 2CWEA 2G7UA 2FF4A 2K27A 2ZO4A 3JW4A 2RC4A 1PP8F 1G4DA 5D8LB 2OQRA 5L3EA 1YW7A 1ZN2A 4RGRA 3HRTA 1BI2A 2IJLA 4GCVA 1SAXA 2QZ8A 3R6SA 1MDMA 3MWMA 4R1HA 3L9FA 5HS8A 3RIRA 3EYIA 3OV8A 4B09A 2F5DA 2O6GE 2K02A 2A68F 5CLSA 1BJAA 3QU3A 5H6RA 5BPDA 4YFKF 2MH2A 5HDGA 3KP2A 4ESBA 2ACJA 1ZGJA 2A61A 4XBFA 1S7OA 2W25A 1MJBA 2CG4A 1KA8A 2E7WA 2UWMA 1FX7A 2HTJA 2CGPA 4A6EA 3RKYA 2R7DA 4LG0A 5D5UB 1KU7A 2A07F 2DQRA 4Q5SF 2H09A 1IRGA 4P9FA 3DPLC 4RB0A 4CICA 1Z6TA 2EK5A 2ZBKA 3E5UA 4RS8A 2LKPA 1DPRA 1WQ2A 4JBAA 1DUXC 2J5PA 1DDNA 2QLZA 3ULQB 1IXSB 1IW7F 3BZ6A 2ZMEB 2HQNA 3DKWA 5D5XB 4KMFA 2IA2A 3I59A 5LEKA 4L0ZB 3IC7A 4OIQF 4HDVA 3PQKA 4GO1A 4KA4A 2F5EA 3ECOA 3JAMK 3FXQA 1SD5A 2XUBA 2IRFG 5ILUA 1F9NA 3CUQC 4KT5C 5F64A 2FNPA 5F1RA 2STWA 3ABTA 1TQIA 3F3XA 3J80Z 3G3ZA 1I1SA 2VODA 1U6GA 1RUOA 5E17F 5D4SA 3LFKA 3WODF 3IRQA 1ZH5A 3LA2A 4HF0A 1R1VA 4G94A 3V7SA 3ZP5A 4L18B 2GAUA 1FYMA 2VBYA 2F5FA 2LF7A 2E1CA 3C1DA 2O61A 1R7JA 1CF7B 2P5VA 4RB3C 1SD6A 4IF4A 3ZMVA 4HBLA 1D8JA 2K4JA 1FP1D 3HOTA 1K78A 2OBPA 1P6RA 3KP7A 4RGXA 1BBYA 4AIHA 1USSA 2M30A 3MQ0A 2YX4A 1FZPB 5KK1A 1T0FA 2B0LA 4R79A 1RZ4A 5ICCA 2YR2A 4U7DA 3HUGA 4BH9A 1TLHB 3U2RA 3KP6A 2M1BA 2A6HF 1SD7A 5J6XA 1ONVA 4FT8A 3HOSA 1HKSA 2VOOA 1XSXA 2VBWA 2MA3A 1F4KA 1LVAA 2EV5A 3ZN0A 2A6EF 3EDPA 3ERED 5FFZA 3WE3A 5JVTA 3WU1B 1EV7A 2DK5A 3Q9VA 4KYWA 1R22A 3U9GA 1XDSA 3E5QA 5JFRA 2P8TA 1HKQA 2Z5UA 1Z6RA 4L9JA 1U78A 1WKMA 4EQQA 1R23A 4A0ZA 3R61A 2RNJA 4HQEA 4I01A 5BPIA 1G6NA 2QWWA 1K7AA 2DO7A 3MCZA 5ILSA 5LBQA 3TO7A 2M8EA 3IKTA 1L0OC 5L3BA 4A6DA 2OQGA 3REOA 1I5ZA 5L3CA 1YIOA 2OAZA 3BDDA 4A2UA 3JAMZ 3T8RA 3M8EA 4OIPF 3HSFA 2A3SA 4KIBA 1W7PB 2ZKZA 3W6KB 1JE8A 4EMSA 3I71A 5FD6A 3M9AA 4LJZF 1R1UA 5D5VB 4XSZF 2ZNZA 2RN7A 3VOEA 1V4RA 3WG9A 3TGNA 4L5IA 2H6BA 4ZYEA 3SFZA 4JK1X 3TO9A 1LJ9A 2XKPA 5D8KB 3ML6A 2ZFWA 4ESJA 3K0LA 3GFMA 3C18A 3TDZC 4AVPA 1I6XA 2ETHA 2Q2EA 2Z99A 5HLHA 3ZMUA 2ZXJA 3HHHA 3F22A 2DPUA 3DV8A 4GXOA 4L0YB 4WX9A 2HFHA 2DLLA 1LDDA 3GFJA 2RQPA 2V1XA 2EJRA 3I54A 3P9KA 3COAC 1XB4A 3FWEA 5L3DA 1IAWA 4KN7X 5ED4A 1K78B 3RKXA 3ZMSA 3T1BA 1XSDA 4HLXA 3LQRA 3MZYA 1I1GA 5KVRA 2XASA 1CF7A 1ZRFA 2BV6A 3WE2A 4BNCA 1S6LA 3H3UA 3MAJA 4RGSA 3RYPA 3FHZA 1AOYA 5AIPA 3C3WA 3HIFA 2FMYA 2FBIA 1O3SA 4ZZLA 2FBKA 1MGTA 2GIVA 3LAJA 2Z33A 1MJ9A 4Y15A 3QPTA 5E20A 2ISZA 2VE9A 3P9IA 5HS7A 1FBSA 5BOXA 3WTSC 5F6FA 2DI3A 3E97A 3FM5A 5D6FA 3WTVC 1LQ1A 1XN7A 4LGWA 3FX3A 4M74A 4U0WA 3ZQ7A 2HR3A 3F8CA 4XLNF 1T39A 1FBUA 4A12A 2Y75A 4KIFA 1FOKA 2XAHA 5HDKA 4BYYA 5LHGA 4IRGA 5LEJA 1ZGAA 1YFHA 2FU4A 4UVCA 4HA8A 1IN4A 5LGTA 4AWXB 1F1ZA 4HW0A 2XGXA 4HX8A 5IT9K 2IA1A 4HF2A 1H0MA 2QBYB 2O8XA 2EFOA 2HEOA 3EETA 1J2XA 2EFNA 1HBXG 4M72A 4LG0B 4EJOA 3I58A 5H6QA 4IHSA 2OA4A 2CYYA 2JT1A 3HHGA 1W5SA 3DEUA 4G7OF 5A2QZ 5FGMA 3WTTC 2Y0MA 1F5TA 2HWVA 2VC0A 4AD9A 3T0YA 5HS9A 3FXUA 4HF1A 1U5TA 2OZ6A 4UXNA 1P4WA 1ON2A 3BPVA 3QAHA 2XROA 1T2KA 4I02A 1TTYA 1S7AA 1G3YA 2HOEA 4XRFA 4A0XA 2P5LC 3HYIA 3I64A 3KP5A 2QYOA 1R58A 5E1XA 1VTNC 4ETSA 3MZHA 4IPAA 2XAFA 2W24A 4IJAA 3G73A 4RGUA 1LEAA 2L01A 5BMZA 1JHHA 4L9VA 3RTRA 4WCGA 2Z3YA 2P7CB 4PGHA 4PGGA 2VONA 3E3VA 1IN8A 5AIQA 1ZRCA 1PUEE 4KN4X 3VB2A 1KU3A 1JHFA 2BYVE 3QP6A 4EM1A 2E1NA 4HYEA 5E18F 5CVIA 1S29A 1MD0A 3F8FA 1E2XA 2Q0OA 2QQAA 3KP4A 4HAMA 4RAZA 2DU9A 5BS6A 1S3JA 3CLOA 1XMAA 3RKWA 3V7RA 1IZ1A 2DAOA 4CDGA 2FSWA 5DD4A 5K5OA 1XD7A 1O57A 4U0VA 4I7HA 2R7FA 3BPXA 4M73A 2EB7A 2F5CA 3W6JB 3V8LA 2PI0A 3WGGA 4KFCA 1IRFA 4CYDA 4FHTA 4MTDA 1KQ8A 4G6DA 3FMQA 1YS6A 4WXDA 4HOBA 3HTUA 3CUQB 1SFEA 1G3TA 1BIBA 3GX4X 5IT9Z 3NQOA 4MQVA 2M87A 4EM0B 3F8NA 4FX4A 4I0AA 4HX7A 2K7LA 5K1YA 1CGPA 1XCBA 3WTZA 4OMZA 4Q47A 3LQQA 1V3FA 2EV6A 4BHCA 2TDXA 2QM3A 2IPQX 2EFWA 2F2EA 4EGYA 1SFUA 4IHTA 4BHBA 1RI7A 2EA2A 3WTYC 1FC3A 2HYGD 2KJBA 4KIGA 4XSXF 1ZLKA 3E6DA 5E1ZB 1HW1A 5AONA 1D3YA 2P6TA 3ABUA 5L3GA 3GFLA 1FLIA 1QO0D 4G6QA 5EEGA 4UUVA 3IWZA 4WF2A 4M71A 3KEQA 2IVMA 4OOIA 3RJPA 1J9IA 3GYHX 3F8BA 1U8RA 2UXXA 3SQNA 2C6YA 1TQPA 2AXLA 2VT2A 4CZZA 4YIFA 3CO6C 1Z91A 3DF8A 3I59B 2PFBA 1QPMA 3FMRA 3HRUA 2HDCA 3O3KA 2JPCA 4MGRA 1O3TA 2DK8A 5LRSA 1HSTA 3ECHA 5IT3A 2XAQA 3KCCA 5CVRA 2HS5A 1EH7A 3F6VA 5DYMA 1B1BA 4P55A 2JSCA 2EV0A 1XGNA 1BN5A 1J7KA 3SHFA 5JHUA 1SFXA 3GUDA 4MTEA 3F6OA 4N9IA 1FWZA 2QQBA 3B02A 1AWCA 5LGNA 2GA1A 1UB9A 3JTGA 2E7XA 2RKHA 1FSHA 3IL2A 4UVAA 3T8TA 3I5UA 2L4MA 2UXNA 2VBZA 2ESHA 1W5TA 2P7VB 4K2EA 1IF1A 4QWQA 1YO5C 1T98A 1C0WA 4CHUA 2KRFA 3GW2A 3ZMTA 1T6SA 4A0YA 2WTEA 4XLPF 2WWYA 1QGPA 2DT5A 4M9SA 1D5VA 3BROA 3Q9SA 1RUNA 2BE5F 2VOPA 2HKOA 2V1UA 1B9NA 2D45A 2D1HA 2VN2A 4KDPA 4HV5A 2CO5A 1YYVA 1MJAA 4Z2YA 1W7PA 1HQCA 5ICGA 2IT0A 4HDUA 2IP2A 2ISYA 4U7BA 1YW9A 3N97A 2PQ8A 3DXJF 5HOOA 1LEBA 1FBQA 5D6EA 1D8KA 3LSTA 1BI0A 4U0YA 3F21A 3V7CA 2XHKA 3H3ZA 3RYRA 4OINF 2X0LA 1H9TA 2NAZA 2W84A 1IN7A 3BJ6A 2DBBA 4CGZA 1HXDA 4G7ZF 3BJOA 5BQTA 4I09A 3B73A 2P4WA 4M6YA 2ZCWA 1ZAOA 3JSPA 3HTSB 3VFZA 4EVIA 2P6SA 1H9GA 1BC8C 1RIOH 3TQNA 3I0TA 2NYXA 5JR3A 2FMLA 4LLLA 4O3MA 1UHWA 2PMHA 1LB2A 2WC2A 4DNCA 2BGCA 1OKRA 2FBHA 4HV6A 3E5XA 2CQKA 1P2FA 5LLQA 2FOKA 5CVUA 2QUFA 3LA3A 2PG4A 1B59A 3BOQA 3PQJA 2DTRA 2CSOA 4N0BA 4EJWA 3GO5A 2NNNA 5DD8A 3U1DA 4KNYA 4IRIA 3DQVC 2NS0A 2ZNYA 2GXGA 3P7NA 1FY7A 2EWNA 1STZA 3VEPA 2MC3A 4FX0A 5K5RA 1PP7U 3GZ6A 1OPCA 1P4AA 2HQRA 2LSOA 3AAFA 2KJCA 1TNTA 2DQLA 1XSVA 3GFIA 2O3FA 5ICEA 2VC1A 3V8KA 3M8FA 4EJVA 5HLIA 3L2CA 2UZKA 1O7LA 4L9TA 4HX4A 4UNOA 3WU0A 3SXYA 2QVOA 4WXCA 2HKXA 1MKMA 2MD5A 2YPRA 1L3LA 4ZYGA 1U3EM 5J8FA 1KQ0A 4A5MA 5CVVA 4AIJA 3NEUA 1IN5A 1PDNC 2YSRA 5E8GA 5DCMB 4KUMA 1ULYA 2HZTA 1FSEA 4MNUA 4GYGA 2VE8A 1BI1A 2FE3A 4P9UA 4LD5A 4IRHA 3IKVA 4L5JA 2V1DA 3LWFA 2WV0A 2ELHA 1OYIA 2RGVA 1K79A 2Q8KA 2KIMA 3CTAA 6PAXA 3TOBA 4EV0A 3S2WA 1WSUA 1UFMA 4OIRF 4D0PA 1G3SA 1P4XA 5K5QA 1KYZA 2K86A 3O6BB 4G8XA 3O2PE 2EFQA 1ZG3A 1J0RA 1TW3A 4Q48A 5J8CA 3GLXA 4TV7A 3WTWC 3NRVA 3K1MA 2V79A 4NQWA 5DEQA 1YQAA 2CW0F 4M6XA 4WWCA 4GYIA 1T38A 4O5VA 4PZJA 2Z9OA 3FM3A 5HLGA 2MLKA 1HW5A 3GF2A 3HRSA 5E8IA 1ODDA 2D2WA 4U88A 4I0BA 4OIOF 1SMTA 4N9HA 3WGIA 1KQ9A 4ENNA 4P5OA 1MDMB 5DCFA 1B9MA 2LNBA 1RNLA 2Y48A 4F7ZA 1QZZA 3OOPA 4ZYDA 2G7HA 2KIUA 3KETA 3BWGA 1XCVA 2BBYA 3PFIA 3CUOA 3SZPA 2PMUA 3BY6A 1SMYF 3KLOA 2V9VA 2FRHA 2QENA 1Z1DA 1GXQA 4G7HF 3TO6A 1Z9CA 3QU6A 3MEXA 3GWZA 3H92A 2XKOA 3K69A 3KZYA 1HW2A 1IUYA 3KLNA 1TQMA 4LLNA 2M45A 3WGHA 4YFNF 4I2OA 4M9ZA 3QPHA 4KMUX 1GVJA 4DQ2A 4Y13A 1QBJA 1KYWA 1G3WA 4IXAA 1ZRDA 2W85A 2XAJA 2H6CA 3L00A 3L09A 2VBXA 5ILVA 2PEXA 3D0SA 4UV8A 1U5TC 1I27A 1XGMA 4WXHA 5D5WB 3KEOA 3JTHA 5HDNA 2R3SA 3KFWX 2L4AA 5DDGA 5CVJA 1B6AA 2GZWA 3QP5A 5FB2A 4NB5A 5E1WA 2FEZA 1W7PD 3D5LA 1IXRC 1FP2A 4S04A 4ENMA 2H94A 3IHUA 3SZTA 1LDJA 4RB1A 1HKTA 5TJJA 4G9YA 1WRJA 3FMSA 4P96A 3T5XA 1E17A 2XVCA 1K6OA 4CO8A 4YG2F 3ZMDA 3F23A 5DUIA 1YLFA 3CUQA 1WWXA 2RVCA 1ZG1A 4ASNA 4LK0F 3GVAA 2XIGA 4ZYHA 4NHJA 1ON1A 4EJUA 1ZYRF 1UHMA 4ENJA 1KGSA 3V8JA 3FF5A 3VODA 1R1TA 2XRNA 3F8MA 4ENKA 5LHHA 3EQLF 3WTXC 4A5NA 3DP7A 3TOAA 1O3QA 1S8NA 1EH6A 5FLXK 2OZUA 2PN6A 4S05A 2W57A 1YW8A 1R36A 1BIAA 5CYVA 3RPQA 2NRAC 4CXFA 2YX7A 3TKYA 5A2QK 1REPC 1FYLA 1XGOA 4UHTA 1J59A 2L02A 2IA0A 1HSJA 3KZZA 5FD5A 2FXAA 1JXSA 2GA2A 1BM9A 2FNAA 3R0JA 3CDHA 1DP7P