3L00A

Crystal structure of benzylated snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
156
Chain Sequence
b'CEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 156
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l00A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3l00A01
2Z3YA 2ZNYA 2DK5A 1I1SA 2HFHA 2YX7A 2R7FA 3I4PA 1MKMA 3ZMDA 3WGGA 3CO7C 3EUHA 4Y15A 1U5TC 2MBFA 3CUOA 1FOKA 1JHHA 5D5UB 2OAZA 1LVAA 4MQVA 2MLKA 3RKXA 3QPTA 5FD5A 3M1EA 2ZCWA 1BN5A 4IF4A 3LWFA 4ZYHA 3Q9VA 4KYWA 2GA1A 2CG4A 5E1WA 1YW8A 1R5HA 3FMSA 4HV5A 2KIUA 1H0MA 5DCMA 1SMTA 4JQFA 3OOPA 4BAYA 4L0YB 3TGNA 2STTA 2CSOA 5HDNA 1XGSA 3HRMA 5KVRA 3MFKA 1XDUA 5LRRA 4WXHA 1J5YA 4CZZA 5D4RA 1FYKA 4EJWA 1TNTA 4WCGA 3GFIA 1I5ZA 4BXUA 5DUIA 4LD5A 2NRAC 3H92A 3IWZA 4A5MA 5FGMA 2GQQA 3GWZA 3O3KA 3CUQA 3TDUC 2D45A 1DPRA 1ZN2A 2EFPA 2VE9A 1T2KA 4IVNA 1IAWA 4RAZA 1CF7B 3RDIA 4I0BA 5EEHA 2O8XA 1QNTA 2VN2A 3ZQ7A 3LFKA 3F8BA 4TV7A 3SZPA 4LLLA 4HLYA 1GHCA 1LQ1A 2LF8A 1IUYA 5L3FA 4A2UA 3VOEA 4LLGF 2QBYA 1MJAA 1A04A 4G7ZF 5KK1A 4EGYA 1ODDA 3RJPA 1JXSA 4HA8A 1W4MA 4Y17A 3LSTA 5K1YA 4PDKA 1YYVA 2OD5A 1HXDA 4QLCU 2XASA 1V3FA 2XAHA 5D8KB 1BBYA 4B09A 4KNYA 3GVAA 4EJVA 4GYIA 1J75A 1BJAA 1ZRFA 4LG0A 3GF2A 5JR3A 2F5EA 1U2WA 1YIOA 5E20A 3F8FA 4Q5SF 2P4WA 4EQQA 3FXUA 5E18F 1KU2A 5HS9A 3R60A 3ELKA 3F8MA 1S7AA 5LLQA 4HV6A 5HVQC 3V7CA 3GEZA 3WTUC 1FBUA 1TBXA 2O61A 4IHTA 5HDKA 1ZRCA 1ZGJA 4M72A 1IZ1A 2HWVA 2DPDA 3K0LA 2OA4A 4AWXB 3RKWA 2W25A 4MNUA 2IVMA 5BS6A 2J5PA 2FSWA 2G7HA 3CDHA 2HYFA 3SQNA 5A2QK 2VONA 3WTSC 1UB9A 1DPUA 1T39A 1R36A 5H20A 3KFWX 2GXGA 1P4XA 1W5TA 1HKQA 4KA4A 4S04A 1RIOH 2ELHA 2HZTA 1HSJA 3DEUA 2A61A 2IT0A 4IJAA 1F5TA 3O6BB 4BNCA 4HLXA 3CLOA 2FNPA 1FPQA 4U88A 1U5TB 2CYYA 1P4WA 5DUKA 4UVBA 3KEQA 1TNSA 5FLXK 1ZAOA 1IXRC 1YLFA 3FZVA 2HDCA 4M73A 4EJTA 2A5YB 1O3SA 1XSVA 3OV8A 1R00A 4EM0B 4YIFA 3KP3A 2L54A 2CW0F 3Q5FA 4B8XA 1S6LA 3FWEA 2J5OA 3HUGA 2Z9OA 5FB2A 2FBIA 2ADUA 2MA3A 2XAQA 1P6RA 2FBHA 3TDZC 3WTXC 3MWMA 3J80K 1B4AA 4KIBA 3KZYA 3IRQA 1FZPB 1Z9CA 1KQ9A 2EA2A 1OMIA 2KIMA 1ULYA 4LK0F 5ICGA 3WE3A 4L5JA 3K2ZA 4L9JA 2B0LA 2G9WA 5E1ZB 3BPXA 4HBLA 1HW1A 4OOIA 2TDXA 2P5VA 4RGXA 2DK8A 2V79A 3V4GA 2MH9A 4OMYA 2LKPA 2WTEA 3LAPA 1O3TA 2QQ9A 1LB2A 1QGPA 3F22A 4BQAA 2RQPA 2L02A 1GVJA 1Z7UA 2UXNA 2E1NA 1BIBA 3RKYA 4KICA 1CF7A 1ZGAA 4MHGA 3L09A 2BYVE 1V4RA 1ZG1A 3R6SA 3ZP5A 4WXDA 3P9KA 4YFXF 3R61A 1O7LA 4P9FA 5DV5A 1U6GA 2IA1A 4N9HA 2RNJA 3PFIA 3I5UA 4LK1F 2A69F 4IRGA 3I71A 3EQLF 2ESHA 3HTSB 4RB2C 3GXOA 1TW2A 3C7JA 3C3WA 4XSZF 2M30A 4EM2A 1EH6A 2P7VB 1BOAA 3RIRA 4ESFA 2EFQA 3DFGA 5H6QA 2GWRA 2D1VA 2VT2A 3GW2A 1U8RA 1BI3A 3JW4A 4M9ZA 2WC2A 1HKTA 2FOKA 2K4BA 3DKWA 3H3UA 1J7KA 3KP5A 1REPC 4G6DA 1FC3A 1B9NA 5HOOA 1GXQA 2HKOA 5D4SA 4RS8A 1IRGA 1IN5A 2R3SA 3RI4A 2EV6A 5D5WB 1LEAA 3ZN0A 2OBPA 2A3SA 4L9NA 2M8EA 3BY6A 3GX4X 4CHUA 1Z6TA 3K1MA 5ILUA 3F23A 2RGVA 4WK8F 4O5VA 2XV4S 4OMZA 1F9NA 4BHPA 3ZMTA 3KP4A 2UXXA 1ZYRF 4Y13A 3BDDA 5CJ9A 3H3ZA 3QAHA 4GGGA 3ERED 4UXNA 2DO7A 1BI0A 1U5TA 1FT9A 1USTA 3J7AO 4M9XA 2Q8KA 1BI1A 4HF1A 1D8KA 4HZFA 2HR3A 1LDDA 1PDNC 4S05A 1KU7A 3VODA 4U0VA 5IT3A 4MEYF 5JFRA 1FSHA 2E1CA 2VC1A 5D5XB 2OZ6A 4NHJA 4ZYEA 3I58A 2A68F 3G3ZA 4EM1A 5LEJA 1D5VA 1K79A 1FNNA 3E5QA 2K02A 3GLXA 3V7SA 2HGCA 2JPBA 1YQAA 2H6BA 2MC3A 2C6YA 2ZNZA 5ICFA 1KU3A 2H6CA 2GA2A 3KE2A 3IC7A 5HS7A 3L00A 2V1DA 2CGPA 4CDGA 3N97A 1EH7A 3DV8A 1MD0A 1PUEE 1B1BA 3HRTA 3MEXA 4A5NA 4KMUX 3IKTA 3HTUA 2Y0MA 2X4HA 3M8EA 1AOYA 3ZMZA 2O3FA 2EJRA 2QVOA 3R0JA 3WG9A 1HQCA 2P5LC 4HX4A 4A12A 2UWMA 3I64A 1K7AA 2QZ8A 4I02A 2V6CA 4P5OA 1L0OC 2D1HA 4EGZA 1ZLKA 4OIRF 2GAUA 3BJ6A 1K78B 3HHGA 4XLNF 2BV6A 1KYZA 1P4AA 4MGRA 5DCFA 1DUXC 3DF8A 3J81Z 1IXSB 2ZXJA 1I6XA 2A07F 2VBXA 4HX7A 4Z2YA 4HDVA 1RUOA 3WGHA 2LNBA 4PCQA 2XUBA 1WWXA 3I54A 1KQ0A 1R1UA 2EFWA 5BPIA 1FX7A 2NYXA 1SD4A 1H9GA 3COAC 1RI7A 2XAGA 2YX4A 1J0RA 2STWA 3F6VA 4GYGA 1F1ZA 4BHBA 3WTYC 1XD7A 3C1DA 3QRFF 3E6CC 3HSRA 2HQRA 3ML6A 2QQBA 3WU1B 1XSDA 3IKVA 5D8LB 3GFMA 3LA2A 3ECOA 1G4DA 2FMYA 2PFBA 4R79A 2FA5A 4WWCA 1FYMA 2EFNA 3NQOA 3BP8A 5TRDA 2P5KA 3TO7A 3QU6A 2UZKA 1XGMA 3ZMSA 5CVRA 1MDMB 2LF7A 1XDSA 3WE2A 5D6FA 3VFZA 1R22A 4WF2A 2ESNA 4FT8A 2YR2A 4QWQA 1C0WA 1XGOA 2CFXA 3E6DA 2V1UA 2CQKA 5IT9Z 1XGNA 3LA7A 5DDGA 3HSEA 4YG2F 2DFIA 2DT5A 3CUQC 2EV5A 4RB1A 1WKMA 3HOTA 2H09A 1L3LA 4RGSA 5L3DA 2FQ3A 4H0EA 5LHIA 2QYOA 1G3TA 4LMYA 2HQNA 1SD6A 2PBIA 3F72A 3FMQA 1KA8A 4NQWA 4ESBA 2A6EF 1O57A 4R1HA 5CLSA 2ZKZA 3KETA 3MAJA 4RB0A 2PJPA 3RPUA 1FLIA 1KGSA 4HF0A 2RN7A 1IN6A 2IP2A 3D0SA 4ENJA 4KT5C 1QPMA 1YW7A 3RYRA 2VODA 4R8HA 3P9CA 4GO1A 5AIPA 1KU9A 2BBYA 2EWNA 4DQ2A 3DP7A 4U0WA 2W84A 5F64A 3KCCA 3WU0A 5AONA 2QLZA 4ETSA 2RDPA 2VT3A 1CGPA 4I01A 2O0YA 4EVIA 1YO5C 3E5UA 4PZJA 1RZ4A 5CVUA 2L4AA 2XROA 2G7UA 4NB5A 1HW2A 4F7ZA 2P7CB 3TO9A 2Z5UA 3K69A 4HF2A 4P55A 2RKHA 3B02A 2JZYA 4YIIA 2ETHA 2VXZA 3LQRA 1LDKB 5E17F 2DU9A 3JAMZ 1HKSA 2FBKA 3ZN1A 3MZYA 4AIJA 3L2CA 3I0TA 2JSCA 4KMFA 1FP1D 3IHUA 3BROA 1K78A 1B6AA 1R1VA 2XAFA 3K9TA 3GUDA 2NNYA 4LLNA 3DQVC 4ZYDA 4EMSA 2FXAA 2HOEA 1B59A 1IN7A 4EV0A 4YFNF 3MZHA 3HRUA 2XHKA 3E97A 1TQPA 3JTHA 1ZH5A 4UVAA 1XCVA 1I1GA 5FFXA 3F8NA 4BH9A 3U1DA 3HOSA 4I98B 1YS6A 1T0FA 2XRNA 2K27A 1K6OA 2W85A 3KEOA 2EB7A 2ZMEB 2R7DA 4BYYA 1JE8A 2CWEA 4EJOA 3ZMVA 5K5RA 1YS7A 2W57A 4Q4ZF 2DBBA 5JVTA 4ENNA 4OINF 3MCZA 2VC0A 2Z99A 1J9IA 3VB2A 4A0YA 1BC8C 1QO0D 4M71A 1ZG3A 2VBZA 2A6HF 2WV0A 4XRFA 2KJBA 1Z1DA 5JHUA 3QP5A 4ENMA 1P2FA 1EV7A 2KRFA 3ROUA 3E3VA 1IRFA 1OPCA 1R58A 5LRSA 3EETA 2RC4A 2AXLA 5CYVA 3FM5A 1OR7A 3KP2A 3QPHA 2MD5A 3CUQB 4FHTA 3KLNA 1QZZA 2PI0A 2KIFA 4IRIA 5HDGA 3FMRA 1SFEA 1UFMA 3HHHA 5LBQA 3FF5A 4LFUA 5CVVA 1SFXA 2V1XA 2DAOA 4K2EA 4A6DA 3JSOA 4KN7X 1YTYA 2JPCA 3I53A 2HEOA 1R5GA 3RYPA 2Q0OA 1KQ8A 2XVCA 1S8NA 3R0AA 1I27A 2RVCA 4AVPA 2Y75A 2P6SA 3W6JB 1FY7A 2PLYA 2WWYA 4JK1X 4LB6B 3TOAA 3KLOA 3IRRA 4P9UA 5DEQA 4UHTA 1SMYF 1TW3A 1UHMA 3V7RA 5BOXA 4HYEA 1UHWA 1KYWA 3P9IA 4KUMA 2Q2EA 3K1PA 1RNLA 2YSRA 2JTVA 1BC7C 1XMKA 1U78A 4G7HF 2IA0A 5JI6A 2NNNA 4UUVA 2K7LA 3PQKA 3J81K 2HTSA 4U7DA 5BQTA 1FBQA 1D8JA 5J8CA 3FHZA 3WODF 1U3EM 3AAFA 4I2OA 4OIOF 2E7WA 5L3EA 3WTZA 1T38A 3NRVA 1RUNA 4G6QA 4GXOA 5D5VB 2QENA 2IRFG 5LGNA 4E70A 4M6XA 5LEKA 3ULQB 2H94A 2VBWA 5DYMA 2OU2A 1XB4A 2DQLA 2ZJ2A 1S29A 1TTYA 2ZBKA 5BMZA 5ILSA 3S2WA 2X0LA 4P96A 3TKYA 1J59A 1TQMA 4ZH4F 2EK5A 5HLGA 3SXYA 5H6RA 4HOBA 5L3BA 5ERIA 2DLLA 3F3XA 5DD8A 4G9YA 2L3DA 1HSTA 1MJBA 2ZMEA 1FP2A 2ZFWA 5ILVA 1MZBA 1IF1A 1TQIA 4KFCA 5HS8A 4LJZF 2F5CA 4LGWA 2HS5A 3WTVC 4KDPA 5IT9K 1JHFA 1G6NA 5AIQA 4CYDA 3L7WA 4A0XA 3E6BA 2HYGD 5LGTA 4U7BA 3ZPLA 1BM9A 1Z91A 1IN4A 6PAXA 2PQ8A 1Z6RA 4N0BA 3V8LA 4UV8A 3N4MA 4G8XA 5E1XA 1FWZA 4BHCA 5F1RA 1FSEA 2DTRA 1WRJA 2GIVA 5LHHA 2FF4A 2FMLA 3DPTA 1QBJA 1SAXA 3C18A 5EEGA 4RB3C 3E5XA 5TJJA 1HBXG 1OKRA 4IXAA 4OIPF 4Q48A 4I09A 1FBSA 1SFUA 1W5SA 5L3GA 1PP8F 4IRHA 4PGHA 4AIHA 2M45A 2FE3A 1UCRA 2PMHA 3F21A 5J6XA 2BGCA 3IL2A 3TOBA 4M74A 4MEXF 1G3WA 1R23A 4MTEA 2JT1A 3JSPA 2F2EA 4GCVA 5ICCA 2ISZA 3ZMUA 4FX4A 1XSXA 3P7NA 3BJAA 4UV9A 1BI2A 4U0YA 2NS0A 2IJLA 3ABUA 2BEOA 3RPQA 1DP7P 4AIKA 4KIGA 3HSFA 3E6MA 5CVIA 4PGGA 1W7PB 1ONVA 2LSOA 1T6SA 3K1NA 2VBYA 2LDUA 3KP6A 2F5FA 3CJNA 5FO5A 1X3UA 1IN8A 3JAMK 1E2XA 2DQRA 3V8KA 2VOPA 3BPVA 2FRHA 4OIQF 2XGXA 3SFZA 4XBFA 2M1BA 3HIFA 3ISPA 4CXFA 3M8FA 2ZO4A 2XKOA 3ECHA 5ED4A 1F4KA 4L5IA 1OYYA 4Q47A 1MGTA 4N9IA 1QZYA 2PG4A 2HKXA 4FX0A 4L18B 1OYIA 2H27A 2EFOA 3RTRA 2COMA 3EYIA 2XAJA 3REOA 4RGRA 3CO6C 1J2XA 5E8IA 5J8FA 2O03A 3KZZA 4D0PA 2KKOA 5E8GA 2PMUA 2YPRA 1Y0UA 2QWWA 4A0ZA 2XIGA 3T8RA 4HQMA 1WSUA 2OQRA 4L9VA 3WTTC 3BJOA 3L9FA 1NHAA 1O3RA 2KJCA 4ZZLA 5LHGA 4ENKA 3EYYA 4WX9A 1O3QA 3I59B 1LJ9A 4YFKF 3BOQA 5K5OA 4CO8A 1R1TA 2OQGA 5F6FA 1LDJA 4CGZA 2W24A 3M9AA 4JBAA 3GZ5A 4ZYGA 1XN7A 1Z05A 4HDUA 1YG2A 3D5LA 3Q9SA 2CO5A 2M5WA 1WQ2A 4XSXF 3FM3A 2IW5A 5K5QA 3JTGA 5D6EA 1QQIA 3GFJA 1MJ9A 5A2QZ 2MLGA 3FXQA 3T1BA 4MQ9F 1ZREA 4M9SA 1ZARA 2Z33A 3LAJA 3T0YA 1IXCA 2IPQX 5CVJA 2EA4A 3DPLC 1LNWA 2EV0A 3GYHX 1G3SA 1ZHFA 1W7PD 3QP6A 1XCBA 5FLXZ 1BIAA 3SZTA 3KP7A 5HLIA 4KN4X 3PQJA 4WXCA 3GFLA 2V9VA 5DCMB 3MQ0A 1Q1HA 4A6EA 2FNAA 1S3JA 3TO6A 4O6JA 4CICA 2JRTA 4XLPF 1AWCA 3VEPA 1WI9A 3W6KB 2BE5F 2FEZA 2RV8A 3EDPA 4EJUA 2F5DA 1VTNC 1MDMA 3FXRA 4HW0A 3T8TA 3G73A 4M6YA 3J80Z 1OYWA 5FD6A 3LQQA 3U2RA 1SD5A 2VE8A 4IPAA 2L01A 1EH8A 2QQAA 2NAZA 2Y48A 3BZ6A 3QOPA 1E17A 4MTDA 2K86A 2YU3A 2XKPA 2E7XA 5BPDA 1W7PA 1D3YA 5HLHA 2AS5F 4I0AA 1DDNA 1P92A 4IHSA 3F8CA 3QU3A 3SHFA 1H9TA 1TLHB 1IW7F 1T98A 3HRSA 3IWFA 4L9TA 1YW9A 3FX3A 2L4MA 2D2WA 5FFZA 2QM3A 3HYIA 5LGUA 3GO5A 2ACJA 4DNCA 2QBYB 2GZWA 3NEUA 4LB5A 3WTWC 4KIFA 1XMAA 3T5XA 5L3CA 4G94A 1ZG5A 1USSA 3R4KA 1YFHA 5DD4A 1PP7U 1R7JA 3V8JA 4RAYA 1LEBA 2VOOA 4O3MA 2QUFA 3DXJF 4I7HA 4UVCA 4LG0B 2HTJA 2M87A 2DW4A 2FU4A 1G3YA 4ASNA 3TQNA 4ESJA 2MH2A 1ON1A 2OZUA 3ABTA 4HAMA 4OU0A 4G7OF 1GXPA 1ZLJA 2PN6A 3WGIA 1S7OA 4UNOA 2GXBA 2IA2A 4ZZDA 3LA3A 2DI3A 3GZ6A 4AD9A 4HQEA 4L0ZB 2P6TA 5ICEA 4HX8A 1ON2A 3O2PE 1O7FA 1ZRDA 2DPUA 1JGSA 2K4JA 2O6GE 1SD7A 1FYLA 4RGUA 3BWGA 1B9MA 3I59A 3M7GA 3CTAA 1STZA 1HW5A 3B73A 2P8TA 3F6OA 2PEXA 4ON0A 3U9GA 2ISYA
chains in the Genus database with same CATH superfamily
2Z3YA 3CCVI 2V89A 2YTPA 2ZNYA 2DK5A 4RAGA 1I1SA 1X2MA 2HU9A 2HFHA 2EOXA 1NG6A 2L9VA 3SFIA 4WSGA 4X66E 2YX7A 2ZSHB 2R7FA 3I4PA 4B3XA 1QU3A 2CQXA 1MBGA 1MKMA 3HKZA 3DEEA 3ZMDA 1LFPA 3J7ZI 3WGGA 1PKPA 4F54A 3CO7C 3EUHA 3QPSA 4Y15A 1U5TC 2MW8A 1E3OC 2EQ3A 2MBFA 1UMQA 3CUOA 4XOTA 1FOKA 1JKRC 1RR7A 2QA4I 1JHHA 5D5UB 3OYNA 3OYBA 2ZM6E 4R03A 4DR6E 2OAZA 1LVAA 4MQVA 4BGDA 2QEXI 4GEQB 2MLKA 1PDAA 3RKXA 2VQCA 1UZCA 2R1FA 3QPTA 5FD5A 4YY3E 2EL5A 1JT0A 3AG2H 1RRJA 1R9TJ 3M1EA 2LJHA 2NABA 2RS7A 3IUOA 2ZCWA 2VQHA 1BN5A 1ENHA 5ADZA 2R5ZB 1E3HA 4PFPA 2DGCA 1TWHJ 4IF4A 2CW7A 3LWFA 3NARA 3OY9A 1TF3A 5BR8E 1YITI 5A6BA 1ETVA 4ZYHA 5LD2C 2YU8A 3Q9VA 3HPHA 3UNGC 4B4CA 5M3MJ 4KYWA 1A35A 1PYVA 2GA1A 2JWTA 4HRIA 2LC2A 2CG4A 5E1WA 3EUAA 1YW8A 5K7ZA 2FV4B 1TP4A 1R5HA 2D9HA 2BY2A 3FMSA 2CQ7A 2KIUA 4HV5A 2NA2A 1H0MA 2LG4A 2HVRA 1RKWA 5DCMA 3L2WA 1SMTA 4JQFA 2P81A 3OOPA 4BAYA 4L0YB 4CCMA 3N05A 3TGNA 4GFBA 4JI1E 3DBLB 2STTA 2Y9YA 4PUSA 2VPRA 2CSOA 5HDNA 1XGSA 3HRMA 5KVRA 3MFKA 1RC7A 3CMAI 2L7FP 1R5ID 2NS8A 3VHTB 1XDUA 2K9SA 5LRRA 4WXHA 3HKZN 1J5YA 2DTZA 2DMQA 4CZZA 5D4RA 1FYKA 2YWQA 2V83A 4EJWA 4IKFA 1M1EB 1TNTA 4E6KG 4WCGA 3WU2C 3GFIA 1I5ZA 2JA6J 1RETA 4LFCE 2WAQA 4JI8E 3KYLA 4BXUA 5EGOA 5DUIA 4JYKA 2HI3A 4LD5A 4IHXA 4IHYA 1DP3A 4LFAE 3KX2A 4XLEA 2NRAC 2B7VA 4BBYA 3G1MA 2OCCH 2CUZA 3H92A 2HZDA 3IWZA 3CJRB 4YEJA 2EPXA 1YRNA 2EOHA 4A5MA 1H88C 1STUA 1T33A 3KYCB 4MFDA 5FGMA 2GQQA 3GWZA 3O3KA 4PK4A 1BW6A 3CUQA 3TDUC 2EOEA 2D45A 1N34E 2JPAA 1RESA 3X2QH 1DPRA 4S0HB 1ZN2A 2EFPA 4JP0A 2R7SA 1PJQA 4RH8A 2VE9A 1T2KA 5E79C 3ZQHA 2E60A 4IVNA 4DYRA 3ZQQA 1IAWA 3DKYA 4RAZA 4BQNA 4DW6A 1CF7B 3CJTB 1YZ9A 3RDIA 4I0BA 5LFAA 3OMYA 5EEHA 1X3CA 5FLVA 1VQ5I 1JK2A 3QODA 2JK3A 2X1DA 4IQJA 1GQEA 2NVTJ 2W00A 4E7SA 2O8XA 1QNTA 2BY0A 1SC7A 3OYEA 3ZQLA 2VE7C 1IQOA 2VN2A 3ZQ7A 3LFKA 3F8BA 4TV7A 3SZPA 4LLLA 4PJMA 2GXAA 4E7IA 1UHSA 2CSHA 4HLYA 1GHCA 1LQ1A 2LF8A 3K2AA 1IUYA 3HB9A 5L3FA 5IP6A 3PJRA 4KISA 4TUIA 2COBA 2Q8UA 4A2UA 3VOEA 1JKQC 3A0HC 4LLGF 4YELA 2QBYA 1MJAA 4R2AA 4DV7E 5F04A 1A04A 1ORKA 4G7ZF 5KK1A 4EGYA 3S16J 1UG2A 1ODDA 2FOWA 2YTJA 2HGHA 3RJPA 3KWRA 2L3CA 1JXSA 4CH7A 4HA8A 1W4MA 3H1CA 3MVPA 4Y17A 4A93J 3LSTA 5K1YA 4PDKA 2YRMA 1I50J 1YYVA 1OCZH 5IWAE 2OD5A 2EMGA 2N8GA 2CRGA 2ZB9A 5EZHA 3RZDJ 2ENAA 5JLWA 1HXDA 4QLCU 3U1KA 2XASA 1V3FA 3OYMA 4DV3E 3TW6A 2XAHA 5D8KB 1BBYA 4B09A 3CCLI 1H89C 1BJZA 4KNYA 3GVAA 2EOFA 4EJVA 4GYIA 3C2HA 1J75A 1FKAE 3OYAA 2YU5A 2QSHX 1BJAA 1ZRFA 4LG0A 1AKHA 2R0QC 3GF2A 5JR3A 4TUGA 2ECCA 1ZR4A 2F5EA 1U2WA 1YIOA 5J1UA 1UELB 2LBSB 2EM8A 3DF6A 4HSTA 5E20A 2XSDC 3F8FA 4Q5SF 2P4WA 3OIQA 4EQQA 3FXUA 4LU9A 3NAUA 1V54H 5E18F 2EQ1A 2YRHA 1KU2A 2W1OA 5HS9A 3R60A 5BNGA 2ZFUA 3ZQCA 3M3YJ 3OIOA 3MMYB 3UK3C 1N3GA 2ODRD 3ELKA 3EPKA 2FQ4A 3F8MA 1LKXA 4IO9F 3S1MJ 2DLQA 1F2IG 1SAUA 1DI2A 1S7AA 3S3OA 1JKPC 1K4TA 5LLQA 1HNZE 2PX9A 4HV6A 3AV0A 5HVQC 3V7CA 2DMNA 1KYQA 3GEZA 3WTUC 2E36A 3OYLA 1N33E 1FBUA 1JUMA 3KEYA 1TBXA 2O61A 1NG7A 1OCTC 4IHTA 4DYCA 5FKOA 5HDKA 1ZRCA 1ZGJA 2R5YB 2AXTC 4M72A 1IZ1A 2WZOA 4OWRB 2CUFA 2L2KB 2HWVA 2WY7Q 1EKEA 2DPDA 3K0LA 3FXJA 3ADGA 2YTEA 1TT5B 4LTYA 2OA4A 2X51A 3JRHA 4AWXB 3RKWA 2W25A 4MNUA 2IVMA 3VSKA 2F6CA 4QIWN 1OCCH 3LSKA 5BS6A 5IP9J 4D9JA 1LUJB 2J5PA 2FSWA 2VKVA 2G7HA 3CDHA 2HYFA 3SQNA 4DZJA 5A2QK 2VONA 3HTXA 3WTSC 1UB9A 2QF7A 1DPUA 1T39A 1R36A 5H20A 3KFWX 2GXGA 1AH5A 1P4XA 1W5TA 1HKQA 1VQNI 2EN8A 4KA4A 3LLHA 2Y69H 4S04A 1RIOH 2ELHA 2HZTA 1HSJA 3DEUA 2DN0A 1QPIA 3O8HA 2A61A 2IT0A 4IJAA 1F5TA 3O6BB 3CMEI 4BNCA 3OYDA 5GAHJ 5IOZA 4HLXA 4NC6A 3CLOA 2FNPA 1MEYC 1Z7LA 1JJ8C 2JUCA 1ZR2A 1FPQA 4U88A 2MGQA 3LSJA 1U5TB 1J26A 2CYYA 4CYCB 1P4WA 3PM1A 5DUKA 1SVOA 4UVBA 3KEQA 3CCEI 1TNSA 2KHXA 5FLXK 1YI2I 1W0TA 2N3HA 5KL5A 3QQAA 4NZVA 4ANJA 1ZAOA 1IXRC 2R7XA 1YLFA 3FZVA 3DCFA 2HDCA 4M73A 4EJTA 1G2HA 5J3LA 2A5YB 1SR9A 1EF4A 4JX5A 1ETXA 1O3SA 1DGWY 1XSVA 2M4IA 4Q35B 1VQMI 3OV8A 2UUZA 1R00A 2AO9A 3ZXSA 4EM0B 4C30A 4YIFA 4UB6C 3FISA 3BG5A 2I8DA 3KP3A 3MZ8A 2L54A 2CW0F 3Q5FA 4BC9A 5KL6A 1A1IA 5B1BH 4B8XA 3CD6I 2R5ZA 1S6LA 3CMMA 3CESA 4LOCA 1ACIA 2IGOA 1DQUA 3FWEA 3IWDA 3K4NA 3L2VA 2J5OA 3F0CA 4ZTJA 1IRZA 2KP6A 4QPOA 3HPGA 2BB8A 4M2ZA 2NS7A 2JA7J 2LP0A 3HUGA 4FASD 2DA4A 4JYAE 2Z9OA 4DBRA 3H5NA 5FB2A 2FBIA 2EE8A 5JLXA 2ADUA 2MA3A 2XAQA 1X6FA 5FLMJ 1JJ6C 1P6RA 2FBHA 3TDZC 3WTXC 3MWMA 2ZXIA 3J80K 1PUFA 1B4AA 2JOXA 1A1HA 3ZQGA 2Y9ZA 3I4MJ 2QQ8A 4KIBA 3KZYA 1R71A 3IRQA 2RS6A 4IZZA 1FZPB 4B48A 1N75A 1BW5A 4UY8I 1SFKA 5HODA 2JA2A 1Z9CA 1KQ9A 5EEAA 3JRAA 2EA2A 1OMIA 2KIMA 1ULYA 3H09A 4LK0F 3HGGA 5ICGA 5TGTA 1SFOJ 3WE3A 2EM2A 3S93A 2EM9A 2XF6A 1OQYA 3OSFA 3HDDA 2EPOA 1IDYA 3BQZA 2IBDA 4L5JA 3K2ZA 4L9JA 3MKYB 2B0LA 2G9WA 2ME0A 2V6EA 5E1ZB 3J7AG 2BY3A 4X62E 2YS9A 4IOAF 2EPMX 3BPXA 2JJ7A 1WI3A 4HBLA 1HW1A 2XGEA 2VKHA 2WBTA 4OOIA 4D7NA 3K4KA 2Z2SB 3HQ1A 4F6NA 2TDXA 4BEHB 2ME6A 2P5VA 3H0GJ 3M4OJ 4RGXA 2DK8A 5HNFA 2V79A 3V4GA 2MH9A 1YJWI 4OMYA 2LKPA 4E4HA 3JRGA 1GZ6A 4DR4E 4XN3A 1QHHD 2VI6A 2WTEA 3VK6A 3LAPA 1O3TA 2QQ9A 1LB2A 1QGPA 1WJDA 1X3ZB 2EMFA 3H9QA 4QTRA 3F22A 2I9IA 4PJLA 2E2IJ 2WBUA 4XLCA 3S2HJ 1Z3XA 2W82A 5EF6A 4BQAA 2RQPA 2L02A 1GVJA 1Z7UA 2UXNA 1MSEC 4BJ6C 1D0ZA 1XG1A 2E1NA 1YUJA 1BIBA 3RKYA 4KICA 2YTIA 1CF7A 1IBKE 1ZGAA 4MHGA 3L09A 2XB0X 5GADJ 3BTIA 3CC4I 4A3IJ 2BYVE 1V4RA 4XMYA 5EDNA 5EYRA 1ZG1A 1MMSA 3SDGA 1YJNI 1K4SA 2JA5J 1X3WB 5J40A 3R6SA 2CS3A 3ABMH 3CP8A 3ZP5A 4IJDA 1WCMJ 4WXDA 3P9KA 2X1CA 4YFXF 3D5SC 5EZGA 4GRIA 3R61A 1O7LA 3LOCA 4P9FA 3ZR8X 2EIKH 4PSWA 2R92J 3KZIC 5DV5A 4AYBN 1U6GA 4LG3A 4C3HJ 2IA1A 4N9HA 2RNJA 3I3LA 3ABKH 3PFIA 3I5UA 3Q0UA 4LK1F 2A69F 4IRGA 2HDDA 2BHYA 3I71A 4MLVA 3EQLF 2ESHA 3HTSB 4HG2A 4RB2C 3GXOA 3RCOA 1TW2A 2CU7A 1A6QA 2HOTA 2VJIA 3C7JA 3Q0WA 1Z67A 3I56I 3C3WA 3JRCA 4XSZF 4C2MJ 2M30A 2WAEA 2CH0A 3C4TA 1YPNA 2EN4A 3F9KA 3FKIJ 3K4MA 4G6TB 4EM2A 1EH6A 5FLXC 1U9OA 1I3AA 2P7VB 2GBYA 1BOAA 1MMNA 1WJAA 3HPSA 2UV1A 3RIRA 4ESFA 2DA2A 4DV4E 2ZJPF 3J7YJ 3DTKA 1JT6A 5J1RA 2UUAE 1T95A 1MNDA 1MSFC 5IPAA 2EMWA 3D1NI 3IWCA 2EFQA 3GZNB 3DFGA 5H6QA 1OCOH 2GWRA 1FOXA 4J19A 1T0FC 2D1VA 2VT2A 3GW2A 3DJWA 3BR3A 3PIOF 4C3IJ 2JY9A 3WHBA 1I6HJ 1U8RA 1BI3A 3GTOJ 3JW4A 4M9ZA 2X85A 1LVKA 4FETA 2WC2A 1HKTA 2FOKA 5E3MA 2FUG2 2W4SA 2IEKA 2K4BA 3DKWA 2LRSA 2L92A 1Z3YA 3H3UA 1VQPI 1J7KA 3KP5A 1VZ0A 2M7QA 2EMBA 5GP9A 2DDAA 1REPC 4G6DA 4DUZE 3HXLA 4Z6YA 2CMPA 2VF1A 1FC3A 1B9NA 5HOOA 1GXQA 2VPLA 4B3TE 1FIAA 2HKOA 3QYEA 3J80C 4O5GA 2X9DA 2R5YA 1QVUA 1TWAJ 5D4SA 5E3NA 4RS8A 1B8IB 1IRGA 1IN5A 4BJTA 2R3SA 3RI4A 4F2JC 2EV6A 4NXME 2LFBA 5D5WB 4F6MA 3OS0A 2L8TA 1LEAA 3ZN0A 2OBPA 2A3SA 1NEIA 4L9NA 4GZNC 2AHQA 2M8EA 5LMUE 1ZR9A 3BY6A 3GX4X 4CHUA 2EMCA 2I10A 2XGCA 3TEDA 2M7AA 3S1RJ 1Z6TA 3K1MA 2VKDA 5ILUA 4I99C 3F23A 2RGVA 4BQOA 1MMDA 4WK8F 2ID3A 4O5VA 3BIDA 2XV4S 1P7IA 4OMZA 5CPRB 1F9NA 2OV7A 4BHPA 3ZMTA 2VL8A 3BQYA 3KP4A 3HOXJ 2UXXA 1ZYRF 4Y13A 1BA5A 2Y0SA 3BDDA 3JCUC 1MNEA 1MBKA 5CJ9A 2YTDA 1TC3C 3H3ZA 4YHHE 5J4VA 3QAHA 4GGGA 5KAIC 3C6KA 3ERED 3K6GA 2I5UA 4UXNA 2DO7A 1BI0A 4IHWA 1YX3A 1L4SA 1U5TA 4DV6E 2RTXA 1FT9A 1P7JA 1USTA 3J7AO 1JUPA 1QHGA 2JQ7A 3LL7A 1Z0XA 4M9XA 4M3BA 2Q8KA 1BI1A 4AC0A 5IOYA 4HF1A 3PO3J 1D8KA 4HZFA 2HR3A 3VDXA 1LDDA 4BMJA 1PDNC 2RQLA 4S05A 3VPRA 4JI2E 1B69A 3FXKA 1KU7A 3VODA 2CTDA 4U0VA 5IT3A 3FK6A 4JX6A 4MEYF 5F0CA 5JFRA 1FSHA 3JTZA 2E1CA 3FIGA 2VC1A 3VYXA 5E3LA 5D5XB 3JR9A 4XM3A 2EPLX 2OZ6A 4NHJA 4X8WA 4FTHA 5AC4A 5A6BD 1ZAAC 4ZYEA 2L2MA 1EKZA 3H5AA 3I58A 4P78A 2DSYA 2A68F 2EOYA 2EOIA 3G3ZA 4EM1A 3BG6A 2ZC2A 5LEJA 4DR3E 1FTZA 1D5VA 1IO2A 1K79A 5A69A 3VYRB 1FNNA 1XMQE 1BR2A 3E5QA 3PNVA 1R6RA 2HPIA 2K02A 2GIZA 3GLXA 2HQ5A 1FIPA 4D7MA 3HOZJ 3V7SA 4G12A 1ETOA 2E1MB 2HGCA 2JPBA 3DTIA 2M9AA 1YQAA 5IP7J 4XR6A 4A3MJ 2H6BA 1U8BA 1NK2P 1TL8A 1YHQI 2MC3A 4M3DA 2C6YA 2ZNZA 5ICFA 4KT6A 4DR7E 1LE8B 1KU3A 2H6CA 1YYOA 2FGGA 5C4JJ 2GA2A 1MW7A 2VJ4A 3KE2A 3IC7A 5HS7A 2JR1A 3L00A 2Y0SN 2EOMA 4HSRA 2EMAA 2R7ZJ 1PJSA 2V1DA 1O0WA 2CGPA 4CDGA 2HOSA 2EQRA 1EH7A 2HOAA 3DV8A 2EZKA 3N97A 3SJMA 4QSHA 1MD0A 2CFOA 2M0MA 2EN7A 1PUEE 1B1BA 3HRTA 3MEXA 4A5NA 3RSNA 1NK3P 3TL4X 1ITYA 4KHPE 4KMUX 1BL0A 1BR4A 5M3FJ 3FBIB 5EG0B 3IKTA 1DU0A 2LVHA 1UILA 2MC5A 3OYIA 2DMYA 3HTUA 4E7HA 2DCEA 2Y0MA 2VQEE 2X4HA 2DT6A 1X5WA 3OYCA 2K9MA 2JSPA 3M8EA 1AOYA 3ZMZA 2O3FA 2EJRA 1GT0C 2QVOA 3R0JA 2BZTA 4N4NB 3WG9A 2OC6A 2UU9E 1HQCA 2P5LC 2UXBE 5KNLA 5E3OA 4HX4A 1X58A 4RBOA 4ZDLA 4A12A 2IS1A 4BC7A 1I39A 2UWMA 1GLNA 2HXIA 2WB1N 3FIWA 4ABZA 4LF6E 3IH4A 2HYJA 3I64A 5B5EC 1K7AA 4Y3OA 2QZ8A 4I02A 2V6CA 4P5OA 1L0OC 2DIXA 4R2SA 3A01B 2D1HA 4EGZA 1RPWA 2JUGA 4XLHA 1ZLKA 4OIRF 2GAUA 3BJ6A 3B6CA 1K78B 2YPNA 3HHGA 2EN1A 4GKJE 4XLNF 4FK5C 2BV6A 2LV2A 1KYZA 1X47A 1P4AA 4MGRA 2LD5A 5DCFA 2WY8Q 2EM7A 3BT9A 3PO2J 1DUXC 2LY9A 4ZDOA 3DF8A 4RAFA 3J81Z 1GDTA 1IXSB 4D5FA 2ZXJA 2YTOA 2M34A 1I6XA 2A07F 2VBXA 4HX7A 2WV1A 4BL0B 1OLTA 4Z2YA 3MD2A 4HDVA 3HBLA 3P1XA 1RUOA 3WGHA 2EOOA 2VJJA 1LPQA 3BC8A 1ZGWA 4ZDPA 3UKGA 9ANTA 2KIQA 2LNBA 5J1YA 5KCMA 1WHQA 3K70C 4OOGC 3GTJJ 2M3AA 4PCQA 2XUBA 1WWXA 3I54A 1KQ0A 4BE1A 3RMPA 1OFCX 2LOOA 1R1UA 2EFWA 5BPIA 1IBME 1FX7A 2VJ5A 2NYXA 1SD4A 4C2TA 1H9GA 4BE2A 3COAC 3G1LA 4BXXJ 1E3PA 1RI7A 2XAGA 2YX4A 3BLYA 1OCRH 5T6JA 1J0RA 3A03A 5HLTA 2LCEA 5FROA 2STWA 4F93B 1NCSA 1TN9A 1VQKI 3F6VA 4GYGA 4IEJA 2EJ4A 1F1ZA 2ZMEC 4BHBA 5KL3A 3WTYC 2YSOA 2TCTA 2VKEA 1XD7A 3C1DA 2K5CA 3QRFF 2DA6A 3K10A 3E6CC 2Z16A 3HSRA 2YT4A 3OTOE 2HQRA 3ML6A 3H0DA 2QQBA 3WU1B 1XSDA 2W7NA 3IKVA 4HPQA 5GPAA 5D8LB 4EATA 3GFMA 3LA2A 3L2UA 3ECOA 3H36A 1WH5A 1G4DA 1D1CA 2YTNA 2YTFA 2FMYA 2PFBA 2LK2A 4R79A 2FA5A 4WWCA 1FYMA 2EFNA 2NVYJ 3NQOA 1IMUA 1W36C 3BP8A 4OX9E 2JWOA 2WAQN 1B8IA 2EQ0A 4WSPA 1WJEA 5TRDA 2P5KA 3TO7A 3HOYJ 1A1LA 3DEWA 4F9CB 3CC2I 3QU6A 2UZKA 2QCOA 2ZJRF 1XGMA 3HOWJ 3ZMSA 1X4OA 1MH3A 3ABLH 2KISA 3BCBA 5CVRA 1MDMB 2LF7A 1XDSA 5GPCA 3JREA 3WE2A 3RPUD 5D6FA 2NXNB 3VFZA 1R22A 4WF2A 2ESNA 2PJRB 1OISA 4FT8A 2QGUA 1A1JA 2LY1A 2YR2A 4QWQA 4DKKA 1C0WA 2BW3B 2W48A 2RPCA 1XGOA 3HM5A 2ADRA 3QG5C 2CFXA 3E6DA 3GBGA 1ETYA 2IXSA 2CQKA 2V1UA 5IT9Z 1XGNA 3LA7A 3TP0A 3HSEA 5DDGA 3SEZA 1XMXA 2DYRH 2MDGA 3FXMA 1BOBA 1HF0A 2VRDA 1IV8A 1WVRA 2Y2ZA 3CCRI 1IUFA 4YG2F 3GTLJ 2DFIA 1IV6A 2DT5A 2H8RA 3CUQC 2WCC3 4OAYA 3MKWB 4PFOA 2EV5A 2Y30A 4CCOA 4N4RB 1X19A 2CQNA 1HOMA 2XSJC 4RB1A 3QPLA 1FJLA 1WKMA 3HOTA 1WFXA 1Y56A 1Z21A 4A3CJ 2H09A 4GKKE 1L3LA 4RGSA 5L3DA 3BBGA 2FJ1A 1V55H 2FQ3A 3EPLA 4LF7E 4BXFA 3B6AA 4H0EA 5LHIA 2BBGA 4BKXA 2LT7A 2QYOA 4XKVA 2GOXB 1G3TA 4B47A 2K3PA 4LMYA 4N4OB 2HQNA 3OSGA 1SD6A 4HTGA 2PBIA 4R2PA 3DLLF 2QKLB 5HNHA 3F72A 1YUIA 3FMQA 3SYTA 2EPUA 4PSXA 4UUSB 2DOEA 1KA8A 2UXDE 1VQLI 4NQWA 3J7Yp 4ESBA 3U21A 4JI7E 4V19K 4C3JJ 1X6HA 1O57A 2A6EF 4R1HA 5CLSA 2EN3A 1YYWA 1ZK8A 1ZBTA 2ZXHA 2ZKZA 3KETA 3OL4A 1GTKA 1QVTA 1I94E 2YSPA 3IAM2 3MAJA 1MH4A 3PFYA 4XONA 2BXZA 4BUPA 2M9HA 4RB0A 2PJPA 3J7AY 3RPUA 1FLIA 2IHR1 2VIXA 1KGSA 4HF0A 2RN7A 2HDWA 2KONA 1IN6A 2IP2A 1ZBQA 3I4NJ 2E19A 2V88A 3D0SA 5IT9C 3K6QA 4AIDA 4ENJA 4KT5C 3FBNB 3DKXA 1QPMA 2NVUB 1YW7A 2XAUA 3RYRA 3ADLA 2VODA 2M1SA 3EQ1A 3JRBA 4IS1C 4R8HA 3P9CA 2GLOA 2KRCA 2O8KA 4II2A 4GO1A 5AIPA 3EUKL 3DLAA 4LF8E 2K7IA 1KU9A 2BBYA 2EWNA 3FKJA 1O4XA 2PMZA 1WJPA 3ZRGA 4DQ2A 4M0VA 3DP7A 4U0WA 2W84A 1ZELA 5F64A 3KCCA 2ZJQF 3C6MA 4BU2A 3WU0A 5AONA 2QLZA 4ETSA 2EOJA 2RDPA 2M7BA 1D5YA 3NWSA 2VT3A 2EZLA 4PJJA 4BDZA 5EG0A 2CV2A 4LFBE 3T1HE 1CGPA 2X48A 4I01A 3CMYA 4A3EJ 4XICA 2O0YA 4EVIA 2MYSA 1YO5C 4A3LJ 3E5UA 1U0JA 4PZJA 2LTRA 2EBIA 1RZ4A 2F48A 5CVUA 2LUQA 2L4AA 2Q2EB 2G7UA 2XROA 4NB5A 3HC7A 1MIJA 2YUSA 2EH3A 1HW2A 4F7ZA 2P7CB 2L5QA 3TO9A 4RA2A 2Z5UA 2VB6A 3K69A 4HF2A 4P55A 1X2NA 3C2GA 2RKHA 3B02A 2JZYA 4C2UA 2IGMA 4YIIA 2ETHA 2VXZA 3LQRA 1ETWA 5GAEJ 4XRMA 1LDKB 2E1MC 5E17F 2DU9A 2E71A 3JAMZ 4X1EA 3BG9A 1HKSA 1V5EA 1IBLE 3OS2A 2FBKA 5AE1A 3ZN1A 2WADA 3MZYA 4AIJA 3A01A 4XLFA 3L2CA 1XTAA 3I0TA 2ZSIB 3OL3A 3PUBA 2JSCA 2RAEA 4R2RA 4KMFA 1FP1D 2E5NA 3IHUA 3BROA 2L9RA 1K78A 1N78A 3F6HA 1B6AA 1R1VA 2XAFA 3K9TA 2K9QA 3VWBA 3JRFA 3GUDA 4KJZA 1KONA 2NNYA 2KHMA 1K83J 2E5ZA 4LLNA 3A4CA 4XRSG 3CP2A 3DQVC 4Y52J 2PMZN 2L3JA 4ZYDA 1GVDA 2R7QA 3CDIA 4EMSA 2FXAA 2ZXWH 2HOEA 1B59A 2NVQJ 2V4JC 1IN7A 2EPCA 4EV0A 2UUCE 3VYYA 4A3KJ 2EP3A 4YFNF 3K4CA 4KZSA 3A2KA 3MZHA 3HRUA 2XHKA 3E97A 1JKOC 1G59A 3OYHA 1TQPA 2YTQA 4NDLA 2YU9J 4X0GA 3JTHA 2ODRC 1ZH5A 4UVAA 2PRTA 4LIVA 2X6XA 2F4VE 1XCVA 1I1GA 2VQGA 4BBRJ 3M1CA 3BF2A 1FMWA 5FFXA 1QRYA 5GTHC 2M0CA 3F8NA 4BH9A 2LE2A 3U1DA 3HOSA 2MFZA 3JAMC 4I98B 1G2DC 2MD0A 3HOVJ 4BE0A 1YS6A 4DZPA 1T0FA 2V8QB 1VFCA 2XRNA 3OYKA 4UB8C 2K27A 3LSGA 1K6OA 2W85A 3VYSB 4JX4A 3KEOA 2EB7A 2V9PA 5IV8B 2ZMEB 2VQFE 2N8XA 2R7DA 4BYYA 1JE8A 2CWEA 4EJOA 3TW7A 3ZMVA 3KPHA 5K5RA 2EM5A 4O24A 1J5EE 1YS7A 2W57A 2XPWA 4Q4ZF 2DBBA 5JVTA 4ENNA 4ITVA 4OINF 3PIPF 3MCZA 2VC0A 1R4MB 4B3ME 4E7JA 2O5RA 2K4VA 1YOVB 2CT1A 5K7FA 4Y33A 2CW8A 2Z99A 2H1LA 3BCAA 3VB2A 4A0YA 1J9IA 2FTXB 1BC8C 3PUFA 2IGKA 1QO0D 2O9LA 4M71A 1ZG3A 2KZVA 2XF5A 4ZJZA 2VBZA 2A6HF 2YTGA 2EILH 2WV0A 4XRFA 1IJWC 2KJBA 1IGNA 1Z1DA 1AHDP 5JHUA 3I55I 4E7ZA 3ERMA 3QP5A 4ENMA 3ADJA 2EZHA 1P2FA 1XX5A 1EV7A 1SANA 2XPVA 2KRFA 3IWBA 3ROUA 3E3VA 3FHNA 2YZTA 1IRFA 1OPCA 1R58A 3W3CA 3DU6A 5C3EJ 1X1CA 4F92B 2HC5A 2L2OA 1N36E 4XQFA 5LRSA 3H9JA 3EETA 2MDRA 2RREA 1SEUA 4NC8A 1VQOI 2RC4A 1WJBA 2DYSH 3H3VK 1ZKGA 2AXLA 4FISA 2EOQA 2EOZA 5CYVA 1Q1VA 3FM5A 1XPXA 1OR7A 3KP2A 3QPHA 2MD5A 3CUQB 1D1AA 4FHTA 3BR2A 3KLNA 1QZZA 4R2EA 5M5WJ 1IG7A 2PI0A 2BOLA 2L9NA 2RNGA 2KIFA 4IRIA 2JXPA 2R7RA 1DU6A 2GHFA 1YYKA 1WPKA 5EJCA 2EMIA 5FJ8J 5HDGA 1A1FA 3FMRA 3D5RC 4BDYA 1HNXE 2HQAA 1SFEA 1D1BA 2L7KA 4FQGA 1LFBA 1UFMA 2EM6A 3AL0B 3HHHA 5H2FC 4U87A 4ZYAA 3PNTA 1B72B 5LBQA 1QU6A 3FF5A 4LFUA 5CVVA 2KPMA 2BXYA 1EA3A 1SFXA 3JRDA 2NVXJ 2V1XA 4Q28A 3Q3SA 2DAOA 4I8OA 4K2EA 1POGA 2KOUA 4A6DA 3JSOA 4KN7X 1YTYA 1MMGA 2CUJA 4UUSA 2JYAA 2EMYA 2VXDA 2JPCA 1Z1BA 2XC7A 3I53A 2KDOA 5DM6F 2HEOA 1X1BA 1XC5A 2KFDA 1R5GA 4A3DJ 3RYPA 1WJ5A 2Q0OA 3LSMA 4JI5E 4NXNE 2KQRA 4L8NA 1KQ8A 2XVCA 1FTTA 2L33A 1S8NA 3R0AA 2E2HJ 1I27A 2VQLA 2E34A 4LF5E 2RVCA 4AVPA 2Y75A 2P6SA 1R49A 3W6JB 1X1PA 3M07A 1TWGJ 5J4YA 2AQFA 2JP9A 1FY7A 1A36A 5DS9A 4F52A 2OTLI 2PLYA 2I13A 2UXCE 2Y31A 2WWYA 4P7DA 2EN6A 4XRSA 2A05A 4JK1X 1AKHB 1XNRE 4CYCA 3S1NJ 4F91B 3G2BA 4LB6B 3PNYA 3TOAA 3DWLE 3KLOA 1V5FA 2ENCA 3IRRA 4P9UA 1WH7A 1FOYA 5DEQA 4RDUA 3HG9A 3HGYA 4RM3A 4UHTA 3K4LA 1SMYF 4DR5E 4L5EA 3S17J 1GUUA 1TW3A 2MC6A 1UHMA 2XPUA 4M30A 1JTXA 3W6VA 4WFTA 4DJAA 2EN2A 3V7RA 3OR2C 5BOXA 4HYEA 1UHWA 3BR0A 1KYWA 2MC4A 3P9IA 3K4JA 4KUMA 2Q2EA 3S14J 3K1PA 2IAIA 1RNLA 2YSRA 1BBOA 2JTVA 3HL2A 1BC7C 3VSLA 2V26A 1XMKA 1U78A 4G7HF 2WAFA 2IA0A 5JI6A 2NNNA 4CCNA 2A6TA 4GDFA 4UUVA 2ELJA 2K7LA 4F55A 3OS1A 1UBDC 3PQKA 3J81K 2R7WA 2HTSA 2B9DA 2HHHE 1DGRM 4U7DA 5BQTA 1FBQA 4MFEA 4RLFA 1WHUA 1J09A 3JRIA 1D8JA 5J8CA 3FHZA 1XS9A 2EPRA 3FK7A 1BBGA 3THOB 3WODF 1HA8A 1U3EM 2ID6A 2K3FA 5LMNE 3VYUB 1AU7A 3AAFA 5IYBJ 2NUGA 1GV5A 2LR8A 2KLOA 3E1SA 2M4GA 4P1WA 4I2OA 4OIOF 2E7WA 2XGDA 5FRMA 4F9BB 2LBFB 5L3EA 1RMDA 3G4SI 3WTZA 1T38A 2EM4A 3NRVA 5B66C 1RUNA 4G6QA 4GXOA 3WHCA 5D5VB 2V86A 2WA0A 2QENA 2IRFG 1JUSA 5LGNA 1W36D 4E70A 5AE3A 4JI3E 4M6XA 5LEKA 4XLAA 4XNFA 3ULQB 2H94A 2VBWA 5DYMA 4O4KA 2M2EA 3L2QA 2B63J 1X49A 3FDYA 2OU2A 1XB4A 2DQLA 2ZJ2A 4B3AA 4W97A 1RQ0A 1DGCA 1S29A 1TTYA 4QPQA 3ESWB 5GAGJ 4BEHA 2HXOA 2LMDA 2V1NA 2ZBKA 4AU7A 5BMZA 4NHRA 2ICWG 3ZQIA 2KDZA 5F3WA 2XF7A 4DV5E 5ILSA 4ZTFA 3S2WA 1R4NB 2BVMA 1WZ2A 2X0LA 2B9SA 3GLLA 4P96A 1MMAA 2DFHA 2VASA 3TKYA 1J59A 1G8XA 1TQMA 1PJRA 2ELYA 4ZH4F 2EK5A 1NTCA 3M8JA 3PSFA 5J47A 5TISC 5HLGA 3SXYA 5H6RA 5KL7A 4HOBA 5L3BA 2DLLA 5ERIA 3F3XA 3S1QJ 1X4PA 4G9YA 5DD8A 2L3DA 4M3EA 2L9SA 1HSTA 2GPIA 2QSFX 3QYBA 1MNMC 3E7LA 2LMZA 1MJBA 3CCQI 2EL4A 2ZMEA 5IXMB 4BJ5C 1UHZA 1YJ9I 2EM0A 4LF9E 1FP2A 2ZFWA 4XK4A 2DRPA 2MABA 3HUGB 5ILVA 2F4OB 3EPHA 1MZBA 1W1WE 3O8GA 1IF1A 3DBHB 5TSEA 3OR1C 5A6AA 2EWLA 1TQIA 1F36A 5FKMA 1VQ8I 2HNHA 2LKXA 1PUFB 4KFCA 4NUBA 4XKBA 5FKKA 4IQ4A 5HS8A 3K4BA 4LJZF 2F5CA 4LGWA 2HS5A 2KRHA 4AUXA 3WTVC 3ECRA 2DJIA 4KDPA 3CCSI 5IT9K 1JHFA 1G6NA 4AM3A 2DFFA 5AIQA 1UN6B 4H4KC 4CYDA 4DIQA 3L7WA 3OYGA 2P0WA 4A0XA 4KWYA 3EUHC 3G1OA 2X6OA 3E6BA 3MHSC 2HYGD 1H8AC 4O43A 5LGTA 3I9V2 4U7BA 2L2NA 3ZPLA 1BM9A 1Z91A 1IN4A 4LIUA 2EZIA 2PQ8A 1Z6RA 6PAXA 5CQEA 4DR2E 4N0BA 2M4KA 2L7ZA 3V8LA 2WBMA 4UV8A 1SVMA 1X48A 3SEQA 3N4MA 4G8XA 2JVHA 2EMKA 2A5WA 5E1XA 1FWZA 4BHCA 5F1RA 5A6JA 3GTQJ 3S3NA 1FSEA 4XOPA 5CKTA 2DTRA 3EPJA 1BB8A 2DOAA 3ZCOA 1MBEA 2EPPA 1WRJA 2GIVA 3AFHA 3BTCA 5AE2A 5LHHA 2FF4A 2E2JJ 2FMLA 1JI8A 5KL4A 3DPTA 3GTPJ 1QBJA 1OJLA 4A3JJ 3LNQA 1SAXA 2DJNA 3C18A 5EEGA 3TP3A 4B3RE 3J81C 4RB3C 4DYQA 3C4BA 1GV2A 3E5XA 2DT7B 5TJJA 1HBXG 1OKRA 2MG4A 4IXAA 4DR1E 1LLMC 4II3A 3W2VA 2R7VA 4B43A 4OIPF 1IRXA 3G6EI 2D5VA 4F9AB 4Q48A 1B72A 2JOBA 4I09A 1FBSA 1SFUA 2J7JA 3CQZJ 4UUTA 1W5SA 2K9LA 5L3GA 1PP8F 4IRHA 4NC7A 4BCAA 4PGHA 4AIHA 2M45A 2FE3A 1S7EA 3HPZA 1UCRA 2PMHA 2B3TB 1MBFA 3HJEA 5J6XA 2X6WA 3F21A 1IC8A 2VLAA 2BGCA 3IL2A 2JVAA 4JV5E 3LSIA 4JOMA 3TOBA 1OCPA 4R2DA 4M74A 4MEXF 1G3WA 1R23A 4MTEA 2JT1A 3JSPA 2F2EA 4GCVA 5ICCA 2ISZA 3ZMUA 4FX4A 1XSXA 3P7NA 3BJAA 5LL6R 4UV9A 5F0HA 1BI2A 4IL6C 1T4NA 2EPFA 2K85A 4U0YA 2EMZA 3MHHC 2LJUA 5GTIC 3CCUI 1A1KA 2NS0A 2IJLA 1ETQA 5F27A 4B1RA 1QZEA 3ABUA 2BEOA 3RPQA 4DOZA 1DP7P 1VQ4I 1QA6A 4AIKA 4ZC3A 1EJ9A 4K0KE 4KIGA 3HSFA 3E6MA 5KL2A 3EPZA 5CVIA 2NUFA 4PGGA 1W7PB 1ONVA 4CCLA 5KHDA 2OJED 3ONQA 2LSOA 5JHFA 4CCKA 2K9NA 3CC7I 4HEA2 4AVZA 1T6SA 3K1NA 2EPZA 4MLQA 4A3BJ 2VBYA 2NUEA 2LDUA 3KP6A 2XRLA 2F5FA 3CJNA 5FO5A 2LH9A 2X6YA 1X3UA 1Y0NA 2JN6A 1IN8A 3OOUA 3JAMK 3ZQFA 3AL0C 1E2XA 2RSMA 2DQRA 2LVSA 3V8KA 2VOPA 3BPVA 1IDZA 2DDBA 2ELZA 1AAYA 2FRHA 4I6ZA 2ECBA 4OIQF 2XGXA 3SFZA 4J8ZA 4XBFA 2LYCA 4X64E 1N32E 2M1BA 3JU0A 5M5YJ 3HIFA 3ISPA 1HLVA 4CXFA 3M8FA 2ZO4A 1FEXA 2KMUA 2XKOA 3ECHA 2EIMH 2DFEA 4E7KA 1D0YA 5ED4A 1VF9A 4KITB 4DMIA 1F4KA 3W2WA 3H5RA 4L5IA 3BR6A 1OYYA 2R93J 2E1MA 4XKCA 1T56A 4Q47A 3M99B 1MGTA 4J00A 3OYJA 3CF5F 2GLIA 2TRTA 1ZU1A 4N9IA 5DM7F 1QZYA 1LE8A 2V7FA 4CSWA 2PG4A 4WYQB 1RKTA 3DTEA 3ZGKA 1ERDA 2HKXA 4CZCA 4R2CA 3SDBA 2KL4A 4M6VA 4DV0E 3T1YE 1JK1A 2DA3A 2LTSA 3F6GA 3TMOA 2LBFA 4FX0A 1NH3A 4L18B 1OYIA 2H27A 2EFOA 3RTRA 2BHZA 2COMA 3OWTA 1T08B 3EYIA 2V9KA 2XAJA 3REOA 4RGRA 3H9GA 3CO6C 1N25A 2OCEA 1V5GA 1J2XA 3BTJA 2WBSA 1APLC 3GTMJ 3S32A 5E8IA 1W5CC 1PVEA 2EIJH 4CCJA 4FCYA 2GM4A 2KT0A 2O03A 3P5JA 5J8FA 2A25A 3KZZA 4D0PA 2KKOA 1TF6A 2XDVA 5E8GA 4L5NC 3BGHA 4JI6E 5DTDA 3OMLA 2PMUA 2E5LE 2IS2A 2EMLA 1K61A 2E35A 2QKMB 1S5LC 2YPRA 1CQTA 1Y0UA 2QWWA 4A0ZA 2AQEA 5M5XJ 2EM3A 2XIGA 3T8RA 4HQMA 2N3GA 1TWFJ 2Z1DA 3C2BA 2OQRA 3K7AJ 4L9VA 4D5CA 1WSUA 4DUYE 3WTTC 5A6KA 3BJOA 2ENHA 4J01A 3L9FA 2R7TA 4A3GJ 1NHAA 1O3RA 2KJCA 4ZZLA 5LHGA 1TZLA 2IS6A 4DGWB 4ENKA 4X65E 3EYYA 4BACA 2MKDA 4CUGA 4WX9A 1O3QA 3I59B 1VQ9I 2LRDA 1WJCA 3BR1A 1LJ9A 2LUPB 4YFKF 1U9NA 3KYDB 3BOQA 5K5OA 4CO8A 2L7MP 1R1TA 1UJ8A 4XN0A 2OQGA 5F6FA 3IP4B 2R7OA 1S9HA 3A1YA 5C44J 2CPNA 1LDJA 4CGZA 2G0EA 2W24A 2JMWA 3M9AA 4DV2E 4JBAA 1Y6IA 3GZ5A 4ZYGA 2EINH 3BG7A 2EMXA 4CA0A 5F0FA 3PL8A 1XN7A 1Z05A 5KAFC 4HDUA 1YG2A 4AQYE 3D5LA 3Q9SA 4BY7J 1IQSA 1WXRA 2CO5A 2DMPA 2M5WA 1WQ2A 4XSXF 1KJKA 3FM3A 2IW5A 2RQQA 5K5QA 4R8OA 3JTGA 5D6EA 4AYBA 1QQIA 4HNTA 1TWCJ 3GFJA 2H36X 1MJ9A 5A2QZ 2MLGA 2BVLA 2EOSA 5B3SH 3FXQA 3T1BA 2JRMA 4MQ9F 2ELKA 2DXIA 2E1OA 1ZREA 3G71I 4M9SA 3CCJI 1HNWE 4IHVA 3IH2A 1ZARA 2NOJB 1S72I 2Z33A 2CV0A 3LAJA 3T0YA 1IXCA 4MLOA 4YIRX 2IPQX 4PJ0C 4NNJA 5CVJA 4C9YA 3CCYA 4YRVA 3MKZA 1FJGE 3A0BC 2EA4A 1HDDC 3DPLC 4FE7A 1LNWA 1X1DA 3LMMA 1HCRA 2EV0A 4RHBB 1FMVA 5DNYA 2DLKA 3GYHX 1G3SA 1ZHFA 1W7PD 3QP6A 4R2QA 3CDLA 1XCBA 3HZJA 2H1KA 5FLXZ 4WPYA 1BIAA 3SZTA 1X6EA 2CUEA 1Z77A 3KP7A 3QYFA 5HLIA 4KN4X 1WJFA 1YX5A 2O7OA 3PQJA 4WXCA 1T8IA 2JA8J 1VQ6I 3TQMA 4IOCF 3GFLA 3HEFA 2V9VA 5DCMB 3MQ0A 1Q1HA 4A6EA 4V2FA 2FNAA 3RZOJ 2LLKA 3A02A 4B3SE 1S3JA 5IY5H 3S3MA 3TO6A 4HNVA 1X1AA 4I76A 2EZ6A 4O6JA 4CICA 2OUMA 2JRTA 4XLPF 3AKZA 2UUBE 3BTLA 1AWCA 1K6YA 2L0KA 3QOEA 5C4XJ 5CFFE 1BR1A 3VEPA 1WI9A 2VUMJ 2IGNA 5A2QC 3W6KB 2BE5F 4MO7A 1UG0A 2FEZA 2RV8A 3IV5A 5JVGF 3S2DJ 2M8GX 4PJNA 3CLQA 3EDPA 3LSRA 2EPAA 4EJUA 4E7LA 2F5DA 5B1AH 3KIOA 1VTNC 1MDMA 3L1PA 1A6IA 3FXRA 4HW0A 1T4LB 4V2GA 1G2FC 3T8TA 3CZ6A 1PJTA 3BZCA 3VYTB 3G73A 5EGOB 2PJRA 2GOMA 4M6YA 3J80Z 1OYWA 2LY2A 3LQQA 4EEFG 5FD6A 3AUZA 2BW3A 3U2RA 4M9VC 2OTJI 1SD5A 2VE8A 4IPAA 1YRNB 2V87A 1A1GA 1FOWA 1VI0A 3E0JB 2L01A 2XB5A 1RC9A 1EH8A 2QQAA 1AA7A 1P9QC 2NAZA 2JVGA 2OF7A 1JGGA 2V85A 2Y48A 3BZ6A 3CF2A 1SVLA 3QOPA 4FE4A 1E17A 4MTDA 3ASOH 4W1UA 2K86A 2YU3A 2XKPA 2E7XA 5BPDA 2DODA 3GCMA 1W7PA 1D3YA 5HLHA 2E72A 1LFUP 2AS5F 5CQGA 4I0AA 1XNQE 2DB2A 3W2AA 3OIPA 4IX7A 1DDNA 1VQ7I 2B7EA 1P92A 2MSYA 4IHSA 2FD5A 3F8CA 3RQ4A 2HPMA 2CV1A 2HVSA 4D1QA 3QU3A 2DA5A 4OAZA 5IYCJ 3SHFA 1H9TA 3UR3C 5F1JA 1TLHB 4A69C 3ASNH 2MKNA 1IW7F 3ZOQB 4Y7NJ 2DA1A 5AC5A 1HC8A 1T98A 2NOGA 3HRSA 1YSAC 3IWFA 4LITA 4L9TA 1Y39A 4RLQA 1YW9A 3FX3A 2HVQA 4BQQA 2L4MA 2D2WA 5FFZA 1ZQ3P 2EPNA 2QM3A 3HYIA 5LGUA 3SZGA 3GO5A 1ETKA 1WGXA 3Q0VA 5F08A 2ACJA 3ZOBA 4DNCA 2QBYB 1ZTRA 2GZWA 3WG7H 1W0UA 1UAAA 2EMHA 3NEUA 4LB5A 2L6MA 4XIDA 2IS4A 3WTWC 3IH3A 4KIFA 1XMAA 3T5XA 2LKSA 5L3CA 2F5VA 4G94A 1Y8QB 3L2RA 1ZG5A 2LTPA 1USSA 3R4KA 1YFHA 5DD4A 3ADIA 4M3GA 1A31A 1PP7U 1P47A 5IYDJ 5FRNA 4HEIA 3BZKA 3AG4H 2DMTA 4NBQA 3AG3H 1R7JA 1Y8RB 2K40A 4RAYA 4XL9A 3V8JA 4X6AJ 5AASA 3BR5A 3CCMI 4X9JA 1LEBA 5FKNA 2VOOA 4O3MA 4M3FA 2QUFA 1TT0A 3DXJF 3GTGJ 4I7HA 1KZHA 4UVCA 4LG0B 2HTJA 3V42A 1MBJA 3DPUA 4BY1J 4HNUA 1MBHA 2M87A 2DW4A 2FU4A 1G3YA 1HDPA 3TQNA 3RQIA 4ASNA 5K7HA 2X1EA 3LSPA 4ESJA 2F4MB 2BY1A 2MH2A 1E0EA 1ON1A 1I3QJ 2OZUA 3ABTA 3LFUA 4HAMA 4OU0A 4G7OF 2F4IA 1GXPA 3DBRB 1ZLJA 2PN6A 3WGIA 1OR7C 1S7OA 4F3QA 3NWTA 4UNOA 2GXBA 1JTYA 2IA2A 3GTKJ 3FXOA 4ZZDA 3MN2A 4LF4E 3BG3A 2Q1ZB 3K70D 4JI0E 1N77A 4B44A 3FXLA 1A5JA 1RR8C 3LA3A 1DQ3A 4MIMA 2F8BA 2R7UA 1Y1WJ 2CQQA 2DI3A 2CJJA 3CJQB 4A3FJ 2DA7A 3HOUJ 2HJJA 3GZ6A 3IAS2 2EORA 1XMOE 4XORA 1Y1VJ 4AD9A 4HQEA 3RKQA 5FKLA 3LSHA 2H8WA 4L0ZB 2P6TA 4BS9A 4BBSJ 1WHNA 5ICEA 2RSIA 4HX8A 1ON2A 3O2PE 3LMLA 1O7FA 4RM2A 4RMNA 4XKWA 2R76A 1ZRDA 1T4OA 2OPTA 1VNDA 2DOFA 1JGSA 2DPUA 2K4JA 2LO3A 4JI4E 1YIJI 3GMEA 2O6GE 1SD7A 2QSGX 3S15J 1FYLA 3H35A 4DV1E 3PSIA 2KZGA 1F43A 4NQWB 4RGUA 3BWGA 3S8PA 3MKLA 1B9MA 2DMIA 1D0XA 3I59A 2FX0A 3M7GA 3CTAA 3TBIA 1STZA 1HW5A 3B73A 4DBQA 2WB1A 2P8TA 3F6OA 2LREA 4Y4RA 2R4GA 2EL6A 3THNA 2B7TA 2PEXA 3MSWA 4ON0A 1YE9A 2DMUA 3U9GA 2YRKA 2ISYA 3QWLA 2EPKX 3OYFA 1HR0E 3DU5A 3AG1H
chains in the Genus database with same CATH topology
2Z3YA 2ZNYA 2DK5A 1I1SA 2HFHA 2YX7A 2R7FA 3I4PA 1MKMA 3ZMDA 3WGGA 3CO7C 3EUHA 4Y15A 1U5TC 2MBFA 3CUOA 1FOKA 1JHHA 5D5UB 2OAZA 1LVAA 4MQVA 2MLKA 3RKXA 3QPTA 5FD5A 3M1EA 2ZCWA 1BN5A 4IF4A 3LWFA 4ZYHA 3Q9VA 4KYWA 2GA1A 2CG4A 5E1WA 1YW8A 1R5HA 3FMSA 4HV5A 2KIUA 1H0MA 5DCMA 1SMTA 4JQFA 3OOPA 4BAYA 4L0YB 3TGNA 2STTA 2CSOA 5HDNA 1XGSA 3HRMA 5KVRA 3MFKA 1XDUA 5LRRA 4WXHA 1J5YA 4CZZA 5D4RA 1FYKA 4EJWA 1TNTA 4WCGA 3GFIA 1I5ZA 4BXUA 5DUIA 4LD5A 2NRAC 3H92A 3IWZA 4A5MA 5FGMA 2GQQA 3GWZA 3O3KA 3CUQA 3TDUC 2D45A 1DPRA 1ZN2A 2EFPA 2VE9A 1T2KA 4IVNA 1IAWA 4RAZA 1CF7B 3RDIA 4I0BA 5EEHA 2O8XA 1QNTA 2VN2A 3ZQ7A 3LFKA 3F8BA 4TV7A 3SZPA 4LLLA 4HLYA 1GHCA 1LQ1A 2LF8A 1IUYA 5L3FA 4A2UA 3VOEA 4LLGF 2QBYA 1MJAA 1A04A 4G7ZF 5KK1A 4EGYA 1ODDA 3RJPA 1JXSA 4HA8A 1W4MA 4Y17A 3LSTA 5K1YA 4PDKA 1YYVA 2OD5A 1HXDA 4QLCU 2XASA 1V3FA 2XAHA 5D8KB 1BBYA 4B09A 4KNYA 3GVAA 4EJVA 4GYIA 1J75A 1BJAA 1ZRFA 4LG0A 3GF2A 5JR3A 2F5EA 1U2WA 1YIOA 5E20A 3F8FA 4Q5SF 2P4WA 4EQQA 3FXUA 5E18F 1KU2A 5HS9A 3R60A 3ELKA 3F8MA 1S7AA 5LLQA 4HV6A 5HVQC 3V7CA 3GEZA 3WTUC 1FBUA 1TBXA 2O61A 4IHTA 5HDKA 1ZRCA 1ZGJA 4M72A 1IZ1A 2HWVA 2DPDA 3K0LA 2OA4A 4AWXB 3RKWA 2W25A 4MNUA 2IVMA 5BS6A 2J5PA 2FSWA 2G7HA 3CDHA 2HYFA 3SQNA 5A2QK 2VONA 3WTSC 1UB9A 1DPUA 1T39A 1R36A 5H20A 3KFWX 2GXGA 1P4XA 1W5TA 1HKQA 4KA4A 4S04A 1RIOH 2ELHA 2HZTA 1HSJA 3DEUA 2A61A 2IT0A 4IJAA 1F5TA 3O6BB 4BNCA 4HLXA 3CLOA 2FNPA 1FPQA 4U88A 1U5TB 2CYYA 1P4WA 5DUKA 4UVBA 3KEQA 1TNSA 5FLXK 1ZAOA 1IXRC 1YLFA 3FZVA 2HDCA 4M73A 4EJTA 2A5YB 1O3SA 1XSVA 3OV8A 1R00A 4EM0B 4YIFA 3KP3A 2L54A 2CW0F 3Q5FA 4B8XA 1S6LA 3FWEA 2J5OA 3HUGA 2Z9OA 5FB2A 2FBIA 2ADUA 2MA3A 2XAQA 1P6RA 2FBHA 3TDZC 3WTXC 3MWMA 3J80K 1B4AA 4KIBA 3KZYA 3IRQA 1FZPB 1Z9CA 1KQ9A 2EA2A 1OMIA 2KIMA 1ULYA 4LK0F 5ICGA 3WE3A 4L5JA 3K2ZA 4L9JA 2B0LA 2G9WA 5E1ZB 3BPXA 4HBLA 1HW1A 4OOIA 2TDXA 2P5VA 4RGXA 2DK8A 2V79A 3V4GA 2MH9A 4OMYA 2LKPA 2WTEA 3LAPA 1O3TA 2QQ9A 1LB2A 1QGPA 3F22A 4BQAA 2RQPA 2L02A 1GVJA 1Z7UA 2UXNA 2E1NA 1BIBA 3RKYA 4KICA 1CF7A 1ZGAA 4MHGA 3L09A 2BYVE 1V4RA 1ZG1A 3R6SA 3ZP5A 4WXDA 3P9KA 4YFXF 3R61A 1O7LA 4P9FA 5DV5A 1U6GA 2IA1A 4N9HA 2RNJA 3PFIA 3I5UA 4LK1F 2A69F 4IRGA 3I71A 3EQLF 2ESHA 3HTSB 4RB2C 3GXOA 1TW2A 3C7JA 3C3WA 4XSZF 2M30A 4EM2A 1EH6A 2P7VB 1BOAA 3RIRA 4ESFA 2EFQA 3DFGA 5H6QA 2GWRA 2D1VA 2VT2A 3GW2A 1U8RA 1BI3A 3JW4A 4M9ZA 2WC2A 1HKTA 2FOKA 2K4BA 3DKWA 3H3UA 1J7KA 3KP5A 1REPC 4G6DA 1FC3A 1B9NA 5HOOA 1GXQA 2HKOA 5D4SA 4RS8A 1IRGA 1IN5A 2R3SA 3RI4A 2EV6A 5D5WB 1LEAA 3ZN0A 2OBPA 2A3SA 4L9NA 2M8EA 3BY6A 3GX4X 4CHUA 1Z6TA 3K1MA 5ILUA 3F23A 2RGVA 4WK8F 4O5VA 2XV4S 4OMZA 1F9NA 4BHPA 3ZMTA 3KP4A 2UXXA 1ZYRF 4Y13A 3BDDA 5CJ9A 3H3ZA 3QAHA 4GGGA 3ERED 4UXNA 2DO7A 1BI0A 1U5TA 1FT9A 1USTA 3J7AO 4M9XA 2Q8KA 1BI1A 4HF1A 1D8KA 4HZFA 2HR3A 1LDDA 1PDNC 4S05A 1KU7A 3VODA 4U0VA 5IT3A 4MEYF 5JFRA 1FSHA 2E1CA 2VC1A 5D5XB 2OZ6A 4NHJA 4ZYEA 3I58A 2A68F 3G3ZA 4EM1A 5LEJA 1D5VA 1K79A 1FNNA 3E5QA 2K02A 3GLXA 3V7SA 2HGCA 2JPBA 1YQAA 2H6BA 2MC3A 2C6YA 2ZNZA 5ICFA 1KU3A 2H6CA 2GA2A 3KE2A 3IC7A 5HS7A 3L00A 2V1DA 2CGPA 4CDGA 3N97A 1EH7A 3DV8A 1MD0A 1PUEE 1B1BA 3HRTA 3MEXA 4A5NA 4KMUX 3IKTA 3HTUA 2Y0MA 2X4HA 3M8EA 1AOYA 3ZMZA 2O3FA 2EJRA 2QVOA 3R0JA 3WG9A 1HQCA 2P5LC 4HX4A 4A12A 2UWMA 3I64A 1K7AA 2QZ8A 4I02A 2V6CA 4P5OA 1L0OC 2D1HA 4EGZA 1ZLKA 4OIRF 2GAUA 3BJ6A 1K78B 3HHGA 4XLNF 2BV6A 1KYZA 1P4AA 4MGRA 5DCFA 1DUXC 3DF8A 3J81Z 1IXSB 2ZXJA 1I6XA 2A07F 2VBXA 4HX7A 4Z2YA 4HDVA 1RUOA 3WGHA 2LNBA 4PCQA 2XUBA 1WWXA 3I54A 1KQ0A 1R1UA 2EFWA 5BPIA 1FX7A 2NYXA 1SD4A 1H9GA 3COAC 1RI7A 2XAGA 2YX4A 1J0RA 2STWA 3F6VA 4GYGA 1F1ZA 4BHBA 3WTYC 1XD7A 3C1DA 3QRFF 3E6CC 3HSRA 2HQRA 3ML6A 2QQBA 3WU1B 1XSDA 3IKVA 5D8LB 3GFMA 3LA2A 3ECOA 1G4DA 2FMYA 2PFBA 4R79A 2FA5A 4WWCA 1FYMA 2EFNA 3NQOA 3BP8A 5TRDA 2P5KA 3TO7A 3QU6A 2UZKA 1XGMA 3ZMSA 5CVRA 1MDMB 2LF7A 1XDSA 3WE2A 5D6FA 3VFZA 1R22A 4WF2A 2ESNA 4FT8A 2YR2A 4QWQA 1C0WA 1XGOA 2CFXA 3E6DA 2V1UA 2CQKA 5IT9Z 1XGNA 3LA7A 5DDGA 3HSEA 4YG2F 2DFIA 2DT5A 3CUQC 2EV5A 4RB1A 1WKMA 3HOTA 2H09A 1L3LA 4RGSA 5L3DA 2FQ3A 4H0EA 5LHIA 2QYOA 1G3TA 4LMYA 2HQNA 1SD6A 2PBIA 3F72A 3FMQA 1KA8A 4NQWA 4ESBA 2A6EF 1O57A 4R1HA 5CLSA 2ZKZA 3KETA 3MAJA 4RB0A 2PJPA 3RPUA 1FLIA 1KGSA 4HF0A 2RN7A 1IN6A 2IP2A 3D0SA 4ENJA 4KT5C 1QPMA 1YW7A 3RYRA 2VODA 4R8HA 3P9CA 4GO1A 5AIPA 1KU9A 2BBYA 2EWNA 4DQ2A 3DP7A 4U0WA 2W84A 5F64A 3KCCA 3WU0A 5AONA 2QLZA 4ETSA 2RDPA 2VT3A 1CGPA 4I01A 2O0YA 4EVIA 1YO5C 3E5UA 4PZJA 1RZ4A 5CVUA 2L4AA 2XROA 2G7UA 4NB5A 1HW2A 4F7ZA 2P7CB 3TO9A 2Z5UA 3K69A 4HF2A 4P55A 2RKHA 3B02A 2JZYA 4YIIA 2ETHA 2VXZA 3LQRA 1LDKB 5E17F 2DU9A 3JAMZ 1HKSA 2FBKA 3ZN1A 3MZYA 4AIJA 3L2CA 3I0TA 2JSCA 4KMFA 1FP1D 3IHUA 3BROA 1K78A 1B6AA 1R1VA 2XAFA 3K9TA 3GUDA 2NNYA 4LLNA 3DQVC 4ZYDA 4EMSA 2FXAA 2HOEA 1B59A 1IN7A 4EV0A 4YFNF 3MZHA 3HRUA 2XHKA 3E97A 1TQPA 3JTHA 1ZH5A 4UVAA 1XCVA 1I1GA 5FFXA 3F8NA 4BH9A 3U1DA 3HOSA 4I98B 1YS6A 1T0FA 2XRNA 2K27A 1K6OA 2W85A 3KEOA 2EB7A 2ZMEB 2R7DA 4BYYA 1JE8A 2CWEA 4EJOA 3ZMVA 5K5RA 1YS7A 2W57A 4Q4ZF 2DBBA 5JVTA 4ENNA 4OINF 3MCZA 2VC0A 2Z99A 1J9IA 3VB2A 4A0YA 1BC8C 1QO0D 4M71A 1ZG3A 2VBZA 2A6HF 2WV0A 4XRFA 2KJBA 1Z1DA 5JHUA 3QP5A 4ENMA 1P2FA 1EV7A 2KRFA 3ROUA 3E3VA 1IRFA 1OPCA 1R58A 5LRSA 3EETA 2RC4A 2AXLA 5CYVA 3FM5A 1OR7A 3KP2A 3QPHA 2MD5A 3CUQB 4FHTA 3KLNA 1QZZA 2PI0A 2KIFA 4IRIA 5HDGA 3FMRA 1SFEA 1UFMA 3HHHA 5LBQA 3FF5A 4LFUA 5CVVA 1SFXA 2V1XA 2DAOA 4K2EA 4A6DA 3JSOA 4KN7X 1YTYA 2JPCA 3I53A 2HEOA 1R5GA 3RYPA 2Q0OA 1KQ8A 2XVCA 1S8NA 3R0AA 1I27A 2RVCA 4AVPA 2Y75A 2P6SA 3W6JB 1FY7A 2PLYA 2WWYA 4JK1X 4LB6B 3TOAA 3KLOA 3IRRA 4P9UA 5DEQA 4UHTA 1SMYF 1TW3A 1UHMA 3V7RA 5BOXA 4HYEA 1UHWA 1KYWA 3P9IA 4KUMA 2Q2EA 3K1PA 1RNLA 2YSRA 2JTVA 1BC7C 1XMKA 1U78A 4G7HF 2IA0A 5JI6A 2NNNA 4UUVA 2K7LA 3PQKA 3J81K 2HTSA 4U7DA 5BQTA 1FBQA 1D8JA 5J8CA 3FHZA 3WODF 1U3EM 3AAFA 4I2OA 4OIOF 2E7WA 5L3EA 3WTZA 1T38A 3NRVA 1RUNA 4G6QA 4GXOA 5D5VB 2QENA 2IRFG 5LGNA 4E70A 4M6XA 5LEKA 3ULQB 2H94A 2VBWA 5DYMA 2OU2A 1XB4A 2DQLA 2ZJ2A 1S29A 1TTYA 2ZBKA 5BMZA 5ILSA 3S2WA 2X0LA 4P96A 3TKYA 1J59A 1TQMA 4ZH4F 2EK5A 5HLGA 3SXYA 5H6RA 4HOBA 5L3BA 5ERIA 2DLLA 3F3XA 5DD8A 4G9YA 2L3DA 1HSTA 1MJBA 2ZMEA 1FP2A 2ZFWA 5ILVA 1MZBA 1IF1A 1TQIA 4KFCA 5HS8A 4LJZF 2F5CA 4LGWA 2HS5A 3WTVC 4KDPA 5IT9K 1JHFA 1G6NA 5AIQA 4CYDA 3L7WA 4A0XA 3E6BA 2HYGD 5LGTA 4U7BA 3ZPLA 1BM9A 1Z91A 1IN4A 6PAXA 2PQ8A 1Z6RA 4N0BA 3V8LA 4UV8A 3N4MA 4G8XA 5E1XA 1FWZA 4BHCA 5F1RA 1FSEA 2DTRA 1WRJA 2GIVA 5LHHA 2FF4A 2FMLA 3DPTA 1QBJA 1SAXA 3C18A 5EEGA 4RB3C 3E5XA 5TJJA 1HBXG 1OKRA 4IXAA 4OIPF 4Q48A 4I09A 1FBSA 1SFUA 1W5SA 5L3GA 1PP8F 4IRHA 4PGHA 4AIHA 2M45A 2FE3A 1UCRA 2PMHA 3F21A 5J6XA 2BGCA 3IL2A 3TOBA 4M74A 4MEXF 1G3WA 1R23A 4MTEA 2JT1A 3JSPA 2F2EA 4GCVA 5ICCA 2ISZA 3ZMUA 4FX4A 1XSXA 3P7NA 3BJAA 4UV9A 1BI2A 4U0YA 2NS0A 2IJLA 3ABUA 2BEOA 3RPQA 1DP7P 4AIKA 4KIGA 3HSFA 3E6MA 5CVIA 4PGGA 1W7PB 1ONVA 2LSOA 1T6SA 3K1NA 2VBYA 2LDUA 3KP6A 2F5FA 3CJNA 5FO5A 1X3UA 1IN8A 3JAMK 1E2XA 2DQRA 3V8KA 2VOPA 3BPVA 2FRHA 4OIQF 2XGXA 3SFZA 4XBFA 2M1BA 3HIFA 3ISPA 4CXFA 3M8FA 2ZO4A 2XKOA 3ECHA 5ED4A 1F4KA 4L5IA 1OYYA 4Q47A 1MGTA 4N9IA 1QZYA 2PG4A 2HKXA 4FX0A 4L18B 1OYIA 2H27A 2EFOA 3RTRA 2COMA 3EYIA 2XAJA 3REOA 4RGRA 3CO6C 1J2XA 5E8IA 5J8FA 2O03A 3KZZA 4D0PA 2KKOA 5E8GA 2PMUA 2YPRA 1Y0UA 2QWWA 4A0ZA 2XIGA 3T8RA 4HQMA 1WSUA 2OQRA 4L9VA 3WTTC 3BJOA 3L9FA 1NHAA 1O3RA 2KJCA 4ZZLA 5LHGA 4ENKA 3EYYA 4WX9A 1O3QA 3I59B 1LJ9A 4YFKF 3BOQA 5K5OA 4CO8A 1R1TA 2OQGA 5F6FA 1LDJA 4CGZA 2W24A 3M9AA 4JBAA 3GZ5A 4ZYGA 1XN7A 1Z05A 4HDUA 1YG2A 3D5LA 3Q9SA 2CO5A 2M5WA 1WQ2A 4XSXF 3FM3A 2IW5A 5K5QA 3JTGA 5D6EA 1QQIA 3GFJA 1MJ9A 5A2QZ 2MLGA 3FXQA 3T1BA 4MQ9F 1ZREA 4M9SA 1ZARA 2Z33A 3LAJA 3T0YA 1IXCA 2IPQX 5CVJA 2EA4A 3DPLC 1LNWA 2EV0A 3GYHX 1G3SA 1ZHFA 1W7PD 3QP6A 1XCBA 5FLXZ 1BIAA 3SZTA 3KP7A 5HLIA 4KN4X 3PQJA 4WXCA 3GFLA 2V9VA 5DCMB 3MQ0A 1Q1HA 4A6EA 2FNAA 1S3JA 3TO6A 4O6JA 4CICA 2JRTA 4XLPF 1AWCA 3VEPA 1WI9A 3W6KB 2BE5F 2FEZA 2RV8A 3EDPA 4EJUA 2F5DA 1VTNC 1MDMA 3FXRA 4HW0A 3T8TA 3G73A 4M6YA 3J80Z 1OYWA 5FD6A 3LQQA 3U2RA 1SD5A 2VE8A 4IPAA 2L01A 1EH8A 2QQAA 2NAZA 2Y48A 3BZ6A 3QOPA 1E17A 4MTDA 2K86A 2YU3A 2XKPA 2E7XA 5BPDA 1W7PA 1D3YA 5HLHA 2AS5F 4I0AA 1DDNA 1P92A 4IHSA 3F8CA 3QU3A 3SHFA 1H9TA 1TLHB 1IW7F 1T98A 3HRSA 3IWFA 4L9TA 1YW9A 3FX3A 2L4MA 2D2WA 5FFZA 2QM3A 3HYIA 5LGUA 3GO5A 2ACJA 4DNCA 2QBYB 2GZWA 3NEUA 4LB5A 3WTWC 4KIFA 1XMAA 3T5XA 5L3CA 4G94A 1ZG5A 1USSA 3R4KA 1YFHA 5DD4A 1PP7U 1R7JA 3V8JA 4RAYA 1LEBA 2VOOA 4O3MA 2QUFA 3DXJF 4I7HA 4UVCA 4LG0B 2HTJA 2M87A 2DW4A 2FU4A 1G3YA 4ASNA 3TQNA 4ESJA 2MH2A 1ON1A 2OZUA 3ABTA 4HAMA 4OU0A 4G7OF 1GXPA 1ZLJA 2PN6A 3WGIA 1S7OA 4UNOA 2GXBA 2IA2A 4ZZDA 3LA3A