3L00A

Crystal structure of benzylated snap-tag
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
175
structure length
156
Chain Sequence
CEMKRTTLDSPLGKLELSGCEQGLHEIIFLGGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SNAP-tag
publication title SNAP-tag structure
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 156
sequence length 175
ec nomenclature ec 2.1.1.63: Methylated-DNA--[protein]-cysteine S-methyltransferase.
pdb deposition date 2009-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l00A02
3.30.160.70 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Methylated DNA-protein cysteine methyltransferase domain 3l00A01
1TW3A 1IAWA 2YSRA 2BV6A 2COMA 1IN7A 3GFIA 4MGRA 3KP4A 2F2EA 3H3UA 3GEZA 2L01A 1LB2A 2EFWA 3Q5FA 3E6CC 2Y75A 4UVCA 3BOQA 4IHSA 3FHZA 5CVJA 1FLIA 4O6JA 1KU7A 2M5WA 1S29A 2NNYA 3RKWA 1QZYA 1D8KA 1F5TA 2OQRA 1R23A 1JE8A 2G9WA 4KIGA 1KQ0A 2FBHA 1PDNC 3KEQA 1AOYA 2PBIA 1R1VA 2QUFA 2A61A 1XD7A 1XB4A 1IXRC 4OMYA 3FM3A 3GO5A 1O3QA 3JAMK 3LQQA 1ZGJA 5DCMA 4MEYF 5ILUA 4UXNA 1IXCA 4EJTA 5CVRA 4LK1F 4ZYGA 1S7AA 1V3FA 4YG2F 1G3YA 3KP2A 5BOXA 5FGMA 3WE3A 4CICA 1U5TC 4CO8A 4OINF 3LA7A 3QAHA 2XUBA 2L3DA 4ETSA 1HBXG 2NAZA 3P9KA 1U3EM 5D6FA 3JTHA 2HFHA 3I54A 2PI0A 5DD8A 3HRTA 2PJPA 1TTYA 4WF2A 1U5TB 4N0BA 3LA3A 1T0FA 4B09A 4O5VA 1TNTA 3LQRA 3ERED 2JPCA 1KGSA 3G3ZA 3L00A 2XAQA 4UVAA 1FYMA 2ZXJA 4L9TA 4P9FA 2PLYA 4KA4A 1S3JA 1KYZA 1G6NA 5K5QA 5D6EA 3L2CA 1YIOA 1QQIA 1USSA 3LWFA 1FSHA 4M74A 3F22A 1BJAA 1W7PD 2VBXA 2OQGA 3BP8A 1MD0A 3WTTC 3E5XA 2R3SA 4RB3C 5AONA 1HXDA 3RDIA 3S2WA 2W57A 3JAMZ 2EWNA 1K78B 4L0YB 4A0XA 4BQAA 3IL2A 5E17F 5L3EA 4ZYDA 1KQ8A 4AWXB 4YFKF 3KP6A 3KZYA 1VTNC 3FXUA 2K27A 3BZ6A 3V7SA 5JFRA 1REPC 2ZNZA 2L4MA 2ZMEB 2DU9A 3BDDA 2OAZA 3F8BA 1IN6A 4RB0A 1G3SA 2E7WA 4CXFA 1J7KA 4MQ9F 1QBJA 4MTEA 1QPMA 1Z05A 4KNYA 3BPXA 3IKTA 1GVJA 3COAC 3MQ0A 5LHIA 4N9HA 1R00A 1B9MA 4EJUA 3SHFA 1S6LA 4XLPF 2LF7A 1IW7F 1FYLA 3HSFA 4BHBA 3MZHA 3GFMA 3ISPA 3M9AA 1F9NA 1BC7C 2CGPA 3F72A 3MAJA 5AIPA 4M6XA 2QENA 4GYIA 1FP2A 5FB2A 4H0EA 2FF4A 3K1MA 3EDPA 2IT0A 4WXCA 4G8XA 5BMZA 1FP1D 3BJ6A 1K6OA 4I01A 3OOPA 5BPDA 3R60A 1XCBA 2D1HA 4KUMA 4OOIA 2KKOA 5ICFA 3F8MA 2UWMA 1FT9A 3V7RA 1B6AA 3ULQB 3F8FA 3GZ6A 3T8RA 5DUIA 3HYIA 2MA3A 4HV5A 1CF7B 2RVCA 2FBIA 3V8KA 1R5HA 4PDKA 3J7AO 1TLHB 1SMTA 5HS7A 1QZZA 3I58A 2XASA 1B59A 4LD5A 3DEUA 3T1BA 4TV7A 3R4KA 2EV6A 3F21A 3OV8A 1U5TA 2HQRA 1D5VA 3MCZA 2DK8A 2QM3A 4ENKA 3FMQA 5JR3A 1E17A 1KU3A 1I27A 4WXHA 4HOBA 2M30A 3LAJA 1HW5A 1TQMA 1BI2A 2ADUA 3FZVA 2MBFA 3ZMDA 4BH9A 4WWCA 3DP7A 1MJBA 3HSRA 3RPUA 1IN8A 4A6EA 1ZREA 1Z91A 3KE2A 2RKHA 2VE8A 1JHFA 1O7LA 1D8JA 3MZYA 2H09A 1K78A 2YU3A 2K4JA 3AAFA 1ULYA 3J80K 5E1XA 3C18A 2MC3A 3WGIA 4MNUA 2Z33A 5HDNA 2QLZA 2XIGA 5H20A 4Q47A 5ERIA 1SD5A 4CGZA 2ZMEA 1FPQA 3HTUA 5CYVA 2J5PA 1D3YA 4L9VA 4PGHA 5ICCA 2EFPA 3IRQA 1HKSA 5H6RA 2L02A 4AIKA 3P9IA 1QO0D 2DO7A 2V9VA 1YQAA 3HRSA 4EV0A 5LGNA 5HLGA 1WWXA 4I7HA 5HOOA 5K5RA 3K1NA 4CYDA 3WU1B 4BNCA 5LBQA 1IZ1A 1ZLKA 4JBAA 1IN5A 1V4RA 4RB2C 2ZO4A 3FXQA 4L5IA 3ZPLA 2BE5F 2MD5A 4ZYEA 3E97A 3HRMA 2MLKA 1HSJA 1HW1A 2GXGA 1P4AA 5A2QK 3HRUA 5CVUA 4ESJA 2GIVA 5CJ9A 5KK1A 4HZFA 4IRIA 3J80Z 1IN4A 5L3BA 1E2XA 2XVCA 4F7ZA 2F5DA 3RYRA 3H92A 4IPAA 1XN7A 2RDPA 4NQWA 4LB5A 3KP3A 1P6RA 1ZG3A 2KJBA 2ELHA 2HTJA 1K7AA 1CF7A 2HOEA 2OBPA 1ZYRF 4ESFA 3EQLF 5CVVA 3U1DA 5L3DA 1W5SA 2UZKA 1ZHFA 4BHCA 4M73A 3WU0A 4A6DA 1IUYA 3WGGA 5KVRA 4AVPA 2K7LA 3ECHA 3GX4X 2A68F 2QQ9A 4P5OA 2WV0A 1T98A 3GXOA 2XAHA 1HQCA 2P8TA 2OD5A 3P9CA 2AXLA 5J6XA 3DFGA 1MJAA 3R0AA 5CLSA 4LJZF 4ESBA 3NEUA 5LGUA 2VC0A 3CLOA 4G9YA 1O3TA 2GZWA 4XBFA 3L7WA 1BM9A 1FC3A 3O2PE 1MDMB 1FSEA 5A2QZ 2VBYA 3LSTA 2ZNYA 2QWWA 2LKPA 5D5WB 1X3UA 2O0YA 2FRHA 5LGTA 1XGOA 3KP5A 4RGUA 5K1YA 2A5YB 1Z9CA 3CO6C 4UHTA 2EFNA 1AWCA 2DFIA 3PFIA 4KN4X 4GCVA 2IJLA 2GA1A 3WTWC 2Z3YA 5LEKA 2DI3A 2O61A 1W4MA 1B1BA 2FU4A 5LHHA 3KCCA 3R6SA 2E1NA 4ASNA 2WC2A 1Z7UA 4UUVA 4LMYA 2DLLA 4JK1X 3RKYA 2LF8A 1EH7A 1EV7A 2IVMA 1K79A 1I6XA 4L9JA 4G7HF 1ZGAA 5DD4A 1P2FA 2V6CA 1J2XA 4MQVA 2LSOA 1NHAA 3IWFA 1YW9A 2HWVA 3CO7C 5HVQC 2VBWA 2G7HA 2VODA 5D5UB 2O3FA 3V7CA 1B9NA 2WTEA 2FOKA 2BGCA 3ZN1A 1ZG5A 3I53A 2KIMA 2KJCA 5HS8A 5TRDA 2IA2A 3KFWX 2XV4S 1ODDA 1TBXA 5D8LB 5FFXA 3JSOA 1Z6TA 1UCRA 2IW5A 4RS8A 4IRHA 2K4BA 1SD4A 1R1UA 2OZ6A 4L18B 2A3SA 3EYYA 3VOEA 1I1SA 4KFCA 2OU2A 1STZA 2F5FA 3HUGA 4HA8A 4AIHA 4CDGA 2GXBA 1OR7A 1U78A 4HLXA 2VOPA 4G7ZF 4P96A 2PG4A 3WTZA 2ETHA 5BQTA 4I0AA 1YW7A 1KQ9A 4KT5C 4EMSA 1OPCA 3KP7A 3E6MA 3DQVC 2W24A 5LEJA 4RGRA 2P5KA 3RTRA 2ISYA 3BY6A 1LQ1A 4M9XA 1G4DA 4OIOF 4HX7A 5BS6A 1S8NA 4G7OF 4OU0A 4G94A 1XMAA 2B0LA 2V1UA 4EVIA 1GXQA 3E6DA 3VFZA 3SZPA 1ZRDA 1Q1HA 2RNJA 4OIQF 2CO5A 3TDUC 1MDMA 1RUOA 2XKPA 2H6BA 2GA2A 5E1WA 3HSEA 2M87A 3KLOA 3KLNA 4PZJA 3ZQ7A 4WXDA 2OA4A 4WK8F 3SXYA 5E20A 2W84A 1CGPA 1RIOH 5ILVA 3W6JB 2HEOA 3GFLA 4HDVA 1T6SA 2CFXA 4GYGA 3RJPA 4ENJA 3QOPA 1FOKA 3R61A 3K69A 2XAFA 5FLXK 4RAYA 2FE3A 1TW2A 5DYMA 3M8FA 4GXOA 1J59A 2QQAA 4U0WA 2A07F 4RAZA 4I0BA 2MH2A 2DT5A 3QRFF 5EEHA 3WG9A 2VOOA 5F1RA 3CDHA 4P55A 4GO1A 4M9ZA 2ZCWA 3B73A 2FMLA 1WKMA 1EH6A 2W25A 4KDPA 2A6EF 3ELKA 3FMRA 5L3FA 3TKYA 1ZRFA 2HYGD 3LFKA 4G6QA 1U6GA 2VE9A 4S04A 5E8GA 3BJOA 4EGZA 1OYYA 3FM5A 2G7UA 4EM1A 2V1DA 3TO6A 2O6GE 2QZ8A 3TOBA 1LVAA 2L4AA 2OZUA 3CUQB 1JGSA 2CYYA 4UVBA 3KEOA 5H6QA 3IC7A 3HIFA 1OKRA 4WCGA 4D0PA 1T2KA 2W85A 3ABUA 4P9UA 1H9TA 3ZMUA 2DW4A 3PQJA 1O3RA 2CWEA 1SFUA 1OMIA 1WSUA 4ZH4F 2FNAA 4LLLA 1ZLJA 2ZFWA 5JHUA 3VODA 4A12A 5FLXZ 3GUDA 2KRFA 2ESHA 1BOAA 1OYWA 2K02A 1KU2A 3I59B 2JRTA 4A5MA 1XMKA 1SMYF 3T0YA 3LAPA 5D8KB 2XHKA 5D5XB 5TJJA 3M7GA 1RI7A 1IRGA 2HKOA 3FX3A 2YX4A 3QU3A 3RI4A 1BN5A 2QBYB 1ZN2A 2X0LA 2IA0A 3GF2A 2FNPA 4N9IA 2DBBA 3I64A 1KU9A 1T38A 4Y15A 1LDDA 1DPUA 4KMFA 3VB2A 4U7DA 5HDGA 3QP6A 2FSWA 1UB9A 2EB7A 4AIJA 2NNNA 3M8EA 3DF8A 4LLGF 1TQIA 3VEPA 1Z1DA 2M1BA 4YFNF 5J8FA 1PP8F 4AD9A 1SFEA 2XKOA 3GW2A 4IVNA 1FX7A 3KZZA 3J81K 2RC4A 4FX4A 1YS6A 2CQKA 4HX8A 1H0MA 3SFZA 1BBYA 1XDUA 2VT2A 5K5OA 3F23A 1RZ4A 1MJ9A 4BXUA 4FT8A 2LNBA 4HV6A 4K2EA 4L5JA 1HW2A 2DQRA 3O3KA 1P92A 1XSDA 2XGXA 3C3WA 2JT1A 4U0VA 4M9SA 4EM2A 4E70A 3U2RA 4UNOA 2GWRA 4R79A 3F8NA 1YFHA 2Z9OA 3BWGA 6PAXA 1B4AA 2V79A 4LGWA 3ZMVA 3G73A 2J5OA 3LA2A 4LLNA 2KIFA 3TGNA 2STWA 1YO5C 2Y48A 3NRVA 3TO7A 5F6FA 4M72A 5L3GA 3RPQA 1O7FA 3K1PA 3ZP5A 5J8CA 4Q48A 3NQOA 1ONVA 2HTSA 3L09A 4EJWA 1FY7A 3E3VA 1WQ2A 1USTA 1L0OC 5DV5A 5FFZA 4IF4A 4KYWA 2XAGA 3ZMZA 2FQ3A 3CUQA 2ZKZA 3KETA 1KA8A 2PMUA 2P6TA 4U0YA 2VONA 1PP7U 1IRFA 2E1CA 4LG0B 4KIFA 1FBQA 3TDZC 2JPBA 3J81Z 1BIAA 3GYHX 2Q0OA 4M6YA 2Q8KA 5HS9A 1UFMA 2C6YA 4ENNA 1P4WA 4IXAA 2ISZA 3ZMSA 3REOA 5E18F 2ZBKA 4YFXF 2AS5F 4OIRF 1I5ZA 2QVOA 4KIBA 4LFUA 2CW0F 1R5GA 3F6VA 4HDUA 3N4MA 5HLIA 1J0RA 4RGSA 2RV8A 2EFQA 3I59A 2STTA 4HYEA 4JQFA 3JW4A 1J9IA 2V1XA 2HS5A 1ZRCA 4HW0A 2P5VA 4RB1A 3HOTA 3GFJA 2GQQA 3QU6A 3DV8A 5FO5A 2IA1A 4A2UA 3QP5A 3PQKA 4QWQA 3GVAA 2QBYA 5LRSA 4CHUA 2FXAA 2Y0MA 1ZH5A 3WTUC 4ZYHA 1G3TA 1DUXC 4HQEA 3GLXA 3CUOA 2K86A 4OMZA 4YIIA 1L3LA 2FEZA 4I2OA 3ABTA 3FWEA 1BI1A 1YS7A 5F64A 2EA4A 1GXPA 2M8EA 1FWZA 1FZPB 3T5XA 1F1ZA 1SD7A 1XGNA 1F4KA 2A6HF 2PQ8A 2EV5A 4HAMA 3I5UA 3I4PA 5ED4A 1TQPA 1XCVA 4KICA 1GHCA 3ML6A 4NHJA 3WTSC 2CSOA 2YPRA 1HKTA 3HHHA 3I0TA 4HLYA 1U2WA 2FBKA 5DDGA 3T8TA 3P7NA 3FF5A 1FBSA 1XGMA 2ZJ2A 3BROA 2A69F 1LDJA 5IT3A 2IP2A 4GGGA 5FD5A 1C0WA 4LB6B 5DCFA 1ON2A 3RIRA 3F8CA 1J75A 4DQ2A 1RNLA 4KMUX 2XAJA 2NS0A 1BI0A 4HBLA 2FMYA 4BAYA 3TQNA 3Q9SA 3DXJF 4PGGA 1RUNA 4IRGA 4L9NA 2R7DA 4HF2A 1JHHA 4DNCA 2PN6A 1W7PB 5JI6A 1ZARA 3RYPA 2DK5A 5LLQA 4Q5SF 4ZZLA 1WRJA 3V8LA 3MFKA 4B8XA 4XSXF 2BEOA 4I02A 3L9FA 1LJ9A 3GZ5A 3V4GA 2HYFA 3DKWA 2E7XA 2P6SA 2YR2A 1R7JA 4CZZA 4XSZF 4LG0A 1TNSA 1KYWA 4I98B 4U88A 3TO9A 1YYVA 3ZN0A 3K2ZA 4HF1A 3QPHA 3DPTA 5HLHA 1LDKB 3HHGA 2BYVE 2EA2A 1I1GA 3W6KB 2VT3A 2HDCA 3K0LA 2Q2EA 2EJRA 3MEXA 2P4WA 1R1TA 4RGXA 3WTXC 1W5TA 4ON0A 2P7VB 4WX9A 4OIPF 1QNTA 1FBUA 4EQQA 1J5YA 2JTVA 4NB5A 4LK0F 2LDUA 4MHGA 2JSCA 3H3ZA 4XRFA 2WWYA 2RGVA 2F5EA 4MEXF 1EH8A 2F5CA 2L54A 3WE2A 2DPUA 3N97A 4MTDA 4I09A 1IXSB 2H27A 2HR3A 2XRNA 3IHUA 3D5LA 3TOAA 1Y0UA 1R36A 3D0SA 3WGHA 3CUQC 5DUKA 3MWMA 1S7OA 2HGCA 3O6BB 1YW8A 2H94A 3RKXA 3ROUA 1MGTA 4BHPA 4Y13A 1LNWA 2Z99A 2EFOA 4S05A 1O3SA 3GWZA 2R7FA 5FD6A 3IWZA 4KN7X 2VXZA 2XROA 4R1HA 1YLFA 3IKVA 4A5NA 1A04A 2HZTA 2RQPA 2YX7A 2QQBA 2EK5A 2O8XA 2X4HA 4XLNF 4QLCU 2TDXA 4HF0A 4YIFA 2VN2A 3B02A 2H6CA 5ILSA 1O57A 2JZYA 2RN7A 1ZAOA 3F3XA 5L3CA 2UXXA 5DEQA 2CG4A 1R58A 5IT9K 1P4XA 1SAXA 1MKMA 4EGYA 3C1DA 4G6DA 3FMSA 5HDKA 1DDNA 1SFXA 2NYXA 3CJNA 5DCMB 2FA5A 2UXNA 2O03A 4ZZDA 3EETA 4A0ZA 5E1ZB 3I71A 1XGSA 3ZMTA 4FX0A 3EUHA 1W7PA 1XSVA 2ACJA 4Z2YA 3WTYC 4Q4ZF 3R0JA 2PFBA 1T39A 4BYYA 2D2WA 4IHTA 4EM0B 5LRRA 1WI9A 1PUEE 2M45A 5E8IA 4HQMA 3HOSA 4L0ZB 2EV0A 2D45A 3E5QA 1SD6A 1YG2A 4EJOA 2P5LC 1BC8C 3CTAA 2IRFG 2KIUA 2VC1A 1U8RA 1G3WA 1H9GA 3Q9VA 1ON1A 5CVIA 1LEAA 3E6BA 1XSXA 3EYIA 3JTGA 1DPRA 1FNNA 4HX4A 5AIQA 4Y17A 3V8JA 3SZTA 5D4SA 1Z6RA 2NRAC 1ZG1A 2D1VA 2PMHA 1OYIA 5ICGA 4A0YA 1IF1A 3HTSB 3DPLC 3BPVA 4U7BA 2QYOA 1YTYA 3ECOA 2VBZA 5IT9Z 5D5VB 4M71A 5LHGA 4IJAA 2DQLA 5ICEA 1QGPA 3M1EA 4PCQA 4R8HA 1BIBA 1XDSA 1LEBA 4UV8A 1FYKA 2IPQX 3JSPA 1DP7P 1UHMA 3BJAA 1R22A 3C7JA 1JXSA 2DPDA 1MZBA 2DAOA 2MH9A 2PEXA 3U9GA 5JVTA 5EEGA 3WTVC 2BBYA 3FXRA 1HKQA 5BPIA 4O3MA 3SQNA 4UV9A 2HQNA 2MLGA 3QPTA 2GAUA 3K9TA 3WODF 5D4RA 2DTRA 3IRRA 4ENMA 2Z5UA 4EJVA 2ESNA 3F6OA 2HKXA 4FHTA 1BI3A 1HSTA 1UHWA 3E5UA 2P7CB
chains in the Genus database with same CATH superfamily
1TW3A 3KYCB 2KMUA 1IAWA 1OQYA 2YSRA 2BV6A 2COMA 3ABKH 5M3MJ 1VQ6I 1IN7A 3GFIA 2H8RA 4AM3A 4CCMA 3DU5A 4MGRA 2XB0X 3KP4A 2F2EA 2OCEA 3H3UA 3GEZA 1WJPA 5CQGA 2L01A 1LB2A 2EFWA 3Q5FA 2W00A 4QIWN 3E6CC 2Y75A 1IQSA 4UVCA 3TP0A 2MFZA 1R4MB 2R93J 2L9RA 3BOQA 4E7JA 2LC2A 4IHSA 3FHZA 5CVJA 1FLIA 2DA1A 4O6JA 5A6KA 2GBYA 1A6QA 2MYSA 1KU7A 4HRIA 3NWSA 2M5WA 4DUYE 2MSYA 1S29A 2NNYA 3C4BA 3EUKL 3RKWA 2E60A 2HOAA 1QZYA 1D8KA 1F5TA 1Y6IA 2OQRA 1DQ3A 4XR6A 3W2AA 1VQMI 1NK3P 1R23A 2HZDA 3Q3SA 2G9WA 4KIGA 1JE8A 2BBGA 1KQ0A 2FBHA 1PDNC 5K7HA 3KEQA 1V54H 1AOYA 2PBIA 1R1VA 2QUFA 2JA2A 2A61A 3H1CA 2KZGA 4JX5A 2KOUA 4CCJA 2DFFA 3E7LA 1XD7A 2DTZA 1XB4A 5IYCJ 1IBLE 4XLAA 1VQ4I 4AC0A 2K40A 4LF7E 1IXRC 4OMYA 2MC4A 3FM3A 3GO5A 1O3QA 2UUZA 3LQQA 1ZGJA 3JAMK 4ZJZA 2E2JJ 5DCMA 2LBFA 3DCFA 4C9YA 4MEYF 4TUGA 5ILUA 2QKLB 4XORA 3G2BA 1TF3A 1VQOI 1N75A 4UXNA 1S5LC 2K7IA 4XM3A 1IXCA 3OYGA 2EZKA 3UR3C 4EJTA 3GZNB 2VKEA 3NWTA 5CVRA 4LK1F 3H35A 3QOEA 3H9QA 3LL7A 4GZNC 4ZYGA 1S7AA 3CCLI 1V3FA 4YG2F 1G3YA 2PX9A 4CUGA 3OIOA 3CCRI 2KIQA 3VHTB 3RMPA 3H5RA 1T56A 5LFAA 1MMGA 3KP2A 5BOXA 5FGMA 1X1DA 3WE3A 4CICA 4C2UA 1U5TC 1CQTA 4CO8A 4OINF 2ME6A 4D7MA 4R2SA 2NOJB 3LA7A 3QAHA 1XTAA 2XUBA 2L3DA 4V2GA 4ETSA 2ELKA 2EMGA 1QHHD 4WSPA 1HCRA 2RPCA 2M4GA 3IP4B 1HBXG 2IEKA 2NAZA 3P9KA 5D6FA 1U3EM 2V83A 3JTHA 4JI6E 1BL0A 5HNHA 3GTQJ 2HFHA 3I54A 3O8GA 2PI0A 2EM3A 3C2GA 4PUSA 1NEIA 1UN6B 5DD8A 4KZSA 3HRTA 2XDVA 2WADA 3RPUD 2VIXA 1JKOC 5IT9C 4IQJA 3BTCA 2DA6A 2PJPA 1TTYA 4WF2A 3HOVJ 3IWDA 3PIOF 1U5TB 4N0BA 3IH3A 3LA3A 1T0FA 4B09A 1I6HJ 2AO9A 4O5VA 1TNTA 2CQXA 3LQRA 2YTIA 3ERED 2JPCA 5GAGJ 2LT7A 1KGSA 3G3ZA 3L00A 1Z67A 4DOZA 2QSFX 2L7FP 2XAQA 4O5GA 4UVAA 1FYMA 2ZXJA 2P81A 5KHDA 2V85A 4L9TA 1HDPA 2JUCA 2X6XA 4P9FA 1LFBA 4ZTFA 4C3HJ 5GAEJ 2PLYA 4KA4A 2YS9A 1S3JA 1KYZA 1G6NA 1JKRC 1DGCA 1TWAJ 2E34A 5K5QA 1Z21A 5D6EA 3MMYB 3ADGA 2R7ZJ 5M5WJ 3L2CA 2VUMJ 3BR3A 2M8GX 4DYQA 1YIOA 4W97A 1QQIA 2K3FA 3LSJA 1USSA 3LWFA 4II2A 3NARA 5K7FA 4PJJA 4J00A 2KT0A 3G1MA 1FSHA 2VQLA 4M74A 3F22A 1LKXA 1BJAA 1GQEA 1W7PD 2QGUA 2VBXA 2RQQA 3V42A 2OQGA 3BP8A 5BR8E 1MD0A 3WTTC 3E5XA 2R3SA 4RB3C 5AONA 1FIAA 1HXDA 3CCJI 2LCEA 3RDIA 1GVDA 2ZMEC 3S2WA 3S93A 5M3FJ 3G1LA 2HYJA 2W57A 3JAMZ 4OOGC 2EWNA 4V19K 3S1MJ 1K78B 2MW8A 4L0YB 2B63J 3EUHC 1EJ9A 1MH4A 2M34A 4A0XA 4BQAA 3IL2A 4BQOA 1D0YA 5E17F 2KDOA 2HXOA 2ZSIB 1S9HA 5L3EA 4AWXB 4ZYDA 1EF4A 4PJ0C 4YFKF 3KP6A 2XRLA 3KZYA 1VTNC 3FXUA 2LY1A 2V7FA 3OYKA 2K27A 1YSAC 5FRMA 3BZ6A 3V7SA 2VE7C 2L9VA 5JFRA 1TC3C 3BR0A 2CMPA 1SVOA 1REPC 2D5VA 4X62E 1WJBA 2ZNZA 5KL7A 1ZBQA 3MHSC 2L4MA 1KONA 2WB1N 2ZMEB 3HEFA 3OIPA 2DU9A 3BQZA 3BDDA 2OAZA 1GT0C 3F8BA 1K4TA 1IN6A 2DB2A 4RB0A 1G3SA 1OISA 2E7WA 4H4KC 1J7KA 2Y9YA 4CXFA 4MQ9F 5DM6F 3G6EI 1QBJA 1VQ8I 2YTDA 1TZLA 4MTEA 3JTZA 1QPMA 1Z05A 2WY7Q 2L2KB 1DGRM 2MDGA 1BR2A 4UB8C 5DM7F 5EZHA 2ID6A 2WCC3 4KNYA 3BG9A 3BPXA 2M1SA 3IKTA 4DR2E 1MSEC 1GVJA 2JVGA 3COAC 3MQ0A 1FTTA 1ZU1A 5LHIA 3BGHA 4N9HA 2Z1DA 1R00A 1SR9A 1B9MA 3IWBA 4EJUA 2V86A 2V87A 1G2HA 2DDBA 3SHFA 1S6LA 5A69A 4F2JC 4XLPF 3O8HA 4XL9A 2XGDA 2LF7A 4A3KJ 2Y9ZA 3LSMA 2V9PA 4R03A 1IW7F 3W2VA 1FYLA 3KYDB 2E5ZA 3HSFA 1HDDC 4BHBA 3MZHA 4TUIA 3QQAA 2DLKA 3GFMA 3ISPA 2HU9A 3M9AA 1F9NA 4YHHE 4M9VC 4M3EA 1BC7C 2F8BA 2CGPA 3OYAA 3F72A 4ZDOA 4OAZA 3MAJA 5AIPA 5K7ZA 4M6XA 2QENA 1A1FA 1UILA 4GYIA 1FJLA 2GM4A 2JR1A 4KJZA 1FP2A 5FB2A 2LY2A 2XSJC 4H0EA 2FF4A 3K1MA 3EDPA 4PJMA 2IT0A 4XK4A 1FTZA 2BY2A 4WXCA 2R7WA 3OOUA 2E71A 4G8XA 1YITI 2DOEA 2L33A 5BMZA 1W36D 4XONA 3FKIJ 1FP1D 1XPXA 3F9KA 3X2QH 3BJ6A 1K6OA 4DYRA 4I01A 2E1MC 1QVUA 2M7AA 2JN6A 2NVQJ 2ENAA 5KAIC 3OOPA 4LF9E 5BPDA 3R60A 1T8IA 1XCBA 5J1UA 3EPJA 3J7AG 1W36C 2DJIA 2ECBA 2VB6A 2D1HA 2ZB9A 4KUMA 4OOIA 2EPCA 2M4IA 3ESWB 2KKOA 5ICFA 4C3JJ 4N4OB 1YHQI 2VPRA 3F8MA 2UWMA 2PJRB 1FT9A 3V7RA 4NQWB 3BCAA 5JLXA 1B6AA 3W2WA 3ULQB 4E7HA 1X58A 2I10A 3S14J 3IWCA 1E0EA 4Y4RA 1HA8A 3F8FA 2RTXA 4BC7A 1RETA 4FASD 3GZ6A 3T8RA 4A3EJ 5DUIA 1POGA 3HYIA 2MA3A 4HV5A 1CF7B 2RVCA 3BQYA 2FBIA 4D7NA 3V8KA 1R5HA 3I4MJ 4MLVA 4PDKA 4AVZA 3FXKA 1NTCA 1DI2A 3J7AO 1TLHB 1SMTA 4CCKA 5HS7A 1QZZA 4R2QA 2R5YB 1MH3A 5AC5A 1RC9A 2MGQA 3I58A 2XASA 2QEXI 1B59A 4LD5A 3DEUA 3CJQB 3JREA 3T1BA 4TV7A 4F9CB 3R4KA 3C2BA 1AHDP 2EV6A 3BR1A 3F21A 3OV8A 3M3YJ 3OYFA 4M3GA 1U5TA 1BR4A 4F3QA 2HQRA 1X1CA 3L2RA 3HOXJ 1D5VA 3MCZA 1PJRA 1FOYA 2EMFA 2DK8A 1OCRH 4HNTA 2CPNA 2QM3A 3Q0VA 4BACA 2H36X 3JAMC 4ENKA 2F4IA 4M6VA 3FMQA 4MO7A 5JR3A 3HM5A 4JI5E 1E17A 1LVKA 4E7SA 2CUFA 5KL6A 1KU3A 2ODRD 1I27A 2NA2A 4WXHA 2RAEA 4HOBA 2M30A 3LAJA 1HW5A 3D5SC 3H36A 2FTXB 5AASA 3LSKA 1T4NA 2B9DA 1T4LB 5DTDA 1TQMA 1XS9A 1EKZA 1BI2A 2ADUA 3FZVA 4IOAF 3D1NI 2XF6A 2MBFA 2DFHA 3ZMDA 5AE3A 2M0MA 4BH9A 2BXZA 4AUXA 4WWCA 1X2NA 3DP7A 3OWTA 1Y56A 2ODRC 1TWHJ 1U0JA 1VZ0A 2LKSA 4PK4A 2DMQA 1X19A 1W1WE 1KJKA 1MJBA 4XLEA 1IQOA 3A1YA 4BQNA 2OC6A 3HSRA 3MKYB 3RPUA 4NXNE 1IN8A 3ZR8X 3DBHB 4A6EA 2CFOA 2CTDA 1ZREA 4B3XA 1Z91A 3KE2A 2RKHA 1ZELA 2VE8A 3IAS2 1MNEA 2IGMA 3I9V2 1JHFA 1O7LA 3A02A 4M3DA 2JYAA 1D8JA 4RM3A 3CCQI 2QKMB 3MZYA 2K4VA 2VI6A 2H09A 1K78A 2YU3A 2B7VA 2CS3A 5EDNA 2K4JA 2IS6A 3AAFA 2MDRA 1S7EA 1ULYA 2W82A 4MFDA 3J80K 2DMNA 2YRHA 5IXMB 3FISA 4BJ6C 4BCAA 3QYBA 5E1XA 2YSOA 1ETKA 4N4RB 3C18A 2MC3A 1RKTA 3WGIA 4MNUA 2DOFA 1JJ6C 5B5EC 2JP9A 2Z33A 5HDNA 2QLZA 3GCMA 2XIGA 1D1CA 4Q47A 5H20A 3ZCOA 5ERIA 2EPKX 1SD5A 2K9MA 2L7MP 2JUGA 4ABZA 4CGZA 2ZMEA 4M3FA 1NCSA 1FPQA 3HTUA 5CYVA 2MABA 3JRIA 2J5PA 3OMYA 1JKQC 2LRSA 1D3YA 3ADJA 1JUMA 4L9VA 1V5GA 4XRSA 4PGHA 4IEJA 4F6NA 4EEFG 5TSEA 5ICCA 4FETA 4NDLA 2CUEA 2EFPA 3IRQA 4WPYA 2O5RA 1HKSA 1IDZA 5H6RA 4M0VA 4ITVA 2L02A 2EIKH 2HPMA 4DBRA 2WB1A 4PFOA 3AG4H 2X6WA 4HG2A 3BZCA 4AIKA 1T0FC 2OF7A 2NUFA 2KL4A 3P9IA 2EPNA 1QO0D 2DO7A 2V9VA 5ADZA 1YQAA 2MC6A 4IL6C 3HRSA 1PJQA 2CU7A 2EOQA 4EV0A 4RHBB 2F4VE 5LGNA 3DKXA 3MHHC 5IYDJ 2LTRA 5HLGA 1WWXA 4I7HA 5HOOA 5K5RA 4QTRA 3K1NA 4CYDA 3WU1B 4BNCA 1MMSA 2EOSA 2MKDA 3FXMA 4AIDA 4XLCA 3PJRA 2UV1A 5LBQA 1IZ1A 1R71A 1ZLKA 2HDWA 4JBAA 1IN5A 3ZQGA 4L8NA 2QQ8A 1V4RA 1VQ7I 4A3LJ 4RB2C 2VF1A 5IWAE 1YUJA 2ZO4A 3FXQA 4L5IA 3ZPLA 1QHGA 1RMDA 2DRPA 1JT6A 1FMVA 2TRTA 3QPLA 1GTKA 2BE5F 1PJSA 1XNQE 1Z3YA 2QA4I 3ZOQB 4AQYE 2MD5A 1Q1VA 3CJRB 4ZYEA 3E97A 4XRMA 3HRMA 2ADRA 3FXOA 1VQLI 2MLKA 2EQ0A 1HSJA 1P47A 3M07A 2IS4A 1HW1A 2GXGA 2R1FA 2X85A 3GTJJ 1P4AA 1UBDC 2YUSA 2EL6A 2R7XA 2XC7A 2EOJA 3FXLA 4KT6A 5A2QK 4R2PA 4UUSB 5FKKA 4J8ZA 4BS9A 3HRUA 5CVUA 3OTOE 4A3CJ 2HDDA 4ESJA 2OV7A 2DFEA 4P7DA 2GIVA 3BG5A 5CJ9A 2QSGX 1AAYA 1OR7C 5KK1A 3A2KA 2B7TA 4YEJA 3ZQHA 2EM6A 3KWRA 4HZFA 4IRIA 2EM9A 2EL5A 2LP0A 3J80Z 3S2DJ 1IN4A 5L3BA 2A05A 2MD0A 5KL4A 1QPIA 1E2XA 2QCOA 3TEDA 2EPZA 4B3ME 2XVCA 4F7ZA 2F5DA 2RREA 2IXSA 4R8OA 3RYRA 1TT0A 3H92A 4IPAA 4HNUA 1V5FA 4RDUA 1XN7A 2DMUA 2PJRA 2RDPA 4NQWA 2NVYJ 3KP3A 1QA6A 4LB5A 1X1BA 1P6RA 3J7YJ 1ZG3A 2EZLA 3HUGB 2XF5A 3AKZA 1IJWC 4GEQB 3BCBA 1Y1WJ 2KJBA 2WZOA 2ELHA 2HTJA 1K7AA 2EILH 1CF7A 2HOEA 2OBPA 4XNFA 3BF2A 1ZYRF 4ESFA 2EOOA 3EQLF 5CVVA 3U1DA 1OFCX 1V5EA 4FE7A 2L2NA 2R5YA 5IP6A 2I9IA 3H5AA 4L5EA 5L3DA 1W5SA 2UZKA 1ZHFA 3OR1C 4BHCA 4M73A 3WU0A 3HOUJ 4A3FJ 2R76A 1YOVB 4CH7A 4PFPA 4A6DA 2EMWA 1IUYA 3WGGA 1NH3A 5KVRA 4AVPA 3EPLA 3C4TA 3ZQCA 4JI3E 2K7LA 3ECHA 2KHXA 3GX4X 1A6IA 4AU7A 3JRFA 3D5RC 5IP9J 1DU6A 2OUMA 3RCOA 2A68F 4D5FA 3TMOA 2EPLX 2QQ9A 4P5OA 3IAM2 2WV0A 1X6FA 3CP2A 1T98A 3GXOA 4BXFA 3THNA 5F27A 2XAHA 1HQCA 2P8TA 2WAFA 2OD5A 3JR9A 1WJ5A 1LUJB 3P9CA 1WCMJ 2AXLA 2LUQA 1U9NA 5J6XA 3HJEA 3DFGA 1MJAA 3GTMJ 4C2TA 3R0AA 5CLSA 4LJZF 4ESBA 2YTJA 3NEUA 5LGUA 2HI3A 5EG0B 4NC8A 2EM5A 2VC0A 3K4NA 3SYTA 3CLOA 4G9YA 3OY9A 1O3TA 4OX9E 2N8XA 2EPUA 2RS7A 1W0UA 2GZWA 4XBFA 3L7WA 4B3SE 1BM9A 4E7IA 1FC3A 3O2PE 2XPWA 5DS9A 1MDMB 2EPMX 4GDFA 3CLQA 1X48A 2NABA 1FSEA 1Y1VJ 1VQNI 5A2QZ 3AG1H 4IHWA 1YUIA 1QU3A 2VBYA 3LSTA 2FD5A 4YY3E 4HSRA 3FDYA 3HQ1A 2BY1A 2ZNYA 2F5VA 1F2IG 1FOXA 3K4JA 2A25A 4XIDA 3S1NJ 2AXTC 2QWWA 2LKPA 2EN4A 2DIXA 2DMTA 1E3HA 1X3UA 5D5WB 2O0YA 2FRHA 2YT4A 2ZJRF 2KRHA 2HOSA 1MBHA 1HR0E 5LGTA 1XGOA 3KP5A 4RGUA 5K1YA 2YTGA 1BBGA 4F91B 3QWLA 2LD5A 2A5YB 1YX3A 1K6YA 2EOZA 3H09A 2JSPA 1OLTA 1Z9CA 3ASNH 2EN2A 3CO6C 2KONA 4IOCF 2EMKA 3RZOJ 3LMMA 4UHTA 2EFNA 3HL2A 3OYDA 2B9SA 1AWCA 2DXIA 2B3TB 1P7JA 3CZ6A 1YJ9I 2DFIA 3PFIA 4KN4X 2JVHA 4GCVA 2CV2A 4F9BB 4LF8E 5B1AH 2BXYA 3SDBA 5F0CA 1JTXA 1G59A 1N32E 2O8KA 2IJLA 1U8BA 2GA1A 2KQRA 4DIQA 3M4OJ 2L92A 3WTWC 2Z3YA 5LEKA 3PSIA 2UXDE 2DI3A 2O61A 4OWRB 1W4MA 1B1BA 2FU4A 5LHHA 3KCCA 3R6SA 2E1NA 4ASNA 2WC2A 1Z7UA 5C3EJ 1IC8A 2J7JA 4UUVA 4LMYA 3LSRA 4BMJA 5E3MA 2CT1A 2DLLA 5IP7J 3PNVA 2WAQN 4JK1X 3RKYA 5JHFA 2LF8A 1A36A 2XPVA 1EH7A 1EV7A 3J7Yp 2IVMA 3PSFA 4JP0A 1K79A 1ERDA 4NXME 2UU9E 4DZPA 1I6XA 1WJDA 1X1PA 4L9JA 4G7HF 2DGCA 3CC2I 1HOMA 2IGOA 2GPIA 2EN6A 4B47A 1UELB 3F0CA 3ABMH 1ZGAA 5DD4A 3J80C 1P2FA 2V6CA 3TQMA 1J2XA 1YE9A 4MQVA 2LSOA 2EPAA 1NHAA 2UUCE 3IWFA 1ITYA 2WA0A 1N3GA 1YW9A 4LIUA 2HWVA 4XKWA 3CO7C 3TL4X 5GTIC 5HVQC 2VBWA 2G7HA 2VODA 1T95A 2R7TA 5D5UB 2O3FA 3LLHA 2CRGA 3V7CA 1B9NA 4BXXJ 2CH0A 2IAIA 2YRMA 5AC4A 2WTEA 2DYRH 2FOKA 2OJED 3CCVI 2BGCA 3ZN1A 2NUGA 1ZG5A 1MMNA 3I53A 2EP3A 2KIMA 2KJCA 2W48A 5HS8A 2ELYA 2EL4A 5TRDA 2IA2A 5E3LA 1T4OA 2EN7A 1MBGA 3KFWX 2XV4S 4UUSA 1IUFA 1ODDA 1TBXA 4A3GJ 5D8LB 5KCMA 5FFXA 3JSOA 1KYQA 1Z6TA 1UCRA 4YIRX 2HQ5A 2E2HJ 1AH5A 2W1OA 2IW5A 5KAFC 4RS8A 4RA2A 3DBLB 1U9OA 4FK5C 4ZC3A 5F04A 1ETQA 2K4BA 4IRHA 5EEAA 2LJHA 1SD4A 1JKPC 3KZIC 1X6HA 3L1PA 3RKQA 1R1UA 1VF9A 2OZ6A 1TL8A 4L18B 2HC5A 1VQKI 2A3SA 5CQEA 3EYYA 3VOEA 1I3QJ 2V1NA 1I1SA 2LR8A 4KFCA 2OU2A 4X8WA 1VQ9I 3HGGA 4A69C 4DR7E 1YJNI 4DV1E 3QODA 4RLFA 3PFYA 5TISC 3C6MA 3EPHA 1STZA 1BR1A 2F5FA 5E3NA 4JI2E 3HUGA 4HA8A 4AIHA 4CDGA 2GXBA 4LU9A 1OR7A 1IGNA 1WJEA 1U78A 5GADJ 3CCYA 4HLXA 3VWBA 2VOPA 4G7ZF 4P96A 4G6TB 3SDGA 2Y2ZA 4Y52J 3S8PA 2PG4A 3WTZA 2LJUA 3OL3A 2ETHA 5BQTA 1K61A 4I0AA 4DMIA 5DNYA 2DT7B 1XG1A 1YW7A 1KQ9A 5A6BD 3K6QA 4KT5C 1ACIA 3S32A 3BLYA 2W7NA 4NNJA 4EMSA 2Q8UA 1OPCA 3KP7A 4A3DJ 1YZ9A 1N77A 3THOB 5A2QC 3E6MA 3OYIA 3DQVC 1H89C 2I8DA 3S17J 4JX6A 1JK1A 2W24A 2H1KA 5LEJA 4XLHA 3C2HA 4RGRA 5GAHJ 3K2AA 2P5KA 3RTRA 1ETWA 5IPAA 4UY8I 2ISYA 3BY6A 3CCEI 1LQ1A 2RSMA 3OSGA 4M3BA 2M9HA 2NVTJ 4BKXA 4M9XA 1G4DA 4OIOF 4HX7A 5BS6A 2V8QB 5EG0A 1S8NA 4G7OF 3TW6A 4I76A 4OU0A 4G94A 4DBQA 1IDYA 1IV6A 1XMAA 4CCOA 2JA5J 3OYEA 2B0LA 2V1UA 4EVIA 1GXQA 4OAYA 2OCCH 4DV3E 3E6DA 4NBQA 3VFZA 3SZPA 1ZRDA 1Q1HA 2RNJA 2HVSA 4OIQF 2CO5A 3TDUC 3EUAA 1MDMA 3PNYA 1RUOA 1XNRE 2E35A 1YYOA 2XKPA 4BL0B 5FKLA 2H6BA 5J3LA 3I56I 2GA2A 2ID3A 3LSPA 5E1WA 2LUPB 3HSEA 2M87A 3KLOA 3KLNA 2DA2A 4J01A 2GLOA 4PZJA 3CF2A 1YPNA 3ZQ7A 5EGOB 4WXDA 3HOZJ 1RC7A 1OCPA 2YZTA 3ABLH 4IHVA 2OA4A 1JUSA 1FOWA 2EINH 4V2FA 5JLWA 4WK8F 5AE1A 2VQFE 1HNZE 4A93J 3OR2C 1GUUA 3SXYA 3BR5A 1WZ2A 4KWYA 4ZDPA 5E20A 2W84A 1CGPA 4R2AA 4JI0E 1IV8A 5M5XJ 5CPRB 1RIOH 5ILVA 2UUAE 3W6JB 2HEOA 3GFLA 4HDVA 1T6SA 2CFXA 4GYGA 4BE2A 1LPQA 1E3OC 2ZFUA 3RJPA 3TW7A 2EPFA 4ENJA 5A6JA 2BY0A 3QOPA 5LD2C 1FOKA 3K69A 3R61A 3QPSA 1D0ZA 1A1LA 2K3PA 3VYTB 3HG9A 2XAFA 1SAUA 2QF7A 2X6OA 3Q0UA 4IKFA 1K4SA 4D1QA 2LG4A 5FLXK 4RAYA 2LV2A 2ELJA 2M2EA 2A6TA 2N3HA 1N25A 2FE3A 1TN9A 4B44A 1TW2A 2EMZA 2KLOA 5DYMA 3MKWB 3M8FA 3MKLA 1MEYC 3JRHA 4GXOA 4XKCA 1EA3A 2LYCA 1J59A 1BW5A 2QQAA 4U0WA 4YELA 3H9JA 4B1RA 2L7ZA 4GRIA 2A07F 3CQZJ 1R9TJ 4RAZA 2JPAA 4I0BA 2MH2A 2AQFA 2LLKA 1OJLA 4JI8E 2VXDA 1NK2P 2DT5A 3QRFF 1YIJI 2ME0A 1IMUA 1PKPA 5EEHA 3WG9A 2DMYA 2VOOA 4BU2A 1WI3A 2EOFA 3DLLF 5F1RA 1F36A 3CDHA 2YU9J 2HQAA 2X1EA 4CSWA 4P55A 4GO1A 4IX7A 1UG0A 4M9ZA 2EPXA 1UG2A 1PVEA 1X3CA 3W6VA 3DTIA 2ZCWA 2WAQA 3B73A 2FMLA 2EPRA 4DR1E 2Y0SN 1WKMA 1EH6A 2W25A 2EJ4A 4KDPA 2A6EF 1R49A 3ELKA 3FMRA 5L3FA 3S2HJ 3TKYA 3OSFA 1AA7A 1R4NB 2K9QA 4LG3A 4L5NC 1ZRFA 3OIQA 2HYGD 2LTPA 3LFKA 4G6QA 3OYNA 1U6GA 2VE9A 4S04A 3KIOA 2DMPA 2XGEA 5E8GA 3IH2A 3BJOA 4EGZA 4BQQA 3PO2J 1OYYA 3G4SI 3E0JB 4XICA 1A1KA 4FISA 2GOXB 3FM5A 2G7UA 4EM1A 2CSHA 2V1DA 5KL2A 3TO6A 2EQ1A 3WG7H 2O6GE 2QZ8A 3TOBA 4XKVA 1LVAA 2WBTA 2L4AA 2OZUA 3CUQB 1JGSA 5F3WA 3FBNB 3OMLA 4O43A 2BY3A 4W1UA 5HODA 2CYYA 4UVBA 3CC7I 2JY9A 2HGHA 3KEOA 5H6QA 3SFIA 1YRNB 3IC7A 3E1SA 1JGGA 3JRDA 3HIFA 1OKRA 4WCGA 4D0PA 4QSHA 1T2KA 4R2EA 2WV1A 1N36E 4I6ZA 2W85A 2M3AA 1JT0A 2LY9A 2V6EA 3ABUA 4P9UA 1MMDA 3IH4A 2XAUA 3DPUA 4IO9F 1H9TA 3OYHA 2EM0A 2VASA 3ZMUA 3OYCA 2DW4A 4PSXA 2RNGA 3PQJA 1O3RA 2LOOA 1Y8RB 2CWEA 1SFUA 1OMIA 2F48A 3CP8A 1WSUA 1KQ8A 4RH8A 1A1IA 4ZH4F 2FNAA 2R92J 2YTEA 2BW3B 4LLLA 1ZLJA 2ZFWA 5JHUA 3VODA 4A12A 4BE0A 3OYMA 1TWGJ 5FLXZ 2EM2A 3GUDA 2KRFA 3IUOA 5FKNA 2ESHA 3FBIB 1BOAA 2EPOA 5B66C 1OYWA 2K02A 1KU2A 3I59B 4MIMA 2JRTA 2ELZA 2YU8A 2CV0A 2CQQA 4X6AJ 1K83J 1RR7A 3OYBA 2R5ZB 4A5MA 1XMKA 1SMYF 2LMZA 2L9SA 4MFEA 3M8JA 5BNGA 4BJTA 3T0YA 3LOCA 2HJJA 5IOYA 3JRCA 3CD6I 3LAPA 3S3NA 5D8KB 2XHKA 5D5XB 4GFBA 5TJJA 3M7GA 1RI7A 2UXBE 1IRGA 2HKOA 2DA7A 2VKVA 3FX3A 4LITA 3DKYA 3FXJA 3J7AY 5C44J 3GTPJ 2YX4A 3QU3A 3RI4A 1BN5A 2QBYB 2ZJPF 4XLFA 1ZN2A 2X0LA 2IA0A 2XGCA 3GF2A 1Y0NA 2FNPA 4N9IA 2DBBA 3I64A 1KU9A 2KZVA 1T38A 4Y15A 5B1BH 2EIMH 1LDDA 5FKOA 1DPUA 1WHQA 2EOEA 1B72B 2KP6A 4JX4A 4KMFA 1IBKE 2V9KA 3KPHA 1SVLA 4NUBA 2FX0A 1QVTA 2EZHA 1I94E 3FK6A 2VJIA 3VB2A 4U7DA 4JI7E 3LSGA 2JMWA 4Y33A 3QP6A 2FSWA 5HDGA 2NS7A 1UB9A 2EB7A 1UAAA 4DUZE 3K10A 4AIJA 1WJAA 3RQ4A 3F6HA 2R7OA 2LVHA 2NNNA 1SVMA 5A6BA 3M8EA 3DF8A 4B3AA 4CCLA 4LLGF 1T33A 2RSIA 1SANA 1TQIA 3VEPA 1Z1DA 3H3VK 2M1BA 4YFNF 4JV5E 4RM2A 2KFDA 3BG7A 5F08A 5J8FA 2G0EA 4BBSJ 2CUJA 1PP8F 3U21A 4AD9A 1W0TA 1SFEA 2XKOA 5EGOA 3ECRA 1WFXA 3CDIA 3GW2A 4IVNA 5CFFE 1HF0A 3K6GA 2BOLA 4F52A 1FX7A 2EH3A 3KZZA 4DR6E 3J81K 2RC4A 4J19A 1YS6A 2CQKA 4FX4A 2M7QA 1OCCH 4HX8A 2XF7A 1H0MA 3SFZA 1BBYA 1XDUA 3VPRA 4LFBE 5FKMA 2LTSA 2VT2A 4FQGA 3TP3A 3HPHA 5K5OA 2M9AA 3F23A 1RZ4A 1MJ9A 3M1CA 1T08B 4BXUA 2NS8A 4FT8A 3PIPF 4XOTA 2V89A 4HTGA 2R7SA 3CC4I 3UKGA 2K9NA 2LNBA 4X66E 1X49A 4HV6A 4K2EA 2E5NA 3FHNA 4L5JA 5J4YA 3A03A 5M5YJ 3CDLA 2E2IJ 4HEIA 3BC8A 1HW2A 2L6MA 2DQRA 2LRDA 3O3KA 1P92A 1XSDA 2IS2A 4LIVA 2XGXA 2KHMA 3ZGKA 3HBLA 1XMOE 3K4BA 3C3WA 2JT1A 2KRCA 1D0XA 2V4JC 2EMHA 3AG2H 3MVPA 4U0VA 4F92B 4M9SA 4EM2A 2BB8A 4PJNA 5IOZA 4BE1A 4CCNA 4O24A 4E70A 1B69A 3OL4A 3U2RA 4UNOA 2GWRA 4R79A 4S0HB 3F8NA 1YFHA 2Z9OA 3BWGA 6PAXA 1B4AA 1X4PA 2EMXA 1A31A 2V79A 3ADLA 3DEWA 4LGWA 2LE2A 1BA5A 3ZMVA 4BGDA 3G73A 2J5OA 3LA2A 1KZHA 5IV8B 1VQPI 3EPKA 4LLNA 1LFPA 2KIFA 3TGNA 2STWA 2AQEA 2IGNA 1YO5C 2Y48A 3NRVA 4GKKE 3TO7A 3LSIA 5F6FA 2JK3A 1GV2A 4M72A 5L3GA 3GTKJ 3JCUC 3RPQA 1BOBA 1O7FA 4B48A 1B8IB 3K1PA 3ZP5A 5J8CA 5GP9A 4DZJA 4BDYA 4Q48A 3NQOA 4KHPE 1ZR2A 4ZTJA 4WYQB 1ONVA 2HTSA 3L09A 2EPPA 4EJWA 1FY7A 3E3VA 1ETYA 1XMQE 1BJZA 1UZCA 3S3OA 2GIZA 2Y0SA 3CCUI 1WXRA 1WQ2A 4XN0A 1USTA 4A3BJ 2E72A 1L0OC 1X4OA 5DV5A 4I8OA 4FTHA 1O0WA 1D5YA 4KISA 4DV6E 5FFZA 2K9LA 3DLAA 3HB9A 5FLXC 4IF4A 4Y3OA 2YTNA 4KYWA 1PJTA 2XAGA 3ZMZA 2FQ3A 4MLQA 2K85A 3CUQA 2ZKZA 3AV0A 1V55H 3KETA 4CYCB 3GMEA 4NHRA 3ZXSA 1DU0A 1KA8A 2PMUA 1FEXA 4E6KG 2P6TA 1WH7A 4U0YA 2HXIA 2VONA 2I5UA 3H0DA 4X9JA 1PP7U 1YRNA 3TBIA 1IRFA 1TP4A 2FUG2 2NOGA 2E1CA 4LG0B 4KIFA 5LL6R 1WHUA 3G1OA 4CZCA 1GZ6A 1FBQA 3TDZC 5FLVA 3VK6A 2JPBA 3QYFA 3J81Z 1BIAA 3JRAA 3GYHX 3K70D 1Z7LA 2Q0OA 4M6YA 2Q8KA 2X51A 5HS9A 1I50J 3NAUA 1UFMA 2C6YA 4ENNA 1P4WA 4IXAA 4BY7J 2ISZA 2B7EA 3ZMSA 1ZK8A 3REOA 1ENHA 5E18F 1UJ8A 2OPTA 2ZBKA 3LFUA 2MC5A 3M99B 4YFXF 2AS5F 2GHFA 4OIRF 1I5ZA 4Y7NJ 2QVOA 3CESA 2BW3A 4KIBA 4R2CA 4LFUA 3K70C 4F93B 4RMNA 4XN3A 2CW0F 1R5GA 3F6VA 4HDUA 2Y31A 3B6CA 3N4MA 2ENCA 4LFAE 5HLIA 1J0RA 2EIJH 1RRJA 3WHBA 4RGSA 2RV8A 2Q2EB 4F54A 2EMCA 2EFQA 2NVXJ 3I59A 2STTA 1N34E 3DTEA 3HZJA 5E3OA 3QG5C 2BHYA 3ZRGA 4HYEA 1EKEA 2R5ZA 3ZQLA 4JQFA 2VKHA 2E19A 3JW4A 3ZQIA 3JRGA 1J9IA 2EM7A 2L2OA 2RS6A 3ASOH 2V1XA 2DA3A 1IO2A 2CJJA 2HS5A 2N8GA 4HW0A 1ZRCA 2P5VA 4RB1A 3HOTA 3GFJA 2GQQA 4QPQA 3QU6A 3DV8A 5FO5A 2IA1A 2XPUA 4F9AB 4A2UA 2R7UA 1L4SA 3CCMI 4X64E 1WJCA 2EMIA 3QP5A 3HPZA 4G12A 1Z77A 3PQKA 4QWQA 2VPLA 3GVAA 2LREA 4DGWB 2QBYA 3HPGA 2EZ6A 5LRSA 4CHUA 3MN2A 2FXAA 3A0HC 3BIDA 2ZXHA 2WAEA 2Y0MA 1ZH5A 3WTUC 4ZYHA 1G3TA 1B72A 1J26A 5J4VA 1LFUP 1DUXC 4HQEA 3GLXA 3HGYA 3CUOA 2GLIA 2K86A 4OMZA 1MBFA 1PYVA 4YIIA 2DT6A 1L3LA 1ETXA 2LMDA 2FEZA 4BUPA 2GOMA 4I2OA 3ABTA 2EN3A 3FWEA 5C4XJ 1G2DC 2LK2A 1BI1A 1YS7A 1WPKA 5HNFA 4BBYA 4HNVA 4DV2E 1X3WB 5F64A 2EA4A 1GXPA 1M1EB 4DV7E 5LMUE 2M8EA 1FWZA 2DODA 2P0WA 1FZPB 3T5XA 2YU5A 3PUBA 3VYXA 4XQFA 1F1ZA 2W4SA 2RQLA 2JOXA 2D9HA 4BEHB 3PNTA 1SD7A 1XGNA 1F4KA 2A6HF 1TWFJ 1UMQA 2PQ8A 2EV5A 4HAMA 1A1JA 2Z16A 3I5UA 5KL3A 3BTLA 3I4PA 5ED4A 1TQPA 1IRXA 1R5ID 1XCVA 1XMXA 4KICA 2DLQA 4DR4E 1GHCA 2UXCE 3ML6A 3OS0A 4NHJA 5HLTA 3WTSC 2CV1A 1ETVA 3QYEA 2CSOA 5JVGF 2YPRA 1HKTA 3HOYJ 1PDAA 3SEZA 3AUZA 2L8TA 2O7OA 1ORKA 3HHHA 3I0TA 4HLYA 1U2WA 1G8XA 2NXNB 2LKXA 3L2UA 2FBKA 3K7AJ 4JYKA 5DDGA 3T8TA 3P7NA 3OYLA 3FF5A 1RPWA 1FBSA 4O4KA 1XGMA 2ZJ2A 3BG6A 3BROA 2A69F 3OS1A 1SEUA 5A6AA 2LBSB 1LDJA 2X1CA 3BG3A 5IT3A 4X1EA 1FIPA 2IP2A 4GGGA 1WHNA 2LH9A 4RAGA 3VYUB 1MNMC 2ENHA 4LF5E 1O4XA 4E7LA 2EWLA 2GXAA 3VDXA 2PMZN 5FD5A 3VYYA 4DW6A 2F6CA 1C0WA 2YSPA 4LB6B 5DCFA 2DSYA 5LMNE 2ZXWH 4I99C 1W5CC 1ON2A 2H8WA 3RIRA 3F8CA 1J75A 4JI4E 3HDDA 1TT5B 4DQ2A 5KL5A 1RNLA 1D1BA 5CKTA 2E36A 1H88C 4KMUX 2XAJA 5FRNA 2NS0A 3HKZN 1HNXE 1BI0A 3BT9A 4HSTA 4HBLA 2FMYA 4BAYA 3TQNA 3F6GA 3W3CA 3Q9SA 3DXJF 4LF6E 3SZGA 3CF5F 4PGGA 4NC6A 1RUNA 3J81C 4IRGA 1SFKA 4LOCA 4XMYA 4M2ZA 2IGKA 1B8IA 1QU6A 4L9NA 1ZKGA 5J1YA 2R7DA 3KYLA 3GTLJ 4HF2A 4IS1C 1JHHA 4PJLA 4DNCA 2YTPA 3CCSI 4UB6C 2MKNA 2PN6A 1W7PB 1HLVA 3HC7A 1PUFB 5JI6A 1ZARA 4HEA2 2BVMA 3A01B 3LSHA 3RYPA 2DK5A 3VSKA 5LLQA 4Q5SF 3P5JA 2YTQA 4ZZLA 3ZOBA 1WRJA 3EPZA 5GTHC 3C6KA 2NUEA 3V8LA 3MFKA 2EMLA 4B8XA 3IV5A 2ZM6E 4XSXF 4LF4E 2BEOA 4I02A 3L9FA 4B4CA 1LJ9A 4CYCA 3GZ5A 3V4GA 2L2MA 4C2MJ 2HYFA 3DKWA 4EATA 2E7XA 2P6SA 2YR2A 3MSWA 4F55A 4RLQA 5FJ8J 1R7JA 2KISA 4CZZA 3PO3J 4LTYA 4JYAE 4DKKA 2JA8J 4XSZF 4LG0A 2F4OB 1TNSA 1KYWA 2M0CA 1XC5A 4I98B 4U88A 3TO9A 1YYVA 2JA7J 2L0KA 4AYBN 3B6AA 4JOMA 3ZN0A 2EMAA 2EMBA 1NG6A 1TWCJ 2XB5A 3K2ZA 2LVSA 3MZ8A 2CUZA 3DEEA 4HF1A 4ZDLA 4XOPA 3U1KA 3ADIA 4IQ4A 3GLLA 3QPHA 2WBSA 3Q0WA 3ZQFA 3DPTA 5HLHA 1LDKB 3HHGA 1N78A 1RKWA 4A3MJ 2EM4A 3H0GJ 4ZYAA 5C4JJ 2BYVE 2EA2A 1I1GA 4DV0E 2EZIA 3W6KB 1BB8A 4NC7A 2VT3A 2HDCA 3K0LA 3T1YE 1YYWA 2Q2EA 5FROA 4K0KE 1BBOA 2F4MB 3FIWA 2HVQA 4LFCE 2EJRA 3MEXA 2FOWA 2P4WA 1R1TA 3CMYA 2O9LA 3GBGA 4RGXA 3WTXC 1W5TA 4ON0A 2P7VB 4WX9A 4OIPF 1ZR9A 1QNTA 3K4KA 1JUPA 5E79C 2Y30A 2YWQA 4DJAA 1FBUA 4EQQA 1J5YA 1RESA 2JTVA 4NB5A 3VYRB 1X3ZB 4KITB 2PRTA 1N33E 2FQ4A 2EOHA 4A3JJ 3S16J 4P78A 4IHYA 4LK0F 2EM8A 2LDUA 1DGWY 1AKHB 1SFOJ 1LE8B 4MHGA 2DA5A 2JSCA 3J7ZI 1IG7A 3BBGA 3H3ZA 4XRFA 2JWOA 1Z0XA 2WWYA 1YYKA 2RGVA 2F5EA 2X6YA 1X1AA 3DJWA 4E4HA 1F43A 2YPNA 2ZSHB 5F1JA 1IRZA 4MEXF 1EH8A 2F5CA 2UUBE 2R7QA 2L54A 3WE2A 3BR2A 2DPUA 4E7KA 2EOMA 1MIJA 3N97A 4MTDA 4I09A 1IXSB 2H27A 2VJ4A 4B43A 3S1QJ 3DTKA 2HR3A 2R4GA 2XRNA 3IHUA 1ZBTA 3SEQA 2JQ7A 2BZTA 3D5LA 3TOAA 4E7ZA 4DR5E 1Y0UA 1R36A 2E1MB 3D0SA 3PL8A 5J40A 1ZQ3P 2OTLI 2QSHX 1DP3A 2FV4B 3WGHA 3CUQC 5DUKA 3MWMA 5IYBJ 3HOWJ 1S7OA 2HGCA 3O6BB 5EJCA 1BW6A 3L2WA 2IS1A 2JOBA 1YW8A 2H94A 5F0HA 2WBUA 3RKXA 5GPAA 3AL0C 3K4MA 1MGTA 3CJTB 4RAFA 3ROUA 4BHPA 4Y13A 1LNWA 2EN1A 2Z99A 4BEHA 2EFOA 4S05A 1O3SA 2M7BA 4BY1J 3FKJA 3GWZA 1OCZH 4JI1E 2HVRA 4FCYA 2ZJQF 5GPCA 1JTYA 2FGGA 2R7FA 3CMAI 1DQUA 1Y8QB 2VQCA 5FD6A 3IWZA 2VJJA 4DV5E 3K4LA 4KN7X 2ICWG 4ANJA 2VXZA 2XROA 1XX5A 4R1HA 2EMYA 2AHQA 3K4CA 1JK2A 1YLFA 3IKVA 4A5NA 1A5JA 1A04A 2HZTA 3OYJA 2Y69H 4YRVA 2RQPA 3AL0B 4D9JA 2YX7A 2X1DA 1ZGWA 4DYCA 1P7IA 2QQBA 2EK5A 3RSNA 4R2DA 3S3MA 2O8XA 2X4HA 4XLNF 1ETOA 1MBJA 2DDAA 1R6RA 4QLCU 2YRKA 1MBKA 2TDXA 2V88A 4WFTA 3GTOJ 4HF0A 3G71I 4YIFA 1MW7A 4R2RA 1A1HA 2VN2A 3B02A 5F0FA 2H6CA 1X47A 3HTXA 2EQRA 4A3IJ 2A5WA 2OTJI 5ILSA 2V26A 1O57A 2HPIA 2JZYA 2WY8Q 2RN7A 4P1WA 1ZAOA 2E1OA 4BDZA 2ZC2A 3F3XA 5L3CA 3RZDJ 1X2MA 2UXXA 2EOXA 2CW8A 5DEQA 1WGXA 3A4CA 3PM1A 2ECCA 2X48A 2CG4A 1R58A 5IT9K 1P4XA 1GLNA 1FMWA 2R7RA 1SAXA 2VRDA 3FK7A 1MKMA 4EGYA 4PSWA 3C1DA 4IZZA 2BHZA 2LFBA 2PMZA 4G6DA 3FMSA 1VFCA 1OCTC 3ZQQA 4RBOA 2EORA 1RQ0A 1P9QC 5HDKA 3N05A 1HC8A 1DDNA 5J47A 1SFXA 2NYXA 1G2FC 3CJNA 2DN0A 2EE8A 5DCMB 1A35A 2LBFB 2FA5A 2DYSH 1QZEA 2UXNA 2O03A 4ZZDA 2M4KA 3FIGA 3OS2A 2L5QA 3EETA 4A0ZA 3S1RJ 2JXPA 5E1ZB 2DJNA 4XRSG 3S15J 3I71A 3HKZA 1XGSA 3LMLA 2COBA 3ZMTA 2L3CA 2EQ3A 1LLMC 3HPSA 1I3AA 2CQNA 4FX0A 2MG4A 2E5LE 1X5WA 3EUHA 1W7PA 2EOYA 1XSVA 4XKBA 5EYRA 2ACJA 1PUFA 5T6JA 4Z2YA 2DA4A 3VSLA 3WTYC 1FJGE 4Q4ZF 3R0JA 2HOTA 2PFBA 3PUFA 3A01A 1T39A 2YTOA 4NZVA 3BTJA 5KNLA 4BYYA 4B3TE 2D2WA 2L7KA 1H8AC 4IHTA 2JWTA 1ZAAC 4EM0B 4C30A 3T1HE 5LRRA 2BVLA 4N4NB 1S72I 1WI9A 3BR6A 1PUEE 4X65E 2M45A 5E8IA 4HQMA 1UHZA 3HOSA 2K5CA 2VJ5A 5EZGA 3P1XA 4L0ZB 2EV0A 2D45A 1TF6A 2HHHE 1Z3XA 4GKJE 2I13A 1ZR4A 1SC7A 3E5QA 2HNHA 1SD6A 1YG2A 2VQHA 4U87A 2H1LA 2R0QC 3DWLE 4EJOA 2EOIA 2P5LC 1RR8C 1BC8C 3CTAA 1STUA 2IRFG 2JJ7A 5TGTA 2DOAA 2IHR1 2KIUA 4X0GA 2VC1A 1U8RA 1I39A 4Z6YA 3L2QA 1J5EE 2Q1ZB 2VL8A 1G3WA 1GV5A 1H9GA 2XSDC 3Q9VA 1GDTA 3KEYA 1ON1A 5CVIA 3H5NA 1LEAA 1X6EA 4IJDA 4WSGA 3MKZA 3E6BA 1A1GA 1XSXA 2VQGA 3I55I 3EYIA 4Q28A 3JTGA 1D1AA 1DPRA 1FNNA 3MD2A 4HX4A 5J1RA 2EN8A 4D5CA 4AYBA 5AIQA 1MSFC 3DU6A 4Y17A 3V8JA 3SZTA 5D4SA 1Z6RA 4C3IJ 1WH5A 2NRAC 1ZTRA 2YTFA 2ZXIA 1ZG1A 2D1VA 1YI2I 4FE4A 3JU0A 2JVAA 4BJ5C 2CQ7A 3DBRB 5EF6A 2L3JA 2DCEA 2PMHA 2Z2SB 1OYIA 2EBIA 5ICGA 1WJFA 4A0YA 1IF1A 9ANTA 1Y39A 3HXLA 3HTSB 3DF6A 1AU7A 1JI8A 4CA0A 3DPLC 3BPVA 1UHSA 5B3SH 1VNDA 4Q35B 3BTIA 4U7BA 4UUTA 3RQIA 1FKAE 2TCTA 3A0BC 2CW7A 2QYOA 2VQEE 3GTGJ 1YTYA 3ECOA 2VBZA 2X9DA 5H2FC 1Z1BA 3LNQA 2WBMA 4DR3E 2VLAA 1E3PA 1AKHA 5IT9Z 5D5VB 1LE8A 1JJ8C 3VYSB 2IBDA 2FJ1A 3KX2A 1HNWE 2KDZA 1MNDA 4M71A 2R7VA 5LHGA 3ERMA 3ONQA 1APLC 2JRMA 3JRBA 4IJAA 2DQLA 2K9SA 5ICEA 4B3RE 1QGPA 3M1EA 4PCQA 1MBEA 4R8HA 3AG3H 1BIBA 1XDSA 1LEBA 1YJWI 3I4NJ 4UV8A 4MLOA 1FYKA 3WHCA 2IPQX 3JSPA 1DP7P 1NG7A 3L2VA 2KPMA 1UHMA 3BJAA 3WU2C 1VQ5I 1WVRA 2VKDA 1R22A 3C7JA 2E1MA 3H9GA 2DMIA 3UNGC 1JXSA 4II3A 1J09A 5AE2A 4IHXA 2DPDA 2JA6J 1MZBA 1OCOH 2DAOA 2MH9A 2PEXA 4QPOA 1MMAA 3U9GA 5JVTA 5EEGA 5FLMJ 4DV4E 3WTVC 2L9NA 5IY5H 4BC9A 2BBYA 3AFHA 3FXRA 1HKQA 5BPIA 1VI0A 4O3MA 2LO3A 4UV9A 2HQNA 2MLGA 3CMMA 3QPTA 2NVUB 3SQNA 2GAUA 3UK3C 4F6MA 3K9TA 3WODF 3I3LA 4BBRJ 5D4RA 2N3GA 3EQ1A 2DTRA 3IRRA 4ENMA 2Z5UA 4EJVA 1QRYA 2ESNA 3F6OA 3BZKA 2HKXA 4FHTA 4HPQA 3SJMA 1BI3A 3CMEI 1HSTA 1UHWA 1YX5A 4M30A 3E5UA 2P7CB 1IBME
chains in the Genus database with same CATH topology
1TW3A 1IAWA 2YSRA 2BV6A 2COMA 1IN7A 3GFIA 4MGRA 3KP4A 2F2EA 3H3UA 3GEZA 2L01A 1LB2A 2EFWA 3Q5FA 3E6CC 2Y75A 4UVCA 3BOQA 4IHSA 3FHZA 5CVJA 1FLIA 4O6JA 1KU7A 2M5WA 1S29A 2NNYA 3RKWA 1QZYA 1D8KA 1F5TA 2OQRA 1R23A 1JE8A 2G9WA 4KIGA 1KQ0A 2FBHA 1PDNC 3KEQA 1AOYA 2PBIA 1R1VA 2QUFA 2A61A 1XD7A 1XB4A 1IXRC 4OMYA 3FM3A 3GO5A 1O3QA 3JAMK 3LQQA 1ZGJA 5DCMA 4MEYF 5ILUA 4UXNA 1IXCA 4EJTA 5CVRA 4LK1F 4ZYGA 1S7AA 1V3FA 4YG2F 1G3YA 3KP2A 5BOXA 5FGMA 3WE3A 4CICA 1U5TC 4CO8A 4OINF 3LA7A 3QAHA 2XUBA 2L3DA 4ETSA 1HBXG 2NAZA 3P9KA 1U3EM 5D6FA 3JTHA 2HFHA 3I54A 2PI0A 5DD8A 3HRTA 2PJPA 1TTYA 4WF2A 1U5TB 4N0BA 3LA3A 1T0FA 4B09A 4O5VA 1TNTA 3LQRA 3ERED 2JPCA 1KGSA 3G3ZA 3L00A 2XAQA 4UVAA 1FYMA 2ZXJA 4L9TA 4P9FA 2PLYA 4KA4A 1S3JA 1KYZA 1G6NA 5K5QA 5D6EA 3L2CA 1YIOA 1QQIA 1USSA 3LWFA 1FSHA 4M74A 3F22A 1BJAA 1W7PD 2VBXA 2OQGA 3BP8A 1MD0A 3WTTC 3E5XA 2R3SA 4RB3C 5AONA 1HXDA 3RDIA 3S2WA 2W57A 3JAMZ 2EWNA 1K78B 4L0YB 4A0XA 4BQAA 3IL2A 5E17F 5L3EA 4ZYDA 1KQ8A 4AWXB 4YFKF 3KP6A 3KZYA 1VTNC 3FXUA 2K27A 3BZ6A 3V7SA 5JFRA 1REPC 2ZNZA 2L4MA 2ZMEB 2DU9A 3BDDA 2OAZA 3F8BA 1IN6A 4RB0A 1G3SA 2E7WA 4CXFA 1J7KA 4MQ9F 1QBJA 4MTEA 1QPMA 1Z05A 4KNYA 3BPXA 3IKTA 1GVJA 3COAC 3MQ0A 5LHIA 4N9HA 1R00A 1B9MA 4EJUA 3SHFA 1S6LA 4XLPF 2LF7A 1IW7F 1FYLA 3HSFA 4BHBA 3MZHA 3GFMA 3ISPA 3M9AA 1F9NA 1BC7C 2CGPA 3F72A 3MAJA 5AIPA 4M6XA 2QENA 4GYIA 1FP2A 5FB2A 4H0EA 2FF4A 3K1MA 3EDPA 2IT0A 4WXCA 4G8XA 5BMZA 1FP1D 3BJ6A 1K6OA 4I01A 3OOPA 5BPDA 3R60A 1XCBA 2D1HA 4KUMA 4OOIA 2KKOA 5ICFA 3F8MA 2UWMA 1FT9A 3V7RA 1B6AA 3ULQB 3F8FA 3GZ6A 3T8RA 5DUIA 3HYIA 2MA3A 4HV5A 1CF7B 2RVCA 2FBIA 3V8KA 1R5HA 4PDKA 3J7AO 1TLHB 1SMTA 5HS7A 1QZZA 3I58A 2XASA 1B59A 4LD5A 3DEUA 3T1BA 4TV7A 3R4KA 2EV6A 3F21A 3OV8A 1U5TA 2HQRA 1D5VA 3MCZA 2DK8A 2QM3A 4ENKA 3FMQA 5JR3A 1E17A 1KU3A 1I27A 4WXHA 4HOBA 2M30A 3LAJA 1HW5A 1TQMA 1BI2A 2ADUA 3FZVA 2MBFA 3ZMDA 4BH9A 4WWCA 3DP7A 1MJBA 3HSRA 3RPUA 1IN8A 4A6EA 1ZREA 1Z91A 3KE2A 2RKHA 2VE8A 1JHFA 1O7LA 1D8JA 3MZYA 2H09A 1K78A 2YU3A 2K4JA 3AAFA 1ULYA 3J80K 5E1XA 3C18A 2MC3A 3WGIA 4MNUA 2Z33A 5HDNA 2QLZA 2XIGA 5H20A 4Q47A 5ERIA 1SD5A 4CGZA 2ZMEA 1FPQA 3HTUA 5CYVA 2J5PA 1D3YA 4L9VA 4PGHA 5ICCA 2EFPA 3IRQA 1HKSA 5H6RA 2L02A 4AIKA 3P9IA 1QO0D 2DO7A 2V9VA 1YQAA 3HRSA 4EV0A 5LGNA 5HLGA 1WWXA 4I7HA 5HOOA 5K5RA 3K1NA 4CYDA 3WU1B 4BNCA 5LBQA 1IZ1A 1ZLKA 4JBAA 1IN5A 1V4RA 4RB2C 2ZO4A 3FXQA 4L5IA 3ZPLA 2BE5F 2MD5A 4ZYEA 3E97A 3HRMA 2MLKA 1HSJA 1HW1A 2GXGA 1P4AA 5A2QK 3HRUA 5CVUA 4ESJA 2GIVA 5CJ9A 5KK1A 4HZFA 4IRIA 3J80Z 1IN4A 5L3BA 1E2XA 2XVCA 4F7ZA 2F5DA 3RYRA 3H92A 4IPAA 1XN7A 2RDPA 4NQWA 4LB5A 3KP3A 1P6RA 1ZG3A 2KJBA 2ELHA 2HTJA 1K7AA 1CF7A 2HOEA 2OBPA 1ZYRF 4ESFA 3EQLF 5CVVA 3U1DA 5L3DA 1W5SA 2UZKA 1ZHFA 4BHCA 4M73A 3WU0A 4A6DA 1IUYA 3WGGA 5KVRA 4AVPA 2K7LA 3ECHA 3GX4X 2A68F 2QQ9A 4P5OA 2WV0A 1T98A 3GXOA 2XAHA 1HQCA 2P8TA 2OD5A 3P9CA 2AXLA 5J6XA 3DFGA 1MJAA 3R0AA 5CLSA 4LJZF 4ESBA 3NEUA 5LGUA 2VC0A 3CLOA 4G9YA 1O3TA 2GZWA 4XBFA 3L7WA 1BM9A 1FC3A 3O2PE 1MDMB 1FSEA 5A2QZ 2VBYA 3LSTA 2ZNYA 2QWWA 2LKPA 5D5WB 1X3UA 2O0YA 2FRHA 5LGTA 1XGOA 3KP5A 4RGUA 5K1YA 2A5YB 1Z9CA 3CO6C 4UHTA 2EFNA 1AWCA 2DFIA 3PFIA 4KN4X 4GCVA 2IJLA 2GA1A 3WTWC 2Z3YA 5LEKA 2DI3A 2O61A 1W4MA 1B1BA 2FU4A 5LHHA 3KCCA 3R6SA 2E1NA 4ASNA 2WC2A 1Z7UA 4UUVA 4LMYA 2DLLA 4JK1X 3RKYA 2LF8A 1EH7A 1EV7A 2IVMA 1K79A 1I6XA 4L9JA 4G7HF 1ZGAA 5DD4A 1P2FA 2V6CA 1J2XA 4MQVA 2LSOA 1NHAA 3IWFA 1YW9A 2HWVA 3CO7C 5HVQC 2VBWA 2G7HA 2VODA 5D5UB 2O3FA 3V7CA 1B9NA 2WTEA 2FOKA 2BGCA 3ZN1A 1ZG5A 3I53A 2KIMA 2KJCA 5HS8A 5TRDA 2IA2A 3KFWX 2XV4S 1ODDA 1TBXA 5D8LB 5FFXA 3JSOA 1Z6TA 1UCRA 2IW5A 4RS8A 4IRHA 2K4BA 1SD4A 1R1UA 2OZ6A 4L18B 2A3SA 3EYYA 3VOEA 1I1SA 4KFCA 2OU2A 1STZA 2F5FA 3HUGA 4HA8A 4AIHA 4CDGA 2GXBA 1OR7A 1U78A 4HLXA 2VOPA 4G7ZF 4P96A 2PG4A 3WTZA 2ETHA 5BQTA 4I0AA 1YW7A 1KQ9A 4KT5C 4EMSA 1OPCA 3KP7A 3E6MA 3DQVC 2W24A 5LEJA 4RGRA 2P5KA 3RTRA 2ISYA 3BY6A 1LQ1A 4M9XA 1G4DA 4OIOF 4HX7A 5BS6A 1S8NA 4G7OF 4OU0A 4G94A 1XMAA 2B0LA 2V1UA 4EVIA 1GXQA 3E6DA 3VFZA 3SZPA 1ZRDA 1Q1HA 2RNJA 4OIQF 2CO5A 3TDUC 1MDMA 1RUOA 2XKPA 2H6BA 2GA2A 5E1WA 3HSEA 2M87A 3KLOA 3KLNA 4PZJA 3ZQ7A 4WXDA 2OA4A 4WK8F 3SXYA 5E20A 2W84A 1CGPA 1RIOH 5ILVA 3W6JB 2HEOA 3GFLA 4HDVA 1T6SA 2CFXA 4GYGA 3RJPA 4ENJA 3QOPA 1FOKA 3R61A 3K69A 2XAFA 5FLXK 4RAYA 2FE3A 1TW2A 5DYMA 3M8FA 4GXOA 1J59A 2QQAA 4U0WA 2A07F 4RAZA 4I0BA 2MH2A 2DT5A 3QRFF 5EEHA 3WG9A 2VOOA 5F1RA 3CDHA 4P55A 4GO1A 4M9ZA 2ZCWA 3B73A 2FMLA 1WKMA 1EH6A 2W25A 4KDPA 2A6EF 3ELKA 3FMRA 5L3FA 3TKYA 1ZRFA 2HYGD 3LFKA 4G6QA 1U6GA 2VE9A 4S04A 5E8GA 3BJOA 4EGZA 1OYYA 3FM5A 2G7UA 4EM1A 2V1DA 3TO6A 2O6GE 2QZ8A 3TOBA 1LVAA 2L4AA 2OZUA 3CUQB 1JGSA 2CYYA 4UVBA 3KEOA 5H6QA 3IC7A 3HIFA 1OKRA 4WCGA 4D0PA 1T2KA 2W85A 3ABUA 4P9UA 1H9TA 3ZMUA 2DW4A 3PQJA 1O3RA 2CWEA 1SFUA 1OMIA 1WSUA 4ZH4F 2FNAA 4LLLA 1ZLJA 2ZFWA 5JHUA 3VODA 4A12A 5FLXZ 3GUDA 2KRFA 2ESHA 1BOAA 1OYWA 2K02A 1KU2A 3I59B 2JRTA 4A5MA 1XMKA 1SMYF 3T0YA 3LAPA 5D8KB 2XHKA 5D5XB 5TJJA 3M7GA 1RI7A 1IRGA 2HKOA 3FX3A 2YX4A 3QU3A 3RI4A 1BN5A 2QBYB 1ZN2A 2X0LA 2IA0A 3GF2A 2FNPA 4N9IA 2DBBA 3I64A 1KU9A 1T38A 4Y15A 1LDDA 1DPUA 4KMFA 3VB2A 4U7DA 5HDGA 3QP6A 2FSWA 1UB9A 2EB7A 4AIJA 2NNNA 3M8EA 3DF8A 4LLGF 1TQIA 3VEPA 1Z1DA 2M1BA 4YFNF 5J8FA 1PP8F 4AD9A 1SFEA 2XKOA 3GW2A 4IVNA 1FX7A 3KZZA 3J81K 2RC4A 4FX4A 1YS6A 2CQKA 4HX8A 1H0MA 3SFZA 1BBYA 1XDUA 2VT2A 5K5OA 3F23A 1RZ4A 1MJ9A 4BXUA 4FT8A 2LNBA 4HV6A 4K2EA 4L5JA 1HW2A 2DQRA 3O3KA 1P92A 1XSDA 2XGXA 3C3WA 2JT1A 4U0VA 4M9SA 4EM2A 4E70A 3U2RA 4UNOA 2GWRA 4R79A 3F8NA 1YFHA 2Z9OA 3BWGA 6PAXA 1B4AA 2V79A 4LGWA 3ZMVA 3G73A 2J5OA 3LA2A 4LLNA 2KIFA 3TGNA 2STWA 1YO5C 2Y48A 3NRVA 3TO7A 5F6FA 4M72A 5L3GA 3RPQA 1O7FA 3K1PA 3ZP5A 5J8CA 4Q48A 3NQOA 1ONVA 2HTSA 3L09A 4EJWA 1FY7A 3E3VA 1WQ2A 1USTA 1L0OC 5DV5A 5FFZA 4IF4A 4KYWA 2XAGA 3ZMZA 2FQ3A 3CUQA 2ZKZA 3KETA 1KA8A 2PMUA 2P6TA 4U0YA 2VONA 1PP7U 1IRFA 2E1CA 4LG0B 4KIFA 1FBQA 3TDZC 2JPBA 3J81Z 1BIAA 3GYHX 2Q0OA 4M6YA 2Q8KA 5HS9A 1UFMA 2C6YA 4ENNA 1P4WA 4IXAA 2ISZA 3ZMSA 3REOA 5E18F 2ZBKA 4YFXF 2AS5F 4OIRF 1I5ZA 2QVOA 4KIBA 4LFUA 2CW0F 1R5GA 3F6VA 4HDUA 3N4MA 5HLIA 1J0RA 4RGSA 2RV8A 2EFQA 3I59A 2STTA 4HYEA 4JQFA 3JW4A 1J9IA 2V1XA 2HS5A 1ZRCA 4HW0A 2P5VA 4RB1A 3HOTA 3GFJA 2GQQA 3QU6A 3DV8A 5FO5A 2IA1A 4A2UA 3QP5A 3PQKA 4QWQA 3GVAA 2QBYA 5LRSA 4CHUA 2FXAA 2Y0MA 1ZH5A 3WTUC 4ZYHA 1G3TA 1DUXC 4HQEA 3GLXA 3CUOA 2K86A 4OMZA 4YIIA 1L3LA 2FEZA 4I2OA 3ABTA 3FWEA 1BI1A 1YS7A 5F64A 2EA4A 1GXPA 2M8EA 1FWZA 1FZPB 3T5XA 1F1ZA 1SD7A 1XGNA 1F4KA 2A6HF 2PQ8A 2EV5A 4HAMA 3I5UA 3I4PA 5ED4A 1TQPA 1XCVA 4KICA 1GHCA 3ML6A 4NHJA 3WTSC 2CSOA 2YPRA 1HKTA 3HHHA 3I0TA 4HLYA 1U2WA 2FBKA 5DDGA 3T8TA 3P7NA 3FF5A 1FBSA 1XGMA 2ZJ2A 3BROA 2A69F 1LDJA 5IT3A 2IP2A 4GGGA 5FD5A 1C0WA 4LB6B 5DCFA 1ON2A 3RIRA 3F8CA 1J75A 4DQ2A 1RNLA 4KMUX 2XAJA 2NS0A 1BI0A 4HBLA 2FMYA 4BAYA 3TQNA 3Q9SA 3DXJF 4PGGA 1RUNA 4IRGA 4L9NA 2R7DA 4HF2A 1JHHA 4DNCA 2PN6A 1W7PB 5JI6A 1ZARA 3RYPA 2DK5A 5LLQA 4Q5SF 4ZZLA 1WRJA 3V8LA 3MFKA 4B8XA 4XSXF 2BEOA 4I02A 3L9FA 1LJ9A 3GZ5A 3V4GA 2HYFA 3DKWA 2E7XA 2P6SA 2YR2A 1R7JA 4CZZA 4XSZF 4LG0A 1TNSA 1KYWA 4I98B 4U88A 3TO9A 1YYVA 3ZN0A 3K2ZA 4HF1A 3QPHA 3DPTA 5HLHA 1LDKB 3HHGA 2BYVE 2EA2A 1I1GA 3W6KB 2VT3A 2HDCA 3K0LA 2Q2EA 2EJRA 3MEXA 2P4WA 1R1TA 4RGXA 3WTXC 1W5TA 4ON0A 2P7VB 4WX9A 4OIPF 1QNTA 1FBUA 4EQQA 1J5YA 2JTVA 4NB5A 4LK0F 2LDUA 4MHGA 2JSCA 3H3ZA 4XRFA 2WWYA 2RGVA 2F5EA 4MEXF 1EH8A 2F5CA 2L54A 3WE2A 2DPUA 3N97A 4MTDA 4I09A 1IXSB 2H27A 2HR3A 2XRNA 3IHUA 3D5LA 3TOAA 1Y0UA 1R36A 3D0SA 3WGHA 3CUQC 5DUKA 3MWMA 1S7OA 2HGCA 3O6BB 1YW8A 2H94A 3RKXA 3ROUA 1MGTA 4BHPA 4Y13A 1LNWA 2Z99A 2EFOA 4S05A 1O3SA 3GWZA 2R7FA 5FD6A 3IWZA 4KN7X 2VXZA 2XROA 4R1HA 1YLFA 3IKVA 4A5NA 1A04A 2HZTA 2RQPA 2YX7A 2QQBA 2EK5A 2O8XA 2X4HA 4XLNF 4QLCU 2TDXA 4HF0A 4YIFA 2VN2A 3B02A 2H6CA 5ILSA 1O57A 2JZYA 2RN7A 1ZAOA 3F3XA 5L3CA 2UXXA 5DEQA 2CG4A 1R58A 5IT9K 1P4XA 1SAXA 1MKMA 4EGYA 3C1DA 4G6DA 3FMSA 5HDKA 1DDNA 1SFXA 2NYXA 3CJNA 5DCMB 2FA5A 2UXNA 2O03A 4ZZDA 3EETA 4A0ZA 5E1ZB 3I71A 1XGSA 3ZMTA 4FX0A 3EUHA 1W7PA 1XSVA 2ACJA 4Z2YA 3WTYC 4Q4ZF 3R0JA 2PFBA 1T39A 4BYYA 2D2WA 4IHTA 4EM0B 5LRRA 1WI9A 1PUEE 2M45A 5E8IA 4HQMA 3HOSA 4L0ZB 2EV0A 2D45A 3E5QA 1SD6A 1YG2A 4EJOA 2P5LC 1BC8C 3CTAA 2IRFG 2KIUA 2VC1A 1U8RA 1G3WA 1H9GA 3Q9VA 1ON1A 5CVIA 1LEAA 3E6BA 1XSXA 3EYIA 3JTGA 1DPRA 1FNNA 4HX4A 5AIQA 4Y17A 3V8JA 3SZTA 5D4SA 1Z6RA 2NRAC 1ZG1A 2D1VA 2PMHA 1OYIA 5ICGA 4A0YA 1IF1A 3HTSB 3DPLC 3BPVA 4U7BA 2QYOA 1YTYA 3ECOA 2VBZA 5IT9Z 5D5VB 4M71A 5LHGA 4IJAA 2DQLA 5ICEA 1QGPA 3M1EA 4PCQA 4R8HA 1BIBA 1XDSA 1LEBA 4UV8A 1FYKA 2IPQX 3JSPA 1DP7P 1UHMA 3BJAA 1R22A 3C7JA 1JXSA 2DPDA 1MZBA 2DAOA 2MH9A