3L01A

Crystal structure of monomeric glycogen synthase from pyrococcus abyssi
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
428
structure length
428
Chain Sequence
RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Processivity and Subcellular Localization of Glycogen Synthase Depend on a Non-catalytic High Affinity Glycogen-binding Site.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
molecule keywords GlgA glycogen synthase
total genus 155
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3l01A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3l01A01
3D0RA 1WV1A 4G2TA 4MRAA 4X7MA 3E3LA 4GZ5A 3NB0A 2F3QA 3OKCA 4F9FA 3IA7A 1GG8A 4KQMA 3TSAA 3ZCPA 3Q3HA 1PYGA 4N3CA 1Y8ZA 1Z62A 4NC9A 2GT1A 1XOIA 1FTYA 3EBOA 3G2JA 3MT9A 2X0FA 5TMBA 4Z5XA 4WADA 2XGOA 4RELA 2WTXA 2R4TA 4MHOA 3GPBA 2IW1A 4EKEA 2HY7A 3VDNB 3WADA 3NCHA 5HXAA 2PYDA 1L5WA 3PE3A 4EL5A 2GEKA 2VG8A 1L5RA 2ECPA 3RT1A 4M83A 1M5RA 1O6CA 4HLNA 3Q3IA 1FU4A 4BQEA 3S29A 3OT5A 3EBPA 1RZUA 4AMBA 2XCIA 3MT8A 1EXVA 4F97A 1C50A 3L7AA 2XA2A 1GFZA 3BCUA 2XA1A 1UQTA 3E3OA 1L5VA 1UQUA 4NEQA 4EJ2A 4CTNA 1RRVA 1JIXA 4YI5A 2O6LA 3ZCUA 1V4VA 3D1JA 1WUYA 1BX3A 3L79A 2C1XA 3HBFA 1XKXA 3MT7A 1P2BA 4RIHA 3BEOA 1E4OA 4BQFA 2QLNA 4RIFA 1NZDA 3C4VA 1GPBA 1H5UA 3OY7A 1F6DA 1Z6PA 3HBMA 2GJ4A 4MI9A 3CUYA 7GPBA 2QN3A 3MBOA 1Z8DA 4GZ6A 4AN4A 1SXPA 2F3SA 1JIUA 3G2IA 4BQIA 1JIVA 1JG6A 5JTUA 2QN1A 3CX4A 2G9QA 2VSNA 3NPAA 1J39A 2G9RA 3BCRA 3CUUA 2GPBA 4CTOA 3BD6A 4KQ1A 1FTQA 2FETA 3E3NA 3L7DA 3CEJA 2YJNA 2R68A 3CEMA 1NOKA 2GPNA 2F3UA 3L01A 2R66A 2H1HA 2IYFA 3T3GA 3DDWA 3L7CA 4GZ3A 1P4GA 4N9WA 3S28A 1QM5A 1C8LA 4CTMA 3GUHA 2SKEA 3FROA 3CUVA 3ZCTA 3ZCVA 4N3BA 1F0KA 3MTAA 1IIRA 3RSCA 3AMVA 4BFCA 1P2DA 3S0JA 2X0EA 3MRXA 1K06A 2PRIA 3TAXA 3BD8A 3Q3EA 2GPAA 4GPBA 2F9FA 4MI6A 1P2GA 3OTHA 1A8IA 1L7XA 3CEHA 3RHZA 2PQ6A 3HBJA 3ZCRA 3G2NA 1AXRA 3OKPA 2IYAA 4HWGA 3CUWA 1B4DA 2KS6A 3MQFA 2IEGA 2ZB2A 1L5SA 1NOIA 3MS2A 3NAZA 1FA9A 4AMGA 3DDSA 4RBNA 1FC0A 3ZCSA 4PQGA 4AY5A 1P29A 4X6LA 3QKWA 5TVGA 3WAGA 1P4HA 2VSYA 4XI9A 3T3HA 3O3CA 3BCSA 1GGNA 1YA6A 5D01A 2IEIA 2PYIA 2SKDA 2QNBA 3PE4A 5I45A 1NVKA 2ASVA 1FTWA 3H4IA 4M7PA 4X7RA 4XIFA 1FS4A 2AZDA 2G9VA 2QLLA 2QRPA 4KQ2A 1K08A 1P4JA 4F96A 4W6QA 5JTTA 3UYLA 3OTGA 3SYMA 2GEJA 1SXQA 5TMDA 1WW3A 4EKYA 1EM6A 2GM9A 3NP9A 2X6RA 3IAAA 2AV6A 2IV3A 3QHPA 3BDAA 1WUTA 4REMA 2SKCA 5ENZA 2G9UA 4RIIA 1GZ5A 4N39A 3OKAA 3MSCA 2AW3A 1NZFA 2ACWA 3S27A 2X0DA 5IKOA 4LEIA 4M60A 1AHPA 4N3AA 2IUYA 1WW2A 2QRGA 4MI3A 3NP7A 3ZCQA 4X7PA 4RIGA 4WACA 5DU2A 5BNWA 2QN8A 4NESA 4RIEA 2XGSA 3VUFA 1YGPA 2ACVA 3NC4A 2VCEA 1Y6GA 3MRVA 4RENA 4QLBA 3C4QA 3T5TA 2C9ZA 1HLFA 2H1FA 5DXFA 1JG7A 4YI3A 2VCHA 1FU8A 3CV3A 3T3DA 1L5QA 3MTBA 1E1YA 1FU7A 1UZUA 5TMEA 3MS7A 1QKJA 2QN2A 3VDMA 2QRHA 2BISA 3DD1A 3G2HA 3COPA 1PN3A 1JEJA 5LQDA 2QRQA 1LWOA 2FFRA 5IKPA 1NLMA 3CUTA 3WC4A 2R4UA 4WHMA 5C1DA 3C48A 2BGUA 5D00A 3S2UA 4AY6A 3HBNA 3UYKA 3MRTA 1VGVA 2P6PA 4FZRA 4MICA 1Y6FA 3MTDA 1PSWA 4GYYA 1ABBA 2JJMA 2XGMA 2C1ZA 2IV7A 3OY2A 1IXYA 3SYRA 3T7DA 1LWNA 1XC7A 5GPBA 1RZVA 3OTIA 2QRMA 3RSZA 2XMPA 2C4MA 3VUEA 1C3JA 8GPBA 1KTIA 2JZCA 3G2KA 1XL1A 3D0QA 4EL0A 2BFWA 4CDRA 2XA9A 2QZSA 2OFFA 1XL0A 1XV5A 3H4TA 1C8KA 1Z6QA 1WV0A 4MHSA 3BD7A 1GPAA 2F3PA 2FF5A 9GPBA 2R60A 2AMVA 4YUAA 2QLMA 4GYWA 4LDPA 2X6QA 3G2LA 3MS4A 4FKZA 2XCUA 1L6IA 2JLBA 2Q6VA 1PNVA 3T3IA 6GPBA 1GPYA 5DLDA 1NOJA 2BGTA 3DZCA 2QN7A 3T3EA 4L22A 2QN9A 3L7BA 2PRJA 2ATIA 3TOVA
chains in the Genus database with same CATH superfamily
5BV1A 1B41A 1SA0A 3AIOA 3OIFA 3D0RA 3DKVA 4EG0A 5TGTA 5A4KA 5HX7A 2C88A 2V7QA 2QTFA 2WLSA 3FWYA 2OZEA 3O9VA 4LYAA 3EPPA 3R3WA 3T4UA 3H16A 3A3NA 2ZRQA 3RK4A 3GDFA 4BMVA 5FWYB 2IIPA 1WQ3A 2VJBA 4MW0A 3TSCA 2OOSA 4KQMA 3FJ1A 2COEA 4J0DA 3RVPA 1NHWA 1RRGA 2BHLA 4MYCA 1PAUA 4OJMX 4ZT3A 3QHAA 5FBLB 1G98A 1M6VB 1Y3HA 4GOXA 1QQAA 2M1ZA 3ZGLA 2R4QA 2Q6IA 5TNXA 4BE9A 3EPLA 3CRMA 1G8PA 2Q1UA 1L9KA 2V0NA 4QGBA 4KFTA 1XSEA 5ERYA 5FTKA 4BZQA 2H2HA 1QYVA 1C4OA 1K6MA 1XN1A 3LXMA 1E1RD 1BGXT 4BNVA 2C84A 1HDOA 3BERA 4X41A 2XTMA 1HSOA 3T41A 3V7NA 5JANA 1DAPA 1BMFA 3DT6A 4J7CA 1Y4SA 4B3MB 2R6AA 3WJAA 1X13A 5A2GA 1Q6ZA 4ZKDA 2O8EA 1OI2A 2I4IA 2EKBA 2A0YA 2V96A 3B78A 4OUDB 3H5WA 2FMHA 5B2FA 5AKXA 1N2BA 2PKXA 1CCWA 5CM2Z 4AO8A 4HBZA 4NARA 5HXAA 5IXYA 5BOSA 2QTGA 4MS3A 1U8FO 2XOKA 3DEKA 5AK4A 3RT1A 3CMMA 2W11A 3C1TA 3LKDA 1GPWB 4Z9XA 4IV5A 4Q9KA 2B0CA 3KFXA 1U9ZA 1RZUA 2HXGA 3M1LA 4IJ6A 3A31A 4Q15A 2EDCA 2HNKA 3G7UA 5K0EA 2LVBA 3KQSA 3LBHA 1M33A 1V7QA 4YRPA 4Y67A 1DBIA 1M2HA 1M2OB 1ONSA 3V8MA 4B2YA 3BOSA 3DW3X 3AVXA 1M8JA 3PQ3A 2FXIA 2GCGA 4U6NA 1NFFA 3GJ7A 3TSYA 3WZMA 8ADHA 4HNTA 3EMKA 1CEXA 4AULA 3NHPA 2DWOA 1BXGB 3HHPA 3VJMA 4QHSA 4RL6A 2X0JA 1XTUA 4MPTA 5BWMA 3AYXB 2EIHA 3MELA 3O1HB 1QKIA 5DHFA 3JQGB 3O4JA 2EZ4A 3OPNA 4WKGA 1I2BA 3DDOA 2RGBA 3U31A 5FWNA 1JQBA 4KTTE 4P8RA 4QU5A 5AKIA 5AXCA 1K89A 5AVWA 4S35A 4JCCA 5HZHA 3GJ5A 3OCCA 1DX9A 3HP1A 3P9CA 4O4IF 3GDOA 3M5CA 1XZLA 3Q0EA 4OHRA 5EFZA 5H02A 1J4AA 3DDZX 4BS9A 1S4QA 1YR7A 3GY0A 1NZDA 5JD5A 3PYMA 3BB4A 4MA0A 2PV7A 1YQEA 1Z6PA 2Y67A 1V45E 3GIDA 2HF9A 2GJ4A 3PIIA 5HKLA 1E69A 1ZCBA 3GVIA 3CUYA 1PQPA 4R0NA 1K63A 3AVUA 3Q6MA 1QFYA 3EN0A 4J1QA 3QW4B 3LAWA 4MA4A 4X1KA 2BI4A 5CJ2A 4PS0A 3G2OA 3IDOA 4QEKA 4LQCA 1ZLYA 1PFWA 2OK8A 2I6QA 1B6SA 3LI2A 2VP6A 2QIOA 1Y5LA 4INJA 2ZJYA 4O1MA 1ACMA 4P3PA 1AUXA 1YZFA 3GGCA 4Q3OA 1KI7A 4N8SA 5B1IA 3VPXA 1BE0A 1M73E 1KL7A 3UTDA 4Q48A 1SVNA 2Y2VA 1MX9A 1Q3HA 2Q9UA 3BCRA 3D7NA 5DOZA 4EPRA 1ONPA 1RFLA 2XWJI 3CNOA 3ZEAA 4AJPA 3AETB 2A86A 2H4JA 2QVBA 4BNFA 5J5AA 3UMVA 1V95A 3KKNA 1RAIA 5BSGA 1FTQA 2FOIA 4M21A 4U6SA 4C7VA 4KX5A 3H86A 2JCVA 3MLAA 5I4BA 4BNYA 4IIGA 1P31A 3RRNA 1C14A 3R0JA 1CUBA 4IVPA 1YA4A 3ZE6A 1EHCA 2R11A 3U7QA 2D2EA 2FJPA 2QL9A 1F4LA 2HU5A 3PNBA 4BX8A 3K4QA 5EMMA 4I5FA 3ROEA 5HOQA 1RHRA 2OBBA 3L4BC 2G08A 3ZWXA 4FEEA 2A1UB 5DCLA 3OLYA 1HSZA 4JH0A 4IFTA 1H6BA 1YAHA 1IB0A 4O2AB 4Q6BA 1R7RA 1HC7A 1RI3A 2G70A 3FDIA 1KC1A 4NBTA 3ED1A 4UAUA 1WU8A 2J0UB 2R62A 1V43A 4ZVNA 1J0AA 2GEBA 3ZCVA 2WNIA 3AW8A 3IT1A 4MVJA 3F7MA 5ALKA 4COKA 5IBQA 1GEGA 1IHPA 1ZUIA 3AMVA 1ESZA 3LG2A 2Q2QA 2DVMA 1Y1QA 2PYZA 2ZULA 3ZG6A 2WUEA 1A4IA 1EWKA 2PY6A 3S6JA 1G18A 4TT3D 1VFNA 1D6MA 3KYCB 3ESQA 3ISJA 5EJMA 1E2JA 2APJA 4HCJA 5FHRA 1E8MA 3DVAB 3R5XA 4URZR 1XMVA 3RIMA 5D84A 2C4UA 1GPUA 1PT9A 4KFCA 2X6TA 2G28A 2V4UA 3MTIA 1TIPA 4MV5A 2FWJA 2O1WA 1GYRA 1T4GA 2IYQA 2V97A 3QUTA 3R23A 4EK9A 5A3JA 1SEVA 2PMDA 1IXRC 4MVJG 2ZJZA 4D0LB 5CW2A 1PKXA 3RHZA 3RSOA 3PPXA 2DPXA 1R64A 1GU1A 2YN4A 4W5QA 1MFPA 3V4PB 4YUYA 1NHGA 1RDFA 4RDXA 2VHZA 3OWXA 2C04A 1OPRA 1X7XA 5H9WA 1EFCA 1CX9B 3DNMA 3FOWA 2ET6A 2BR4A 1V3QE 2I29A 3PXUA 2JAUA 3N8HA 5ECYA 3PD0A 4B82A 3E5RA 3PFNA 4IKPA 2D1SA 4OLFA 4E5UA 3OTOB 2ABWA 2HJGA 2IEGA 2AVNA 3AHFA 3EODA 3MS2A 4OPMA 4AMYA 1H66A 4B7ZA 5F23A 1F7VA 3QK7A 1QG4A 1NF2A 1SNYA 4DW8A 3H17A 3A1FA 2JATA 4G2NA 5JS6A 4NH0A 2ZAGA 3NJ8A 4D0NA 1RI5A 4ZI3A 2JFBA 3BKWA 5IC4A 1ZGZA 3ZK9A 3OPYA 2UVPA 2Y92A 2OXIA 3VPAA 3VYTB 1Q91A 3C15C 3FSEA 1RYZA 3D3QA 4NCBA 4KSYA 1NI5A 1ZK2A 2BUBA 4ABTA 2FPSA 1MIOA 1P4HA 2NUAB 3NDJA 1XVAA 3E15A 2JLAA 4CI9A 2W42A 2CNNA 2QRNA 1R0SA 2BMAA 4HFRA 2BEKA 4ZZ3A 2Z6VA 1D2RA 1J90A 3UY4A 2ZUEA 2EGHA 4M7RA 4OHWA 2Z2JA 4NJEA 3LJKA 4P93A 5TS3A 3K8YA 2BR5A 2YN0A 4S2UA 2V03A 4B17A 2A1TS 2Q28A 2HMAA 3CM0A 3ZE0B 4EHHA 2FR8A 3F0TA 3U80A 3PTAA 3C6MA 4BNLA 1Z5UA 2C2KA 4UARA 1XTSA 2RH5A 3ANXA 4JEUA 1V6AA 4ARIA 1FFEA 1NP6A 3C1UA 4XIFA 5C2JB 4KK3A 3E7WA 3VHQA 1M2KA 5T3YA 4KYIB 1Z2PX 1KJNA 2ZIGA 4IDNA 4AJOA 2ST1A 4BX0A 1E7YA 2FH5B 4TKLA 1JQ5A 3VGJA 3F67A 4JBGA 3OTGA 2RAUA 3TMKA 3QPWA 4EAQA 4EGSA 4X3CA 3I3OA 4X93A 2P1DA 5TLSA 1FP7A 3B5IA 1E6CA 1BFDA 1X8KA 4WA7A 3C7KA 4UEOA 2JAXA 4ZCMA 1ZL0A 1KIFA 1XMPA 3PUIA 3OZDA 2NTYC 3DMRA 5EZYF 1VDMA 1UBSB 3V4VB 2NAFA 2Z57A 4GOLD 4I55B 3DO8A 5J63A 1DAIA 1CNEA 1SXHA 3AERB 3DLCA 1P5HA 1NUAA 3R5JA 3VSEA 3TG8A 3OUZA 1LY1A 5L8VA 2WHXA 1Z5WA 3SQDA 2V8BA 5DO9A 3I83A 2VP2A 5FEUA 4KXYA 1X8XA 3B70A 3VR3A 621PA 1SG6A 2CXQA 5B1HA 3LCVB 1H1DA 3R40A 3IODA 3GFQA 4MAMA 4UREA 1CY1A 1PJ8A 2AE2A 2IFTA 3HB9A 4B8YA 1BWPA 2WLTA 2ZT7A 1CR6A 3ZLBA 3ZCQA 4COOA 5KTKA 2ZITA 4R8VA 2YH2A 2IU0A 5L9AA 1TPZA 2NSYA 2IQIA 4Q4HB 3CZAA 1LNZA 1XEXB 2QLFA 4U7WA 4GOKA 2XE6A 5BUCA 2CB9A 2V55B 2VPPA 4JL6A 5CNMA 3VZSA 1NIJA 2JANA 1I7QB 2XZLA 5E2AA 1SVWA 3FGNA 3DB2A 4YR9A 2OHGA 3CC8A 2H4FA 3UT5A 3ZNPA 1COWD 1YAJA 3AZOA 2VWGA 1ECBA 3E2IA 1YR8A 4XJSA 4BMSA 4E13A 1IVYA 1TJ4A 2ZYWX 2QHXA 4UUQA 4C0HA 3ZTYA 3PJFA 1QGUB 3HDHA 1XJ5A 4DGSA 2AXNA 4JJKA 2F4VB 4OUDA 5EXDA 3RKSA 4W7HA 3HU3A 1KYIA 2IYVA 4D6XA 2VDRB 4KU4A 1VZ3A 1JHMA 1YI8A 5I7HA 1E3JA 2HLDD 3O9MA 3NCTA 4XB2A 4X66B 3IQEA 1C7QA 1L5YA 1V5EA 2O8NA 4HB2A 4K6GA 4N0PA 5HYVA 2A5GA 2BAGA 4L9WA 5KWJA 4RY0A 1G8KA 5CJJA 4BFSA 4EZBA 3OPQA 4DBZA 4Y1GA 4F4IA 1E1YA 2ZETA 4S0ZA 3EIUA 2H5IA 2Y1DA 1MPTA 2DP4E 1KHTA 4U3JB 1A5SB 1I0IA 2KQUA 4XYBA 1LV7A 3AI1A 1CXZA 4ZYWA 1KKLA 2RGNC 3QKRA 3ABIA 3WXMA 1X1SA 1OAOA 2W90A 4FHZA 1PV1A 1Y8RA 2HU7A 2WT4A 1XTVA 2HPAA 3AEYA 2H00A 3A4IA 5F4BA 1ZVJA 3HPRA 1C1DA 4CF6A 1VI6A 5B1EA 4GP9A 4EX6A 2VPXA 1RYFA 3A9TA 3QP9A 1C1HA 4G4IA 4E5NA 3KZKA 3NT4A 4C3ZA 2UXDB 1E1DA 2GK7A 2EX4A 4HQRA 3S2UA 5JCJD 1MXHA 3IAFA 3ZV3A 1Q1AA 1E9SA 3Q87B 1IB6A 2WU4A 1D7AA 1FMTA 1AM4D 2Y6VA 1CVRA 1GSHA 4ZPJA 5ARCA 1OWLA 1LUAA 3QBJA 1VDZA 4UJ5A 2A94A 5A3QA 3P5BA 2LCFA 4IAOA 2CWWA 3LCUA 1SELA 1Z7YA 2ZAMA 2GSDA 4B40A 5JWHA 1W4ZA 1LA2A 5DM60 1Z13A 1O97C 2H5EA 4WZ6A 6YASA 5IT0A 1U6IA 3D8HA 1UDWA 4DV3B 4FFLA 1FP1D 3DW1X 3ZUPA 1DDGA 1GZ3A 1GYQA 2IC5A 1C7IA 4AJIA 2QD2A 4DA8A 3LDUA 1QZ3A 4WBSA 2O8EB 4C7JA 1OA0A 3PGLA 3WIEA 2RARA 4F5YA 1SBHA 3EIXA 4QM7A 4ZEWA 4AKEA 5I7UA 1LFDB 2ODTX 4YRCA 5JWOA 3IB6A 4IDQA 2Y1CA 4ITRC 3EE6A 3K9LA 4L4ZA 4XDHA 5EXXA 4LF5B 1WHSA 1L1EA 3DTVD 3TE6A 3ELWA 4AAYA 5A0VA 4JN6B 2QYOA 4YRBA 1SKUA 4CDGA 1KK3A 2XMPA 4KK4A 5GVRA 3THXB 2AOVA 3H6GA 3LHDA 1USVA 4RTKA 3ILSA 1GNVA 1JG3A 5IWCA 1N3IA 3NLLA 1AUVA 3L6DA 3E27A 4ZRMA 2Q4RA 4M4SA 3LA8A 4MLCA 1EE1A 5K3FB 2HK9A 4EG4A 2OE2A 1BRTA 2PH3A 4GR9A 3ECCA 4DMUB 5LYJF 5BSRA 1XBTA 1NPTO 4WCDA 5B4UA 3I8SA 3WLSA 2OHIA 4IHJF 2C7OA 2VPYA 3R8CA 1X7WA 3X2EA 3KQTA 4A3SA 4RVHA 4U00A 1NT4A 4CG1A 3H4TA 1C8KA 3FZNA 1W93A 4ZRNA 3UQZA 2H1SA 3T0GA 3CR8A 4A0SA 1CLUA 4FHDA 2V9ZA 4DS3A 4U7GA 5ILOA 5T4BA 5FOQA 1BDBA 2BBTA 3EGWA 4TYMA 4B4KA 3H99A 4HB4A 2WJ3A 3UA4A 1T8SA 4YUAA 1SHTX 1ZAKA 4LN1A 1WD5A 5I8ZA 3HDGA 2GGSA 1GNSA 2DHDA 3IRVA 5ES3A 4BWFB 4HVTA 3K0CC 3U7GA 1ZJZA 2MJLA 3MB5A 3OI7A 1U3WA 1CR1A 1GU0A 1L6IA 1PS0A 3BJMA 1ISSA 2PRZA 4ARSA 1ECJA 5HBGA 1C1XA 3I64A 4BP8A 1N9KA 2ZB4A 3KFVA 3MLEA 5BRNA 1H9BA 1U3VA 1ZUWA 2RHHA 1U0NA 3C8HA 4BNHA 5DNYB 4WGGA 4AY4A 1P1BA 2IYOA 1I2AA 3PXAA 5BRAA 1XZHA 2E21A 3B5EA 3AJRA 1Z63A 4EYOA 3EIEA 2VHXA 3LF1A 3KDAA 1LDYA 1IVSA 1SY7A 3VU9A 1E60A 1YB7A 3V2GA 3GZNB 3OE5A 1Z7EA 2UYYA 3EMDA 3UG7A 4AF8A 4B7XA 4PN3A 3TGLA 1Z8NA 3JQEA 1U81A 3I2KA 4ZI5A 3ZU5A 4IDHA 4K6FA 2P2SA 2VJPA 2W2QA 1TKBA 3OKCA 2DR3A 3IA7A 5DW3A 3RKRA 1GG8A 3X1XA 3D6NB 3UJ8A 4F0JA 3VKFA 3O0TA 3ZCPA 4B71A 5C46F 4RKRA 3PNMA 4EELA 3CB4A 4O5AA 4J7AA 1TVKA 4OIMA 3DOIA 4R51A 3PRHA 1A76A 2CNWA 2VF4X 3L8CA 3U4IA 1YS1X 1UAAA 2W6QA 2GT1A 2TMKA 2XWSA 1FTYA 5KYWB 4BNWA 1R8SA 4GE3A 5EUMA 3HYRA 3UMBA 1T0JB 1QHXA 1P7VA 2AKYA 1QH9A 2X0RA 3RDPA 1YC2A 2IUEA 4HNSA 3Q2KA 2CL6X 2JI8A 4RDHA 4CMKA 4ECAA 5IYZA 2Q7XA 1M10A 1HNXB 4CZ2A 5FX2A 4RY9A 4KQJA 5EP1A 3HCDA 2H57A 4FMPA 4JR2A 2NZ8A 2QS9A 4PXAA 3FFBA 3ROXA 2XUOA 5HK8A 5JAQA 4W5RA 3QU4A 4B43A 3TUIC 1NRJB 1OXMA 2XVMA 1K9VF 4KMMA 5TXGA 2FN8A 4FEAA 2XCTB 2CLKB 4DBLE 2XGJA 2BI8A 2W2KB 3CLTC 4ZP1A 1GZHB 2PT5A 4OQEA 5AWFC 2GEKA 1FP6A 4JEMA 4DCOA 1TXGA 5C8YA 2QVZX 3AV3A 1UBCA 3DTTA 3H9JA 3F3MA 3CZPA 3PR3A 4HFMA 4BATA 4C5BA 3OQMA 2O9JA 1FU4A 1IFXA 3AILA 3VPSA 4Z4EA 3C7TA 4NENB 1RYBA 2NU7B 3OTWA 4OA5A 3KR1A 3OEHA 4MGHA 4F21A 3F3SA 5F73A 1Q12A 1MJHA 1W5FA 3E7PA 2AYZA 4F97A 4GKBA 4YJKA 2V4MA 2GEFA 4PSCA 5E95A 1U98A 5KNBA 3E61A 1E79D 1PUJA 4EJ6A 4AS3A 1RE1A 1YDMA 3GN2A 3MUOA 2FE1A 2AXQA 3AP2A 2D7JA 4A6EA 2I76A 3UIEA 4MRNA 2R7AA 1MPXA 2VIIA 2BZ0A 2ZDQA 3JQQA 1WR8A 4ZVUA 1F51E 1I4LD 3KRTA 1LTKA 2H51A 3NJRA 4RJKA 1NJ1A 1WTCA 5AKEA 5EP2A 3FPHA 3LUKA 4P7KA 1YB1A 3D6MA 1YJAA 5TMPA 1ILEA 1KH3A 2IBTA 4Q3AA 3JYNA 1IXZA 2DUMA 1G2QA 4Q1CA 4V39A 2CNOA 4D43A 3Q41A 1WSWA 1BX3A 3O8CA 1EVEA 3DLTA 1FFDA 4RXMA 5EIWA 1P5RA 2IOYA 4S1TA 3PCTA 4ENWA 4NXNB 1JDJA 1LJUA 721PA 3JALA 4IIVA 4FS3A 2CLFB 2SECE 4RA9A 5DV9A 1JKXA 1ADGA 3FTQA 3N7UA 2P9JA 5DM2A 1BS9A 1R4AA 1VIDA 1A1VA 1EHIA 1XF1A 2OVBA 4JVSB 1QC5A 2VAWA 4KAXA 1FDIA 3BXZA 1UEJA 5TPWA 3KTDA 1JJBA 2HJ9A 4MA5A 2HT1A 1MF7A 1C9KA 1A5ZA 2OBLA 2WUVA 5J2UF 2POCA 3HJRA 5ICMA 3JVUA 5F35A 3IERA 4U4AA 1TRHA 1T5SA 5JSFA 4GKKB 4MKXA 2J9ZB 4XD7A 2Q8PA 4N0QA 4B6SA 1R9GA 2QG4A 2P6NA 4MWGA 4UBKA 1W2WB 2R25B 4C43A 2GPTA 3O2NA 4RY8A 4PZZA 5J4VA 1S3SA 2YHIA 3URKA 1TGVA 5IKXA 4KFUA 2JJ2D 1P4AA 2RIRA 3QU5A 1UP6A 4NATA 5F9MA 3JAMA 2CD9A 3ELBA 4CTOA 5L4LA 3A4NA 4LG1A 3CVVA 3QU9A 5DXJA 3SYKA 5DULA 3VH2A 2CN1A 3PXCX 3NTOA 2HIMA 3CBGA 2VQFB 3C70A 3SQWA 5L3ZA 3ZIAA 2R68A 4LYDA 2P2YA 1O94D 4Y2GA 4M54A 3MD9A 5FA8A 5EJ8A 4H17A 4ZVLA 1Z0DA 3L01A 5G40A 3UT0A 2H1HA 1KO1A 3QF7A 4D9IA 2CLHB 2JIRA 4UVDA 3V1KA 3V80A 4EGJA 1N5LA 5B3KA 1QM5A 3LECA 1XPRA 3QBVA 4IZHA 1C8LA 3TLCA 3V7UA 2R84A 3I5AA 3D59A 4M1WA 4L6CA 1E6UA 1C0EA 2TS1A 4GQAA 3FROA 4HN4B 3IYLW 4JSTA 1D1TA 1GL7A 3OLXA 1Q57A 2I1WA 5C1PA 1SPXA 3I1JA 1QRTA 2HO4A 1OBHA 1IAVA 1PFVA 3KSMA 4B3IA 5IMBA 5BWNA 3AWDA 2BRUA 4ML3A 4AY3A 4FYWA 2OCBA 1G20E 1CIPA 2QRVA 4G5GA 1CQJB 3MFQA 2IHTA 5DYNA 3C41J 4EECA 1AXEA 3K8ZA 1KWGA 2QG6A 3M83A 3PC4A 4FFWA 5CIYA 3FTCA 3KV3O 3K31A 2PFGA 4IJMA 4P53A 1HQCA 2VXBA 4JI4B 4ZHSA 3QLUA 4AM8A 1K4YA 2H2DA 2WMNB 4RYLA 2VO1A 3PUXA 5GAJA 4C7KA 5BUZA 4LOAA 3HA3A 4Y0AA 1VL0A 4E5DA 3GBVA 1CUJA 1RMYA 3CIFA 2I2WA 5TF4A 2PU7A 2PXXA 4OQYA 4F9EA 3RFUA 3ZU6A 1RRFA 3LPNA 1E66A 2QZJA 2C3MA 2ORWA 4OAOA 5KVCA 3JQ6A 4D5EA 3PVSA 2PQ6A 1KK1A 4LCJA 2PQ2A 2INGX 1T8WA 3MVEA 5AM0A 2G63A 2ID8A 3RS7A 2LRHA 4H27A 4E08A 1SKQA 4NCXA 5LZ7A 1YRHA 5ESXA 1ECLA 1JUDA 2DY0A 4RANA 1L2TA 1HH4A 1B3BA 2ZYSA 4Y9DA 1I3NA 3ZKAA 3AM3A 2PO7A 4CU5A 2WJVA 3RVRA 1CUUA 1C9EA 3TG2A 1B14A 1Q1NA 1C30A 4G97A 3EGIA 5F7OA 2FWRA 3PXGA 4NXMB 3TZKA 2QZPA 3VYSB 2OV1A 2UXCB 4BEWA 3PQ5A 2XDQB 2NNLD 4H4EA 2QXYA 3MINB 4IFIA 5GONF 4KG7A 5A03A 1M34E 4F4FA 2YIJA 4PYJA 4ZK6A 3QIAA 2AUMA 2CVQA 2BGLA 3Q7EA 2OXFA 1GADO 1J42A 2FFHA 2G4LA 2OP0A 5JG7A 4EMTA 1RWPA 3FKSD 3C3DA 3WAGA 4PR0A 2CCKA 3CW9A 1J0CA 4OTZA 2PGXA 3FE2A 1B93A 1HQKA 1T8PA 1U1FA 2BKUA 3BX1A 3F7TA 1G21E 2XE4A 3C3AA 4N7BA 4OHVA 5AKKA 4I08A 2YHUA 1GL9B 3IAEA 4CLHA 3PJEA 5HPYB 1TM1E 4I4CA 2PYIA 1UAYA 2JRLA 4M0MA 3T4EA 3ZZUA 1E2NA 4GVPA 5BWBA 4B9AA 5E6SB 1RM3A 1K5HA 2A7XA 5DGXA 2Z98A 3EEBA 1QO0D 2ASVA 2C5LA 4UU8A 2QDXA 4GICA 4JXXA 2AYXA 4UD2A 2BC9A 3GWGA 3M1YA 4KMRA 2YVLA 3WGJA 3QOYA 1EXWA 3HXOA 2YS6A 3R74A 3N7AA 3QFTA 2GCNA 1CR0A 3N2KB 3VAAA 1D1SA 4M37A 3ZX4A 1NXQA 5BSKA 1GUDA 3A4LA 2EJWA 3M9XA 2QRPA 4MB0A 2PZAA 4I8DA 4Q7EA 3GLGB 4FM9A 1GSOA 2NWQA 5JXJA 4B7AA 5MGNA 3EMBA 3PQEA 1X1QA 2IHJA 3N2GA 4TMFA 1MG5A 5JO9A 3VR5D 4EBBA 4IICA 1EXDA 3ZE2B 4CT5A 4ICIA 3S5UA 5BW4A 2UUPA 3P2KA 3MWLA 4C4TA 4TYYA 5TMDA 1DRJA 1Q2UA 4UM9B 2MYNA 3NFYA 4U7HA 1KVTA 2FKNA 4CLRA 3VO1A 1UM8A 4H9GA 1MBZA 4R84A 5DWQA 3A0RB 1Y8QA 1Z25A 5DGIA 4HRYA 1C81A 4P32A 3OHMA 3QVSA 1X15A 3LS2A 3R5TA 4WERA 4HLUC 3OFJA 3BWVA 1TLTA 4LNAA 2GR9A 4UHHA 1FFAA 2W22A 3F9CA 1PF7E 2AFHB 1IM8A 3HA7A 1QO7A 4R83A 2HM7A 1N4DA 3AUUA 4NP6A 1GZ5A 4HSEA 5DSTA 4WEOA 2YXNA 3VR3D 1V5FA 1NW3A 2M32A 1MRNA 3F6YA 4QYIB 2F48A 3JQDA 4BV8A 3L5OA 1O0CA 4K9SA 4UOEA 3TQIA 5AICA 3QPAA 3ENNA 4M60A 2HQSA 1MH9A 4QAQA 1G8SA 3ESDA 4YROA 1LW7A 2AN1A 4P92A 1DV1A 4O4HF 1DXQA 2FEWB 5LYYA 3FNRA 1GCOA 4XGIA 4F3TA 3W4IA 2WABA 2ZYTX 1SK8A 3IP3A 4UKDA 4M88A 2XEXA 3KLNA 4QOJA 3O8QB 2YKGA 1EAYA 1EFDN 1W76A 3D8NA 3HSKA 4OREX 5CVTA 2CLOB 2M98A 5KTYA 1L7DA 1Z0FA 2Q21A 3LLCA 4MVJI 4N5MA 4PZAA 4WLNA 4XPIB 3W6ZA 1G5HA 1RWWA 3C4JA 3CTMA 3MN1A 2PX3A 1E6WA 3B6EA 3LYHA 3WWZA 1NPYA 2Y2UA 4KR6A 2P2LA 3HEAA 1MXFA 3ICVA 1K0UA 5IHPA 3NC4A 1ZFNA 1NYQA 4TLCA 4RTLA 4MQEA 5IYZB 3K70B 5F9HA 1Q1BA 5B2EA 1XO1A 4O4JA 4DIDA 3ZY3A 2R8ZA 5FPYA 4A8PA 2O8VA 1YBMA 2M1XA 3KKLA 1ZCZA 1XK7A 4DNOA 2Q50A 4R2WA 2ZM6B 2PG3A 5L4SA 3RYFA 3DVQX 5EHNA 4WLFA 1EBBA 2BBOA 2GKSA 3UJ9A 4AG3A 2QY6A 4E88A 2ZYGA 5CDSA 3DBIA 1K8RA 1H2RS 1CFJA 1DKLA 2B37A 2OMKA 3OF5A 4TTRA 4MKHA 4QGFA 5DXFA 4XVHA 3WGLA 4G01B 3NBYC 3WDKA 3KYIB 3PGJA 1GTZA 2RHTA 1E20A 3SGLA 1C1XB 1TFRA 2VTEA 4MPJA 3QKSA 3IUNA 1GR1A 4O3FA 1DAOA 3G5LA 3MEQA 1JHUA 1MAAA 3QE2A 4PPNA 2B8JA 1V1MA 4TYPA 1A1SA 2RDMA 3ND6A 2WZCA 4ZGGA 3DD1A 3FR7A 3IIEA 4HVCA 3AW9A 4H7EA 4LHXA 5IAEA 3UT6A 3HXMA 2W9XA 1T6ZA 3Q9NA 3ZWOA 4J75A 1SRRA 2OKCA 2ZS9A 3UF0A 4JC5A 5FRDA 3WLEA 1ETUA 4CR7A 3RSQA 4MQ6A 3AJEA 4BUJA 4EYSA 4Q3KA 2NVOA 2UUBB 4Q9HA 1DQPA 2WWYA 2DETA 4D1YA 2FSSA 1EI9A 3RYIA 3RARA 3PHLA 4R01A 4W5NA 4AU1A 4GXQA 1FFYA 4DM4A 3F7OA 2BPOA 1ISHA 3FPAA 3OZWA 3NEPX 4IS3A 5H80A 1KQFA 4I6EA 1K6IA 1ID1A 1SCJA 5M3BA 1V9SA 1U4SA 3CF2A 5BNTA 1ZSNA 2O8BB 3FIUA 4PSAA 2IOQA 2NU9B 3JZAA 3R0XA 4Q9JA 4B0PA 1LDMA 3ZI7A 3PQ8A 3D6VA 4LGYA 2XMCA 3L1KA 1NFQA 1LU9A 4MP6A 3CLSC 5L7YA 3EZLA 1E8DA 2B5WA 3GLRA 3ADCA 5IBPA 3DL7A 4L02A 2GO7A 3AFHA 4MV6A 1VJ0A 2FMXA 1R15A 4OH7A 6LDHA 5AW1A 3QPBA 5B1DA 1SURA 4LZNA 3EQ8A 4QBFA 3W5IA 3SHWA 3WOVA 2GYWA 3TSZA 4HGZA 5BYKA 3ER6A 3TSWA 5HBRA 1IIBA 1LWNA 2LBPA 2W6JD 4EHIA 2W2KA 3BHMA 3FGOA 1Y5NA 3U7EB 2N1BA 3L07A 3GNSA 1PGQA 1VM6A 5GPBA 4OXKA 2IYLD 2WYWA 1BU5A 1YZYA 2AXPA 4FXPA 9LDBA 5D1NA 3IR5A 2QGNA 2VH1A 2Z6AA 4LGVA 1DWQA 2A3RA 1T5DX 1BMDA 2YHIB 3C97A 3N87A 4K9QA 2KWIA 4BYMA 5ALEA 3RS0A 3ILYA 4EHJA 3V00A 1A88A 4MWCA 1KTIA 3ZVNA 2HLPA 3MJVA 4PNPA 4UEJA 2ZSFA 3EXHA 3KZNA 3WKCA 1SKMA 4LCBA 3WNVA 1U3FA 1G1AA 3KPUA 3F47A 2VQEB 1RJGA 4B44A 4OI1A 1JH9A 1R5JA 1BH6A 2MSLA 3RAJA 2EBWA 2NU6B 1JJAA 2JAOA 4K9LA 5LQRA 1HZJA 2CHFA 3DE4X 3KTFA 4PZ9A 1Z06A 1Z6QA 4IIBA 4BAZA 1P9OA 2ZBPA 4AICA 3O47A 4YT8A 4RF3A 5KX5B 4ZZIA 2BDUA 3ANMA 3OM1A 3Q10A 5ICEA 4JBHA 3AP1A 3PYXA 2XB9A 2RCNA 4Y2PA 5I4IA 4AJKA 1A77A 2WJYA 1O9BA 2VP5A 3MJTA 3AVQA 3GJ0A 4LDPA 3D6AA 4L7VA 2ZRLA 4AZWA 1QFSA 2Q0HA 2X0KA 3ANYB 4DEYA 4P36A 1RYYA 2QT1A 2BFFA 3B85A 5J2TA 1XLTA 2AWOA 2CMFA 2FVYA 3DTVB 1Y9DA 5AI6A 4OXRA 3RS5A 4Q1BA 4CUZA 4AKIA 1OX4A 1HKHA 1JA0A 1MX3A 3LIPA 1JFFA 4NV0A 3H8WA 2ZYVX 3G1TA 3HB4X 2LR0A 3JASA 4JSYA 1IONA 3EW7A 3MPUA 4KUHA 5ALLA 2QYSA 3DHNA 3K09C 3GJZA 2BGTA 3GP5A 3IVRA 4GSLA 4NFSA 4RQBA 2BONA 3T3EA 3KJGA 3ZWBA 5BUSA 4C07A 1EDDA 2XUJA 4YT2A 5KC8A 3ZPXA 1O95D 2FPUA 3VU0A 2Q5OA 5A71A 2QF7A 1VB5A 3SMQA 4F9GA 3BRCA 1RQRA 3H9UA 3NNNA 4FGUA 1AGYA 3KQWA 1HM5A 5GM1A 2GSWA 4QTXA 2O52A 3VPHA 1JTVA 3PRJA 2L19A 3RYHA 1SVOA 3HKCA 3JQ9A 4EO9A 3IRUA 2R5NA 4O29A 5L51A 2RGEA 5TR9A 1FYEA 2YRWA 1JWBB 3U9LA 3SIXA 4G0UA 2PA3A 3CHYA 1Z0KA 3EX7C 2PTHA 1I3LA 4OY3A 5JAZA 3BXEA 1X1DA 3TZQA 1GKYA 4WVFA 4K87A 1DEOA 4KDCA 5TQJA 3JY6A 2ZUTA 1K7XB 2G83A 4K3UA 4EZEA 1RYHA 1U1IA 2WT8A 5AJVB 3TEMA 5IH7A 5HKKA 1KOGA 2RE8A 5EZQA 2VAXA 5KNDH 1U04A 5E6RA 4ZVQA 3EHEA 4HGPA 5CHYA 4Y8VA 5IDXA 2XVYA 3MINA 3S2EA 4J0GA 4FUQA 4XRGA 5E4FA 1XDGA 2GAOA 4QYXA 4Z51A 3SM9A 2X2PA 2IW1A 1L8QA 2Z2XA 4TTVA 4NOMA 2P0YA 4DGQA 2QV7A 1IQPA 1ZH8A 3GAAA 1I1QB 3FTEA 5B4TA 3HUUA 5K0GA 1T10A 3GEDA 1JNXX 4QTZA 1N4AA 2I9KA 2X7XA 1IXKA 2C2OA 2OCDA 2O1XA 2FSGA 3FUVA 2D8MA 4MUKA 2PZKA 4ZQCB 1A5AB 4HJXA 2H1OA 4Z4IA 2D1YA 5KAPA 2ZIXB 3GFGA 3ZJVA 2W4IA 3EBPA 1KAMA 3R0QA 4C78A 2YY5A 1D4ZA 3B8HA 1E32A 1RJWA 2BN4A 2QL6A 3NV7A 4IXDA 4AZ3B 1ZHOA 1YZVA 4IVRA 3OM8A 2QTZA 3PNVA 2UZ0A 5HFAA 3BIOA 4RV5A 2HWWA 4DMMA 3UBTA 4XLLA 1UQUA 5C8XA 4G0ZA 4V3CA 4K6CA 1APBA 1KXJA 2C7BA 4IDCA 3T9FA 1DT5A 4RY2A 4ZTZB 2O7RA 2C83A 4RJ2A 2O6LA 5TJ9A 3WLPA 2I4TA 2GPWA 3TJZA 2WSSA 2YJ6A 4M49A 5GP1A 3EEYA 1H3EA 4RPHA 1GZVA 1UKBA 1BW9A 2GFIA 1NVVR 1YIOA 2BKLA 3C7DB 2FX5A 3RJ9A 1CULC 1JQJC 3G9UA 3THXA 2C1XA 3M81A 2HLNA 1E3DA 3UMSA 4FN5A 1QIGA 3P0IA 3IVMA 4I1OA 4CIVA 4DC0A 2EKDA 1E4OA 3R8XA 4ZI7F 1DC3A 2B20A 1N2HA 1SQGA 2DFTA 1W94A 1PWEA 4C1NA 1YS9A 2QAJA 3H2KA 3HBMA 3UAYA 1JE0A 1PR1A 4GD3Q 3KSAC 1OZAA 3HEBA 4KRXA 4LYGA 3T9AA 1SB9A 4KE6A 1ZK3A 1P0MA 1YDEA 4YDRA 4RAQA 4HAUA 3EVTA 4REQB 2AK3A 3EVEA 1PWYE 3DMFA 2J8ZA 1GV0A 3JVDA 3MJDA 3OH8A 1VMKA 1GQSA 1CDEA 2B9EA 3IJEB 2DQKA 3IPRA 4IRXA 1JG6A 2ODWA 3H8JA 3I9NA 4KNVA 4OXNA 5EWMA 2EBHX 1IZ8A 3CX4A 1LS1A 3MOSA 3EZ9A 3QFSA 2DWPA 4XSGA 2O8DA 4L8GA 4RLHA 4B80A 5LZ8A 3A4VA 3RC2A 2DM6A 3NTQA 1PK7A 1RHMA 1TO6A 1VA5A 3PC3A 4EZIA 2R6GA 5U4XA 4DA9A 3DTYA 4P7JA 4E46A 4ASUD 3OC0A 3PKJA 4QTUB 5AUNB 3WYAA 1NBMA 2W43A 4LRTB 1KPHA 2BEJA 1EJ2A 1MVNA 2C00A 2CZQA 2NUTB 1RC0A 2XUQA 3CEMA 2NZXA 3FPCA 4RWZA 1NXVA 4QD3A 1GFSA 3HXLA 1G5QA 3DONA 1VJ5A 3GLGA 2XDAA 3KYCA 2IV2X 3OZCA 4KZKA 2GKGA 5JNLA 2XEDA 4HYYA 3R3ZA 4LXUA 2VP9A 3JAKB 3PG5A 4EITA 1KRHA 3CKMA 1ECFA 1FJHA 2WHPA 2X1LA 4CV2A 3R9XA 1FMFA 1QWSA 4IFEA 1SIBE 1JLRA 2EX0A 2XBLA 2PCLA 4L7QA 4U7JA 4UUMA 3TTVA 1A9XA 1XQXA 3MLBA 3HTXA 3CNQS 4JP3A 3HDTA 4GI5A 3HV2A 3NWJA 5IXSA 2VBCA 4WESA 4GMKA 5H83A 3X1JA 3JWPA 4YRDA 4EI8A 2EQBA 1F5SA 1PQUA 2GN4A 3B60A 1OLXB 4G0PA 5FQOA 4MUXA 1JQEA 2GD0A 1BWQA 3ST7A 3SSNA 1XNHA 5HGXA 5AJYA 4OX9B 1YULA 2D0PB 1XQVA 2VT2A 2P2CA 4LXHA 4P2GA 3O83A 4TTSA 5C7LO 3DOJA 3Q40A 3V1YA 4LXTA 4PZUA 5T8KA 3T7TA 1EFHA 1F5NA 3L41A 1NVAA 4N6GA 4F6CA 4ER7A 2DMRA 3ETHA 2ERCA 5FP0A 2WKRA 2GBPA 4LPKA 2N1MA 1W36C 2GFHA 2R6R1 4KIFA 5CDFA 1GRVA 1YNSA 2W4QA 3GUYA 1QE0A 3C3JA 3CINA 3QI7A 4MJLA 3EGDB 3I53A 3MRSA 4TSFA 2AX3A 2ICAA 2Q46A 3EYAA 3OSZA 2UVPB 4G0YA 4HGQA 4NPHA 4YN3A 1NIPA 4RHCA 4KXMA 4KQHA 4TM7A 3A11A 3OPXA 5JFOA 2VDUE 3KZ1E 4OQPA 4Z0HO 2VK1A 3HBJA 4CM4B 1YBHA 1ZWLA 2UZ3A 3G2NA 3OQBA 3E5MA 2DU8A 2G6TA 2IYAA 5C8YB 1IUPA 1MB4A 1XQYA 3Q7SA 1XLWA 4L5BA 4ZOLF 5CLHA 4BP1A 2O8BA 4JJAA 1Y7IA 1YOVB 3WP0A 1Z26A 2WAMA 5EJ9A 1X87A 3QVJA 4ZARA 3Q8KA 4HL6A 1JQKA 3ZQ4A 5B57C 2O8FA 3WISA 2EWVA 2WG2A 4ZO9A 1OREA 2WKWA 5B2ZA 4BBPA 3TZCA 5AK5A 4R7TA 1ZMRA 2J41A 1GNQA 2VTBA 2CB0A 1T9HA 3IVXA 4EY7A 4O4JB 1I3MA 2XNKA 4MR7B 4MRMA 2Q2WA 1BGVA 1T1JA 2M6SA 3JTMA 1ZXXA 4J0KA 2GM5A 3HBLA 5CB0A 3Q9UA 3UCXA 5FNVB 5CYPA 3SICE 4EM6A 3DC7A 3W4KA 2V4ZA 5BSFA 1ZSVA 1G0NA 2WBLC 1W1UA 2ZAIA 4NWIA 3DWEX 4WAUA 4D3YA 2D06A 1XTTA 4EB6A 5B6PA 2UUAB 3EQ6A 3RODA 4Q4LA 4LV5B 1OILA 3SHOA 4MYTA 4O2BA 1WB4A 2JBAB 2P9ZA 4XZ3A 4BOYA 4JJFA 5K4GA 4WQMA 3HACA 2OSVA 1SXJE 1CY0A 1BOFA 4M7WA 3RVQA 2RC5A 2PLRA 1VL8A 2Q4EA 3P2OA 4DIMA 4BPBA 2FRDC 3QOWA 1V1MB 3ZV7A 3WFZA 2EHJA 1LDEA 2C20A 3MSXA 5ICGA 4BNNA 1GAJA 4BVKA 5A9SB 1CYEA 4CCYA 3BMCA 2CVFA 1MT3A 4DQDA 2B21A 1YCHA 2XIJA 5CCDA 5IRCD 4KIJA 4TYWA 2L42A 3PDHA 4Z9BA 5BV7A 5IJ0A 1DEXA 3ONWA 4UFNA 1Z36A 1M9NA 3VDXA 5BMVB 1U0LA 2V3WA 5ALPA 3AEKB 3S8YA 3L7KA 2OLJA 3KO8A 2CFCA 2XY4A 1ACLA 2FN7A 4MUIA 1PJ4A 1QNFA 2EXXA 2K5UA 3HDJA 4B5LA 2CMDA 1TYBE 2IPNA 2PGDA 1S89A 3TW8A 1IBSA 1FK8A 2QRJA 3R3XA 5H7XA 3KJHA 3GF4A 1O8BA 2AWNA 4HAWA 2NLOA 2JLSA 5AJHA 1AO0A 5ELLA 1V16B 3QJYA 1RYDA 1NMZA 2GM9A 4HDCA 2X6RA 3IAAA 3T15A 1GSIA 3GQBA 4Y9UA 2IV3A 2E4YA 1NUPA 2VF7A 4RJIA 4DCPA 1YCFA 1GQYA 3K1TA 5FPTA 2JNWA 3L3BA 2JGMA 2SKCA 5EHIA 4RJJA 1J1IA 1RXUA 2QTLA 3DL4A 4FIDA 4C5AA 2G9UA 4ZGWA 1T25A 3BXPA 1M2JA 1Z56C 2HRBA 3FR8A 4PINA 5JDIA 4R40A 4EJMA 3ZHUA 4CEJB 1FNSA 4FJ1A 4BLVA 3U19A 1DG3A 1NI4B 1NNLA 1UMKA 5EE5B 1U2QA 1FTSA 1GL3A 3ZH2A 1XPOA 2GUGA 2AL7A 1U7UA 3OCZA 2C8VA 3DKRA 3PC6A 2Z3WA 3DL0A 1OGIA 3DPIA 2VXCA 1DXOA 1W29A 3IR7A 4QHTA 3ROKA 2AK2A 4HD8A 4U0KA 5FLKA 2M6RA 4L5IA 3EAFA 4HNVA 1TT7A 4J6FA 2QN8A 5EKTA 1JQDA 1NBIA 4HFJA 2I8CA 1KRWA 2JIOA 4P31A 6Q21A 1MQ8B 4EVQA 1SULA 2C97A 5C8ZA 4QJBA 4RETA 3VOAA 5J4LA 4ZGBA 1QP4A 1R8JA 6REQB 4KI0A 1DQNA 1R0BA 4S1WA 2DBYA 4EKGA 1ZN9A 2P30A 4JYZA 3G5UA 5HDQA 3TRJA 4N3GA 5EMLA 4X90A 3UQYS 2DWUA 1DC7A 1XCBA 2WSSD 3E9RA 5LA6A 4F71A 2I55A 1P17A 3B1VA 1Z4KA 3P9NA 4N5HX 1MR3F 1XVTA 2JFQA 1XVIA 2RI6A 3DM9B 3EUAA 3VJKA 3WQSB 2PVSA 3DYVA 3IDAA 3EUWA 4AWAA 2IX9A 2PUTA 3DYIA 1RP7A 3S81A 3FFAA 3TOZA 4DPMA 5KWSA 3RQSA 4BKRA 5ALQA 2D1FA 5J5CA 5K5EA 1K7YA 1AMOA 4KHPB 1H9CA 3P52A 4UU0A 4I99A 4F2DA 1Y7HA 1FU8A 4AG5A 3GPIA 3CV3A 4A8JA 3EK2A 3OCVA 4WFJA 5BQFA 1XAJA 4RDCA 1MAVA 5CLGA 1E2QA 1X39A 4MV7A 1Z5GA 4PQFA 2NXJA 4IZIA 3ZQUA 1GGFA 4HYEA 1NNUA 2GCOB 1QCZA 5AHXA 4YYEA 4CNBA 1S01A 1V6CA 4QSMA 1ZD3A 4QYSA 2F55A 2EBUA 3EXIA 1RAFA 3D1VA 2N47A 4UDXX 5LIPA 3WQHA 4DJAA 1SKAA 1J2UA 3ICCA 2XITA 1LBTA 2OGWA 1JJVA 3OMXA 4ZA2A 3I1YA 2DTXA 1R0KA 2V6MA 2RB4A 2ZSDA 2C7RA 4CTKA 2IOFK 5IKPA 4WFKA 1TD1A 2ZVDA 3ZXYA 2Z83A 1LPMA 2IHUA 3HP4A 4GECA 2P11A 1I0LA 2WFAA 2EHDA 1YDGA 5ER9A 1KEKA 2QUJA 3ESAA 1E3EA 1L9XA 2BE9A 1QYCA 3SF0A 3K0EA 3WL3A 2HK7A 4BNGA 4Q3BA 2YV3A 1D03A 4KQ6A 3H2SA 2IPXA 3WIOA 4HAXA 3ZQJA 1J07A 1QCYA 4BLRA 3I28A 5KOIA 1YVEI 2DTEA 4LYFA 1K5DA 4Q1VA 1J1UA 3DZIA 4YRKA 4P22A 1VMDA 3OOEA 3G8AA 4QTYA 1N8KA 3I62A 1DB3A 1T9GS 2VKTA 3L6UA 3IIMA 4AUKA 1R1DA 3WO0A 1Q15A 1E0DA 2C1EA 3SAJA 4F84A 5DSZA 5C5CA 1X7WB 2ON6A 1T43A 4FR2A 1CNFA 2PFKA 4GPTA 2H59A 4C05A 2WM2A 4JYAB 2YOGA 4ND3A 2QORA 3RUHA 2C2MA 1W6RA 2CXOA 2JS7A 4UM5A 4KQIA 2CUNA 1E1CA 4NH4A 2ZRKA 2YS7A 3PLNA 2V1XA 4EHAA 2FY8A 3KQUA 4AF7A 3BXXA 3ETEA 2FW6A 4U2DA 1QIDA 2B7BA 3U4HA 3W05A 3V1TC 4DBLC 5AM4A 1RXIA 4J3JA 3BB3A 2BCJQ 4BLPA 1GKLA 1TL7C 4A8HA 3K0BA 3E58A 1HGXA 3H7AA 2HU8A 3RANA 3SZLA 2A9FA 1Z33A 5BWLA 4YCAA 4PVCA 2HMTA 1ZG3A 1KVRA 3TW0A 4O4IB 2GILA 3VKHA 3AKYA 1C3EA 1GRRA 1OHHD 3KEFA 4DHEA 3H5NA 3ZHZA 3T1QA 1PDOA 3KYBA 1GLVA 1CIJA 3DHYA 3IMCA 4L74A 3LOPA 4PLCA 1HNWB 1Q1ZA 4AI6A 3L7YA 1IQUA 3O4HA 4Y6PA 2BI7A 3WLTA 3IKTA 1GTJ1 2WB4A 1P4RA 1MABA 2ZBVA 4IWXA 3LLUA 4QQ8A 5GOZA 1U2ZA 3HYSA 4P3OA 4OXIA 4ZU3A 2ODEA 1P2TA 4BLQA 1KEZA 1HDYA 1QH0A 3SR0A 5I7FA 5ABPA 1XPUA 1P6XA 1JHDA 1JQAA 1QE5A 3K0FA 2J7PD 2GN6A 5FLXA 2GNPA 4Y2SA 4PC2A 1KORA 1HE3A 1TLLA 1G8MA 1J8DA 1Z4MA 2O2GA 3L7MA 3RV3A 4MKRA 3I6BA 4OB7A 1OAKA 2ADMA 1CJCA 1ZK0A 3JVVA 4JB0A 3UEOA 2WIBA 1Q7TA 2QENA 4UQPA 3VNBA 1ADYA 4RCYA 3WLAA 5HKAA 1O9HA 1BEUB 3KQOA 1XYYA 2OZLB 4MP8A 3RNLA 3TIGA 3NFRA 4CF5A 2WICA 1CJTC 5KNBD 3NVMB 2HDNB 1KSGA 2JCYA 2HJHA 1TK2A 3V6MA 4CMAA 3ZWPA 4CKCB 5IF9A 5JAOA 4RF4A 3HVRA 2I71A 4BLUA 4OFBA 3QWFA 4I1YA 1EBFA 2G72A 4MEAA 1OZ0A 1KYZA 4X7MA 4RTPA 3JQAD 3PL1A 1BE8A 2FQQA 2JLWA 1EVQA 4LRQA 3R3VA 4WVLA 1BDIA 2I0FA 4N3NA 3WGVA 4FWIB 3CVXA 3HJFA 1PR9A 2W2NA 1N34B 3D3KA 5EY5B 5DJ5A 5KIAA 4XQCA 1J99A 1W88A 2RGUA 1N0HA 1RM5A 5COBA 4XLZA 1M83A 4V03A 4EGAA 4QDJA 1KERA 2PZGA 3G2JA 1VB3A 1B8NA 2C9CA 2Q5HA 1OUMA 2WR8A 3O92A 3MT9A 3BA1A 4C0JA 4D8VA 1Y3DE 1PJLA 3H6HA 4JOQA 1DIAA 4BE4A 5C51B 1QOZA 1GUYA 4CGZA 2WA2A 5D6OA 4OXQA 4PLZA 3WE7A 4L95C 3OZFA 4RW0A 1JECA 2WQ6A 3RJTA 2VYVA 2XKBA 3MWYW 4GE0A 1N1GA 3TVYA 1YQDA 1TD9A 1N7GA 2IH4A 3KIPA 4EVRA 2JIZD 3K15A 4GPD1 4NHOA 2BEVA 2VHUA 3D5QA 1UOQA 4OG2A 1JEAA 1X6VA 4QOHA 4TXJA 5EKXA 3NCHA 1B00A 2XNDA 2JEZA 3KTAA 4MPDA 5CIWA 4CM6A 4HN2A 4J0HA 5KCZA 4G9EA 1Y3AA 1T26A 5LUBA 3HYTA 2WVGA 5HIKA 4A23A 2ZQ5A 1L7QA 2EV9A 4D8XA 3D1LA 3O6VA 1U7WA 1X3SA 2HMWA 1X77A 3HZZA 3R2JA 4JUFA 2ZG6A 3WRWA 5HKOA 1G59A 4MB6A 1U63A 1C7EA 4EG5A 4DQLA 1QF7A 3L1HA 3OM9A 4HTAA 4L0QA 4JJZA 2V7XA 1LQ2A 4RA9B 3MWJA 3RBZA 2HIGA 1HRDA 1R6AA 2OHOA 1YZUA 4UU7A 4Z86A 3DCIA 3FNFA 3DZ8A 5JQGB 2NXNA 5J47A 3LO8A 3E3OA 1U0EA 2ZQYA 4DMLA 2XDYA 3TMAA 4DUYB 3OQOA 2D3TA 1DIRA 1RRVA 3W8FA 1Q0QA 4DTCA 3NX4A 3KB6A 5CX4A 3ELYA 3AKCA 4DKJA 2AHOA 1ZC4A 1PHPA 4RVSA 2XWBF 4QO8A 1VRWA 4MV4A 3PPIA 4W6ZA 2OFOA 3LY5A 2I9PA 3JARA 4HUJA 3OZVA 3A3PA 2GARA 1JE1A 1KA9H 2H9AA 3LFUA 1DKQA 4QPDA 3SQMA 3AXTA 1DP4A 1TUIA 4QOFA 2XT9A 3SYTA 1QF6A 3KQVA 1WCV1 2JGLA 4U1RA 1YKSA 1NMQA 2A57A 2WA1A 2JGDB 1J25A 1U3DA 3VTFA 3RIGA 5HTOA 1YQWA 4JLAA 3UAVA 3TLBA 3GA7A 2PR2A 1O0BA 1LVHA 3BXGA 3RS2A 3ZR4B 1JDTA 1D1QA 1SXIA 1GSAA 2JFOA 3BA6A 3DZHA 5HF9A 1SMKA 3W2GA 4DLYA 2DHQA 4FEYA 3GUCA 5KQLA 3H1FA 4QFCA 4KN8A 5FFFA 1JIUA 5LWQA 3TN7A 3O21A 4J0CA 4MVJE 2CYAA 2GN8A 1Z5VA 3HNRA 1SUAA 5FTJA 1EP1B 4DY6A 4EJFA 1U7PA 3RC9A 2WWHA 3GVCA 5ITWA 4K1XA 4WN9A 1KVUA 3ZHCA 3K9HA 4PZLA 4TOIA 1SXJD 4FFDA 4DUZB 4ZOEA 2Z9DA 4KCGA 1EHYA 2HW8A 3L4SO 3OEHD 4XW2A 4IF4A 4B4UA 5CG1A 3EGXA 1IU9A 1EINA 1F8GA 2HAEA 3WICA 3BD6A 3ZD6A 1V39A 2IHKA 4M86A 2XCSB 2AN5A 2WYOA 4FE7A 1EFVA 2PU5A 3G8BA 5CLJA 1YMVA 3E23A 1ESMA 1VJGA 3ZDZB 4ZHQF 3LHKA 1ZD1A 3QVMA 3E1SA 3IHLA 4X1OA 4LRUA 4XGQA 2B94A 3ERCA 2O14A 2W8BB 5EG5A 3AQ4A 3NBAA 2CF5A 3DR3A 2VP4A 4HS4A 1L4KA 2RGRA 4KR3A 4DT1A 3LPDA 3A1NA 4IIJF 3FDFA 3WGIA 2IHBA 1E7WA 2DFDA 3RM3A 5IN4A 4YWJA 1TEVA 3AB7A 3LD9A 2BKAA 2B2NA 1Q11A 3N8DA 3SC6A 4HP8A 1CY7A 1ULAA 3A6EA 3ZV6A 5H4HA 3QIVA 2GASA 4ZU6X 5EMHA 2Z5LA 1ZW6A 1U7HA 2HUNA 3ZHBA 4KO3S 3QKTA 3K5WA 4D4HA 2ADFA 4XM0A 2GBCA 2NO6A 1SK9A 3T3OA 3L43A 4AMVA 5B64A 3BGVA 2XNJA 4MRPA 2C59A 3FYHA 3LCMA 5JVDF 3AUXA 2COUA 2AR7A 2V7WA 2I7DA 4FFMA 3K32A 4E5YA 1NYRA 1X7ZB 5AVOA 2BYTA 5FFNA 4GP6A 4YAGA 1X1TA 5DX0A 3R0ZA 5JS7A 1IXSB 2BIFA 4DNPA 5A1JA 3NYIA 2XAUA 4CW7A 4WECA 3JD3A 1XRJA 3W1VA 1PEKE 1UEIA 2CVHA 4P4UA 2AFRA 4RZQA 1YL5A 4ETMA 3KAJA 2DCUA 3OLWA 3WA6A 1JX6A 1SXJA 3M7IA 4WWHA 4OJTA 3D6TB 4OHXA 1YZQA 2E2WA 2OCIA 3SS9X 4W5OA 4GEGA 1JYFA 1XKTA 4ZOCA 4BEBA 2Y1GA 4FMDB 5K45A 4IUBS 3T5PA 5DM1A 4DCUA 1YRAA 4JP8A 5EN4A 1TU4A 3WNDA 4F4CA 4XYMA 1MOPA 2CMHA 3GUVA 3VDQA 1SCNE 3HR4A 2R97A 1QH8A 4M6WB 1ULBA 3QEOA 1BMFD 1TVCA 4GHWA 1UJMA 2IQ5A 2ZB2A 3EAGA 4FQ8A 1XZKA 4QECA 4KXUA 4MMZB 3ITKA 1N7JA 2P5SA 1FA9A 3SIWA 3A3OA 3JRNA 4FXOA 2DRIA 3RJ5A 3TKAA 5ILQA 2F7SA 1ZVVA 1HE5A 4O8ZA 2PKCA 3NTLA 1JEEA 1J0XO 2OD9A 1J22A 3EYWA 1TK3A 1Z7BA 3LGAA 4O2AF 3OEWA 1V9LA 1B15A 4XUEA 5EWLB 5A4IS 3EPKA 3S2FA 2RJOA 1FBNA 3F2IA 4CKWB 4CMGA 3RTBA 1KJIA 3E4CA 5LBUA 5B55A 4HB3A 4HGRA 2X3YA 4RD2A 5BV0A 2CWDA 3UH1A 1VGQA 2IYTA 1DCFA 1ZD2P 1H0SA 2IEIA 3K2QA 3KT6A 4TZTA 4DQVA 4YT4A 5JJBA 3RRBA 1JA9A 3H87A 3DQQA 3GRRA 2ORIA 3GD7A 1BYUA 3TVDA 2BELA 3ADPA 3TOSA 3U4DA 4DLRA 4DDUA 4UXJA 5GVSA 3PE4A 1E7MA 1ZM7A 4AP9A 2IF2A 4JL8A 3IC5A 4Y18A 1MDFA 2WSIA 2IZ1A 3VISA 4L4YA 3P0FA 2W2VA 4QOEA 4G09A 1K8YB 3Q8LA 1P6QA 2WK1A 3C3CA 1CBUA 4KGXA 1TJYA 2BFBA 1P2VA 2NTEA 3ADOA 1RT9A 3DBLB 3OU2A 4GT1A 4HXEB 1JAIA 2IPMA 2WT9A 1W9MA 2DB3A 3VPCA 3BICA 1XAIA 4HATA 4BLTA 4WJLA 5AOBA 2D5IA 1QGZA 3ZE1B 1SC1A 3JZDA 3PGMA 1YI1A 3R6LA 1E1LA 3PRYA 5EJ6A 1USGA 4GBGA 3TD9A 5HVNA 1WQ4A 2IPAB 3L7JA 3EXFA 3TLYA 2OAP1 3NP9A 4XIGS 3TM5A 2ZR8A 2OUIA 4FGLA 3PQ4A 1AB5A 1U8AA 4JT9A 4AYXA 1H2WA 1OC4A 2ZSBA 2R79A 4L3VA 4NDZA 2Q6TA 2YJ4A 2I91A 1WUTA 1ZM4A 3GXBA 1D8TA 3IAXA 4I5DA 2FR8C 5IX8A 1F0YA 2O0MA 3ZZ1A 5DOVA 5IWAB 3IO5A 1ZOIA 2XUZA 3LOQA 2V54A 5LMZA 4G85A 2AUNA 2B98A 2PAAA 2JIZA 4KDEA 5LZ4A 1NBME 5DPMA 2FPOA 2ZJ8A 3JYOA 5FXMA 4OHMA 2YXDA 1R8YA 3K6JA 1U9IC 1WL8A 4PTYA 4DCTA 1RAGA 1PLKA 3KR0A 4OLHA 1SC4A 4LPSA 2Q2VA 3ZOKA 1NMXA 1K6XA 3M3HA 1ZD5A 2HJVA 3MC1A 1GGMA 2XSZA 4KWIA 3W1EA 1AUPA 3UGJA 4RHXA 3H97A 2QW1A 4ID3A 4WK6A 2AJDA 1II9A 1IHUA 2Z9CA 4FFPA 4OLJA 4BO9A 1KY2A 4CI0B 4CU2A 3FRJA 3AHDA 3B13B 3U3OA 1D2GA 1IQRA 2CCJA 2P9FA 5TGZA 3OJXA 3H5VA 3I5UA 4IR7A 2GN0A 1COWA 1QBKC 3QRWA 2QQEA 3FMGA 5K0CA 4J91A 4UDOA 1FUEA 3RS9A 5JNRA 4N8EA 5AXAA 3FPGA 1F0NA 2Q29A 3W7BA 5I6DA 2W5UA 1Y7PA 2ZIVB 1TO1E 2PX0A 1FY2A 3H3JA 4DJEC 4Y0NA 1IBMB 1PD1A 4E94A 3BWYA 3FYUA 5C1OA 1L4UA 3D54D 3KEOA 4PCLA 4GL2A 4FDVA 2H1WA 4XQ0A 3WWCA 4BN5A 1J9GA 3ZVRA 5LLTA 4IX9A 4Z0NA 1U4OA 4IOKA 3VVBA 1PS9A 4DDKA 1W44A 2X77A 5A4MS 3SPXA 2A9OA 4F4JA 4WMLA 2AJLI 3E5NA 3ADBA 4YI3A 2EFGA 4YP7A 2O4CA 4QLAA 4C7OB 2JGNA 1GUFA 4MWOA 1U8UA 1J24A 1DMSA 2NQ8A 3NTXA 4H18A 4C6HA 1TMGE 1UBEA 4IMJB 2JW5A 5LA6F 4BGIA 5TMEA 1XYGA 3P32A 2O5RA 3L7IA 2IWHA 5TC4A 5LQAA 1J97A 1JKJA 1K8XB 2YWGA 3L8EA 3WWPA 4Z8YA 3PR1A 4IL5A 4H15A 1VCHA 2XV1A 2ZE5A 4WXMA 2GD1O 4KN9S 3AEUB 3C74A 4PQYA 3K1AB 4XFJA 5DBIA 5L3SB 2O8CA 1Y1RA 1QUFA 1W4AA 3M6WA 4HJRA 4D79A 1QOPB 3ONEA 3CNNA 1AGXA 3QVLA 3I4LA 5CB4F 3O8BA 2EFHB 2VH5R 3Q0TA 4RD3A 2J5KA 2CXPA 3ACCA 1XRSB 4FMDF 2X40A 1CUGA 1S96A 1KJYA 4EJSC 2NM0A 2P9TA 1L4EA 3ONFA 5PGMA 2C61A 1I9GA 2BW0A 3JARB 4TX1A 1SG0A 3HGTA 5F3WB 4J9VA 2B1QA 1M6VA 8MHTA 3ISVA 5B37A 1A9YA 3V4OA 5IT5A 1Y4UA 1PTKA 3FVVA 2VXYA 3NYWA 3CNEA 3WVNA 4B2LA 2ZUUA 3GVXA 1BA2A 3QTTA 4DR7B 3PGKA 1W7AA 3HM2A 2FWNA 1B73A 4YCNA 1QQ7A 2EJVA 2PEYA 5AW6A 1XZPA 3INGA 5FYDA 4ZYXA 3TM4A 3UKJA 3UHPA 5DN9A 1PSWA 1THGA 1JJIA 4OM7A 5T3UA 4F1JA 2JFNA 3OCYA 2XRZA 4ZCRA 4GVXA 5EUCA 4XOUA 3OY2A 3G82C 2NU6A 3GFFA 5J4HA 2GERA 3AIKA 5M2QA 2IYWA 4JY7A 1XC7A 1P39A 4WZAB 4YAUA 4B76A 2CXXA 1JAYA 2UVDA 1JDPA 4FE3A 1R9NA 2FZEA 2H0RA 3JPYA 4YEDA 3BREA 1M72A 3V1NA 2OFWA 1T6YA 3NU1A 5KEIA 1YNOA 3HMKA 1SC3A 1T5LA 2F1HA 4NZMA 1CZRA 1L0BA 3H05A 4NQZA 3IPAA 3STVA 2YJZA 3QMMA 3IQHX 4YX9A 4AKHA 3HWSA 3E03A 2GVZC 1JBQA 2HBQA 3ROGA 1RXSA 3TKYA 2ES4A 1I4TD 1AZLA 1K27A 3R1IA 4PPFA 1JVNA 3N05A 1OX4B 5AMXA 1PZFA 1UKVY 1CQIB 4X95A 5CH5A 5EFOA 1PD0A 4HAZA 4H4CA 4HWKA 5AW5A 3FOZA 4HR7A 2QL7A 5DM0A 4HMQA 3CWZA 4Y9RA 4MS4A 3SEQA 3SBEA 4PO1A 1XX6A 3KOZA 4MHSA 2P0EA 3QX9A 4TVSA 3TLMA 3FOCA 2NUPB 1EX6A 3HKDA 3RHTA 1E3LA 2X7JA 1QG0A 2R60A 1Q7EA 1LC3A 2ZIWB 1LBHA 3IT0A 1EM8B 4AJEA 2KLBA 1QIHA 2OY0A 2X6QA 1S8FA 3HS3A 1EGMB 5DTRA 3BB1A 5AKJA 4R1SA 5K3FA 1AA9A 2CL7X 1Z0ZA 2ZIAA 3CEPB 1Z4OA 3KAPA 2Q6VA 4IH9A 5B3JC 3K9GA 5JROA 2VQ3A 4AJHA 4CETA 3W5CA 2IOHA 4M1YA 2I80A 1VG1A 4Y2QA 3W5BA 4Z4CA 1BCSA 4DM3A 1PX0A 2GK4A 3USZA 4X62B 3F6CA 3K8QA 2H92A 4HGOA 5TJHA 1ZL2A 2V7GA 4K86A 3WSWA 4J7UA 2X4LA 4I4TA 4MQ4A 2BEWA 5TF0A 4ZDKA 3G0IA 5E2IA 1B3RA 4N6NA 2P4UA 2P8JA 1TO2E 4K5QA 1NW8A 3EGOA 3PFBA 2XXAB 4M9RA 4DLKA 4FQ5A 4WN9B 3HN2A 4M8LA 4YS6A 3ISTA 5CCXA 1Z4IA 4XVQA 4BPRA 1QK4A 4D46A 3ZZTA 4J07A 2NGRA 1DHTA 1A96A 1UIRA 5E8RA 4WY8A 2VN8A 4PO3X 1JPUA 2XB2A 3UWKA 3WFJA 2VRCD 3TSAA 3EIOA 5AKZA 1XEWY 1OFHA 5IVDA 4ZYYA 4LIPD 4DUGD 4HSGA 4QUGA 1WUIS 3DKPA 4WOKA 3ORQA 2RHCA 3AP3A 2I65A 4KQCA 4NC9A 3TRKA 2I1QA 2ZIXA 4RKFA 5EINA 5CUQA 1VMAA 3G68A 4NG5A 5HFNA 4HQ6A 1RRPA 1T2CA 4UD6A 1KMQA 3JYLA 3QVGA 5FI1B 3D7RA 3AL3A 2X0FA 3S1AA 3KLPX 4DT1B 1R6DA 2HA0A 4H1TA 3BBLA 4FFBB 5GJVC 1TK9A 2ROQA 1UH5A 2HLDA 4NI5A 1W5AA 3ILVA 3O84A 1DTWA 4UCFA 1SCKA 3KYDB 4HDNA 1EXMA 1LLCA 2DSTA 1BS1A 3NKFA 4MNTA 3UHOA 2FLWA 1SWWA 1NNEA 2VUHB 3GLIB 3CTPA 3EF0A 3L02A 3V2UA 3OOJA 4TMYA 2YVQA 4NZNA 3VV3A 4DNFA 1OLSB 2NUAA 1KZHA 5IJZA 2GZDA 2IEBA 3DMGA 4HEA1 3LNTA 4MZXA 1C80A 3WO1A 2BFDA 4BMNA 4EL5A 1JSXA 2PBRA 4JITA 4O59O 3ZI0A 1CJKC 3PFGA 3RI3A 2BKEA 4YP5A 2V6FA 5CYGA 1MEJA 3QI2A 1UDXA 5IKEA 5HGJA 1WWKA 4KZPA 4L8WB 4TQUS 1FJGB 1DAMA 1ZJ5A 1E79A 1OTHA 3DFMA 5KYUB 2PZLA 1YK1A 3MT8A 1LBSA 1QYWA 2XTJA 4HQFA 4C4OA 1HDGO 2Z8XA 2MINA 3VTAA 5DTQA 3T52A 4BC1A 3BIJA 1HDRA 1LZKA 2HA5A 5T6BA 5BN4A 3NZEA 2GRJA 1XZBA 4HXFB 4JBYA 1L5VA 2PSSA 4X84A 1QO0A 2WTBA 1N0WA 1ZA2A 3VKVA 5C9ZA 4BZXA 1B2LA 1POWA 1YQGA 2X8AA 1WMSA 2X8JB 3U3KA 4NJMB 3HN6A 1WLSA 2BMVA 4BLWA 3DC2A 1UPUA 2B92A 3UXYA 3ZW8A 2AOUB 4QC2A 4Z53A 3RS8A 1V4VA 5EIOA 4YJFB 4ECEA 1HYHA 1W59A 1Z6ZA 2WAOA 4CWAA 4JDUA 1N92A 2BM0A 5FHQA 1PJTA 4UUAA 1I4OA 3KZVA 4JD5A 4MYRA 2PCJA 4LE0A 4YJGB 5IM4A 1KMIY 2WP8J 1PR2A 2BV3A 4N7MA 2PIDA 4LRSB 1JF8A 1RZRA 2X86A 1N9GA 4WINA 4BZZA 4ZCTA 1NX6A 1R6XA 3GXOA 1OE0A 1ZH4A 2O20A 3AERA 3HXTA 5G02A 1N57A 4ENTA 5FTMA 3ABOB 4W5JA 3GRYA 3UWOA 5KBYA 5I3ZA 3BWBA 3I30X 5I9NA 4PR3A 1P7YA 4P0QB 1EFPA 2WD9A 4HG2A 3WYGA 3VA7A 3E9QA 3QVWA 4HEA6 4PYKA 2A9KA 5EESA 1D8AA 3FPSA 3I0NA 3HDVA 4GXNA 3TGWA 2HDWA 3A05A 2EW1A 3B7GA 2GXAA 4XWKA 3KPVA 4PPQA 3ZLVA 3WBBA 4IGEA 1UDRA 2GVNA 5ALSA 4ZO7A 5F2NA 3NPAA 2JD0A 4YCCA 4RUKA 1R6VA 4GOOD 2R3SA 1XMOB 5BUQA 1S2DA 4LJYA 2X2OA 1XDDA 1XEXA 4QJ4A 4ZT2A 4BJ1A 2EJTA 1H2EA 5K0ZA 3D8TA 3MPOA 3P2MA 4OKSA 1AIPA 5SZKB 2RGWA 3O75A 3FNQA 3E3NA 4Q9NA 1SBIA 3V8RA 1IBLB 3IHTA 1LLQA 1RYEA 2IL1A 2YJNA 3B51X 3G2QA 5EIBC 3NAMA 5IC6A 4AB1A 3WIBA 4MQ5A 4AJLA 3LQ2A 1SHUX 1XI2A 2PGJA 2ZPAA 2NU8A 3DXYA 4KKXB 5CU7A 5LYJA 3RS3A 3IMGA 2PO5A 4GAEA 4HDSB 4WLUA 1H1LB 5KYTA 2W6ZA 4PIVA 4UM9D 2IXTA 3PXDA 3QE9Y 4CVNA 2QJOA 1E1NA 1UWLA 2PKRA 2ZJ3A 2XB4A 4Q9IA 5CA0A 4BVJA 3KJFA 2H85A 4EG8A 1L4MA 3GCXA 2D1QA 5BXYA 2HRQA 1S3FA 4KR0A 3GARA 1T4CA 2XF2A 5U9CA 5CTAA 4X8OA 2J4FA 1VCMA 3UUWA 1EE2A 3DUWA 1VJ1A 2X8WA 1NG1A 3V2HA 4EFNA 1TAQA 2YWRA 1V4NA 2ZUCA 4PBTA 4DR3B 5BORA 5BPFA 3SBDA 4QUAA 4ME6A 3SHVA 2HV9A 3H2YA 3GOQA 1XVVA 4H4DA 3H4MA 4MMXB 1KZ6A 4WFQA 1NQWA 5GZ1A 1NQOA 3U26A 3YASA 1LNSA 3K1AA 3M33A 4Y2TA 3TZLA 5FDFA 4QOSA 2GPAA 3QU2A 4G0OA 5AYVA 3HWRA 5D7NA 4BFUA 4UE3S 1OFVA 4RADA 5K51A 4FKBA 2IYPA 4WY5A 1W47A 3KQNA 1P2GA 4GMFA 4US2R 1P60A 3MT0A 4G86A 1G21A 1L1QA 1LPAB 1L7XA 5GTDA 2FPKA 4WNAB 3NH6A 1DRWA 2P6MA 1KGSA 1UKYA 1DG1G 3LPMA 4B0OA 1LC0A 1I6WA 2XYHA 1P1IA 3DL2A 1RHQA 3BSWA 3OF3A 4RVFA 1I30A 4HRAA 4PRKA 2G40A 1DIGA 3CUWA 3ETGA 2WY2D 5AO9A 1QFMA 4QLOA 3UW1A 2H31A 5GGYA 4OEHA 3R7SA 5FJIA 1BKDR 1GZDA 2X9NA 1FSZA 1PO7A 1NATA 3HFJA 5GV7A 3ZD7A 4LJ6A 2JFXA 2IS6A 1SHKA 4GLOA 3IEUA 3AB3A 3TDNA 3ZLJA 2VUTA 1CDZA 3TI7A 2JCXA 3BJZA 4BMCA 1D09A 5H68A 3EQZA 1EZ1A 4WV3A 1CQZA 1K98A 2EP7A 5FWXA 1DBSA 4C5CA 4A2WA 2PWBA 3DEHA 3IJRA 2HTFA 3C6KA 1WZUA 2ZYDA 3F71A 3N86A 5DSXA 4NZ9A 5TVGA 4CM5A 3PTZA 1CTQA 1NTRA 5KKNB 4U39A 3VAZA 4YRSA 5MFZA 3NRJA 2D0IA 4R69A 3G23A 4X54A 5LQSA 2GN2A 1ZN8A 4D9KA 5L45A 3QEAZ 2HB6A 4E1VA 3QWAA 2UYGA 3AJ8A 3QFRA 5FF9A 3PI6A 5THKA 1YA6A 2AEMA 2JKZA 1R4ZA 3FBWA 2DBRA 4HFNA 3RD5A 3IAM6 1GM5A 2QVYX 4PX5A 1Y5MA 2CE7A 1OGJA 3I58A 4LGCA 1DDIA 1Z0UA 5A7FA 1KQGA 2IH2A 4HKTA 1UJ2A 2YMQA 4L3WA 4PX2A 3QX7A 3GLHB 3QV2A 5FOSA 1JFTA 1K5PA 1QLWA 2AI1A 4M7PA 2GEUA 3V7WA 1D4OA 3AKDA 5EGSA 1WNTA 2AZDA 2ID4A 5A5GA 2JLZA 1KE1A 2J9XB 1Z34A 1WKBA 2QT9A 4KQ2A 4B32A 4U9HS 4WOBA 1SKYE 5SZJA 3EXAA 1GGVA 1CETA 2R6JA 4TQGA 4GLFA 2ZE6A 4NABA 3UO8B 4NZYA 4UJ3A 5E7JA 5B3AA 1TAGA 1B8VA 4RGYA 4RVGA 3L6CA 1H6DA 1HEUA 1WX1A 3KLBA 4K0RA 1UL1X 4C3UA 1X42A 3PHGA 4XD2A 1MB3A 3F1LA 5AJTA 4CBVA 2GM4A 2JG3A 1B8UA 3ZGNA 4EKYA 1A04A 2P2DA 3HEMA 2GI4A 5ECGC 1E7SA 1Z4PX 3Q6NA 3AUKA 4W9NC 4D99A 2Z2YA 4AYWA 1X80A 5FOTA 1Q16A 2ZTMA 4Q4DA 4BJ3A 4PSVA 5JNVA 2BFCA 3B9BA 3MJEA 2P4EA 2DFPA 2ZUBA 4F04A 4RFVA 2PH1A 3PR2B 5C1BA 3VNVA 1EX9A 1BCSB 1OCEA 2ZTVA 3VC3A 3NJ4A 2IYRA 4Y9SA 3RG2A 3UFBA 1AF7A 1E3WB 1RYNA 2ODBA 2QE6A 1GPNA 5D86A 3ZE9A 5KZMB 1Y1SA 1L3BA 1FTGA 1NZFA 4DRXB 1JEOA 2C0PA 1M1UA 3B3JA 5WRFA 2DFLA 4Q4JB 5KVAA 1MABB 4F91B 4NCNA 3SR4A 1ESDA 2VDJA 4QGGA 4HTFB 3FD8A 3Q5GA 1ORTA 4I50B 4G0MA 1VL1A 2NVUB 2FPGB 1N2CE 1M7BA 3H2IA 2HD4A 2VSXA 1Y3IA 4YP9A 2FP3A 4HNRA 2NZYA 4DPLA 2CKMA 4DB2A 1P0QA 5BNWA 1R0ZA 2VSQA 3AIMA 4QVKA 5HNKA 1KEPA 4HDQB 5COAA 2ANCA 1ATIA 5BSWA 1DAFA 1Z8HA 4M99A 3HNPA 3K0HA 4L28A 1Y4AE 2XGSA 2VRCA 1KZYC 1MQ9A 1PJCA 5JPIA 4GPAA 1WULS 2YASA 5LBTA 1SG9A 3RIEA 3TLXA 5AVYA 3N8NA 5CRIA 1D6NA 4A8JC 2C3OA 3GK3A 3ZU4A 3H9CA 3J7AC 1L4NA 4FHGA 1EVIA 1UEXC 4U7FA 1Z6TA 1VE9A 4J16A 4TRMA 1QRRA 3QLVC 4ND8B 2P0AA 2WPDA 4E7OA 4X60A 1CD5A 4OHBA 3C4QA 2G76A 2GZMA 5J2TF 4J0EA 4JEHA 2PZFA 1C8BA 3QXHA 4G0NA 5DZSA 3MA0A 5A3SA 5H5JA 2ZPUA 3V48A 3DFZA 4B73A 4EFMA 1F1JA 4C0WA 1AJEA 4E6EA 1E4YA 2IY7A 4ZI7A 4KPUB 1JIKA 1KARA 3X1KA 2IZZA 2ZPTX 1JR3A 3G0BA 4KWTA 4D2IA 5JH7A 2E4UA 1ORRA 4L5CA 4RKEA 3UOWA 4EKDA 1Y34E 3PCXA 1P7PA 3CZQA 5ERXA 3R09A 3LNCA 4QZVA 2YINC 4YXWA 5FI3A 1U94A 3AY6A 2V0GA 4KGDA 3VOBA 5FPSA 1PN3A 2QNRA 2Q3CA 4CMJA 5LQDA 1FDUA 2J09A 3GRUA 2QMQA 3KSZO 4RKYA 3KSRA 4R31A 4CMEC 3B2EA 1Y6RA 3LX4A 4WLOA 4C2TA 2E49A 2ZRGA 1W4CA 3W90A 3WMFA 1HX7A 5CXXA 2IGTA 3PXBA 4GU5A 4C03A 4Q4CA 3CH4B 4JOSA 5DYYA 3X1MA 4RTSA 4OQQA 1YJ5A 2QQGA 1EUCB 2AOUA 4RU1A 4P4TA 1YZNA 3PZRA 3EY9A 4IIEA 4U9UA 5KTSA 3C5WP 4MVCA 4WH0A 5C8DA 3JWHA 1T1GA 4ZI2A 4O1HA 2O1SA 5I9TA 4B7UA 4B3HA 1Q44A 4PSKA 1C3LA 2P6PA 4F92B 3S99A 1XNGA 2VYQA 1T2VA 3FZGA 1Q3KA 1L4BA 4XQ9A 3ADDA 3JSAA 1HG1A 1TTQB 1YRBA 3IUSA 2VZEA 3FYCA 4YMLA 4QKQA 1Z4JA 1DMRA 3U5ZB 2LUOA 4PF1A 1OX6A 2VZ0A 4LV6A 1NVVQ 3KBBA 1PBNA 2FPRA 3LQ1A 1I3KA 3TOCA 4OP1A 3EH1A 1CY6A 2AN9A 1BZYA 4RPGA 3U5TA 4ISCA 2WPDD 2DH5A 4NYJR 5DWDA 4P3YA 2I62A 3COZA 3I5XA 4BEVA 2IZ6A 1N1DA 4R1LA 3W3AD 4LDJA 1DOHA 2H5JA 2WFLB 3OIDA 1WEKA 3AHJA 2IKQA 3OTQA 3OX4A 4OXXA 4MKIA 5DWVA 2YZNA 2A35A 1QF9A 1SUIA 2GFQA 2FUEA 3EGCA 2BFOA 2FXVA 2Y0CA 3FHCB 1XZNA 3QJ5A 2H2AA 4FNAA 4K05A 1U7OA 4LZOA 3THWB 1JYEA 1KFBB 3EXFB 4P4SB 3EOZA 5DKFA 2DLNA 4UCXA 4LYHA 1H2BA 4MVXA 4DN6A 5DMXA 3NMUF 1CSEE 2CK3D 2X22A 2H1IA 3GCDA 3KD2A 4PM4A 2Y93A 4KIUA 1ZOOA 1LQTA 2WJ6A 3LC1O 1DRUA 2PWYA 1EU1A 4YLYA 1VYVA 3OA2A 3DMPA 3E53A 4GBED 4IGAA 4JGGA 4X94A 3SP1A 2AR9A 3GGJA 4G81A 2ESRA 4NAVA 2GHRA 1GZUA 1W2GA 2PFSA 5BWOA 3L40A 1K2WA 3A6ZA 3KHUA 3PE6A 1JHOA 1XV5A 4U2BA 4JB3A 4XCXA 3SU8A 5IZCA 3V8NA 4ENPA 5KNCH 2PS0A 4DKXA 1XZGA 4IJUA 5K3DA 4NBVA 3HQ4O 2IXGA 4C6TB