3L01A

Crystal structure of monomeric glycogen synthase from pyrococcus abyssi
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
428
structure length
428
Chain Sequence
RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFTPSHGRFQGEEIGKIRVFGEEVQVKVSYEERGNLRIYRIGGGLLDSEDVYGPGWDGLIRKAVTFGRASVLLLNDLLREEPLPDVVHFHDWHTVFAGALIKKYFKIPAVFTIHRLNKSKLPAFYFHEAGLSELAPYPDIDPEHTGGYIADIVTTVSRGYLIDEWGFFRNFEGKITYVFNGIDCSFWNESYLTGSRDERKKSLLSKFGMDEGVTFMFIGRFDRGQKGVDVLLKAIEILSSKKEFQEMRFIIIGKGDPELEGWARSLEEKHGNVKVITEMLSREFVRELYGSVDFVIIPSYFEPFGLVALEAMCLGAIPIASAVGGLRDIITNETGILVKAGDPGELANAILKALELSRSDLSKFRENCKKRAMSFSWEKSAERYVKAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GlgA glycogen synthase
publication title Processivity and Subcellular Localization of Glycogen Synthase Depend on a Non-catalytic High Affinity Glycogen-binding Site.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Transferase
total genus 155
structure length 428
sequence length 428
chains with identical sequence B
ec nomenclature ec 2.4.1.21: Starch synthase.
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00534 Glycos_transf_1 Glycosyl transferases group 1
A PF08323 Glyco_transf_5 Starch synthase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3l01A02
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 3l01A01
1EM6A 2QN3A 2JJMA 3NAZA 1XKXA 2QLMA 4MI3A 1JIUA 1GG8A 4KQ1A 2GM9A 3S28A 3PE3A 1JG6A 1Z8DA 1BX3A 3DZCA 4YUAA 2GEJA 1IXYA 2R66A 3NP9A 2R4UA 1Y6GA 3SYRA 4BQIA 3BEOA 4GYWA 2IEIA 2FETA 3OKAA 3RHZA 2H1FA 1P2BA 2BFWA 3MS7A 3QHPA 4RIFA 1L6IA 1RRVA 3L7CA 2O6LA 1PSWA 4X6LA 3O3CA 1XC7A 3MRVA 2QRQA 2H1HA 2FFRA 1SXQA 4RIEA 1PN3A 3MT7A 1NLMA 1AXRA 2JLBA 4LEIA 4RBNA 2AV6A 3ZCQA 1C8KA 1A8IA 3CUYA 2PQ6A 3MTBA 3IA7A 2AZDA 1K08A 3CUWA 3MSCA 3CEHA 4N9WA 3T3EA 1YGPA 2HY7A 3BCUA 3C4QA 4N3AA 3WC4A 5HXAA 3G2IA 4XIFA 3VDMA 1PNVA 3CEMA 2X0FA 3HBFA 1NZDA 3GUHA 3ZCUA 3DD1A 4BQEA 3E3LA 2ACWA 2X0EA 2F3SA 3ZCTA 2ACVA 4KQMA 3VUFA 5I45A 3CEJA 1FA9A 1L5WA 3HBJA 2XGOA 3NC4A 4AY5A 1HLFA 2SKEA 1WV1A 4X7RA 2BISA 2AMVA 4YI3A 2R68A 4EKYA 5BNWA 3E3NA 3D0RA 4WHMA 4BFCA 4NC9A 1UZUA 1IIRA 1B4DA 2PYDA 3L7BA 4GZ6A 3OTIA 1Y8ZA 3MS4A 2XCUA 1WV0A 1YA6A 3Q3HA 3T3HA 1NVKA 3MT8A 3BD7A 4CTNA 2IW1A 4GZ5A 2BGTA 1P2DA 3QKWA 3DDWA 2VSNA 4MHOA 1FTQA 1WW2A 1SXPA 1ABBA 2XA9A 4YI5A 8GPBA 1M5RA 5JTTA 1NZFA 2GPBA 3OTGA 4AMBA 3C4VA 1V4VA 3BCSA 1FU7A 2GEKA 2XGMA 2F9FA 3WAGA 1K06A 1GZ5A 1WUTA 5DU2A 3H4IA 2XGSA 4PQGA 5D00A 3COPA 4MRAA 2IEGA 5JTUA 3CUTA 3NB0A 4MICA 2QN9A 3MRTA 1JIVA 1VGVA 5TMEA 2IV3A 1H5UA 2QNBA 3OKCA 1FS4A 2ECPA 4RIHA 4NEQA 2QRGA 1GFZA 3WADA 2VCEA 9GPBA 4FKZA 1L7XA 2C1ZA 1GPYA 4F9FA 4WADA 4X7MA 3UYLA 2VG8A 2X6RA 2AW3A 2C9ZA 4WACA 3TSAA 1J39A 5IKOA 3OY2A 3RSCA 2VSYA 1E1YA 3T3GA 4M7PA 4RIIA 2IUYA 4LDPA 2R60A 1L5RA 1WUYA 4N39A 4EL0A 3ZCVA 3MTAA 3G2HA 6GPBA 2KS6A 2F3QA 1F6DA 2BGUA 1NOJA 4KQ2A 4XI9A 3OTHA 5GPBA 1Y6FA 1KTIA 3BDAA 5TMDA 2IV7A 2QN2A 3FROA 1FC0A 7GPBA 2QN1A 3TAXA 4L22A 2YJNA 4CTMA 4EL5A 1P4JA 4F96A 2F3UA 2C4MA 2ZB2A 1L5QA 3S0JA 2XA2A 3RT1A 2QN7A 1LWNA 4CDRA 3UYKA 4Z5XA 4F97A 3EBOA 1L5VA 3CUVA 3MTDA 4RELA 2GPNA 1XV5A 3CV3A 3AMVA 2SKCA 2XA1A 4W6QA 4MHSA 1LWOA 3VUEA 3RSZA 3C48A 2GT1A 3T5TA 3H4TA 1NOKA 3EBPA 3S2UA 4N3BA 1P29A 2Q6VA 1EXVA 3CX4A 2XCIA 1RZVA 4G2TA 1FTWA 3MRXA 2G9RA 3G2NA 3ZCPA 3E3OA 3T3DA 1Z6PA 2X0DA 4RIGA 1O6CA 1XOIA 3G2KA 1P4GA 2FF5A 4RENA 1FU8A 1Z6QA 4FZRA 2PRJA 2GPAA 2QLNA 2ATIA 2QLLA 4AY6A 5DLDA 4REMA 4MI6A 1Z62A 2PYIA 3NCHA 3BD6A 1UQTA 4GZ3A 3S27A 4EJ2A 3T3IA 2G9UA 5DXFA 4HLNA 1GPAA 3MQFA 5TMBA 2JZCA 3IAAA 1AHPA 5TVGA 5C1DA 2QN8A 1C3JA 1XL0A 4M60A 3D0QA 3ZCRA 2F3PA 2R4TA 4EKEA 2X6QA 4GPBA 2IYAA 3L79A 5ENZA 3MS2A 2QRHA 2ASVA 3Q3IA 3T7DA 1P2GA 1JEJA 4GYYA 1L5SA 3L7DA 4QLBA 1QKJA 3Q3EA 1PYGA 2QRPA 3ZCSA 3G2JA 2SKDA 2OFFA 2PRIA 3HBMA 1E4OA 4MI9A 3CUUA 1QM5A 2IYFA 2QRMA 3PE4A 4M83A 3OY7A 1UQUA 3OT5A 3MT9A 2G9VA 1JG7A 1JIXA 2QZSA 4HWGA 3MBOA 2GJ4A 1FTYA 3BCRA 3VDNB 1C50A 4N3CA 3L01A 1P4HA 1GGNA 1GPBA 3BD8A 2XMPA 4X7PA 3NP7A 5IKPA 1FU4A 3NPAA 3SYMA 3GPBA 2G9QA 1WW3A 3TOVA 4CTOA 3OKPA 1RZUA 3S29A 3HBNA 5LQDA 3D1JA 1F0KA 4AN4A 5D01A 1C8LA 1XL1A 3DDSA 2WTXA 2VCHA 4AMGA 4BQFA 4NESA 1NOIA 2P6PA 3L7AA 2C1XA 3G2LA
chains in the Genus database with same CATH superfamily
3F6EX 2QTRA 4IFEA 4M54A 1V6CA 5KTKA 8OHMA 2X0JA 3NUZA 4GYKA 3ZLUA 2HU8A 4AJJA 4ETWA 2XBMA 1JLSA 1DEHA 5IP5A 3GAMA 4B4KA 2X9QA 2XCLA 3DOOA 2XYPA 3JD4A 3R6DA 4NYMR 4DLSA 1M6WA 4JI3B 1Q22A 3UGTA 2MWMA 3R4VA 3J80A 1X39A 2JGIA 3P2YA 2W37A 4B6PA 1AUOA 2EWWA 3TRJA 4MVXA 3EHEA 1P33A 5IABA 1YAJA 4XFJA 3HZOA 1Z6ZA 3N0RA 4ARZB 4FJ1A 1NN0A 3IP3A 3M6XA 3ZS9A 5K20A 3H11A 2FP4B 3HDVA 1E79A 3GYBA 2O2CA 4C2AA 3KQTA 3BRSA 1R0KA 5CYPA 2BZ0A 2OORA 2QX8A 3WFIA 2GHTA 4JYCA 2IH2A 4BOYA 4HH3C 1G9XA 1GZUA 1NBIA 1VMIA 1P0IA 4RPLA 2B6NA 3IC5A 5K0NA 3L7KA 3NLLA 4MPPA 4Q7EA 2FQYA 1HUQA 4DOMA 3V7WA 3AUXA 5BQXA 2ZWMA 1W0KD 2BGLA 1EK1A 2L18A 2W4IA 3ZWQA 3DC2A 4EMSA 1OH8A 5IM4F 3WI7A 5ISMA 1KKLA 3URMA 5BQFA 4R1NA 3CS3A 1X0XA 4BO9A 3S99A 1N3YA 3Q11A 1N8KA 5BN3B 1O6ZA 3TLBA 4ZN6A 3VO2A 2CE2X 2NZVG 3NTRA 3R3VA 1T24A 2AYYA 1S2GA 2GEDA 1P0MA 2EKPA 4I4LA 2EFGA 2RAPA 2QSUA 3CISA 1KHTA 4OHYA 1MX3A 4IIJB 4OQXA 2DECA 4BTVA 1AXRA 3VU3A 4Q05A 1FMJA 5AHOA 5EWMA 4C88A 1A82A 1PYOA 3ZW9A 5L3QA 4MVWA 3EB9A 3FMFA 1HOTA 4N0MA 2VK1A 3WP0A 4Z7OB 3SNHA 1PX2A 4RYDA 2OQRA 2BZGA 3TLKA 1MTOA 3H5TA 3GK3A 1K6IA 1LPPA 1XLWA 5FA6A 2CL7X 3ZTYA 4A0QA 4EA9A 5PGMA 4WNYA 5YASA 1EWRA 3HQ4O 2GH1A 3T3EA 4PTZA 3ZWOA 2OHFA 1KEVA 2PT7A 3K1AB 4G8BA 4LJAA 4QTUB 1NF8A 2DPHA 4N7JA 4J29A 4PFJA 4RHYA 5ARDA 3OPYI 2JGDA 2Y71A 1QG6A 2GK6A 1YOVB 2HA3A 4G5QA 4HZGA 1W87A 3TJMA 2XMZA 1KMHB 2CFRA 5KYGA 1EM8B 1DKRA 4IIFA 3A28A 2FWBA 4LJ8A 4EO4A 3C8ZA 1TPYA 4YREA 4KFSA 2C9OA 4DG5A 1T5BA 1D5WA 4TN5A 3TTXA 4LYDA 3SBXA 1CSEE 2TYSB 5FNVF 1LH0A 1E89A 1Z6XA 1W94A 1JH9A 3EXG1 1GHTA 2WJGA 1CVLA 1M6VA 5LDGA 521PA 1DJLA 4FDAA 1M34E 3TZ6A 1QZZA 1EP9A 1JDSA 1H2AS 3KYCB 3NC4A 1NBOA 1OWNA 2NUTB 3DXFA 2A9FA 5CM2Z 4YVFA 3TQHA 2ZAGA 3KVNA 1FFXA 2D1QA 1N8TA 1Z2OX 4Q0MA 3ZK7A 2AMVA 2LP4Y 3SFZA 3VR3D 2EX4A 3D8SA 1EJ2A 3AC0A 4L27A 1KDPA 1Y3CE 3D6JA 1Q2XA 3DYBA 4REOA 4V0QA 5TE9A 4M9UA 2IYEA 1HURA 1V25A 2NVWA 5CDTA 3RTAA 4E5VA 4U7GA 4I3GA 4NK5A 5IFKA 3I8SA 1I5OA 2XQJA 2ZOSA 3O74A 4MW0A 1G20A 1KYXA 1SG6A 3EIFA 1NTOA 4C6TB 4G09A 1J2TA 5CVVA 1GARA 4O4LB 4WOBA 5EZYA 1ZH8A 2OM6A 4MOWA 2OILA 4PQEA 1L8OA 4Z99A 4I1VA 4OG2A 1YHZA 1ZVQA 2Q7OE 1IN6A 1PHPA 4JVLA 3NM6B 3O9MA 1FLVA 3EIWA 4G85A 3V80A 4R7TA 4IIXA 4JK3A 1DFIA 3F7TA 1XTRA 1L7MA 2E87A 2GZRA 3L1HA 2BUBA 2QVLA 1P2DA 3UH0A 4F5EA 2N46A 1GEEA 3N74A 3BGSA 3KHTA 4X6UA 1L4BA 1NXPA 1Y1TA 1LJUA 5G1PA 1G2PA 4P31A 3LBAA 2XADA 4BO3A 4KPYA 5BYKA 3PPXA 1Y34E 3QU9A 3AVWA 1A2OA 1V7CA 4C05A 5A9SA 1XLVA 2Y1GA 5H3HA 1T10A 4EG3A 3KV3O 2H29A 1K8QA 4IAOA 4N3NA 2QG6A 3CLTC 3KIPA 2A84A 1JHRA 2HJWA 4LXXA 8MHTA 5I4BA 2XB9A 3ORQA 4U1RA 3M1LA 2BRUA 4WH0A 4JV5B 3PX2A 1ZNQO 4P22A 4ND2A 2FGKA 3RBVA 2G28A 2C9CA 2B1QA 3OZGA 4DCGA 1UAAA 3JCZA 3RNOA 5BV0A 3VR5H 2EXXA 4Q00A 3HWRA 3P8ZA 4DB2A 2WLSA 3HO1A 4GNRA 2PKEA 4JFAA 1HTWA 2H2DA 1JR3D 2VA8A 3PNLA 2NSLA 2II6A 3N28A 2Z8YA 4OM7A 3GLGB 2W6JD 4WX2B 3CUTA 3K05A 3RVKA 2XITA 2ISCA 1WO8A 1KRXA 1RXVA 4MJ7A 3TGWA 2WFMA 3L2OB 3JQDA 1V41E 5FOTA 5TC4A 1F4VA 3LY9A 1RPZA 4II7A 1F8XA 1CULC 5EZYF 3I53A 3OKCA 2K5UA 1PLJA 2RHDA 2QL5A 5CH5A 1RHKA 2QUKA 3DHWC 1BU8A 4JROA 1G8PA 9GPBA 3NTXA 5EXTA 4LMBA 5FLEX 3CUSA 3KZXA 3TKLA 4AG3A 3G2PA 4C03A 2A3NA 4HS4A 4DUGD 4L28A 4M86A 2BT4A 2F90A 2XNCA 2HNBA 1UP6A 3BJRA 4FBGA 4OP2A 3T94A 3RAFC 3OJEA 4TLLB 1Y82A 1E4YA 1E7RA 5T41A 3TI9A 2NYAA 5CW2A 3E03A 5AXDA 1OFUA 5TQ0B 4EMTA 2Y1LA 1BS2A 2WG0A 3AONB 3AW9A 2G5GX 4O4HF 3U40A 4BHTA 2DLNA 3GLTA 2GSDA 3QKRB 4G5FA 2HPZA 2Q9UA 3LQ4A 1ES9A 4M9QA 3PX7A 4CQMA 2XYHA 1KY3A 1SXGA 3CZAA 3R77A 3A11A 4KZKA 2PLFA 2P3SA 4JKOA 3VNRA 4TMZA 3CLRC 1R6DA 4D8UA 1M1XB 3IQXA 2MR6A 1SBYA 2R8ZA 4FOLA 1WPQA 3GIWA 3ZGYA 1NOJA 2N3ZA 3VZBA 4R16A 1FMFA 4YJGA 2VR1A 4GS5A 2Z8XA 1AGRA 2D0PB 2D54A 2ZRCA 1PFQA 3LLSA 5I4KA 5FBLB 1VDZA 1YIAA 1AMUA 1U6IA 4IQ4A 1T1SA 3AVTA 3IEXA 3CKLA 5KCMA 1ZK1A 2CKDA 4ZQIA 5C5CA 1FIUA 2C29D 2FZEA 3GV0A 2ZUSA 1PT9A 4TM7A 2XD9A 3A70A 5CT8A 4RTJA 4EG1A 1CDOA 3D54D 4FFPA 4MUGA 3I2FA 3MMNA 4PTYA 2GPTA 2GERA 4LXYA 3L8HA 4II3A 5H9WA 2CB9A 3K09C 2HTEA 4UM5A 1NQOA 2RKWA 5AWFC 1IYZA 4LOIA 2RKOA 3B6KA 2UZIR 4XIIA 4AG5A 4DWOA 3X1KA 2Q5QA 5C5DA 3I8OA 3PFIA 1CRPA 1GSAA 4F96A 4HVAA 4ZVOA 5CD1A 2C4MA 4G1EB 2PRZA 1CK4A 1MC4A 1VRWA 1YB5A 1M2JA 2CD9A 2ZAYA 3BHNA 4Y1GA 2E1PA 1NXOA 3HH8A 4XDHA 2O6HA 3AT1A 4BN0A 4YNBA 1HETA 4XWKA 4QIHA 1CF2O 2ZZMA 3TRHA 2GZ1A 2RGXA 4I1SA 1RJGA 2P6UA 3IT3A 2DPYA 3QIVA 4JITA 1ZONA 4OU5A 2VRCD 3EIUA 5T4FA 3RUDA 3GCWA 3QVJA 5MGNA 4NDAA 5JSUA 3COVA 4WA8A 1EM8A 3I73A 4KFUA 3RS2A 3W9UA 3LWDA 1Q11A 2WRZA 1NNEA 4KR7A 1AV6A 1TYDE 5CHEA 2BUAA 2A35A 3UV6A 1W4LA 3KTDA 2I3DA 3QE9Y 4CT5A 3M2PA 2CUKA 1IBLB 4FPXA 5DWQA 3LHKA 4ECAA 4DT1A 2AYXA 4JT8A 3DEJA 1GTG1 1R0RE 3PUIA 4HDOB 4JODA 5TGZA 1X0VA 3PL1A 3BKXA 3JVIA 1VFNA 3B38A 3QWHA 3KYCA 4IHAA 1JR3E 1E9SA 2GVDC 1YR1A 3DDNA 3ZE6A 1OX4B 4KGZA 2GNPA 4KXLA 3SLKA 3ZDAA 1Z5ZA 1F9EA 1S8NA 1XKTA 2WW8A 5E3JA 3P2JA 1PUXA 2XOEA 3VGJA 2E55A 2HC9A 2JCSA 1DIGA 5EMJA 5IAKA 4JKYA 3IOCA 4H7PA 4YCBA 4BC0A 3UPTA 2QW0X 3WNBA 5KJFA 3GYGA 1ZPDA 2OHJA 3ZKWA 1NN3A 4DMMA 2RHCA 4ECEA 5JD3A 1QWOA 1ZH6A 5A5FA 4LV6A 3BULA 4O4LA 3GDFA 3RC1A 4QUEA 1Z6QA 4JYBA 3G59A 4KN9S 3UANA 3DE2X 4AZ3B 1XMPA 4H0NA 2AG5A 3L6UA 1SXJD 3DUFA 1TT5A 1E20A 1CE8A 2PKQP 3WLFA 3PENA 3VR1A 4YV0A 3IEUA 5LKAA 1LLQA 4IFTA 4D97A 5K6RA 3IPLA 4MCJA 2WWHA 3SIWA 1AMOA 1R6BX 4C0SA 4IJKA 2OPBA 1MEJA 3G6KA 3FHOA 5F3DA 3AF4A 2OR3A 1T6ZA 1G2IA 1JPJA 3UJ9A 3Q40A 3DTNA 5FFFA 1AN0A 4MKXA 4ND7A 5TS3A 3PFWO 2JVKA 4OP3A 3VHLB 3L7MA 4QELA 4NJEB 4UCQA 1IK4A 5LP6C 3OLCX 4BNVA 1DAFA 4ZQCB 2D2FA 1PSDA 3PC6A 4MPDA 2GNAA 5FUWA 1I2ZA 5JZVA 1DG3A 4AKSA 2XTMA 3TTTA 1ESEA 1TECE 2JI6A 1JE1A 2Q3FA 2VTVA 4QFCA 3S1AB 4HGYA 3USZA 4BEBA 1SURA 4QSHA 3QV2A 1TM7E 2BHNA 2GWRA 1KBZA 4F4HA 3B51X 4PX2A 2RSLA 4UNQA 1IQ0A 5JSQA 2XNDD 4KREA 3T3NA 1ONPA 3E2IA 2H85A 1LXCA 1Y8RB 2QTLA 2WZQA 2RHTA 3NTUA 3N2GB 2FZLA 4D9KA 2WSIA 5KYYB 4LF8B 3FTCA 2W2TA 2UUPA 1Q0HA 1V8PA 2LNDA 1DJPA 4RAQA 5ERYA 4QG3A 5KHOC 3TW6A 3HI6A 5L8VA 3IUYA 2B1IA 4G0UA 1ZKDA 1S8AA 3ORHA 1ZNYA 5BT8A 1N9ZA 1GG5A 4HNAB 4LJ9A 3ZE1B 4E7OA 3NNNA 3GLGA 1WUIS 1SRQA 4Q9HA 2OSVA 3UWKA 4DV3B 1WD5A 1C1HA 3QX9A 4WCFA 1JYEA 2Q0SA 3BXXA 3VNBA 1S2MA 3FFWA 4OSOA 1XB2A 4O4JB 3U7QB 1MEOA 1G63A 2H4ZA 2V4ZA 3PDUA 3HFSA 4M2LA 3TL6A 4G0YA 4JJ8A 1EX1A 4OYYA 4IICA 3H7IA 2I6UA 4J2HA 4C4OA 1OH7A 2OO3A 2TRSB 3GB9A 4TT3A 3PIDA 5ALSA 1VB5A 5K3EA 5AW5A 1MG0A 2FWAA 5TVKA 2OCLA 5CNMA 1XRPA 3H2KA 5EZ6B 3T5GA 3FPAA 5FWXA 5ALPA 3LP5A 3HBMA 5J4KA 2AEEA 5AVYA 3AINA 4Y2RA 4X63A 5TDHA 1DT3A 1JUDA 2IYFA 3N8IA 3WGIA 5JWHA 3LUFA 1M0SA 3FHTA 4YJ3F 3DV0B 2O2YA 4D4JA 4PZPA 2YH2A 4O33A 3WYNA 3BHIA 5J2TB 3KLNA 2H8KA 2O2EA 3B2NA 4NU5A 4O02B 1WAMA 3T1VA 1JKIA 5G3ZA 3PJDA 5EA2A 4D9MA 2CSUA 3ZVLA 2I67A 3E6AA 4RMNA 1NJFA 1U9YA 3NV7A 4ZV7A 4AJ4A 1YFLA 1M3SA 2ZWAA 1T3GA 2X58A 3D6MA 4PX5A 4XWAA 2PZGA 2Q2VA 4A8JB 5JAOA 5KINB 4AYWA 3KEOA 4Q03A 1VJ0A 4JHLA 4CM5A 1GPBA 2FN9A 3A10A 1DI0A 1MB3A 3NW9A 2LBPA 2VK4A 2XMPA 3GVIA 3T0IA 4KWCA 2WBLC 3P19A 4AFNA 5A4FS 2IXAA 2Z3ZA 4TRNA 4S0XA 1VL8A 4HUQB 3NFRA 5DTEA 5KMGB 5HMMA 2JCGA 3EZ7A 4M1EA 2A0FA 1U9JA 1ULHA 3PNYA 2Z2ZA 1YJCA 3NWOA 1VE5A 1EAYA 4CTOA 1ZI8A 2JD1A 3VRHA 1KFKB 4F3CA 1YJ8A 3GY0A 1I4WA 2R6FA 1WU8A 4HAZA 4LHXA 3E5MA 1VG8A 3OAAA 5D01A 1E0JA 4BLQA 2IW3A 4ZAVA 4CUZA 2ZTVA 3W90A 1IZ0A 2ILVA 2LRHA 2OV3A 1DKLA 3PQEA 4FD2A 4MUJA 1K8RA 2P2DA 1XZEA 4YAJA 5KYVA 4B6OA 2GZSA 4TPKA 2WZCA 3OE1A 2AI3A 4US1R 5EXDA 1PTKA 3VU9A 4GLOA 2H4HA 2PKRA 1CETA 4JXKA 1T35A 1XCOA 3LQQA 1FUEA 2AUNA 4RZSA 5KWIA 1JNYA 3EFHA 3MK31 3GARA 2DUMA 2Q3EA 1NQVA 2DPMA 2GCGA 3PE6A 1AKQA 1KARA 4NBVA 1U0OC 1HYBA 3GL9A 2BONA 4EECA 4IL5A 4C87A 5FBZA 2UYQA 1CR2A 1KC3A 3SSAA 3U13A 3ZNQA 4TVSA 1ZOOA 2Q1WA 4MI3A 5A4MS 3SVTA 3QU2A 4UVEA 3VSBA 4JOSA 4QXMA 3RKRA 4K0KB 1FZTA 4DDUA 2VVTA 3LU1A 5K3DA 1PWXA 2RGEA 1HDYA 5K2MA 2O8BB 1ABFA 3L4JA 4C2UA 4K87A 4QDJA 1U11A 4K6FA 2WSSD 4TKMA 1HYEA 4OGWA 1EP2B 1J2JA 1J99A 4IZOA 4M53A 3NBAA 3TTWA 1TJNA 1W47A 3VYSB 1U02A 2LIVA 3BL8A 2FW9A 4MUAA 2XPCA 4GWLA 4PFSA 2VDOB 1ZM9A 5E2BA 1EQUA 1G0OA 2FETA 3IS3A 5GZ1A 1GAJA 1TKCA 3F0TA 1NULA 1YE8A 3TRFA 4V39A 4NVRA 3W8FA 5C1BA 3EZFA 1XZFA 2P6OA 1N7GA 4ABYA 2NTJA 1GKYA 2J6HA 5I7FA 4QTTB 3QKSA 4L72A 3Q5GA 1SKAA 4ZI5A 3TDKA 3RJMA 1LSSA 2PX4A 5EJMA 3FMPB 2F3TA 3UT6A 4NOMA 3TDMA 4G5HA 5JNRA 1YHNA 1QHHB 1S9HA 2QD2A 4MRMB 4X7BA 5HIMA 1SCKA 5CT6A 4DLLA 4Z2AA 4IMPA 4F72A 1R4AA 3M1IA 3NHKA 3IQZA 5AYVA 3HU1A 3VZPA 3ZD8A 4N48A 1R64A 4N65A 2BMDA 3VPAA 2PUEA 2EJBA 5HX7A 1P1FA 1C7ZA 3UGQA 2AL7A 4POAA 5FP0A 4ER6A 1Q6ZA 3DFZA 3G0CA 3H5LA 1PN3A 5ECWA 1BCRA 4CF5A 4J07A 3SS8A 3VOBA 2ADOA 3ILHA 3LYUA 3OUTA 3MCUA 4N5DA 3V3KA 4TKZA 4A0GA 5A5VA 4BWYA 1QAQA 3RC8A 1W49A 3AP1A 1B42A 5AH0A 1CUUA 2JJQA 3RT7A 2HRZA 4K05A 4M0FA 4NF2A 2ENUA 4R81A 3UBMA 4UHKA 2XIQA 2A0XA 5ILGA 1J5XA 4J7XA 5HJ7A 1F2TB 3FJ1A 1TQ2A 5CTAA 3VR2A 2ZYIA 2CN1A 3H9JA 1ECLA 2O7NA 3C5HA 4R98A 3NHLA 1W8DA 2BGWA 1Y8RA 1K27A 3WC4A 1G21B 1W93A 1QLHA 2B7LA 3SSNA 3CVVA 1RAFA 1T9DA 2R1ZA 4ER7A 2XLCA 3FH0A 1KYWA 1ONNA 2B8NA 2H51A 1KJIA 4FI3F 4HFNA 4TV8F 1NMZA 3SM3A 5FOWA 4BXOB 2GFHA 4RPKA 1O5OA 5LBUA 5L3RA 2BP7B 2NNWB 4XB6B 4LJLA 1GDDA 2ACVA 4KQMA 1QGED 1JF8A 1ZG3A 4HQ0A 4TLMB 5I45A 5MFZA 3KKPA 4Q9LA 4AXXA 1J5EB 1JFLA 2E48A 3QEMB 1MQ8B 3D7MA 3HBJA 3OBIA 4OXNA 5DTRA 9MHTA 2ES4A 2PJZA 1OXTA 1AE1A 3B60A 3EY4A 3PGLA 4P1ZA 3G7NA 2GTIA 4KBYA 1N7HA 1TIPA 1XNRB 5A4DA 2GETA 1HT3A 2R2AA 5DSTA 3WLSA 3ZQ4A 4Z1MD 5BNZA 3UICA 3A9CA 3GLUA 1RWBA 3I01M 4IDDA 2NO4A 5EIXA 2O0KA 2X5XA 3IQHX 1T29A 4BFCA 3EA5A 1L9XA 5D5PA 2ZRQA 3WKEA 3HCFA 2OKGA 4BRWA 4B3CA 3WYAA 1GTJ1 4H3VA 4IGIA 5JXHA 1GQ2A 2Q7XA 5TEVA 4F3TA 1MDFA 1ST3A 3ITDA 4MV1A 4A8TA 1EWVA 2UAGA 3GRRA 1XEWX 3QXHA 4LZNA 3OJFA 5LZ9A 3ZZNA 3UAGA 1YA6A 4ZO6A 4KO3S 5TSDA 1A8HA 1UBCA 1BTOA 3VJMA 4L9SA 1DB3A 1PFVA 4A8JA 4WJLA 4MR9B 4XD7A 3EXIB 2H9YA 2WWVD 5ELXA 1URPA 1TOAA 1PR3A 4KIJA 2IS4A 3DDWA 4X41A 5DI3A 1V9CA 3LHSA 1W4BA 1EDDA 2X1VA 1WEKA 3IE1A 3PCRB 3SN6A 4D4KA 1GP2A 1BQ4A 1ECPA 4Q24A 5EE5B 3BH0A 4YUWA 4MV6A 5KX5B 4XTCS 1RWWA 4DJDC 1RWXA 4YAWA 5E9WA 1YMVA 3PDJA 4EEXA 1GR0A 2DPXA 4JU8A 4AX4A 4ENUA 4DV4B 1QP7A 1KGDA 3FTDA 1CKEA 1A9SA 1BKDR 1MH9A 3IIEA 3ROFA 1IZ8A 5CK5A 2A14A 5B64A 1UPUA 1Y5IA 4UD2A 1PJRA 3QKTA 3P27A 4DY6A 2VJQA 2OHXA 4B45A 2QQFA 2GAOA 5DB4A 2I78A 1SPXA 1R6AA 2R11A 4UAVA 4QC2A 2XYQA 5ERGB 1T3TA 2CNLA 3AHCA 3RTEA 2GR9A 2IE0A 3WAGA 2Z9BA 3FOAA 1EFCA 1EGQA 2CNWA 2GJSA 4PCAA 4RGYA 1GV1A 3WSWA 2ZI6A 1Q7GA 4PPYA 4JBWA 5IYZA 5LR6A 3W5CA 1MO4A 3QJGA 4MULA 3NOQA 3AVUA 3GWZA 3MG9A 4CMAA 1RPTA 3ZLBA 3I6IA 4PYJA 2JHFA 1C1XB 4K7JA 1K7EB 3H16A 1Y1QA 2WDPA 3IBSA 4QGAA 1QIIA 4QUAA 1ZESA 3KXKA 1DVRA 2QENA 4XX1A 3G02A 5FFMA 3NEJA 4Z4HA 1CUBA 5DK4A 3LKDA 2HW8A 2O7RA 1IHDA 1XEFA 3J7TA 2CLHB 3D8BA 4EH1A 1AG9A 16PKA 4EIWA 1SHLA 4ZV9A 4QPZA 3AM4A 3CNBA 3SDSA 4WBNB 1ECFA 1IMOA 4FKZA 4HKTA 4R2KA 2X1LA 4MVJG 1V26A 2OHHA 3UYLA 4GM0A 4CMIB 1R9JA 4CQNA 1RKQA 3HB0A 3M5DA 5EG5A 3UGKA 1A5AB 3ZD6A 2ETVA 2O1SA 1GEGA 2P2NA 3AM1A 1J21A 4HAIA 1R4MA 1PCXA 2NZ8A 4TQUS 1G7TA 1TM3E 2RHOA 2VYVA 3FYCA 3K7EA 1T9BA 3CLTD 1EQAA 1U28C 5ER9A 621PA 2PKWA 1VBFA 1XT6A 1LSUA 1TVMA 4PHHA 1E2NA 2CNNA 4G5RA 3B78A 4IJQA 4JB2A 1KAEA 5CVEA 4KR9A 1RQPA 2B1RA 4LHEA 4C4PA 1XVVA 5JAIA 3GA5A 1HK7A 2QPTA 3O4FA 3BWDD 1T1RA 1UINA 5AVZA 1OTXA 4WY5A 2FH5B 1GZDA 2QTVB 3KPWA 2BR5A 4NBNA 3RHTA 4CQLB 4LHYA 4ZPXA 3T1NA 1C2YA 1R0SA 3ZZTA 3NC0C 1MORA 5JHGB 3EXHC 4AP9A 3AF6A 1HYHA 3U6BA 1R8XA 4C4SA 4OK5A 4QA9A 2AJDA 5CVJA 1KDVA 5ITZB 5G3YA 1M34B 3GWGA 5JSZA 5LYJF 5EHNA 5JDCC 1TM1E 1HEIA 1QIHA 1Y7IA 2WZBA 4KNVA 3ZDCA 5JMTA 2PD3A 4Q93A 3WJ1A 1PWZA 3K2EA 3DEYX 1RPNA 2YRXA 3DOCA 4I9FA 1UK8A 1J22A 1SNYA 2JJYA 3TIGA 5DGHA 3P94A 1O0SA 4N6OA 2CNKA 3OHSX 2I8CA 4B4UA 5L53A 4IJUA 1L1RA 3LC0A 5DLYA 5E38A 3UMVA 2P2CA 4IS2A 1HL7A 4RYLA 4ZDIA 1NR7A 4GXNA 2OCKA 5CP8A 2JLAA 5HKKD 4FDUA 1GVNB 3A9WA 1E7YA 1GTL1 2VWHA 1K2VN 5KC9A 1GNTA 1PR0A 3SY8A 4KX3A 1U2TA 2FQ1A 3MCZA 5EUQB 1LI7A 3MWEA 4JLPA 5AVOA 3P1JA 3DZBA 4DXHA 1VHJA 3L05A 4LQ4A 1JALA 1LRLA 4L5YA 3TZKA 4RJIA 1XDBA 3E1GA 3NWBA 4EI8A 2D2EA 6REQB 1FDUA 2FPPA 3HDTA 4FX2A 5EJ7A 1T2NA 3IKVA 2BP7A 2QRUA 4FYJA 4X94A 4WBSA 1UM8A 2GT1A 4OHZA 4C5BA 1E1MA 4J0FA 4F6LA 3GQVA 5BXQC 2AMYA 2W8BA 1H69A 2VXOA 2WZDA 3HR7A 3V7FA 4CG1A 5FEUA 5CLJA 1ZDMA 4DIDA 1FFGA 4JJ7A 4DIKA 2A9JA 2WF9A 3TBHA 4A5SA 3Q5DA 3ZWKA 1XPOA 1C14A 1YVDA 5NLLA 3TECE 2YVAA 2UZ3A 1D4AA 3UIEA 5LWHA 1WABA 5AI0A 3K20A 4LC0A 1TJ3A 3FUUA 3JWPA 3C24A 4DV2B 2OCGA 4RS3A 1Z6PA 4Q7JB 2ZR0A 1SG9A 3E9ZA 3EVFA 4N49A 5JD5A 4HYEA 5AXAA 3DMTC 4EAAA 4RD6A 4PLYA 1PD1A 3VPDA 3CNLA 3IBGA 5A4KA 2VT7A 3CR3C 3IEIA 5CDYA 3KJHA 4GOXA 3H9BA 4KG7A 2VJYA 1O9HA 1EDOA 3RU7A 1GG9A 1SCDA 1KVRA 3QOWA 1XLUA 2QPLA 2HK8A 2HO5A 3UK6A 3PS9A 4CCSA 5K45A 3F8SA 1TKBA 3AHEA 2UVDA 4H59A 2MSCB 1IIBA 3ELYA 2PMFA 5DBOA 1AS2A 1Z4LA 5L95A 4MUYA 2Y77A 3N0XA 5GADl 3AR9A 1H3FA 1LS1A 3FWHA 1QPZA 3JQQA 1NMSA 1ILEA 1M7HA 3KUKA 1EK5A 4RMHA 1BEEA 2W9XA 4AMYA 2ONCA 3DFUA 1J2UA 1KYTA 3PQDA 2RHLA 3AUAA 3JD0A 4BMZA 4FYIA 4I46A 4R7GA 1KH3A 3H9GA 1VL6A 2C5SA 4Y6SA 3C41J 4DJFC 3GRPA 5HRCA 2QS9A 2RGDA 2HXGA 3D6AA 5REQB 5TMBA 3X43A 1R5BA 3B9QA 1U7TA 4FHZA 5C1DA 2DP4E 3MLEA 3PQ4A 3P0FA 3P9ZA 1U2QA 2PUFA 2CLKB 4IDFA 1FX0B 2Q5CA 1BKSB 3E23A 1HH4A 3T54A 1KAMA 4LXGA 4N8SA 4PYKA 4RPIA 5IXSA 4QVIA 4B46A 1FXWF 2ZPAA 5GONA 4V03A 3OF2A 4D6PA 3JYHA 4PSDA 4FZVA 4KQXA 2V1UA 1Q19A 1II0A 1R18A 4HYYA 4EKEA 1MOSA 3AR4A 3RSFA 2VAMA 2X7XA 4G1FA 2AC7A 3AKZA 2H7CA 3X44A 2RK4A 1HYGA 1IVSA 4OIMA 3S70A 3GJQA 4B8ZA 2LR0A 3WIEA 4J3FA 3VR6A 3M34A 3ZVNA 3RFUA 3AR2A 1XQ1A 1SEPA 3V32A 4I36A 1UJ2A 1QO0D 3D59A 5K3BA 3RTDA 4AB1A 1DP4A 1GQFA 1NT2A 1FBTA 1NVTA 2IVFA 3ZDFA 4EFMA 5JVDF 3VNVA 4IQ0A 2P9EA 2VQFB 2WSLA 3AJ9A 1CJMA 4W9NC 4FSDA 2C4UA 2JVJA 4FFDA 5H68A 4OK3A 4LQCA 4BVGA 2HYIC 1MA3A 4OHFA 4M0MA 1PJTA 4QNMA 3WLKX 2YMLA 1GUYA 3KJFA 3RM3A 1H42A 1LB1B 2CXRA 2BEVA 3MTIA 4X8HA 4IIHA 4S24A 4NENA 2P9ZA 2DQYA 2QRMA 5IJ0A 5BW6B 4TUYB 3WHPA 3N1UA 3KPVA 1WHSB 2IYUA 3KJZA 3ONWA 2ZIXB 2UZ1A 4GOJA 3L6RA 1E2LA 2C77A 5GZ3A 2G67A 2B94A 5KOIA 3LUKA 4CKEB 4GPZA 2GYYA 3JRWA 3QFRA 4R7ZA 1Q7TA 3FNGA 1E94E 3MMXA 3ESXA 4J8PA 1Z13A 3BSWA 3DPUA 1IMJA 3PHJA 4AICA 1EFRD 1SVKA 1N36B 5FJIA 4M99A 3EZNA 4JXZA 2CMGA 4ARSA 4L0MA 4LE0A 3IJEB 1I1NA 1L4UA 5CXQA 3F98A 4B3MB 3D8NA 4AU1A 3I9FA 3HYTA 3O92A 3ESQA 3EQ7A 4WKPA 3DMGA 5HZGA 1OLSA 4GO1A 4WY8A 4CQLA 2GBPA 2GDZA 2DBRA 2AQHA 4JBLA 4LECA 3MGKA 4NS4A 2PL5A 1KORA 3C3DA 2AXNA 1OFGA 3BZUA 1NLZA 4HDSA 2PZKA 2CL6X 2X15A 4YP7A 4TXLA 3SQOA 4OYLA 1QIEA 3LUAA 3FF1A 4TWRA 2FSGA 4ZI7B 1VE3A 1UKEA 1UZAA 1QGYA 2PO5A 5JNUA 3PXDA 4MP8A 3NTOA 3ROPA 1VRVA 3EA4A 1ZQ9A 3CE9A 3D5EA 3I04A 3INNA 2I29A 4EHLA 1N2BA 1C8LA 1U2DA 4Y7CA 1JV2B 3CEPB 3K0BA 1T6YA 4TRJA 4IHKA 3REFA 2I3AA 5D51S 3ZHBA 4EUKA 3ND8A 2ZDHA 4JOCA 2W2VA 4AULA 4CFYA 2FPSA 2JEOA 1H2RS 1OR8A 1XQ6A 4BTLA 1H6CA 3P2OA 1QQBA 3L84A 4PSCA 2LV8A 3ED1A 1TIKA 3IQFA 4Z53A 1K5GA 5CVDA 2H1VA 3GJXC 2X0KA 2BMFA 4I8DA 2HA4A 2QDXA 3UO8B 2PUTA 5L9AA 2CLMB 2VN8A 2ZE8A 4MJXA 1EVYA 3HVIA 3SDZA 5JU6A 1C7IA 4GKAA 3NAZA 1XKXA 3V46A 2GJ9A 3VV3A 1AQ6A 1LK7A 1P1CA 3I1JA 4BO8A 3M5CA 4CKCB 3ZLVA 3QUCA 4E4RA 5DM70 2YYYA 2QIOA 1E1QA 2Z1DA 3N05A 1TTPB 1Z34A 3WDSA 4AURA 4F60A 1ZLXA 1YRHA 5HEKA 3AVVA 1UDRA 4TM8A 5AM0A 1JPNA 2W2PA 4K6HA 4B6QA 1EG7A 4TTIA 4B7ZA 3IXQA 4G5YA 2YS7A 1DQNA 1ONBA 2P5TB 3K9GA 3PGKA 2AWNA 2BSXA 1NBWB 4KQ1A 4OATA 2JIQA 4DJEC 4P34A 2GASA 3CUEF 3IJRA 2V8BA 5ERXA 1P7ZA 3ZWYA 4UFNA 1Z8DA 2G7ZA 1VIVA 1YQDA 3BA1A 5C8YF 3G0GA 4TSKA 4X8LA 5DN9A 3L82B 5A3SA 2HBZA 2DKNA 1W4AA 4CFSA 4MW7A 1W0KA 1L0BA 3UAZA 1W2WB 5J4YA 3DT9A 1QMPA 2GF9A 2I6TA 4FSHA 3OD5A 2YJ5A 2CUTA 3REQA 5JZMA 1P2SA 4CYMA 2NTVA 2HJ9A 5JQGF 1XRRA 1J7KA 3CNHA 2AG1A 5F1KA 1CD5A 4UEQA 1LD3A 4DRXB 2KHZA 1V1JA 2C4TA 3MUOA 1AUXA 1ZL0A 2AWOA 2QE7D 1CUWA 1U9CA 2NTEA 3CE6A 3I6ZA 3LC1O 5CG2A 1F7UA 2Q3JA 4ZQEA 4G6ZA 2B83A 2BFEB 2B61A 2DG2A 2EBHX 3K16A 1DUVG 3DTTA 3MS7A 4JYMA 4RK6A 4YV2A 3S2YA 4I99A 1H0HA 3SC4A 1XAIA 2HNAA 3FCSB 3RYIA 3O7WA 4EI9A 4UQPA 3W9BA 2CXPA 1IBRA 1X74A 2XW6A 3PP8A 4XRRA 5F77A 2GVNA 4KPGA 3BC1A 2FB9A 1AK2A 1R0WA 3PRYA 4IWNA 4UVHA 4FB4A 4BJ3A 1N1DA 3HB7A 1MC5A 4EBFA 1E5QA 1WE2A 4Z7NB 1SXQA 1JSCA 2Q27A 4XCVA 1I7NA 1JEYA 1GFSA 2VBFA 1WKVA 2HMYB 2PPLA 2HSJA 2VXBA 1GA4A 3IB3A 3IDFA 5F1PA 2XT9A 4ASUA 1O08A 1VJGA 2FOIA 3SHOA 1W7AA 3SXPA 5GIPE 4O5AA 1EK6A 1GLGA 5ESDA 4F38A 4EKDA 4ZJYA 3GQBB 2JEYA 2Q1TA 5C52B 5J5AA 1FFBA 4UQLA 2C95A 4CHGA 1R6XA 3OUZA 3G0BA 4GI7A 1IM2A 2OHOA 4Z2YA 3WWPA 1LW7A 3HP7A 4GM4A 3U19A 4MYTA 4W63A 4UPDA 5JCJD 2TMDA 2VHJA 2OAEA 2QW1A 3Q7PA 3A1CA 3JAKA 3DFIA 3P9RA 2OTCA 3KP1A 5JEEA 3BMOB 4I5FA 2YTZA 5A4JA 1M2WA 3MINB 5HKBA 3B8HA 4GSKA 4WSOA 3I0MA 1IY9A 3P5SA 4ND8B 5I8ZA 1U8AA 4QDUA 5TT0A 1X1TA 1Y6JA 2DCUA 5CAEA 3M6LA 4UTRA 2ZDGA 3QA9A 2AC2A 5C3UA 2NU6A 2Z5GA 3JALA 2YIVX 4EMBA 1IJKA 4WK6A 2V7VA 1P7YA 2X0EA 4KFTA 1UMDB 3RS8A 3VUFA 4E22A 2P27A 3ICVA 4F1KA 3PHIA 2XKKA 2D13A 1BU5A 1L4FA 1XK7A 3I5MA 2FZCA 3EF0A 3DEFA 1QQ5A 3FPCA 2SKEA 2X8WA 4MV7A 4AJLA 2PRYA 3DL7A 4PX9A 1XQ9A 5BNWA 2VAWA 1XZIA 2FWJA 3KQNA 4K5QA 5GVSA 5A4AA 3UWMA 5JFTA 1SVNA 3D0RA 1Z0IA 2QVYX 3EBLA 3GP3A 4KQ9A 4BNJA 2ZCVA 5JWRA 4JSTA 4MV5A 4CLEA 3MJHA 1B4DA 1MB9A 5DHTA 1B3RA 3D5QA 1OHHA 4DDKA 2PYDA 2VPQA 2VP9A 5TGDA 2OESA 2P68A 4YRBA 1VE9A 1WDKA 3FDFA 1NGSA 3MS4A 3EIQA 4BAUA 4U7HA 4GDFA 5ALXA 4DIOA 3FVVA 1L7RA 1LCIA 1PNQA 1N75A 2FLWA 1UJ6A 1XXHB 2Y27A 3FNBA 1QGDA 2FSIA 1BXGB 4JVMA 1W1UA 1PV2A 2QUAA 1XYGA 5AM1A 4WECA 4EHKA 2O0JA 4HQKA 3OFND 3HCPA 4TX1A 3SSMA 3WS7A 1PNTA 3SBOA 1FTQA 3U1TA 5HIKA 4K88A 2GHIA 3HPQA 2XA9A 3W5AA 1V16B 2GN8A 3RC3A 1JLLA 4A6PA 1MW9X 2XRZA 1CRQA 2IA5A 4EO7A 3ZEIA 1EVEA 2YR0A 3AFHA 1WPRA 4XJSA 2GK3A 2G4LA 3T4XA 3AHJA 1CVRA 4HP8A 4BQNA 2BMJA 2VJBA 4AJHA 1XMXA 2I2AA 4G0NA 4RHXA 5I9SA 2AI1A 3EW9A 4FR0A 3P0RA 2VRNA 4W5QA 1VGRA 2W6JA 1JHVA 3PVZA 1AO0A 3W5HA 4BJHB 4DLTA 1KI6A 4WLUA 3HJHA 3RFXA 3TOXA 2OPHA 5EJEA 1Z0KA 5FI5A 4TWAA 2O2IA 4UEJA 3FOFC 3EWAA 2G72A 3DW3X 3ULKA 1QE0A 3LX5A 1FP4B 2D8AA 1HLPA 1L8QA 3N87A 2J9ZB 2B34A 3FTPA 1OV4A 1J8VA 4RC9A 2YVKA 2C03A 5CYGA 3AVYA 2E18A 1EDBA 5BSTA 1SU6A 3OU7A 5JUWA 5K0FA 3WOVA 4RPHA 3RV3A 5B7QA 3ZY5A 4DUGA 3S8YA 4X8OA 1WTCA 4NCIA 1MR3F 1PQ4A 1NJ6A 4INOA 3SK0A 3QPUA 5EIWA 4CN8A 5JMWA 1FYFA 1R9GA 2ZP1A 4B0PA 5CVCA 6NULA 3EVZA 5DMHA 4CM4B 4BXOA 1AHIA 4F0JA 4PLWA 5CT4A 4O2LA 1W4CA 2C1EA 5B6PA 3O8RA 3H13A 2KX7A 3JQ8B 4F9FA 3Q6NA 2RGCA 4JEIA 5JASA 3KG2A 1RM3A 3DOEA 2Y1XA 2X6TA 5I9TA 1U3TA 1AHHA 5CGZA 5IBQA 2LUOA 1NPDA 3CONA 4LJ6A 1RXIA 1M1UA 4UVIA 4GF5A 5K51A 3OY2A 3MIZA 2LW7A 2P9CA 2QA5A 2W90A 4NBSA 5BYJA 2A30A 4FNOA 4BMVA 2PXHA 4ZT7A 1Z4JA 5DLQC 1MX1A 3H97A 4ZVRA 2PFSA 3W1VA 2W7TA 3GGDA 4IPTA 5HCUA 4NABA 1ND6A 4ZO4A 2IIQA 5HYVA 1T1IA 2ADMA 3FA2A 1VHDA 2GTPA 5K6AA 4DCPA 4L4YA 1LLUA 3PT9A 4QBHA 3U44B 2BFEA 5L3VA 3DL2A 5MFPA 4BFUA 1C4OA 4BS9A 1ZISA 4FFRA 4CV2A 5HJ2A 3UK2A 3AJDA 4W5OA 1M2EA 3O82A 5IJWA 4YP0A 4MSUA 1J70A 4F3NA 2R1VA 2WHRA 2P0YA 4LXQA 3WIBA 3HBAA 3OPXA 3DOFA 3GJ5A 3QELA 3EIHA 3JQ6A 3DM5A 3ZWXA 1N1MA 4I9NA 2BEJA 3RVLA 4J1TC 4ZCLA 4QBFA 3AFOA 4DJAA 4HDAA 1VJDA 2E4VA 4XW2A 3QLUC 3QJ5A 2Q6OA 4Q1VA 4UNSA 4P93A 3T9EA 1WB5A 3U3RA 4BNHA 1RI2A 2OLJA 1RT9A 2PH5A 2P79A 4IX9A 2GD6A 3W0LB 2BBTA 1HKUA 2VRCA 3HPRA 3A4VA 1TD9A 3QVOA 4GWGA 4J1QA 3S7TA 5JOQA 3THYA 5LUAA 1G4HA 2R8RA 3C3EA 3F6BX 1AKMA 1TCAA 1E0DA 1XTZA 3AR7A 1F5NA 4GEGA 4KV9A 4CDRA 3WDKA 2H1WA 4UBLA 1KDZA 4RORA 3M6WA 2CHVA 4WFKA 4F97A 1XU9A 2RC6A 1HNNA 4CUJA 1PZGA 4Q1FA 3F7NA 3Q7RA 3NT2A 3TLYA 3LCJA 3L9XA 4BECA 1ZK0A 5JFGA 1QE3A 4RELA 5FPQA 4BO7A 3ONVA 4N7RA 4DLZA 3FNIA 4Y1RA 1RR6A 1ZOSA 4R84A 3V2UA 1NI4B 1KPGA 2Y0BA 3QXCA 3GLHE 4Q9IA 2H92A 2Z6UA 4EY8A 5K7SA 3JQFA 1M7BA 5I9IA 1BYUA 3U56A 1ZZEA 5FX2A 4PQFA 1NKVA 3KZNA 1Q44A 1ZIYA 3EOZA 4ADSG 1LW6E 2ONKA 3PUJA 3Q0IA 1GTZA 5BR8B 4XYEA 2GN9A 1DMRA 1ZNZA 4A23A 4KQCA 4R2MA 4EW1A 4ZHQF 3ZLJA 3HP1A 4ZGWA 4OBXA 2XIJA 5LA6F 4UHEA 3IFSA 1SXJA 4F85A 3H9UA 3QEAZ 3HYRA 3T1HB 4RV5A 4NNJA 5LYYA 4Z4CA 1D3AA 3O7MA 1YFKA 2J6IA 3VGPA 3KYDB 4L02A 4F3KA 5F2OA 1TGYA 2PRKA 4YR7A 4GC9A 2WOOA 1OLOA 3NYRA 3Q3GE 3GZTB 5FXMA 1VJRA 3DQQA 3JQ9C 3VH4A 2R2GA 4CNQA 4YRNA 2WVHA 1EX9A 1YS7A 1NPYA 1KK0A 1N1GA 1SN7A 2PSFA 3L41A 3VVLA 3WOHA 1RADA 5JY6A 1J33A 3V9PA 2XZDA 3M3PA 4Z49A 3OM1A 3D8RA 3PC2A 5FL3A 1YS2X 5IN4A 1OVMA 1QZUA 2G1UA 3D81A 4JWKA 3R75A 2IPMA 3RW9A 2PGXA 4Z0TA 4B40A 2W58A 2WWFA 2F00A 2YWCA 4BVFA 5AKHA 2BF4A 4FOPA 3MJCA 1S8OA 4DSUA 1IJEA 3CT4A 4QOHA 4OA5A 3U37A 4GI5A 3AVOA 3QSGA 3F7MA 2JBWA 3F46A 1N2CA 1UT8A 3PLNA 4NZMA 3RTCA 2C98A 3DNMA 1COWD 4G07A 2FPGB 3TFOA 3B2QA 1GKLA 4BBPA 2OKCA 1L7VC 1US8B 1SUPA 2RCNA 4ARUA 5EZ5A 1OYVA 2JANA 2QVXX 2W93A 3GT4A 4AWXA 2ZBDA 5J2UA 3EH1A 1D6NA 3WL5A 1I3NA 3Q87B 1W0JD 3UMGA 4G0WA 1C4KA 4OB7A 3CVXA 1J8QA 1C3XA 4R83A 3PUHA 4L8VA 3U4HA 3KKQA 3DO8A 4C14A 2P2SA 3Q7QA 4CMHA 1O6GA 2I7CA 1CUFA 1MJ5A 2OWDA 3L6DA 3C15C 3A6FA 1O4WA 3EXAA 4L3WA 2EKLA 3BMXA 5KHAA 2FMUA 4E2YA 2K7FA 1SQ6A 1VIYA 1CX9B 1DC4A 1Z4KA 4KR0A 1X7WA 3T7SA 5KYWA 3T7DA 2E4XA 5EJIA 5JI2E 4ZEXA 4K6CA 1VECA 3MWFA 3ECSA 1DLIA 1L5SA 4FC6A 1ENOA 4AZTA 4V1CB 1JX6A 4E88A 3C0KA 1VPEA 4X64B 1TK9A 2EERA 2QD3A 3JQBA 1X9IA 1XUOA 4R01A 1YDGA 5L3SB 4HAYA 5DM2A 1VQ1A 1NUUA 3O3MB 5FPYA 3UB2A 3S8EA 1KGSA 4OY3A 1OYOA 3G2JA 2NU7A 4ZU1X 1RQLA 4WIAA 4NHEA 3UY4A 2HHAA 4CV1A 4BBAA 4E1BA 3E9YA 4WKBA 5IMBA 1CB7A 2P75A 2MIIA 4RESA 1D7OA 3NOVA 2PBLA 3ANMA 3OT5A 3PHCA 1XMQB 1JG7A 1DRUA 2X3FA 1S2NA 3LW8A 4FMCB 1XMOB 2N1BA 4UU7A 4WKOA 3VZQA 4B6RA 1P9RA 2GJ4A 4PRYA 3KLOA 1L5OA 3DWFA 4FONA 3ISVA 3RSLA 3WXBA 1T4CB 2PAFA 5BW8A 3BWMA 1UDWA 1VHLA 2UYHA 2O07A 4L2IB 4A16A 3S68A 4NPCA 5I7UA 1T4GA 2JF0A 1UP4A 3GRYA 4AVYA 2JK0A 2P9FA 4UUOA 4F6RA 1YBAA 2DTEA 3GD7A 2IDMA 2ZQ5A 3OU2A 3TNYA 4BGIA 3J7AC 1V1MB 2Z83A 4HNGA 3TXAA 4JL8A 5TQ2A 3PWKA 1KJZA 1DU4A 5IDYA 3SJBA 2NIPA 1J42A 4H7IA 3VR6H 5I7SA 1T8RA 2H1SA 3KQQA 1QS0A 3AETA 5JXJA 3LI2A 3M6MD 1JG3A 1ORVA 2HX1A 3NPAA 1VHTA 2V6JA 1ODIA 2SECE 4KDEA 1S3GA 4Q1EA 5IUKC 1AUQA 4BQPA 3GLRA 5KQSA 2ZUVA 1XPRA 1TF7A 3TF5A 1O4VA 2FYTA 1V45E 1U3WA 4ZZ1A 3W3AD 3V1KA 3MCWA 2WIDA 4WLFA 4QTYA 2QPOA 4LNHA 3PQ6A 2CJPA 3EOBI 1GSOA 4HI0E 2J4FA 4LNAA 3ZDQA 2V98A 2FW6A 1XQVA 1XZMA 1LPOA 3SU8A 3HUEA 2GLUA 3M4XA 3SKXA 3HVRA 3EFOB 1WMBA 2R85A 1QFSA 1DADA 3GUUA 3JXEA 3NIBA 4J3JA 4WESB 3Q8XB 5LB4A 2ODWA 3AG5A 3FPBA 5F2KA 3I83A 3UXHA 1J1ZA 3JSXA 3DMNA 3OWOA 4IV0A 4ZO8A 1XDUA 3KVOA 1KOLA 5JCOA 5AK0A 4XXHA 1QH1A 1ZJYA 5J5CA 1N92A 4WV3A 3F67A 5FJJA 3N2LA 2X4LA 3SD7A 4QTXA 3DWEX 4KVZA 4YT4A 2QL9A 4GX5A 1XZLA 1M2HA 2VP0A 3CBQA 1CQZA 3EMKA 2MYUA 3LPMA 4OOEA 4XYLA 1A9QA 1EFVA 1PEDA 4FE4A 3SZ3A 1MENA 2P11A 1IZ7A 1ADGA 1WXXA 4AXBA 3NGMA 3U3OA 1EFAA 2IU4A 3GBVA 3Q72A 5IH3A 4MTLA 4XOIA 3C6BA 2FMKA 5ALMA 2J5BA 4RTMA 4Z0HO 5B4UA 5G02A 2OV2A 3HMQA 2H48A 4BATA 5I6DA 1HNWB 4RD2A 3TQIA 3TLJA 4G24A 2A9RA 1M2VB 2KBEA 3E7XA 1CNFA 2FJUA 5EWJA 3WLNA 4RULA 4CU2A 3B8EA 4EYOA 2MU1A 1IHOA 2VSFA 3I9NA 5H82A 4PGGA 2XQGA 4RV4A 3RU3A 4NU6A 2PLAA 3IUEA 2AOUB 2CVZA 3DFKA 2V5AA 4KXYA 4ZYYA 1PNOA 3CXUA 1WL8A 1OIVA 1V3VA 4KQFA 5CTJA 4GI3A 1CLEA 1L7AA 2XQKA 3GLQA 3PQ2A 2I1VB 1XEWY 3IP1A 2FTKE 4MYRA 1BWSA 3E4CA 4TMKA 4ZI2A 2GCOA 3LDGA 3ZZUA 2O6LA 1UKZA 3QPCA 3DYVA 1RE0A 4X6LA 1P1KA 3FJYA 4ZARA 5LLTA 1S9DA 4XUDA 4TS3A 5LWQA 3SF8B 4GD3Q 4DPKA 4YXFA 5H16A 1K7XB 4D1YA 4E7PA 3PSAA 1AMNA 1LDMA 2BGNA 3FVQA 4G1BA 3WBJA 3MT7A 2ZTHA 3P9IA 3ABRB 2VO1A 1QLJA 4QGBA 4Q9DA 1I1HA 4RPGA 3UJCA 2EW1A 2I7XA 1D8AA 3SX2A 3A1NA 4PG8A 4JWTA 1Q1QA 1E5LA 1FYVA 2YJTD 1XTQA 1A3CA 1QYDA 5BQPA 1J1IA 1OWOA 1E9CA 2O20A 3MUFA 4PANA 5EIFA 5BQ5A 4K9OA 3U60B 1I1QB 4NS1A 4IO0A 4B6EA 3EZ9A 2C4KA 4AQ7A 1Z8FA 4EABA 5H3CA 1JFRA 4RJKA 4YJFB 4ZJZA 2CNBA 3BXGA 4N0DA 2IZ1A 4C30A 2KW5A 3RS3A 3X1WA 2PJDA 3BXPA 1GPH1 3LDUA 3DTVD 2JJ1D 2V58A 5JS7A 1CUGA 1XTJA 3WGQA 1NJGA 2XWSA 3CLVA 1AGXA 3VDMA 3NKFA 4J94A 1T2EA 3CEMA 4FINA 5C81A 1ZAYA 3Q7TA 4HMOA 4FGJA 2QTTA 4Y2UA 3USCS 4DEVA 3CRQA 2WMYA 4R1OA 5JD6A 2A86A 5JAMA 3ZCUA 2O8FA 4U4AA 1UCFA 2B1GA 2PV7A 4Q3AA 2OENG 5SZJA 4CM8A 5HCIA 1P4SA 3ASVA 4HN2A 5E0OA 1Z2NX 1UBMS 1ISRA 1CUXA 1OJLA 1CQJA 1UBFA 2F3SA 3I2KA 2E21A 2OV6A 1T6BY 3PGA1 1CZLA 4WLOA 4DCNA 4QJ3A 1PL8A 4J0HA 3EPRA 1ULBA 1HDEA 2ZAIA 4V1CA 1DXYA 5JROA 5E7QA 4RZ2A 5JNLA 3VC7A 5JANA 1NF3A 1KZ9A 1GM5A 3JYNA 4D4MA 1NP7A 3H17A 3GZ4A 1G3IA 5KDLA 1U0SY 4REQB 4DW8A 1GZ7A 4EW2A 4YN3A 1FS6A 4YJ2B 3N9IA 3FYSA 5CR9A 5KPDA 2BTQA 3DOJA 1DINA 2BDTA 3S1LA 1U1DA 5EXPA 5H4HA 5HUJA 3KR2A 1X15A 6PFKA 1V4BA 3D43A 1LTKA 4BEWA 1G55A 1LJ8A 2WUVA 3AV0B 4NYJR 2WJWA 3WMRA 3WJ2A 1UFKA 3S2ZA 2RI1A 2XF8A 1P9LA 3L7BA 4WUVA 4GZ6A 3SE7A 5BSWA 4IUDS 1M1NA 1BDMA 2IK8A 4KH1A 4L3VA 2PWAA 4MPJA 1U9IA 4YCLA 1NVDA 4RANA 4TQGA 1XZHA 1JRLA 3TMAA 3ZU6A 1NVKA 3QRWA 2F62A 4V0MA 5G41A 4TV9B 3E22A 4JXXA 1Z0JA 3E7PA 3TZEA 3VNQA 1JVBA 1FNSA 3AKYA 3U09A 2NSHA 2BE7A 2ID9A 3C14C 3OQIB 4I2NA 1LDBA 3NO4A 1K66A 1E4VA 3NEPX 4QRDA 4ZVSA 1P80A 2R6R1 2V03A 1RQ7A 2AF4C 4NWIA 2PXCA 5K3FB 1ESMA 3QQ5A 1WP4A 4R2LA 4P32A 5KNBD 3R1IA 5BMOA 5B58C 4UCWA 2GPBA 1AQNA 3LC2O 1BE6A 4RF3A 4M1KA 1CU1A 1G8JA 3KFVA 1QXSA 1GAQA 1GL7A 4V3BA 3UHOA 4H27A 1G19A 3ESDA 1B0UA 3W8DA 4A4DA 4AMBA 3H86A 5F7OA 4Z4QA 2DEUA 2IZOA 2Z2JA 1JP7A 3ZXUB 1CJKC 1QIDA 5CFPA 5I7HA 5T3UA 5CJJA 3K0SA 1Z28A 4PBRA 1PR9A 2NNLD 4COOA 4Z1OA 3CWZA 1J2RA 3FUTA 4IEFB 3JYOA 4K86A 1L6RA 2FP3A 3DQPA 1OU0A 3HHEA 4FFOA 3T9FA 5F51A 3ZW7A 3HNOA 5DYIA 2A3RA 2D3TA 4RCZA 2Z30A 4DYVA 5IT4A 5GMOA 2C4NA 5JTUA 3IL2A 1B00A 3Q9SA 5BP7A 3PNPA 4S1OA 4WJKB 3RFTA 1XU7A 1LX7A 1PS9A 5FBVB 4ZV4A 3E2MA 4WXEA 2IV3A 3K0FB 4UARA 2HK6A 2IYVA 2QM3A 4XOUA 5IK2D 3TL3A 3AFMA 4AUKA 3FFXA 2J33A 4MV9A 2YN2A 3WADA 4UM9D 1GNQA 2I2FA 3CXRA 1BN7A 1TRHA 4MGZR 1MOQA 4BO6A 3AF3A 4Q6WA 1OAKA 2XAAA 5ABPA 3V4PB 3N7AA 1IU9A 3PV0A 5CX1A 2EP7A 4DARA 4EHJA 1V8BA 4YLGA 2OCAA 3SF0A 2AW3A 2H2GA 3FCAA 1BC5A 1BMQA 5EZSA 3TSAA 4LNUB 5JFOA 3LBYA 4BEJA 1KK3A 4RZUA 1DAHA 3KHSA 2FZKA 1N0IA 1SOVA 4OKSA 3BA6A 3UWPA 3BGIA 3OCCA 5H3LA 1CNEA 3E9NA 4W7IA 3EODA 5ALDA 3DWGA 1QOQB 1P4AA 4JB8A 3R3ZA 4YV1A 3A9UA 3VX4A 4DIEA 2WEKA 4PLVA 4TTQA 5LJLA 4HYTA 1YL6A 2A6PA 3NVMB 1OASA 1OTYA 2F3QA 5KAMA 1WJGA 2PV0A 2QKYA 3QUBA 3FBTA 4FFLA 3MWKA 4UEWA 1MQ9A 2VNKA 4YMLA 3BL5A 4UMFA 1KTIA 5BV7A 4G41A 4LBVA 4GPTA 3T9CA 5CA1A 1RD4A 3WLTA 2G88A 1SZCA 3OOYA 1U0BB 1I94B 1OYWA 1F2DA 3K2QA 4C4AA 2DB3A 1YWGO 3M3HA 3N86A 3SM9A 1YCHA 2IV7A 1IM5A 5DTMA 2NUAB 5ITWA 2HPVA 2XTAA 1TQDA 4G9GA 4GAEA 4OL9A 3VNAA 4YRKA 2M9MA 1OBVA 3AG6A 1TTQB 4EY7A 1IBMB 3IBYA 1MJFA 3KB2A 4UCXA 5AXBA 4DDTA 4D79A 1Q0SA 1YS9A 4ZAZA 5HKKA 3GP8A 1WG8A 3EOAI 4EL5A 1Y5RA 3CURA 3G2QA 3IQDB 1J0DA 5EJ5A 3ZDDA 1IFXA 5FNVB 4KHPB 4HDKB 5AI9A 3U4MA 3O90A 3I23A 2ZB2A 4C20A 4MS3B 1KU6A 3OD1A 1PU2A 3KZ1E 1IB6A 3MD0A 2VXCA 1LWNA 2HRCA 1Z4QA 3FYTA 3G1UA 4W99A 4RTQA 3Q9NA 4Q15A 3C6QA 4RLFA 2VRWA 4JA0A 4PX3A 4UM7A 2IZ7A 3PVSA 3FWKA 2R751 3W2EA 4GH5A 4XYBA 5F21A 3FE2A 5B7GA 1ZUIA 4ENQA 1PQUA 2C3UA 4LQLA 4MA4A 3H7AA 4MHTA 1I2DA 1T5DX 2QRZA 4Y9UA 5AK3A 4DR3B 5AOAA 3HZRA 2VOEA 4D3FA 3HVUA 1BRMA 3AMVA 3E8SA 1P81A 1WOMA 2E49A 2JIZD 2FZGA 2P9YA 5DX8A 1NXXA 2OVFA 1NG1A 3BIOA 4HLUC 2XD4A 3W5VA 4EG7A 5EMMA 4BNYA 3IHTA 3W2IA 4EW3A 3IUSA 4LYFA 2QI9C 4QXAA 4R6WA 1NM5C 4WN9A 2I8AA 4P7KA 1JTFA 3RASA 5EIEA 1LNQA 2O52A 1RM4A 2QUIA 4DWWA 5EZQA 1YFJA 1HNXB 3NV9A 4TWZA 2QT0A 3AESB 2JGAA 3K09A 5JXWA 1XU4A 2NXCA 3OQ6A 1POWA 4IO1A 4U7WA 2C04A 3U0BA 4EYGA 3WA6A 1PEAA 3QU5A 2ORWA 3QG5A 3L4KA 4PO9A 4IIUA 3UXEA 1JA0A 1F06A 3PWZA 3FNRA 5DMXA 1BMTA 3K5HA 4C0XA 3T38A 3TB6A 1BGVA 2G9RA 3QW2A 4HVTA 4LCEA 4MW6A 4X5OA 1MPXA 1A9PA 2J3QA 2ODQA 3B89A 4E2WA 4D99A 4F4IA 3C3WA 4DCTA 2VYCA 3HFGA 1IQRA 4CN9A 2VQDA 1I4TD 5SYNA 3I2IA 3G2KA 5IHPA 2WKQA 3EAGA 4F5ZA 1QVRA 5IN5A 1BN6A 4OYRA 2WPDD 3QF4B 4M1MA 3PDHA 3S2GA 3VKGA 5BVHA 1VE6A 3BVPA 3R9IA 2JVIA 2VHWA 4C7MA 2RH9B 4J1NA 1Z15A 3WGYA 3IALA 2VDNB 4M55A 3EMDA 4XASA 1NLFA 2A5LA 5E9JA 2M6RA 4L9AA 4ZC8A 4TV9A 2WKRA 1T5OA 4GM1A 3UWDA 2AG0A 1PLLA 5K05A 1KETA 2EDCA 1UBHS 4YAGA 3BD6A 2Z2XA 4GZ3A 4R6XA 3UMRA 4DCMA 2V6MA 1IBCA 1TCCA 3S27A 4MWBA 3HCEA 1ZMXA 2EJCA 8ADHA 1G17A 1UMKA 1M6EX 2B92A 2H06A 1QX4A 3LQ2A 5CG1A 3CF0A 3TIXB 3X0DA 1UBOS 1SCJA 1T6NA 1KWKA 1K97A 2J08A 1Y3FE 1XL0A 2OYSA 4QD3A 4XSHA 4FCWA 1A88A 1VC2A 2Q8PA 4IG4A 1G8HA 2CVPA 3K32A 5FUXA 2F3PA 5ENDA 4Y2VA 2P7HA 1X8LA 2PS0A 3KM0A 2PFGA 3PUVA 1QO0A 4AF6A 2QTGA 2VPPA 4OCZA 1KK2A 1K9VF 2BGGA 2O57A 3OX4A 4MP3A 1MOPA 4K6MA 2R6ZA 2I76A 2NW6A 1MFPA 5A3QA 5B2EA 1J09A 2X5NA 2QRHA 2JATA 1T2CA 5EIOA 4O4HB 2ASVA 1P1IA 3TM4A 2YRWA 3VR4A 3WK9A 4ZGBA 2O59A 3PEEA 5A3VA 3GGJA 4J0DA 4CM9D 2AHOA 1RQ2A 2R7AA 4RK5A 1UXHA 2QNIA 2WSYB 4U3JA 1NYRA 4YB8A 5J1TB 3TVTA 1ADFA 1SHUX 3M8KA 4D4IA 4HNVA 5KQPA 1DDGA 5D3QA 2C7VA 4FLFA 5LP6A 1G60A 1N9GB 2JL1A 2CXNA 5LMCA 2Q5IA 1UZMA 4QPNA 2ADFA 4PBTA 1HDIA 4YUXA 1UXIA 2FXIA 4I19A 4K1LA 4ZMSA 1NUSA 4DYDA 2XR1A 1KEEB 4MEBA 4EGFA 2OZLB 1E9FA 1UWKA 1XF9A 1BNCA 4EG6A 2CYAA 3E8XA 3QITA 4FQ7A 1M0TA 1ZOPA 5H02A 2ZRFA 2A9VA 2ZK7A 1JIXA 2O8DB 3I9KA 4KUGA 1X70A 1RBYA 4HWGA 5BRJA 5HOQA 3KKLA 1Z88A 1O89A 2GS9A 2X19A 4I6GA 4W8GA 3ASZA 2FPXA 4BNTA 1K7FB 1ZN7A 1ID1A 5LZ2A 4A82A 4FUTA 3B9PA 1ESZA 1XVAA 3F6YA 3HSKA 3OQ1A 5BPFA 3BK1A 2ZAOA 1T4MA 1KPHA 2NUBA 2AN5A 2AE2A 2X40A 1RHJA 5B53A 5BR1A 1EHYA 3RVNA 3IMGA 1KJNA 3RARA 2DQKA 2ATCA 4DZTA 2JLCA 4CEJB 3NS7A 4J0JA 2PG3A 2ZJ2A 3UAVA 3VHXA 2Z08A 3IMEA 3DUWA 2A0YA 3GLHB 4KO8A 3NFYA 3G23A 3P52A 4W7HA 4X1IB 3T9AA 3SYMA 3GPBA 2O1XA 3CZRA 4XM1A 5SV2A 1LI5A 4BZWA 4D9JA 2VDRB 3LGXA 4OQDA 3A9VA 1O8CA 4TOIA 3T0GA 3TGLA 2VDVE 1GPDG 1TEHA 1YK1A 3SPXA 2WE8A 2F8SA 2XJ9A 4MB0A 4MYDA 2Y1OA 2JB9A 3BE5A 3DV9A 4HUTA 2GD0A 4YFVA 1FNCA 1E99A 4HDKA 1JWAB 3DDSA 5E8JA 1L7BA 1Y3BE 1YZKA 1A1SA 3G9XA 1A8PA 3OIDA 3MMPA 4OGFA 3W2GA 3G79A 5DYGA 4F5DA 4HTFB 2IX3A 1V11A 1V43A 4HXGA 1E92A 5A71A 4K46A 3W5JA 5CDUA 3TG2A 1M7GA 2QMEA 2JH9A 5HKOA 3L7AA 4M1ZA 5K8UA 3VOSA 2BJWA 2CHEA 2OHGA 2LKCA 2BJVA 1POXA 2JPDA 3V1YA 1XI2A 3RSOA 1JQBA 4CLDA 5KREA 4LWQA 3OQNA 2H18A 1XHLA 4OV6B 3TPFA 3L8DA 3T99A 5LP1A 1EE1A 2M32A 4I08A 3ENQA 2NO7A 1GTSA 5THXA 3RREA 4D0GA 4GBMA 3PXBA 1RJ9B 1FJHA 2PSDA 3EWSA 1QH8B 1U7OA 3I30X 4MRNA 3O8QB 3URKA 3IDQA 3ZG6A 1QK4A 2YV1A 1OC2A 5F76A 2B30A 2ZYDA 1ETUA 4LJ7A 1ODKA 3JSAA 3ZS8A 1NNSA 3UMMA 5EP2A 1DAOA 3EVCA 5E3IA 1NQWA 2R6DA 2PUCA 3RJ5A 3UNXA 2B9VA 2QE7A 4LRWA 5J5VA 3DZCA 2A59A 3SC3A 2HJVA 1X3SA 4M0PA 3MF4A 4EF5A 5CT9A 4DAEA 5DRTA 4EBBA 4OXXA 2XMCA 1IZ9A 1PYDA 3FYUB 3IMFA 4IH1A 3UT5B 2GTHA 1KEPA 1O54A 3WZ2A 4R0VA 1QPBA 2A4KA 5C0OE 3E48A 3NRJA 5CB4F 5CDFA 1Q6YA 3T52A 4ZI3A 1WSBA 3IAEA 4KUHA 4RKWA 5FB3A 1GQRA 2V54A 3ROKA 3JAMA 4DA8A 1D1QA 5ARCA 5ICFA 1EU1A 1OT5A 1TL7C 3SVLA 1O6BA 1YOBA 2YC4C 2H0RA 4UDXX 1T0IA 2XDQB 2YZNA 4FIDA 2YVQA 5IANA 2QBYA 4DR7B 5BYBA 2AJ8A 2FEPA 2C88A 1I01A 4H6PA 3D8UA 2NG1A 4IIEA 1V8OA 2NPOA 1S4QA 2ANCA 2WJ6A 2WJ4A 1OXKB 3B70A 4CM3A 2HXSA 2POQX 3P32A 4N0QA 3UFBA 4RIEA 2XI4A 4X71A 1XZCA 3SQNA 1J5PA 4F56A 4JLJA 1UBKS 3VSDA 3ND5A 3FKJA 3DG9A 3ELUA 2X23A 4NMWA 4YAEA 5JCJA 1QRUA 2EQAA 3SJAA 3O95A 3HKEB 3B1VA 3HWWA 1K89A 4DS3A 5LJIA 1IULA 2IS2A 3ZI4A 2JLWA 1NKSA 1GGHA 1NWHA 1HDXA 1LK0A 3QFTA 3RRXA 1X42A 2PH3A 4LYAA 3DE1X 5TQVA 2WWTA 4LK2A 3BMNA 1TUIA 4NMLA 2G04A 3LXMA 1E3LA 5JSKA 2X2EA 3GN1A 5A7FA 1IPFA 1B43A 1S6YA 2W2KA 5JZOA 1JFTA 1NRJB 1NMEA 1ULUA 3MWDA 5KOHB 3DZDA 1YGPA 3DAGA 4D0NA 2WHEA 6AT1A 3ZGOA 3T1YB 1SM4A 5IUJC 2I87A 3BCUA 1SCBA 4QM6A 3KFXA 1UDAA 2CFSA 3F3SA 5DIZA 3TLZA 1WMDA 2G0NA 2NO0A 1B76A 3QTLA 1GPNA 1JYFA 3CM0A 3TGPA 1H9CA 1TKAA 2J30A 1IE3A 2E4WA 3BAZA 1RM0A 4UFOA 3KXDA 3LL4A 5LXTF 2XUZA 4NONA 1ZNWA 2PZEA 4QYTA 2PZFA 3OQVA 4YJ3B 1KDRA 1RQGA 2XDWA 5KYKA 3FVWA 3C4JA 4TVOA 4QGFA 3OMXA 5FI0B 4QGHA 4FEAA 3EXHB 5ILQA 4AYXA 4B9AA 3LY7A 4GT1A 3SHFA 1YUMA 4N7BA 3HKCB 5F52A 1CJSA 3M5WA 3PCTA 3ZVRA 2O2JA 5K1ZA 4QEZA 1TAHA 5DX0A 3E0XA 5MN4A 4IJ5A 1ZAKA 3OT1A 1L5WA 3P9QA 4HYQA 1Y5MA 1PUIA 1A2QA 3DHEA 5ESRA 2WFLA 3PGXA 2GBIA 2JCVA 1J0AA 2XXBA 3JQEA 3PPYA 3TWOA 1UPAA 4AY5A 1BVRA 2D7CA 3M7IA 5BQ3A 1T26A 1I5EA 1P9NA 3K96A 2AFHA 3JAWB 2AW5A 4FCTA 1CPYA 4IWXA 4YXWD 2Y92A 3N2EA 2R68A 1FPMA 4MS1B 1DKQA 3TW8A 1IOWA 2R6JA 1CF9A 4HJXA 4PZ9A 4QOSA 1PGOA 2J4DA 4F2DA 4YMGA 5I3CA 4HFMA 4HNQA 1PRYA 2O8DA 3HCWA 1WRBA 2ZVJA 3OFNA 3DLIA 4YRFA 3BSFA 1BXRA 3CTPA 1KWGA 3GRKA 1C30B 4L76A 3RC2A 3U0VA 3S2EA 5CH8A 3LG2A 2BD0A 4B73A 4ESVA 3ADBA 2I2WA 4FYKA 4UC0A 4CIBA 2Y6VA 1X7YA 4MDEA 5LQKA 4IHJF 2C07A 4GZ5A 2HLDD 4BX0A 3L02A 1GU1A 1O95C 1UKYA 4RK7A 2NPFA 1QU3A 1J97A 1SHZA 4H15A 1OAAA 4D81A 5GJWC 1RRFA 2CFIA 1WW2A 5FTNA 5G4LA 5H1YA 4ARBA 6YASA 4CEJA 5K0LA 3PGVA 1KSGA 1ABBA 2O2DA 3R74A 4KIUA 2F48A 1W75A 5AO9A 4MI1A 3DSRA 1BWPA 1RI5A 2XUPA 1GPJA 4C0WA 1Y6ZA 3TJRA 3FKQA 5I9BA 4CIWA 1ZUD1 1J9EA 1DEAA 2FPIA 1I24A 3OE7D 3G7SA 1TI7A 4YRQA 1KZ4A 3RF6A 1RLTA 3KLPX 3ZX5A 2BEKA 1ZM2A 2VLIA 3CVJA 1XDZA 5LCXA 4BFXA 4EARA 4KYTA 4FYMA 3LUPA 1AKEA 4FGLA 2HA7A 3BCSA 4KRGA 3GPIA 4Y0VA 1Z0SA 5ENVA 3K1YA 5AW9A 1DJMA 1H1TA 2EX1A 2D7JA 1DC6A 2PZLA 3TQOA 1ENYA 3VA7A 1KI9A 2HHCA 2JASA 2X7HA 3M6VA 3HYSA 4L8WB 3HDQA 1FFHA 4PPNA 4INAA 4CETA 1EFDN 5K3OA 1YB7A 4R9RA 3UJPA 2NVUA 4OI2A 3W2FA 5FTLA 3HL4A 1PG0A 2Q50A 3GBSA 2NTNA 5KKNB 3HY6A 2CD7A 2A0KA 2HZBA 3GN2A 3V4OA 5E7MA 4US2R 5MDHA 3IV9A 4OLFA 1INLA 1U98A 1WCV1 2HWKA 3ADDA 4OQLA 5FULA 5IKXA 2JJ2A 4FQ5A 4N40A 3U4QB 1QHGA 4FWIB 5AW1A 1VSQA 3L0YA 3LYHA 5CVTA 2O8EA 3WKBA 3ZXXA 2Z3WA 4OX9Y 1KI8A 2BFDB 3KQWA 1L4GA 3UQYS 5HPYB 1RYEA 3COZA 4FZ3A 2X2FA 1HRKA 1C9YA 1YVEI 4OUDA 4NCKA 4YRMA 1AZSC 4RK1A 2XNHA 4YUZA 5KWEA 2P67A 4M36A 2JFZA 4IFIA 4IEIA 2VATA 5BUQA 4ZTUB 2VI5A 3TK1A 5C4GB 1EHCA 3IUBA 1CUYA 4RIIA 5HBGA 4P0PB 4LGMA 3PQFA 1UKCA 3DMRA 2IUYA 4GQBA 1N0WA 4BFWA 3VKVA 1V48A 1WUYA 3BOSA 1AB5A 1E8DA 4CODB 1YA4A 1BCSB 1WVGA 2BFCB 2O2GA 2R00C 3AFGA 4KDCA 3TYXA 3G2HA 1AOXA 1SBIA 2C0QA 2HWXA 1NRIA 1G66A 2OEPA 3F5DA 3QWAA 2KS6A 4AJ2A 4DSTA 4NCAA 2X8JA 2ZUEA 2P9TA 2X9VA 1ISPA 3C43A 3PC7A 4ND5A 1HT1E 2XUQA 3W4IA 4Z7QB 3ZBUA 1HFKA 2GAIA 2J3MA 1FNDA 1QGAA 1KI7A 1XJ5A 3ADKA 3RYTC 3LHIA 2W0MA 5J4HA 4HATA 4OL0A 2WDZA 3W6PA 2GBFA 4TMYA 1DAMA 1GUFA 4JDPA 4N47A 3RB8A 2NP6A 1XPUA 4P5EA 4TTTS 2H2AA 3L77A 1PT7A 1JKXA 2ZJ3A 1JJBA 3WIUA 7GPBA 2FFAA 2NOAA 3WHLA 3GA0A 1GZSA 1A7KA 3L40A 4TV8B 5EXSA 3DM9B 1USWA 3KJXA 2PQ2A 3HKEA 1ZM4A 3V1NA 3T7IA 5HR5A 3IKTA 3O91A 3D4OA 4PC6A 4ZOEA 3CO5A 5LB2A 3ZUPA 1EVZA 3EEYA 1F4LA 1I3KA 1U28A 3KKMA 4XWWA 1RYDA 1GRRA 1AO3A 1RI4A 2XEDA 2ZBUA 2Y8EA 3RIMA 3STHA 2P6MA 4LGVA 2I8LA 2WHXA 1RLOA 2E5WA 2F1IA 3HUTA 1U8UA 3QFSA 3L46A 2F7SA 3EYWA 4KMOA 1NQUA 5BUSA 1ZH4A 1XVLA 4RVUA 2DUUA 1M74A 2SBTA 4IFBA 4P7BA 5GY7A 1U80A 4Z54A 3T7EA 2XA1A 4MR8A 4C0QC 3G89A 3X1YA 3W1WA 1ZA2A 2PT6A 3FFBA 5EMKA 1YZTA 2W48A 2FMHA 3FHLA 4UPVA 1S2IA 3EXHA 4JY7A 4NXMB 1T8PA 3K2BA 3PC8A 5IBPA 1WSAA 2Z8ZA 3FLBA 4O08A 3E82A 3E15A 3KB8A 3T5TA 5EUCA 4OLAA 2YDYA 4HRYA 5LBIA 2GBCA 3A3NA 1HKHA 2TMKA 2FRVA 1CNMA 2XQVA 4PQYA 5JDCA 1P3JA 2J5QA 1YNSA 4IMIB 1OV6A 1XZQA 2ZVPX 3LBNA 2FCAA 1HTBA 1DV2A 1X1DA 1OKKD 3NKVA 4DG9A 4R54A 3K9QO 3G2NA 1TDJA 4YY3B 1U5BA 3T1TA 1NQAO 3KX2A 3PL5A 3TAHA 4QFMA 2F43A 4Y98A 5DYNA 3DB2A 5L4NA 4DEXA 4H6WA 2VDKB 2C94A 1J49A 3R3WA 3ZHRA 3R40A 4D5EA 1W5SA 3B3AA 3IERA 2JLSA 5H59A 3K4QA 4LUCA 1T5HX 4DV7B 3RABA 5CLIA 3B1KA 4DM3A 5F98A 2ATIA 2IKSA 4JLOA 4EI7A 3ZU5A 3WYDA 2FPRA 1TZCA 2O3QA 2VHYA 2LD4A 4JYPA 2PEZA 3BH7A 2H5IA 1JSLA 3G9UA 3HXLA 4PG6A 4FFWA 1COWA 1G6Q1 4P4SB 1Z62A 2WSMA 2J1LA 3HE3A 1H8ED 2TECE 1M8FA 3UUWA 1U2GA 3X1JA 5KAPA 1T2VA 2WABA 1W0JA 3DTVB 1EX7A 1KNXA 1XSEA 2V4MA 3FOCA 3RADC 3CVUA 1DXQA 5JYCA 4CFZA 2QTNA 1JR4A 4HBGA 2IUEA 5JE8A 4UTNA 1ECGA 1YZ3A 2VFAA 3ICOA 1FRQA 2QN8A 2P77A 3U26A 4H1TA 1TT7A 3B52X 2P5SA 2E9SA 3D0QA 4GEKA 2YHBA 4XQ9A 3D2LA 1RMQA 5KYNA 3O8OA 4QJBA 1KS9A 3DMTA 5IXJA 2UUBB 4LF9B 4ZQBA 3ACDA 2XXJA 4YC7A 1LF0A 3L0ZA 4JR2A 4LV5B 1D8TA 4PRKA 1I0LA 1RJDA 1HG1A 3E3AA 3TTVA 3I9LA 2GLTA 4J43A 2I71A 1KKMA 4ZVMA 3BMCB 3ICCA 1D4OA 3L4SO 2FWPA 3WQQA 1PT5A 2VQ3A 3K72B 1MVLA 2Q4DA 1N7JA 1VJCA 2AMFA 4GE3A 3I1YA 3AEXA 4O2BF 1T6XA 3STXA 5IX8A 3AEQB 4IRXA 4YJHB 4AKHA 1HTTA 1JE0A 3T7JA 3GFQA 1IQPA 2BOVA 4K6KA 3ANTA 4RLHA 4F4CA 2BM0A 2CF5A 2I3GA 3EJWA 4G8DA 3VYVA 3G5LA 4CM7A 4BYMA 2IBTA 1ZSVA 2BKLA 4X54A 2HCJB 3EG9B 5A06A 1GCIA 1ZGHA 2HGSA 3TFWA 3WIOA 1SH7A 3FWPA 4LVNA 2J3JA 2M6KA 3STVA 4JAVC 2UZ0A 4UW9A 4ZZ2A 1RIFA 4OIFA 3OIFA 1TMKA 4HNRA 4IM7A 3THRA 1GTVA 4AY2A 1E63A 1L7DA 3KELA 4L1KA 4UAUA 3V1UA 1V6AA 3PICA 4NCHA 3SZMA 3J81k 4HB3A 3WYCA 1YA8A 1FNMA 2HFKA 1M33A 1P7PA 3C98A 4QOJA 3O4JA 3LTNC 1KVUA 1GDTA 5KTTA 1FBNA 3TNLA 2EEZA 2MYTA 3MT9A 5G4KB 4BKMA 1VSBA 1Z2CA 1Z3IX 4PLTA 1JHUA 4M7RA 3DV2A 1D04A 1ZCFA 2QZSA 4ZT4A 4D9FA 7YASA 4EELA 1JDUA 1DTWA 3WMWA 2X42A 5JV5A 4MQMA 4O3FA 1TLLA 4F8YA 1U7DA 3MWJA 5DHAA 1CRLA 3CW9A 1IEVA 5LYJB 2FMFA 4BQQA 4A3SA 4ALJA 3VHRA 4QOFA 4BX8A 2I3BA 1SBZA 3W7BA 1HZZA 1UPCA 3Q7EA 3TLAA 2O23A 3U1VA 2L82A 3TB4A 3W3AA 3TX2A 1YRAA 1N8NA 1ZM3A 3RC9A 4KFRA 1Y9DA 4B44A 1R27A 4U7JA 1OI2A 1THZA 2QMQA 1LI4A 2KE5A 3L7LA 5C3MA 2AI2A 3FRJA 2QAGA 3TRIA 1OA0A 3S81A 2WIGA 4DV6B 4FC7A 3ETEA 1DOAA 1WW3A 2W22A 4QQRA 1SBHA 3ROTA 1HDGO 2ON6A 4WVFA 3UOGA 4DQUA 4TMFA 1QGUA