3L0IB

Complex structure of sidm/drra with the wild type rab1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
162
Chain Sequence
SMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSRGAHGIIVVYVTDQESFNNVKQWLQEIDRYAENVNKLLVNKCDLTKVVDYTTKEFADSLGIPFLETSATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DrrA
publication title Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Protein binding/protein transport
total genus 28
structure length 162
sequence length 174
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l0iB00
3W5IA 4MGYR 2ZU6A 3I92A 5J5CA 4Y0AA 2IYVA 1E9DA 5AUQA 4MDFA 3KL4A 4ON9A 1A82A 1KZ7B 1FP6A 4DUGA 2JLRA 2IYTA 1XJQA 2ORIA 4ZIRA 3BORA 4BLPA 1ZD1A 4AI6A 1W2HA 3SBEA 2GETA 4B48A 2V6JA 2OZEA 4BWYA 1JQJC 1XMSA 2OUKA 2ZE8A 2ERXA 2YYZA 3H1TA 4P31A 4TYPA 2CJWA 4OI2A 3IKJA 4GZMA 1I2DA 2HF9A 1QHXA 2XEXA 4DT1B 3AKEA 2WIAA 1N6KA 3I72A 5AJVB 1TL7C 2NG1A 4HLUA 4YXWD 4H9GA 5KO2A 4HB0A 4PFSA 4U5XA 1GUAA 3K0AB 1CIPA 4H1VA 2Z6VA 4PSKA 3QF4A 5D3QA 1IXZA 4LBZA 3RRYA 1LNZA 2GZAA 3U7FB 2IXEA 5EP2A 1RZ3A 3BC1A 1OXUA 5AUOB 1RW4A 3N70A 3THOA 1JR6A 3WY9A 3GLIE 4OQXA 1XEXB 1W46A 4KCGA 3SS8A 5JRZA 4Q9JA 4BEJA 1T3HA 2OLKA 2ZXUA 2H8KA 5SZHB 2REOA 2IUSA 3THWB 4KSCA 1EWQA 2QMEA 3QKRB 4IXNA 1TQDA 2W58A 4W5JA 3TSOA 3OE7A 1KK1A 3GJ0A 4AIIA 4AYXA 5FPYA 3UWOA 2GBLC 3L82B 5FR2A 3T61A 3AQ4A 1X86B 2EU8A 4G5QA 1TQ6A 1UKEA 1ZD9A 1VHTA 5L8VA 4D4LA 4QL3A 2YC4C 2F1IA 4W9MC 1KKMA 1M74A 3PXGA 1E2JA 1SKYB 1T91A 2YVUA 3HU1A 4FMBB 4IXMA 3S1AA 1Q1BA 2XSZA 4NKRA 2A5DA 2Z0MA 2RGNA 1FQKA 4C30A 2QAGA 3LXRA 4QNMA 5B30A 3RWOA 1NBMD 1OH7A 2WOOA 1TQ4A 1SVLA 1U9IC 2ECKA 2FPLA 3GFPA 3FPAA 1G8FA 2XZLA 2BC9A 2JLQA 5CJ2A 2P6UA 1JI0A 2UZIR 4A0RA 3MWYW 1TMKA 1CBUA 4DDTA 3BWDD 1UAAA 1XTSA 1CXZA 3UG6A 3OFND 2JASA 4QHYA 5SZJA 3L0PA 2JLVA 3I61A 1SQ5A 3DMDA 3B1VA 3ETLA 2V4ZA 2GWHA 4NCJA 1DAFA 2B7BA 2QY9A 3MLEA 3QG1A 3CPJB 1MOZA 1T9HA 1OFHA 2CLSA 2GJ8A 3GLHA 3NDPA 3TSWA 4JLAA 3GMTA 2XXAA 1KI3A 1Z5ZA 3A37A 3PIRA 2G9NA 2P6NA 4Q48A 1Z0DA 2BEKA 1NNEA 3K0CA 4DEYA 2G77B 5AUNB 1AS2A 3K53A 1YZUA 4US0R 4DDVA 3LO5A 1DO0A 3A58B 3NTUA 2ODBA 2YWHA 1AS0A 5G41A 4ITRC 1GOTA 1XD2B 4TL7A 4M4SA 2FMXA 2WPDA 4OK3A 2J7PA 4LV5B 3T1OA 1AKYA 1A7JA 1W7AA 3IIMA 2GJAA 2EFDB 2JJ1D 2QSYA 4IDOA 4JZKA 4CRWB 4BEBA 1OLOA 3U44B 5E95A 4NCKA 5KSZA 4IEIA 1BKDR 3ZZ0A 3F5FA 3UG7A 4DIEA 1Q1QA 3RABA 4N3NA 1E2KA 4IEEA 5HE8A 5KNDA 3ZD7A 5FI1B 1G64A 4G1UC 4CDGA 2J0QA 2XTZA 3A36A 2GXUA 3K09C 2X2FA 3K70B 3NBZC 2C2HA 1J7KA 2O5VA 2DYKA 4LYJA 3NC0C 2XZOA 2BVNA 5TXGA 1L4YA 3TAUA 4C7OB 4A2QA 2V9PA 1E2EA 821PA 1AQUA 1N5KA 3QKSB 4IOKA 1CR1A 1ZM9A 2QENA 3GFOA 2E1RA 1H65A 1E2LA 1T3LA 2YNMA 1JEEA 1MABB 5F3WB 4F92B 3EIQA 1W1WA 4EPYA 5DI3A 3VR5A 1G4UR 1E9SA 2VSOA 4TT3A 2WM9B 4KVGA 1NP6A 1EFHA 2ZE6A 3D6TB 4NCIA 4YMTA 2FGJA 2QP9X 4GRAA 4JL8A 2ZM5A 3PQCA 1N0WA 2QZ4A 3IO5A 1UPTA 5DYGA 1EX7A 4DLUA 4FCWA 1W49A 1E1RD 2AX4A 1LVGA 1P60A 4A4DA 4ASUD 4DEXA 5JHHB 3AF3A 4DLRA 1G7TA 1GNPA 1CULC 2QNRA 4AG5A 2BJWA 4B2IA 2DCUA 3MWKA 2NMVA 5KNBA 2JDIA 1GDDA 2J0SA 4TQAA 1MRSA 1W4CA 1PLJA 2BM0A 1YQTA 2A9KA 2ODNA 4M9ZA 5CLLA 4OBEA 5EZ5A 1VTKA 5GJWC 4CIDA 2E9SA 1IN8A 5CIQA 3VR2A 2IBMA 2RGEA 3DL0A 1SZPA 4BRWA 4Q4LA 3DM5A 1ESNA 3EA0A 3K0AA 4B3GA 5P21A 5FPHA 1DAGA 3SC3A 3PJRA 2KI5A 1OE0A 1JPJA 3G82C 4B35A 2P2LA 4PQYA 4PAMA 4TMWA 2FSFA 2WWIA 3OIYA 3UIEA 2ZR7A 5DGXA 3K0FA 1XZQA 5C4GB 2GXQA 1VYUA 2DFNA 3FFBA 1NLYA 3VMFA 4URYR 3LX5A 3THXB 4BFVA 2WJYA 1SVKA 2C8VA 4RSGA 2ZRHA 2FG5A 1S1MA 2H1LA 2QORA 1SXJD 2F43A 1Z6TA 1KDOA 4PPNA 1OHHD 3B1XA 3THWA 1G16A 3GLIB 1YR6A 2XITA 2IUTA 2B21A 3QKRA 2EWWA 3SFZA 4AYWA 4EJSC 4GDFA 1D9ZA 3AEZA 1QHYA 4B3CA 1R5NA 5CJPA 2QMUA 1SXJE 3L43A 2F9LA 1KHTA 5G3ZA 2OFXA 5JWHA 3RDPA 1KI6A 2ZI6A 1UM8A 4Q9IA 2IUUA 1OFTA 3CF0A 3T5GA 1UKZA 3GJ8A 1XEWY 2FU5C 3KFVA 4M1TA 3NHAA 5EXSA 3UK6A 2ZJ5A 5K8TA 1B23P 2QP4A 3PFIA 3W3AA 3L8YA 4HSEA 4HUQB 3EAQA 4BRUA 4TMVA 4CVNA 4Q4JA 4MKGA 3TGPA 5GVSA 3HYTA 5DHAA 1H8ED 3RSLA 1E2PA 5M04A 2J0UA 2G0NA 1UF9A 5DIFA 2PJZA 2FN4A 4GP6A 2RGCA 1SVWA 5J40A 3BAFA 4WA7A 5B58C 1OXXK 1R0ZA 3VX4A 4XD7D 1PZNA 1GP2A 1KSJA 3IQWA 2QN6A 1G5RA 3EW9A 4LYFA 4G01B 5EXTA 2IYRA 1P73A 2QU8A 2J1LA 4RZUA 3PEVA 1J90A 1XCPA 4KBFA 4W5HA 3BB1A 1E2MA 3W6NA 2VHQA 5JSZB 3U6KA 3DMNA 5E7IA 4KFTA 3LLMA 5FTNA 2C9YA 2R6CA 1WMSA 1YR8A 4HDQB 5JMTA 1JJVA 3D8BA 1SVMA 3K9GA 4O2RA 4JJZA 3JZMA 2WBLC 4MRSA 1SHZA 1TF7A 4M22A 3WHLA 1NLZA 5BQ5A 3GLHE 4BUJA 1PLLA 3LBHA 3QF7A 5EQTA 3BE4A 4L4UA 3FFAA 5L3QB 2OXCA 3X1WA 3KJGA 4KLZA 3T06B 1JECA 2WPDD 3L0IB 2FA9A 2DBYA 1XTIA 4UNPA 5KSYA 5LD2B 1FX0B 4QM6A 2VP2A 4TSFD 1XTQA 1J8MF 2D7CA 1MO3A 1N6RA 3C15C 2O0KA 2OLJA 4DSNA 1PLKA 2VPPA 3DKPA 2NO6A 2ZVPX 4PSVA 1Z47A 3RNLA 1CLUA 3RLFA 2EFHB 3EZ7A 4Q4AA 3CNLA 1G8HA 2AD5A 4V0MA 3SJZA 4C0JA 2HDNB 5JCZA 3R8FA 3FMFA 4M1OA 1Z6GA 1ZC3A 1VKJA 3OEHD 4IVQA 1N2CE 4JBYA 1II8B 4FW9A 2XB2A 1TEVA 3OHMA 3RWMB 4JBXA 2J46A 1NN1A 2J5XA 3AF1A 5DSZA 3TKLA 4PZZA 2FF7A 2IEZA 1RIFA 1G3QA 4HAXA 2WSMA 2H57A 2PBRA 2WZQA 3LAWA 3MWJA 4IKEA 3WP0A 2ZE7A 2I3BA 1UFQA 1KI9A 2O8CB 1XTJA 2YOFA 2XNSA 1S96A 2VHTA 4S2EA 3MUFA 3ZYCA 2WJHA 4KBGA 1YR7A 3ZQ6A 4B2LA 1MABA 1WBBA 4CEIA 4BFZA 2W6IA 1DAMA 1MV5A 2ZS9A 4AKEA 3SQWA 4M21A 2NO9A 4RFVA 4ZDJA 4AY2A 4OQFA 4PQFA 4G5RA 1E6CA 2G1JA 3NWJA 2F1HA 4B71A 4LSGA 5FBQB 4POAA 2RKOA 1ZP6A 4F4CA 3M1IA 3FE2A 2V1XA 2HUPA 4XWOA 4PR0A 3DOFA 4FMCB 1D6JA 2OCAA 5LB2A 1Z22A 1U0JA 2OO7A 5AR1A 2HJVA 2GAAA 3O8RA 2WJVA 2L0XA 4OHVA 1WB9A 3K0SA 3H84A 2WJIA 1RKBA 3W8NA 3GQBA 1Z6YA 1ZIOA 2EFEB 4M9SA 1XD9A 4PC1A 4TQUS 3LFUA 1E9FA 3AVUA 5TY0A 3CB4A 4UKDA 1YZTA 2CVFA 3FHCB 3TRFA 1KY3A 4PTLA 2QA5A 5DI9A 3REGA 3NIBA 3AUYA 2CJWB 1W4BA 1S4QA 4URWR 1LW7A 3GD7A 2VIIA 2CLDX 1RYHA 2NGRA 5EXXA 1W36B 4HAYA 3H4MA 3HU3A 4QGFA 2ZRBA 1NMYA 4M0LA 5FUVA 2MSDB 4Q1DA 4WOPA 4Q9KA 4G5GA 4JLMA 1ANKA 1AIPA 1KMHA 2SHKA 4U7DA 3U5ZB 1EG7A 2FNAA 2ZSEA 2IXFA 3SU8A 4KFUA 3PEYA 4OQNA 3C8UA 5B64A 3QF4B 1YZNA 2P0EA 2FH5B 5DYIA 4ABYA 4ZDKA 1G7SA 3BOSA 2XJ4A 2GXSA 4TMZA 3GLIA 4LJ4A 2XGJA 1T3SA 3QY0A 3U6BA 2JAQA 2VHJA 1FTSA 2GJKA 3NBFA 1YRAA 4B33A 2JJ2D 4DVGA 3ZIAD 2JLWA 1AQYA 1IJFA 1T5IA 5GADl 1G3UA 1TF5A 3RRMA 2YV5A 1SXJB 2ZANA 3C16C 1R7RA 3P32A 2GCOA 5B2ZA 1B0UA 1Z0AA 2ZI9A 2QMHA 2J41A 2OCBA 8OHMA 1UADA 2X19A 3QG5A 2OBMA 3KQNA 2J87A 1UEJA 3EC2A 3WYGA 2AWNA 4ZO4A 2OAQ1 3OAAD 5EP4A 3SJCA 1ZC4A 4RZXA 1CP2A 5JI2E 3U3MA 4R7ZA 4B6FA 2BMJA 1S3SA 1Z6AA 3BFKA 2WMOB 1EK0A 3S1AB 4OL0A 4D82A 2C78A 2W6JD 4XJXA 3CX6A 2X1VA 4LV8B 4URUR 4DRZA 2QGNA 3P4YA 1XPOA 1MKYA 1E2QA 1N6OA 2QAGB 3X1DA 1Z0JA 1AGPA 1MT0A 4IJMA 2LWIA 5IK2D 2G3YA 2XNDD 3VQTA 5JBQA 1VIAA 2EW1A 4MGIR 4NP6A 3GEEA 1GKIA 1NBMA 2A5FA 1KO8A 1Z28A 2KBEA 3VR1A 2G1KA 2GRJA 1U8YA 4NCNA 4G5SA 1NKSA 1RE0A 1ONBA 1I4LD 4TLAA 3C5CA 1YR9A 721PA 3A1WA 5FR1A 3O8BA 2FEMA 3OFNA 521PA 4I4LA 3KX2A 2GNOA 2KJQA 3CRVA 3W6OA 3MG9A 1A2KC 4RJLA 1MRNA 3GLHB 1FQJA 5DISB 4ZCLA 1M34E 4X8MA 4HLCA 5J4KA 3PEWA 4A15A 1E79D 1RVDA 4C2UA 4GNKA 2BOVA 2GBLA 4DLVA 4A8JB 1H8HD 4XTRA 3SZRA 2R44A 4BLQA 2WOJA 5FTMA 2IYXA 4E09A 2KBFA 2IEYA 3AF2A 1JAHA 221PA 4PHGA 4A82A 2DY1A 1U98A 5JWOA 1MO6A 1QVRA 5K8IA 1DELA 1ZVQA 2FE4A 3QXSA 2PMDA 4FINA 4V0ME 3T34A 2C95A 2WAXA 4BLRA 3AKYA 4UQOA 1NN5A 3L0SA 1G8PA 4JLKA 4GFDA 4HEJA 5L3SA 3TE6A 1P72A 1N0VC 2LCFA 1E9CA 2JJ1A 3B1YA 4WAUA 2D3WA 2OCPA 4OJQA 1U9IA 4BZQA 2D4HA 2FGKA 4Q4HB 1DG1G 1JALA 1KSFX 1S9HA 2BKUA 2CLCX 2YJTD 2GVDC 2J9RA 3SEAA 4M1KA 3MCAA 4A0GA 3TUIC 4KO8A 2NO1A 3LA6A 4XVRA 3WNCA 1A5TA 2W6ID 4OJKA 3ZS8A 3QEJA 2WMNB 4BFYA 5C1BA 5DN6D 5KNCA 4BPBA 3EG5A 4D4KA 3F8TA 1TPZA 5JJKA 5CB8A 2CHVA 2WHXA 3AGQA 3PENA 1YJ5A 3WMFA 3RYTC 1C4OA 1UDXA 3IBGA 4IDPA 1R6BX 1XJCA 2CK3D 1WE2A 3DKVA 5IRCD 2R6DA 1FW6A 1YZLA 2FSIA 1GAJA 4AURA 2CXXA 2IWHA 1BOFA 5JZVA 2OESA 1OB5A 1NIJA 2DPXA 2XX3A 2IYSA 2ZRKA 1JEDA 4XSGA 1E9EA 1WXQA 5DI3B 2GAOA 4B44A 3U3KA 4DCUA 4A36A 1W44A 4LK2A 3Q5EA 4EPVA 4NYJQ 2BMFA 4NPHA 4YQFA 2IYUA 1TQ2A 5L3VA 2IS2A 3KQKA 1Z3IX 4JLDA 4TN1A 4WXPA 4DBLC 5DNYB 1GRRA 1Z2AA 3ZZUA 1KJZA 4OKSA 4NYMQ 4MKFA 5F2EA 4OHYA 2ZS7A 4MGKR 2O52A 5IHPA 1E1RA 4UJ3A 4DLZA 4ASUA 3A4NA 4MKIA 1T8TA 3B7GA 4TL8A 3FMIA 1GL9B 2O8BA 2X77A 1YVDA 3GEIA 5J47A 5LDDC 4KAXA 4W5WA 3UANA 2Z43A 3HR8A 1KMQA 3WYFA 1XDBA 4I1OA 1IM2A 1TNDA 2QTHA 4QM7A 4Z8XA 3TR0A 1F2UA 1FMJA 1ZBDA 4E07A 2QT0A 4K8OA 2BBTA 2BWJA 3REFA 5CYPA 4DDWA 1OPXA 5EP1A 3NKVA 2RHDA 5FOVA 4GZLA 2QUZA 1KKLA 1MO4A 4NONA 1RPZA 3MMPA 4NE2A 4UXHA 1N3BA 3QNUA 2ONJA 5KUTA 2FFAA 2O8FA 3CIOA 4LHZA 4NYIR 4A6PA 4FWTA 3R9WA 1UBEA 3K0FB 1BYUA 4OI0A 2ODEA 1KI4A 1FNNA 5K8UA 1UBCA 1FZQA 1WRBA 4XTCS 3TSZA 3L0OA 2O0HA 2WWGA 4LYHA 4ACBA 2F43B 1G3IA 3D7MA 1G291 2BCGY 1S9DA 1SXJA 4JVSB 1U8AA 3WMEA 3WMGA 1YZGA 4I1UA 1QHIA 1TUEA 1M7BA 1OHHA 1FOEB 1UJ2A 2JA1A 3CUEF 2IYLD 4OI1A 1G21E 1KNQA 1EXMA 1VECA 1KI6B 1EESA 4LX0A 3LX8A 3IGFA 2ZSBA 5FL3A 2OBNA 4TLBA 3N2IA 3UMSA 4LJ8A 3AP3A 2Q3FA 4V0KA 4HUTA 3CR7A 2ZUBA 4QNRA 4URZR 3PV0A 5TDHA 2WSSD 2QT1A 4HLDA 1WP9A 3PG5A 3TMKA 4HAVA 4Q4JB 3QUSA 1G5PA 1ZM7A 3OEED 5BYJA 1G9XA 3PUZA 1W0KD 2J0UB 2NOAA 2REBA 4PHTA 1E2GA 2WV9A 1H8EA 4Q9LA 1O87A 5DLQC 3CO5A 3K0EA 4PPGA 4QG7A 1Z83A 2GA8A 4HZUB 1IONA 4P4TA 3SDZA 3B2EA 2GCPA 2CNWD 3SQXA 1N5IA 4XD7A 3ZVNA 3CONA 4HI0E 3VR3A 2V8OA 1NBME 2V7QD 2C9OA 4XIGS 4O3MA 4M1SA 4PHFA 2MMGA 4C9BA 3I8XA 2GVZC 1GKYA 1GG2A 1XMVA 1C9KA 4LBWA 2G88A 1VHLA 2C98A 4LHYA 5KTYA 4BLOA 4Q1FA 3AVVA 3OESA 2IW3A 4U02A 1KI7A 2MSEB 3KXKA 1ZIPA 1KZGB 1G7CA 2PMKA 3K9LA 3PCRB 1NG9A 3RRZA 1M1YE 3SBDA 5E7MA 3MGCA 3BERA 4D0LB 1NSTA 4WBSA 3B1ZA 3R8CA 3T35A 3FGNA 3E1SA 1E2DA 2DWPA 5JS7A 1PJRA 1ZINA 1NLFA 4A8JA 2I1QA 2R9VA 2RGDA 4JL5A 2GK7A 2ZIAA 4DLYA 4WIAA 3BJIC 2C04A 3TQFA 3V9PA 4A0FA 3IDQA 1HT1E 1IAQA 2BEJA 2D62A 2EWVA 2VEDA 3CH4B 3OZXA 4QJ5A 1RC8A 3DO6A 4Q18A 4TSFA 5JFGA 4Q21A 2ZITA 4ACAA 1KK3A 1Q20A 1Q0UA 3CRW1 4Q4AB 1W47A 3CF2A 3BFVA 1LF5A 3RS0A 3BD9A 1Z07A 3ND8A 4Q4HA 4B32A 1JXMA 5GJBA 1AGRA 5FOSA 2ZYTX 1XF9A 2H92A 3PUVA 1U0LA 2N46A 3OEHA 4B43A 1JPNA 1EFRD 4JVNA 4TZ0A 3MWLA 4Q1EA 5J4YA 4ZKDA 4BFTA 2YINC 3TW8B 3BH6A 3QXJA 4HB4A 4O0MA 1AS3A 2QBYB 4LJ5A 3E70C 1G1MA 1IN5A 1VCNA 1DAKA 1P61B 1R2QA 1R8QA 4Q03A 3CBQA 4KXFB 2GEUA 4CZ2A 1NY5A 4NYJR 4OQMA 2KB0A 5KOYA 1Q57A 1OT3A 5ANRB 3H86A 4DXAA 4CEIB 2UVQA 4DLSA 4D2IA 4NYMR 5GJCA 1ODFA 1DE0A 2R2AA 3FMPB 5AJYA 3Q8XB 4DLTA 1A2BA 2NQ2C 3HYRA 2ZJYA 5SZKB 2YC2C 3ASYA 3QJYA 3R20A 1HTWA 1X1SA 1GWNA 1XXHB 3QVVA 1DARA 3LVQE 1U90A 1ZM4A 1SVSA 2QM7A 1I4DD 3KXIA 1OIXA 2BBOA 2QTVB 2AKAB 2HT6A 3OIWA 2PH1A 1EFUA 2WJJA 1KTVA 3LQQA 2P6RA 1CJTC 1KK0A 1XBTA 2BBWA 3KJHA 4CEHA 3LY5A 3V00A 5A4JA 1XZPA 4B73A 2FZLA 3Q7QA 3N2EA 4DCNA 3AKCA 3SYLA 2ATVA 2NPIA 4R2IA 4TMKA 1P7CA 2GDJA 4ZI3A 5TMPA 1F48A 2GHIA 3AB3A 1IJEA 5EJEA 1XJ0A 1ZW6A 3CF6R 1ETUA 2BIFA 4V0OA 3IIJA 4CGZA 4DZZA 1X8LA 1QZXA 4DHEA 4OYHA 5F9FA 1WBDA 4FN5A 1VIYA 1KI2A 3QI2A 2XZPA 4MITA 3ZJYA 1KDTA 4MQBA 2YWEA 5JJLA 3FTQA 1KMHB 5EUQB 2RGNC 4GI7A 1HV8A 2V1UA 2OFOA 1NRJB 1T4GA 2AD1A 2IC5A 2QAGC 4KVAA 5EP3A 1QHSA 3M6AA 4LHXA 1XX6A 4EDHA 1Z06A 1ZUIA 5J4LA 3MAAC 1E2FA 3GJ4A 2EQBA 3B8HA 1VCIA 4V0LA 1JQLB 4F7WA 4F4JA 2RGBA 3KUDA 1GVNB 1NVVR 1W0JA 2FSHA 2VHUA 2Q9AA 4JL6A 1OJLA 5CYOA 3LXXA 1J2JA 4TTQA 2JJ2A 3ZIAA 3AVWA 1BMFD 1XCMA 4B34A 3UXMA 1II9A 1KO7A 1LF0A 2GCOB 1OXSC 2JLXA 1CEEA 2ZRNA 2FDCA 1A4RA 2CDNA 1V43A 3AP1A 5E3HA 4GOJA 2ATXA 5DE3A 1T0HB 3CPEA 4MUBA 3KUCA 3U60B 1E0AA 1AKEA 4TL9A 4UXJA 1AZTA 1T0JB 3WHKA 2GESA 3EPJA 3OAAA 4US2R 2H5EA 1M7HA 4N1AA 1QDEA 4HZUA 1NVUQ 3P27A 4PXAA 3EARA 4LPKA 2AWOA 4IOLA 1P62B 2GCNA 2ZYWX 4AG6A 2YWGA 4DJTA 3ND9A 1FL9A 5C4MA 1JAIA 1Z2CA 3TR5A 2W6JA 4CYMA 2IL1A 2ZJ2A 3H0KA 2AFHE 1NY6A 2HXYA 5JEDA 1NF3A 1G6HA 4I81A 5IK2A 2XNDA 2OCYC 1G3MA 2ZU0C 4MYCA 5EE5B 3DVLA 3AKDA 5BWMA 3ADBA 4BFXA 4A1FA 2LKCA 2WWWA 1L2TA 3W6PA 4LJ9A 3CZPA 5JI3E 3LRPA 4NL4H 4B74A 2PEZA 5IDVA 2IS6A 5DH9A 2QPOA 4K81B 4BASA 4BQSA 3AVOA 1Z0FA 2AK2A 2XTNA 2ZRIA 2W2TA 5EXPA 3EPHA 2JLZA 3RC8A 1ZD8A 4WZAE 3GCGA 5AJZA 2IA5A 1HUQA 4P33A 3TH5A 2ZRCA 4MUAA 4DSTA 1SHKA 1ZU4A 5C46F 4MDEA 4FCTA 3ICEA 1E79A 3QPWA 1Q44A 2BKEA 4QC2A 4R2HA 1MH1A 1ESMA 4JYBA 4TZ6A 3HU2A 4WVFA 2F3RA 4AC9A 3THYA 1H8HA 1BS1A 1GILA 2ZYUX 4PC6A 4W7SA 2WWFA 1PVOA 4ZV4A 1ZU5A 1SKQA 2Q3MA 2PL3A 4IVPA 4Z1MD 3C4JA 4BFSA 4D0NA 1JR3D 3EZ6A 3VFDA 3O8DA 2GXAA 2W2XA 3HPRA 2RGAA 1TX4B 4AWXA 2GZDA 5D3MA 5FTKA 1D2NA 2QP3A 3U3OA 4DLXA 5E4FA 5L3SB 3CWQA 4RCYA 2NZ8A 3ZZTA 2QBYA 2HLDD 2ZAMA 4KFSA 2QQEA 3TVTA 1UBGA 3UPUA 1FMLA 1I4TD 3EA5A 1ZYUA 2FOLA 2OT3B 1EFCA 3SHFA 5KDLA 5FPKA 5H8WA 3L8ZA 4BFUA 3DZDA 3WBKA 4XVQA 1CJKC 2ZS8A 4FMDB 4X8OA 3LWNA 2NO7A 2GJSA 1VG0B 5DN6A 4L15A 3PITA 4KFRA 2QRNA 4DWJA 1ZNYA 1G8YA 1TU3A 2G83A 4Q1BA 1N0UA 5A0FA 2IF0A 3I73A 5CM8B 3R9IA 3Q7PA 2OSBA 1T8UA 3GJXC 2CK3A 3E5HA 4PSAA 1XTRA 4QBFA 3TAHA 2WWXA 5C18A 2Q21A 4TLEA 3HR7A 5DO9A 5GVRA 1XXHA 5SZIA 4GOKA 2PZGA 4Q66C 5A5GA 2REXB 2ZUCA 4HLQB 2JATA 2ORWA 4RD2A 3VR4A 2Q9CA 3SOPA 4DB4A 2XAUA 4PPFA 3T1TA 1OH5A 2K5UA 2RHMA 4KU4A 1HE1C 1P2UA 4HZIA 5BXQC 5FBVB 4FMCF 4HDOB 1O3YA 1YZKA 2C77A 3DM9B 4I1SA 3T15A 4BE7B 4EQ6B 3ADKA 2WVJA 4PANA 3QEOA 5DHFA 4D0GA 3QXXA 3GLGE 2JLUA 4IDQA 2O8BB 4BFWA 5KYKA 3MJRA 4K46A 4Q1AA 1YRBA 4LYAA 4PAOA 1CR0A 4C0QC 1F60A 4TTPA 1FPMA 2GTPA 3NH6A 4Z54A 1F2UB 2IYZA 1UEIA 2VHCA 4KJZA 1E1QD 2VO1A 4EPWA 1SVOA 4HDCA 1N5JA 2NTYC 3RVBA 1E9RA 2RH5A 5FOTA 1G17A 1OFIA 1Z08A 1GITA 1TUIA 1W2GA 1S1CA 2QL6A 1LFDB 1Q3HA 3BFXA 1UKYA 4PZYA 3KQHA 4P32A 2O8FB 3L2OB 4MYHA 3AVXA 2ZRJA 1W0JD 3FOZA 5JRJA 2OV2A 5EE0A 1E0SA 2QQ0A 2A7QA 3SE0A 2OE2A 4CT4B 4DLWA 3BIFA 4TYQA 4RKEA 4NYIQ 3M4YA 1PUJA 3V4RA 1OXTA 2DR3A 3MRSA 2GK6A 4C0BA 1DS6A 2RB4A 2OG2A 2HXSA 2ZI4A 1LTQA 1FTNA 2QE7D 3X1YA 3IHWA 3QPVA 1LB1B 1N6HA 4JLBA 1J8YF 1NN3A 1VMAA 1E9BA 2NZJA 2X8AA 2ZRGA 2ASEA 4LJ7A 1RRCA 1UDWA 2Y8EA 1IHUA 2IS4A 2A5GA 2AHOA 1G4AE 2ANCA 1XRJA 2NIPA 1OB2A 1P2VA 4IVRA 5BYKA 3HJNA 4C0KA 3QIAA 4CF7A 4GPTA 1IN7A 3ZS9A 4EUNA 1VG9B 1N6NA 2CBZA 2WSSA 4MRNA 3ZVRA 1DAHA 3EIEA 3WNBA 1NJGA 5HE9A 4JYCA 1BH2A 3VHXA 1COWD 3LW7A 4PX9A 3OEEA 3ZGXA 1D5CA 1UBFA 3G0HA 2GF9A 3IBYA 1W0KA 5GJVC 4LWZA 4C2TA 3LD9A 4G0NA 5CM9C 2CCKA 5JWRA 2IYQA 4C3ZA 3R9XA 4JSTA 1W4AA 1QRAA 3Q85A 4R71A 3AVYA 1Y63A 5FTJA 2CNWA 2EYQA 3R7WA 5JECA 4JT4A 1GFIA 3B9QA 4QRHA 2ORVA 2ZUDA 2A5YB 2V7QA 3BXZA 5CDFA 3GLFE 3K70C 3ZVMA 4LBVA 3QQ5A 4P3YA 4B3DA 2YOHA 2EYUA 1W5SA 2YZ2A 2FZ4A 2A2ZA 4DDUA 4NU0A 2P3SA 4DCSA 1AZSC 5J4HA 3IHLA 1M7GA 2QROA 4B3XA 4F93B 3BS4A 3IIKA 3LH5A 4AKIA 2ZRLA 4ARZA 1XMIA 4I99A 1JBKA 3W34A 4IOJA 3VTKA 2GF0A 2EFGA 2VTKA 4O2LA 4YMSA 3BH0A 4JSYA 4BLTA 2HEIA 1Q3TA 4PO1A 5FTLA 1KI1A 2ZRAA 1DPFA 3NXSA 4NZYA 1M2OB 1GM5A 4F38A 3KDSE 1HURA 4KHZA 4A0HA 2WIBA 5KU1A 4MYUA 4FD2A 2WICA 4UXIA 1ZNZA 2VF7A 1ZNWA 2B7CA 4HB3A 1CJUC 2GJ9A 1SVIA 4URXR 4D26A 1YKSA 2QGZA 3U2QA 2ZJOA 2ZJAA 4Q00A 1E9AA 1MO5A 3A1TA 3SHWA 1CJVC 3K70D 1KI8A 3IEVA 2O8EA 2VYFA 1U8ZA 4L16A 1Q21A 2WWYA 2R6GA 1EFRA 2ZSAA 3KFXA 1BO6A 1RRFA 2JLSA 2JEOA 2PLRA 5AUPB 3W8RA 1JJ7A 5TARA 5FH9A 2H17A 1F6BA 1KOFA 2DFLA 2RCNA 4JLVA 4P4SA 4BLSA 3Q9LA 3ZH9B 5FL7D 2XTMA 5HKKD 3GJ6A 2PX0A 3QKTA 1GIAA 4LC0A 1JNYA 4DSUA 1XTKA 1N6IA 2WTUA 3ASZA 3UMRA 4KYUA 4GT1A 1JB1A 2A5JA 4GBMA 1P2TA 4PC7A 1PV4A 1C1YA 3QENA 1OSNA 2IS1A 4HATA 3TNFA 2FPKA 4LHWA 3KB1A 4B47A 2YKGA 4GOXA 1XXHE 4JLOA 1XFAA 3EZFA 1NIPA 5LBIA 1HH4A 1DEKA 2WAYA 2IWRA 3QVUA 4XWKA 3BB4A 2VSXA 2JIZD 2PT5A 4M9QA 4JLJA 1N25A 2B6HA 2CVHA 3EZ2A 4TYNA 1F5NA 4EQ6A 5KDDA 2ZSFA 1E2IA 2ZRDA 3KZ1E 4RY2A 5KSOA 1KO1A 3BGWA 3WRXC 2VP9A 1HEIA 1R0WA 3DHWC 4CEHB 1CRPA 3RS2A 3AUXA 2OEPA 2ZEJA 4M1MA 4LV6A 3VU9A 3FKSD 4RZ2A 3UATA 2J7KA 3AF4A 3U7GA 3GLGB 1K5DA 2OM2A 2BCJQ 3K09A 4EAQA 4LUCA 2PEYA 1GL7A 3SNHA 4ERNA 4O25A 2F3TA 3IUYA 4M8NE 1SULA 1CR4A 2GKSA 2AK3A 2KSQA 4LDJA 5ELXA 3FWYA 1I2MA 3EASA 1FFHA 4JMPA 4RFSA 5BN3A 1XCGB 5JJIA 1RRPA 3D31A 3TVDA 1E0KA 1WQ1R 3ONWA 2RGGA 1OIVA 1KAOA 4JLNA 4TMXA 1L4UA 3SFVA 2OXRA 2W2VA 1G7RA 3RS5A 1AK2A 4X8HA 2RMKA 3VNUA 4PPQA 4Q1CA 4KYIB 4XH9B 5FOUA 3JVVA 3RC3A 4AD8A 1GTVA 2IHYA 5C2JB 3P1JA 2QTFA 3IEUA 2D2EA 4II7A 4AK9A 1FUUA 2GZHA 3RHFA 2HV8A 2W0SA 2DB3A 3A4MA 1Y3AA 1U2RA 2YOGA 3IPXA 3MFYA 4YMUA 1LS1A 2CL7X 4PC2A 2X2EA 1S0UA 4IOMA 4KODA 1NMXA 4LY6A 3B85A 3DEFA 2FFBA 3Q3JB 3V4FA 1ZM2A 3RS7A 1OIWA 2P67A 1EGAA 3GJ3A 5KSPA 2QPTA 2AR7A 1X8KA 4MRRA 1Z0IA 1OKKD 1K5GA 1W4RA 4J0QA 4C0AC 1BMFA 3Q5DA 1NVVQ 2FFQA 2HCBA 2XOKD 2VBCA 3WXMA 3TLXA 2D06A 5LD2C 3O8CA 2F1JA 4QJ4A 3HP1A 1VYTA 1OYWA 2ZYVX 4OQLA 4JS0A 1Q1ZA 3EWSA 6Q21A 1Q12A 3B6EA 3ZLJA 3JZAA 4AKGA 2FEOA 3NBXX 3NG1A 4CT5A 2WJGA 4B76A 2PX3A 4Y0VA 3EIHA 2ANBA 1X1RA 3KTAA 2Z4RA 3RAPR 4LBYA 2CHGA 3C41J 2Z83A 5J4VA 3U4QA 3F3YA 4RVCA 3KKPA 1P3JA 1W48A 1OFUX 5JLJA 1GZSA 2QMOA 3EPKA 3B5JA 4WW0A 1S2MA 1S3GA 3P4XA 4OHWA 2A30A 3B1WA 2CCJA 4ZDWA 4XWAA 1TU4A 5KHOC 1P9NA 4V0NA 1G41A 4S35A 3RRNA 1Z29A 1F2TA 5CDFE 3AV0B 1FNMA 3QSYA 3QKUA 4XOIA 3I5XA 3GLFB 1ZUHA 3EC1A 5FUYA 4EJSA 3B82A 4B3BA 4EPRA 2J59A 1AA9A 3WP1B 1N5LA 2YHSA 3U3RA 3CH5A 4D4JA 3TJZA 4IFEA 2BJVA 2IK8A 3DDCA 2KWIA 2V54A 1WDTA 4EIWA 1E3MA 1HT2E 3JVUA 4QHTA 1U81A 5AJXA 1DBSA 5HCIA 4RD4A 4UNSA 4KLNA 3Q72A 4P4UA 4PZLA 4TMTA 2GILA 2OILA 4TYWA 4CEJA 1TF2A 4EKDA 4H1UA 1EWRA 1R5BA 4UNQA 4TQ9A 1XPUA 2H16A 3SJAA 3THYB 1BYIA 4B75A 4QBIA 3KKMA 4IW3B 4E5UA 2ZRMA 4C4PA 1M8PA 2J45A 3A1SA 5FOWA 3HDTA 4HB2A 3K9NA 2DWQA 1QG2A 2ZI5A 1R8SA 1X8JA 5H68A 4Z1MA 1JR3A 2DFTA 1QHHB 3PUWA 4QBHA 5D3MB 5FPSA 3AP2A 2C99A 5F98A 1GRNA 3LVRE 4OI4A 1ZUNB 3B78A 4QOSA 2HCJB 2QEQA 4WZBE 1BIFA 2PLFA 2VRWA 2QG6A 4BZXA 1HQYE 3FHTA 2JJ8A 1HYQA 3I3SR 2HLDA 3IPYA 1NSFA 4M9XA 1KIMA 1KSHA 5B57C 2RGXA 2ZPTX 3AH8A 2OHFA 4NHOA 4WXRA 3LQRA 5CITA 1W5TA 1W36C 4TLDA 1RJ9A 3W9YA 1A1VA 4TL6A 4Z8YA 5CIWA 1V5WA 1E2NA 4HLUC 3WYAA 2GEVA 4F4IA 2D7DA 1DG3A 1II0A 2O0JA 1LY1A 3I4LA 1GRQA 1N6LA 2PT7A 5FBLB 3LNCA 2VP4A 5JHGB 4XSHA 2VLIA 4BECA 4MYTA 1E98A 3X2SA 4DIDA 4GMXA 2DHRA 4GMDA 1EX6A 3NC1C 3CM0A 3K9HA 4JKIA 4QGHA 4XVUA 1G3RA 3EX7C 3NHBA 4C0SA 2IX3A 3LLUA 4OHXA 4Q19A 2IHBA 3SR0A 3U3JA 5HTKA 1SXJC 2ERYA 3W90A 4DUGD 2BM1A 4LCBA 1M6NA 4EPXA 5BN5A 4DCTA 2V55B 3GLGA 3KQUA 4DSOA 421PA 1D2EA 5HZKA 1X3SA 4N0DA 4P0TA 5AJWA 3UKDA 3I62A 2HF8A 3OIUA 5EE9A 4PAQA 1HQCA 3RS3A 4U00A 1E4VA 121PA 2BMDA 3WRYC 3I8SA 4C0HA 1ZCAA 1Z63A 4JBWA 2HYIC 1CU1A 1Z0KA 3KKOA 4A2WA 1W36D 3QBVA 5CK4A 1D9XA 2DFKB 4ZPXA 2AXPA 2B92A 1X6VA 3QOFA 3NBYC 3UWKA 2Z4SA 2VP5A 4TWZA 4URVR 1T6NA 4DT1A 1KDPA 1OF1A 1CR2A 1E1QA 4EPTA 4QBGB 3ADDA 3KXLA 2O8DB 1GSIA 4JVLA 1J99A 1P75A 3T12A 2FX3A 2Q9BA 4NBSA 3GEHA 5FI0B 1NJFA 1VDZA 4M1WA 2FWRA 4L5BA 1ZJ6A 5AK0A 2VA8A 1WA5A 2HYDA 2PCLA 1IY1A 4D81A 2QAJA 4OK5A 5G3YA 1G19A 4ZDIA 1XPRA 1XMJA 2FJUA 3U61B 1P9RA 4KI0A 3GPLA 2F9MA 2FFHA 1XEXA 2IXGA 1F3OA 1S8FA 3IILA 1MR3F 2A3RA 4PO8A 4HAUA 2G6BA 4M53A 4BGDA 3OE7D 4IDHA 3DOEA 4UNNA 4ZCMA 3NEYA 4JT2A 5FBRB 1IN4A 4FWIB 1P4SA 2QE7A 4QXAA 3U7HB 5EUMA 3K0CC 1RYFA 2CCGA 2ZR9A 5L3RA 5UKDA 3T5DA 1GL6A 4A8JC 2PCJA 2R65A 4RD0A 3PEUA 1OXVA 2WWHA 1KJYA 2R6FA 4LPSA 3TUZC 2I4IA 3CRQA 4Q01A 1G18A 3KKNA 4Q7JB 5G53C 2C9CA 3GJ7A 2AN9A 1G20E 1XWIA 3HPQA 3CZQA 4NCHA 2XSZD 2ZROA 3AGPA 3CR8A 3VX3A 2WKRA 1QHGA 2ZAOA 1ZAKA 1DAIA 1IBRA 4YMWA 1E99A 1COWA 2IYYA 1ZMXA 3C7KA 3P26A 1P9WA 2EFCB 2IYWA 4LZZA 1NVWQ 2WKQA 3TW4A 4OHZA 3GLFA 4CW7A 2Z5FA 2H7VA 3NEJA 4EFNA 2JGNA 1HY3A 2TMKA 1TAGA 1SGWA 4MRVA 3R7WB 2R62A 1U99A 2P5TB 1KO5A 4F91B 1US8B 5E7JA 1YHNA 2QSZA 3ZDQA 1KY2A 4PO9A 1E2HA 3EWAA 1IXSB 4ZKEA 5HZHA 1RFLA 4YDSA 4D80A 2VF8A 4LI0A 1Z6XA 3LBIA 3SJBA 1GNQA 1NN0A 3TBKA 3KQLA 5TVKA 4D6PA 2YWFA 4TYYA 1IOZA 2C5LA 2PJRA 3LBNA 1N6PA 4ARZB 2B8WA 1OH8A 1L8QA 2P5SA 4RCZA 621PA 3KKQA 1QBKC 3VHLB 4KITB 5F9HA 3FDIA 2BV3A 1QVAA 2J3EA 2KE5A 4QGGA 4RD3A 1XU4A 2F1RA 4IFBA 1HE8B 2W00A 2ZTSA 1XD2A 2J7PD 3B9PA 4UJ5A 4NTZA 3FB4A 4C0LA 1QHHA 2V6IA 2AFIE 1KSGA 4MA4A 3WBJA 3FHOA 4YDHB 3ADCA 1R0XA 1JR3E 5JCPA 1Q22A 2F7SA 1DTSA 1E32A 3AVPA 2P65A 4IHQA 3U44A 2ZRPA 4JJKA 4RD6A 3DZ8A 3OIVA 4IRUB 1ZCBA 3MD0A 1YZQA 4B2PA 1KGDA 2O8EB 4Q7MB 2B8TA 4NH0A 5LB4A 1P5ZB 3CX8A 5JS8A 4LGMA 4Q7LA 2ZR0A 4E03A 3X1XA 1R0YA 3TK1A 4ILEA 2UKDA 4ESHA 2PZFA 1VG8A 2ZETA 3CWZA 3EXAA 1J70A 4KSBA 4P4SB 5HCNA 3ZQJA 3AVQA 3DPUA 4M1YA 2ZJBA 1R5OA 4C7OA 3BB3A 4ZI2A 4LRWA 4JKYA 5FL7A 4FMDF 2VSFA 5HKKA 3QKSA 3K1JA 4KV9A 3TQCA 3H2YA 3A6PC 3CW2A 2MSCB 2IF2A 2OBLA 2ZVQX 3B13B 5HPYB 4B3FX 4TT3D 1G6OA 1XP8A 1NVXQ 3UMFA 2CEAA 1E96A 3ECCA 1XEWX 4US1R 1OH6A 1R10A 3W5JA 4V03A 4FCVA 4MRPA 3VR6A 4OK6A 2JIZA 4NDZA 2R8RA 4NMMA 2AXNA 3E2IA 2FV8A 2W0MA 3EPLA 3CLVA 4Q47A 4AKHA 2PZEA 1AM4D 1K8RA 3U7EB 1G5TA 4LJ6A 2LKDA 1E69A 1CRQA 1ZNXA 4QHSA 1ZRHA 2JDID 3I5YA 1ZM3A 4WZ6A 2ZQ5A 3VU9B 1LS6A 3KJEA 3ZD6A 2QM8A 2A78A 3G5UA 1PUIA 2FPMA 3QBTA 2BMEA 3VAAA 1CTQA 2IT1A 3FKSA 4ZIRB 4B6EA 2R6AA 5H70A 3T1VA 1KO4A 4ESVA 4HYYA 1WF3A 2BDTA 2JCSA 2O8DA 1KJWA 2V3CC 4RFSB 4M2LA 4FXPA 1T5LA 2VP0A 2ZRFA 3CRRA 1JXOA 3GJ5A 4LC1A 4YONB 3VKWA 5KPJA 5KDOA 3BH7A 4IDNA 4E22A 1CKEA 4R98A 3EZ9A 3W3ZB 1DAEA 3SI7A 5LPNA 1UKVY 1VCMA 5K8LA 2XJ9A 4DC9A 3THXA 3RSOA 2BBSA 1NI3A 4EFMA 4YXWA 4FI3C 2N42A 4A6XA 2H18A 3CNOA 4I1VA 1XEFA 4PQRA 4PC3A 3N5CA 3VNVA 2ZJZA 3PUXA 2NPFA 1DOAA 2J0VA 4RKFA 4EFLA 3GP8A 2GEDA 2ZE5A 2HJGA 2E87A 2ZI3A 4TLCA 4QJ3A 1XD8A 2ZREA 1QG4A 3FYHA 3AF0A 1QF9A 3CPHA 3IO3A 5CK5A 3KJIA 3NH9A 1DADA 2CMKA 3A4LA 4LHVA 4R9UC 3PUYA 5BN4A 4ZCIA 1GKUB 1CF4A 3VKHA 3VKGA 4D4MA 1KDRA 3PVSA 2C03A 4FIDA 3GFTA 1CS4C 2HT1A 1LV7A 1OKKA 1YE8A 3A8TA 2RAPA 3A1VA 3P20A 2XOKA 4Q9HA 3M0EA 1WCV1 4HUQA 4D25A 3BBPA 5G40A 1TTTA 1E94E 3QXCA 1FUKA 3A1UA 3I1FA 4DB2A 1TEXA 4JVMA 4QFMA 3RS4A 1SKYE 3KTAB 4A92A 2CE2X 1D8TA 5BW8A 2CL6X 3U4QB 1DVRA 3J81k 5JEEA 3B60A 4UNRA 2Q6TA 2ZI7A 1HA3A 3FKQA 3IQXA 4BZPA 1US8A 2VL7A 4Q5IA 4GL2A 1Z8FA 1KNXA 2VH5R 1IXRC 3CRMA 2EVWX 2N1BA 5JSZA 3OF5A 2C96A 3BRWD 1F2TB 3CKLA 1VPLA 1Q1EA 5EE1A 4MH0R 3SYKA 2QRZA 4LOAA 4A9AA 1G8GA 4EJSB 3MSXA 4YC7A 1OW3B 2XB4A 1IQPA 2CL0X 2AL7A 3K8YA 5EE3A 3SN6A 4Z51A 3QPUA 1E0JA 5FUXA 2CHQA 2JLYA 3CNNA 1OYYA 1E4YA 1KYIA 1RRGA 5L3QA 4MKHA 1CJMA 4L8GA 4PHHA 4Q7KA 1R4AA 3FMOB 1NL3A 2D74A 4GP7A 4YMVA 1KAGA 4HAWA 4HAZA 1FX0A 1AJEA 2MMCA 1VYVA 1QHNA 2W83A 4G5OA 5FBWB 4QGAA 5AWFC 2XXAB 1OV4A 4N0EA 5EZ6B 3F0TA 3LDAA 4CEJB 2Q3HA 2ONKA 2VQSA 2ODWA 3X1ZA 4DCVA 3KB2A 4G3XA 3ZVLA 1U0HC 3C14C 3O47A 4X8LA 5FPTA 3HWSA 2OFWA 4RD1A 4TTRA 4V02A 1ELOA 2QPAA 1KK2A 3ICQB 3LW8A 2ZJ8A 1NKTA 1NMZA 1DO2A 3QE0A 1VG1A 1II8A 1AN0A 1IY0A 4LJAA 3FVQA 3C5HA 3T1QA 5CB6A 2G0TA 4MGZR 2D2FA 2DWOA 2BHRA 3AM1A 3PR1A 4JIMA 5IF9A 1FP7A 1TADA 3BK7A 1RJ9B 2NO0A 1P2SA 2CE7A 1IY2A 3MJHA 3LV8A 2O8CA 5FFMA 2OAP1 3QXHA 5IT5A 1VCOA 4AYTA 2I1VB 4L9WA 1IN6A 1L7VC 1XNJA 4L9SA 3WNDA 4DKXA 2WKPA 2VP6A 5TB5A 1XB2A 2QI9C 3SYNA 3AVTA 5CLQA 3NVAA 3CX7A 2FSGA 4GSYA 4LJYA 4QKQA 3TIFA 2UZ3A 2F6RA 4JLPA 3NDBB 5HR5A 4RZ3A 1NG1A 3I32A 4Q02A 1EFTA 3D3QA 5TV2A 1P6XA 5H1YA 5FOXA 1D2MA 2ZSDA 5FUWA 2Q0HA 4YLGA 3RANA 4A2PA 2AKYA 3TUJC 1K6MA 1U94A 5KPDA 1YU9A 2F55A 1GNRA
chains in the Genus database with same CATH superfamily
1B8VA 3PHCA 4YWHA 4GXQA 5I9NA 4L8VA 2VTBA 4MGYR 3F2VA 3SHQA 3TKYA 3Q3HA 4J29A 2IYVA 3G8AA 5D6NA 4A3SA 1U4SA 2I76A 2YFKA 1WLSA 3ZLTA 4AN1A 4ON9A 1JIQA 2NT3A 4ZMSA 1A82A 4WCDA 4A91A 2EC5A 2IYTA 1XJQA 2JCYA 3RF7A 4OOFA 3QZUA 4YAEA 1H9BA 4TKUB 4S1PA 2UYCA 3EIFA 2EZ8A 5EA2A 2EBUA 2ZT7A 2PT9A 3THSA 4JI0B 2GETA 1VE6A 4N5IX 4RE6A 4B48A 4JENA 1PWYE 3NNNA 2OZEA 4BWYA 2OUKA 1WXGA 3KYDA 4O8CA 4Y6SA 1C7IA 4KVZA 1SWVA 2PL9A 4KKXB 2B9EA 3ACCA 2WF6A 2CJWA 3BCSA 2FN8A 3L0BA 3UUGA 4ARSA 1WW3A 3OOHA 3ONFA 5FFNA 2FMKA 3KWLA 2HF9A 3G9XA 2ZUWA 5A7GA 1RYNA 2NPOA 4BVEA 1JW9B 1Q91A 3AKEA 1X7XA 2BKVA 1KF0A 4EK9A 2NG1A 1CR6A 4HLUA 2DQ4A 2VQ6A 5KO2A 3NU1A 4HB0A 4MJ3A 4BWGA 1PEAA 5M3BA 1E4EB 3V2IA 1T43A 1CIPA 1M3SA 1H85A 1NE2A 2Z6VA 5KOHA 4G97A 4JUIA 1RQPA 2ZWMA 1POXA 1YB4A 1I36A 3DXZA 4LBZA 3DFMA 1LNZA 3K35A 4UPVA 1C3OB 2VQFB 4MVJG 2QTNA 3O6VA 5EP2A 5A5DA 3BC1A 5BT9A 3OJOA 5IZ4A 5C81A 3RNOA 5AUOB 4GIBA 1H9AA 1WZEA 3N70A 4H60A 4UUOA 5FA5A 1QQTA 5AQEA 4HGNA 4KCGA 5K3SA 2A58A 3EFEA 4FHCA 3SS8A 1L7QA 1T3HA 3K05A 2UXBB 1IUKA 1SY7A 1I24A 2XGOA 4N03A 4EKYA 1Z35A 1YB1A 3THWB 1FFXB 3EG9B 3TSOA 1N2BA 1Q7CA 3IFSA 3OPXA 4IFTA 5DCYA 4YHHB 1PQYA 4PG6A 3CPSA 1FFDA 1NYLA 3GJ0A 3LRXA 1RAEA 1YRWA 4E1BA 1C7ZA 5JJBA 2M9MA 1MDFA 2R5WA 2VXCA 2AT1A 2HRDA 3D4BA 1BJTA 3IMEA 1H3FA 1JQ3A 4RVHA 1B8OA 1BEZA 4G5QA 2V5VA 1ZIYA 1IBSA 2DPLA 3HL4A 3RAJA 3TZCA 1UKEA 5L8VA 4QDXA 1KP3A 1U3GA 4XDYA 1KEKA 1JDJA 1EA5A 2NUAB 2Q8NA 3VV3A 5SYMA 2ZIGA 1GTRA 3PXGA 1MD9A 1T91A 4FMBB 2DG2A 2FF5A 3DP7A 3ABIA 2A5DA 4BWVA 1U3VA 2H63A 2ZXEA 4K6MA 4P81A 4P84A 3W06A 1AMOA 1H2FA 5IH3A 3LXRA 2O3TA 3Q9NA 2K2QB 3CUTA 1B93A 1FMCA 1LI7A 2JIOA 2FPLA 3RM3A 3KAPA 4LF6B 4K6CA 3I3OA 3JS5A 4UVDA 2IV3A 1AU9A 1TRKA 5AKXA 3TZQA 3ZWYA 2XZLA 2O23A 5IMBA 1FVOA 4Z2YA 4L4RA 2UZIR 3QVKA 3LKVA 4FB5A 1NVGA 3ABRB 1TOAA 5EVCA 5JY1A 2YRXA 1Z5NA 1ZUD1 3K32A 5GM2A 1XTSA 3NYIA 3NETA 4B17A 5IASA 3M49A 2JLVA 1HNWB 1GDHA 3CZ9A 3DMDA 4UZSA 2BI8A 2Y68A 1JIKA 3TNLA 2GWHA 1U28A 1DAFA 2J4CA 2R00C 1IHDA 1KGSA 2CLSA 2IXBA 2JVIA 5KNDH 5AM0A 3D3WA 2FI1A 4OLFA 1KI3A 3H7IA 1RCUA 2G9NA 1NR5A 3L4BC 4A0SA 1LI4A 5I8ZA 4BO0A 3U4AA 4S1NA 1W1UA 4DTCA 3E05A 4TT8A 3CGGA 4UHHA 5LXTB 3K53A 1TVKA 1RC0A 1W9MA 5E4TA 2NVUB 2HW8A 4PYQA 1ULTA 3RHSA 3NTUA 1U9CA 2ODBA 2YWHA 5FLKA 3M9XA 1AS0A 3WOVA 1GOTA 1NAHA 1XD2B 5KWJA 3C97A 2E4ZA 2O2GA 4R8SA 1GAEO 4TLLB 3T5PA 2L17A 4QXQA 4GGPA 2RK6A 4BQRA 3K6JA 4A8TA 3T1OA 4ZO6A 2YV2A 2NNWB 3GRVA 1KARA 3KZVA 3CJTA 4PLPA 2BGWA 3IIMA 4MIEA 1ABFA 2EFDB 4M36A 4X7RA 2QSYA 4CRWB 4IDOA 1Y3BE 1L4MA 4DCPA 1BJRE 3UYLA 1S2NA 4B3TB 4XFJA 4PGGA 5KSZA 1HRDA 4RL4A 3ZZ0A 2JKZA 1SIWA 3CZCA 5EMLA 3SIWA 2FSVA 2NU6B 4TRRA 1I1OA 5HE8A 3PWKA 5M5BA 1GSOA 1VKOA 3ZD7A 4CN8A 2ZTLA 2J0QA 2XD9A 1JKJB 1BW9B 1WCIA 2PR7A 4HVAA 5AVQA 5J2UA 3T7DA 1WSAA 3A6HA 2XZOA 3GROA 4L5IA 2ORYA 1F14A 4HMOA 4UBJA 3K6RA 1CUEA 3DUFB 1TKCA 3N0VA 3AR8A 4OXRA 1JAZA 3CLTC 4WGFA 4KQHA 4R16A 3TAUA 5JC1A 2HIHA 3ZDEA 4A2QA 1E2EA 3E3OA 1U7OA 1QC5A 4Q4DA 3IAFA 1UXHA 3SPXA 1FLNA 3OBBA 5A2GA 1AVTA 1GGNA 2QENA 3GFOA 4Z0HO 5JDCA 4P1ZA 4QUHA 2EERA 4X6LA 4QPNA 3N7AA 4YJ3B 1CQXA 2AH5A 4UPDA 3W77A 4IG4A 4OJYA 4EHDA 5F3WB 5BRNA 2VF5X 4QYSA 3VR5A 1ESDA 1G4UR 3U0VA 1CC1S 3IAEA 4DPMA 4ZYYA 3R6DA 2VSOA 4TT3A 5CCBA 1VJTA 1P44A 2JCXA 1MJ5A 3PFBA 2H6EA 4H35A 4KVGA 3UFBA 4YMTA 2GNPA 2WV7A 2YVQA 1RS0A 4IDFA 2UUCB 4GRAA 3M3HA 3MUOA 1FSZA 3VU9B 1QFZA 1DP4A 1N0WA 2ZG6A 2I8LA 3DP9A 3EVBA 2YJ5A 3H1FA 1V5EA 4DLUA 4LGVA 1W49A 3ZCPA 2GTHA 3R24A 4QT0A 5C9ZA 1Q1NA 1R9JA 4TSRA 1CULC 4MVJI 3JYNA 2GHTA 2DCUA 2WRZA 1RHMA 2FW8A 3WWPA 4LF4B 2BHLA 3L0YA 4KH0A 3UK2A 3OZEA 1M76A 2JDIA 2QIPA 5JE8A 2Z1MA 3RGWS 3S7ZA 1PLJA 4X00A 1YQTA 4NF2A 2PUEA 3G0DA 4DUYB 3OSUA 5AW7A 4B4WA 5EZ5A 1WPQA 2PGLA 2E9SA 3JR3A 2IIQA 5BY2A 2RGEA 4MJ7A 1SZPA 2I3DA 5DP1A 1WB6A 3IHTA 4UAJA 4DM3A 3DM5A 2PS3A 1J1IA 2RI6A 3K0AA 2IPOA 5P21A 3IUJA 2PUBA 4BMXA 4C01A 2PKEA 1DAGA 2BM9A 5B1HA 5AOBA 3PJRA 4EARA 4QVGA 1MMFB 1JPJA 1OE0A 2IYAA 1TT7A 4B35A 4PAMA 3PXXA 2VOEA 4TMWA 2FSFA 2ZUFA 5JS2A 4N8EA 2AR0A 5DGXA 2KQUA 3JYLA 4RIFA 2VJPA 2GXQA 1YR3A 5C4GB 2XQFA 5AVOA 3VMFA 4M1QA 4URYR 3CRZA 3VAYA 3THXB 1XZBA 1ZOPA 4RSGA 2FG5A 2PZMA 1DNPA 5AM3A 2GQ0A 1S1MA 4DTIA 5CFLA 4EGSA 3NM6B 1E0DA 4E2YA 2HPZA 3PNQA 2IOQA 1JV2B 3RT9A 1NE7A 4IR7A 5AKGA 1YFLA 1NURA 1V3UA 3LQ2A 1IXKA 1G16A 1YR6A 1DQZA 1B0AA 2QW1A 3KZXA 3QKRA 3SFZA 3ZHYA 4AYWA 3GLUA 4CODB 1D1TA 1QHYA 1RLUA 1Z7GA 2GPJA 3A6LA 3AEZA 3I9V1 4UMEA 1SXJE 4TYMA 4QU8A 3RQSA 4C7JA 1VB5A 1H42A 3PS9A 3B70A 1A97A 3QLEA 1QZ3A 5H9WA 1KI6A 5B5SA 2R0QC 2V6BA 2VJMB 4KE9A 2ZI6A 3TQTA 1UM8A 1K7SN 1ISMA 2OBBA 3BWEA 3EXFB 2WTXA 3CF0A 1J0XO 1O6BA 3CVUA 1JZTA 2XUIA 2K87A 2NADA 1LPSA 1T2UA 2XWQA 3KFVA 1X7HA 2CFCA 3T7EA 2DERA 3W2GA 3GFGA 4QTUB 2NNLD 3A32A 2QP4A 2QSJA 2NUTB 2WG2A 2XB8A 3EAQA 3I30X 1BS9A 3W3AA 4TMVA 2VI5A 1OTHA 3VKVA 3TGPA 3HYTA 4RM3A 4R3NA 3V4OA 4ZOAA 3AJRA 1R88A 2XMRA 2JI9A 5IHXA 3QU9A 1UF9A 1CRZA 2ACWA 1CZHA 2RGCA 3HWWA 4H27A 1SVWA 1COZA 4WA7A 3MTJA 4A5SA 1KFCB 1R0ZA 5C8VA 2N0SA 5LQMA 3CUSA 1A71A 3OOJA 3C39A 2C0PA 2C9MA 3PQ4A 2IZ1A 5EQFA 2Q1TA 1RYEA 2QN6A 2V4MA 3RD5A 4D92A 4X91A 5JPIA 4XVCA 5CDYA 1M5RA 2IYRA 5HRUA 4RZUA 4B9EA 2OXEA 2LCIA 4RIHA 4XYBA 5F78A 1L5KA 2GWRA 2FG7C 1YSCA 3K7EA 1E2MA 1T4CB 4MV0A 2Y99A 4ZAVA 1APBA 3VPXA 1JA9A 1I7DA 3WGUA 1ZA1A 1R6DA 2P90A 2NU7A 3LLMA 5JXIA 5AVKA 3GRKA 2R6CA 5KJCA 3DVRX 3UCXA 3JW8A 3K9CA 4ISCA 5AKLA 1G2PA 3A7EA 3D8BA 4KWTA 1PRYA 3K9GA 5AHXA 4JJZA 1GNSA 2WBLC 1U0GA 3AU8A 3OOYA 4MRSA 4X64B 4U7GA 3D8UA 5LDGA 2Y92A 2GKGA 3T5CA 4AZSA 1CUUA 1CVRA 4DMUB 2HQRA 4LDNA 3BJZA 1TB4A 3TTYA 4HX5A 3G0BA 3LBHA 3QF7A 1UMBA 5EQTA 3VNSA 4EG4A 2Q1XA 4BIIA 3R0IA 1P7PA 1R0SA 4IUBS 4OKIA 2HB6A 2J9GA 4EY4A 3OCCA 2XQVA 3PWSA 4FBLA 3FLEA 4JI6B 2VP2A 3Q10A 4NATA 1PF7E 3FUXA 4PRYA 3EMBA 1X2EA 4N5DA 4JDUA 3DHYA 3ZE1B 3F4BA 1ZLXA 3SBOA 4N9QA 3C15C 4RH3A 1Q0RA 3KZNA 3ORQA 1OAAA 1PLKA 2EP8A 2O4UX 2NO6A 2ZVPX 3EISA 3G8YA 4ZZ0A 1AV6A 1LX6A 3RNLA 3HKCB 4CMHA 1CLUA 1AV7A 4CDNA 2J8ZA 4CU2A 3S2FA 3QVWA 5DW3A 4R1TA 3M9LA 2AD5A 5B37A 1JSZA 5MN6A 2Y66A 4BS9A 3CX4A 5EPOA 4M1OA 3SS9X 4ESOA 1RP7A 3SZMA 4IVQA 1DIAA 1EBFA 3SFTA 4RH1A 1MX9A 3REOA 1V8OA 4J7XA 5D5QA 1JEQA 3TYXA 4JODA 3OHMA 5CB4B 2C82A 1XIVA 4JBXA 1WD7A 2GFIA 4X5OA 3AF1A 3TW8A 4P4NA 4IFIA 2SKDA 1Q77A 4PZZA 4TROA 3TKLA 2FF7A 3C4QA 1P77A 5CHYA 4MQLA 3K4PA 1R1DA 2C92A 2QIOA 1FTQA 2WSMA 3MWJA 2C8KA 3GH3A 3OCXA 4IKEA 3U4CA 5BUSA 3S99A 3PYXA 1K9SA 1GFWA 2G5PA 2I3BA 3E3AA 1GT91 2HMYB 4BMNA 2I4LA 1PJTA 3TGLA 3OQPA 3GAZA 2QN1A 16PKA 3WYNA 4MMZB 3EEOA 3MUFA 3A9RA 3ET4A 3FLBA 1H2ZA 5DEIA 1PS9A 3VR5D 5DDIP 4B2LA 2AEMA 3V2GA 2W6IA 2GN9A 3AERB 5E8JA 4DIOA 4AKEA 3E8XA 2KYRA 1ABBA 2H4FA 1DO8A 1Z17A 2DQKA 3EVAA 3HUTA 2VKTA 3PHLA 4YUVA 1PGNA 4B6QA 1T24A 4C21A 4CLOA 4J4TA 4GSKA 4LSGA 1WUTA 2JHFA 3RQIA 3ECAA 2UUBB 3PGVA 2NYAA 4EJFA 1T4MA 4G37A 5BNIA 1JIJA 1ZP6A 3ZY6A 4F4CA 1UFKA 4OQQA 2V1XA 2HUPA 3I9MA 3L41A 3RFTA 1FY2A 5JNLA 2Z95A 2EEZA 4HWPA 4PR0A 5K0SA 1IBKB 2IH4A 4WHMA 2GM5A 2OCAA 1PP4A 2PGOA 4KDRA 4MROA 4RMJA 3GXBA 2FEPA 5LB2A 2OV8A 5HQ3A 4JP3A 1RKXA 5AR1A 2WKWA 3VPDA 4DMKA 8AT1A 3GZNB 3WYCA 3NCHA 4YP0A 2JGDA 2EEPA 5HCUA 4V1CA 3SIRA 3AR7A 1LLFA 5THKA 3JAMA 2BHTA 3HV2A 1UPBA 3HLKA 3TWOA 3W8NA 1T34A 2EFEB 4DV6B 1XD9A 4UUMA 1RYYA 3REQB 5B7QA 3O4FA 3FLAA 3FHCB 4N3AA 3VMMA 2V1UA 1QYDA 1KY3A 3F6YA 3HCDA 4PTLA 1I13A 1T9KA 1X7WB 1Z4NA 2GUGA 4J16A 3REGA 3NIBA 4DV1B 1DKUA 1VLLA 1P0QA 1U1DA 3ZWMA 2XCRB 1XZEA 3CZ4A 4URWR 1JMKC 5I5GA 4R2KA 1U5AA 4FZ5A 2VCEA 3F74A 3A27A 4IIJA 3S81A 1P2GA 3H4MA 4FGKA 2W4QA 4I6EA 4R1LA 1BHSA 2WD7A 5DNEA 1Z8DA 4WXMA 3IP3A 2GNAA 3EXHC 1NMYA 2P2ZA 3BWYA 1RLMA 3DDUA 3L9WA 1K1EA 4IWYA 4JLMA 5FUVA 3UJ7A 1EE9A 1KMHA 1AIPA 4PBTA 2ZSEA 3SU8A 5EQJB 2X7XA 4KFUA 4OQNA 2ZUEA 1MEJA 2JVKA 1SUBA 1YZNA 1FSGA 2BFMA 3KALA 1A50B 2WIKA 3COZA 3C6KA 1N2OA 4H6XA 1BVYF 1LCIA 1LK5A 1T0UA 2CZCA 2Q5IA 4GXNA 2PANA 4TMZA 2WYUA 1J07A 3GLIA 1T3SA 1CEQA 3VYRB 3T3NA 1FS4A 3HH8A 5FT9A 4DJEC 4P7GA 4RJTA 1RP1A 2YY7A 4QFBA 4G9EA 4Y1FA 4RWZA 2VPYA 1MOSA 2JJ2D 3SQLA 3DLIA 3SYMA 5LNK6 3CUWA 3TDKA 1AQYA 1KY5A 1T5IA 3CY6A 4AZWA 1D09A 4ZHQA 3AL2A 4DPKA 2JGMA 5L53A 1ORVA 4MI9A 1J39A 1J9ZA 1R7RA 4ZYUA 5A3RA 5B2ZA 3P2EA 4DIKA 1B0UA 2IDMA 4MVXA 1BE8A 1LLUA 3KQSA 1MOQA 2BLLA 1YDWA 4JK3A 2X19A 4P83A 4BRSA 3M6XA 2OBMA 4K9RA 1UEJA 3EC2A 4C22A 4JXJA 2AWNA 4NV3A 3V48A 2Q0QA 4ZO4A 1VE7A 4ISBA 2VUTA 2DUJA 3JALA 3W2TA 5GY7A 3ZK7A 3ROXA 5A1TA 1AB5A 3GT7A 4R7ZA 3U3MA 2HU7A 1JEOA 1S3SA 5ECYA 1Z6AA 5G0VA 5I51A 3BCRA 4ALKA 3R3ZA 3RUIA 2FUG1 4W5NA 2CD7A 2GYYA 1LRLA 4QTTB 4WQMA 1JHVA 1ESZA 3NKLA 2FPUA 3S1AB 3S2UA 1TTPB 1SKMA 3CX6A 3OLXA 5L4SA 4U0JA 2X1VA 4S1WA 3D8HA 2QGNA 3BA6A 4H59A 4DRZA 4E7OA 1E2QA 5GONF 3K5PA 1AGPA 4E2ZA 1CE8A 3VQTA 2VHZA 2LDXA 3ZOZA 4Y1RB 3OLCX 4WFJA 5KTTA 4FR0A 5DBHX 1KO8A 5JMOA 3AR6A 1FYEA 1D5WA 2ZJ0A 3M6IA 4MSUA 4P54A 3OTHA 4J8PA 3STWA 2EJTA 4YFVA 3SM3A 1ONNA 2IP1A 2JS7A 2VT3A 3EFOA 4E30A 1QR6A 1TA4A 1M0TA 4FDMA 1USGA 1OI4A 2WPNA 1ONBA 4NQZA 1KVRA 2VK4A 3X2EA 3NWEA 4I55A 3C5CA 3ZBTA 4Z3KA 1DKPA 2IZ7A 3OX1A 3K92A 4PNZA 4XI9A 2OO3A 3QEMB 5KYNA 3FZQA 1IZZA 1QO0A 1U2DC 1NXPA 3GBVA 1DIHA 521PA 4EHIA 3HZRA 1D1QA 2VDQB 3KKZA 1ND5A 3L1IA 4Q3BA 4PZAA 3B2QA 3X0DA 5BWLA 2CMGA 1JXAA 3D64A 2D2IA 5AXDA 4E31A 4X8MA 4ECAA 5J4KA 5M29A 1RVDA 3BXGA 1U3UA 3AWIA 5CVCA 2B4TO 4GQAA 1JR2A 2VNIA 1DHRA 1F5SA 2P9FA 2C7RA 4HXYA 1PTJC 2CUZA 2PTGA 2ZPAA 3KQOA 2D5AA 3OLWA 3K15A 1QOZA 4G8BA 3NEPX 4X45A 3N6VA 1A5SB 2C7VA 3FH0A 4EW1A 5EWLA 5IJWA 3HB1A 2IYXA 3N86A 1FJXA 1UDRA 2IEYA 4PHGA 3ENWA 4K6HA 5HMLA 5K8IA 4CQMB 2GRUA 5AW5A 1Y4AE 1ZVQA 2FRDA 3FCYA 1L8XA 2QK4A 4IGAA 4NRDA 3C6ZA 4FINA 3HMKA 1T9GR 2C95A 4V0ME 3T34A 2WAXA 3CKKA 3TCXB 1NN5A 3B6MA 4JLKA 4L8WB 4TSKA 3SM9A 3R3WA 4ER6A 4HNTA 5L3SA 1AGXA 1EKXA 3AQIA 5HILA 1N0VC 1MLDA 1N2CB 1VBMA 2JJ1A 2LCFA 2P9EA 1J0DA 3TJMA 3WKBA 3GA0A 4ZCSA 4ND4A 4BB9A 2FGKA 3KWMA 3M6MD 4IUDS 2X3FA 3CSSA 1JALA 1L1EA 1KSFX 2CLCX 3MS2A 4Q1VA 2Y2UA 2YJTD 4PYKA 3BJRA 3KYBA 3MCAA 3AUTA 3TUIC 5IULC 1FCJA 1TXGA 4XVRA 3RBXA 1P4JA 2FPIA 1A5TA 4GICA 2W6ID 5KNCA 1FXSA 5LYJA 3PSHA 1OU0A 3INGA 4MV9A 1EYZA 4FYWA 3LU1A 3UCEA 2BFCA 1GA1A 5CB8A 3A2LA 3RE1A 4ALNA 1UAYA 1DIOB 1RPAA 2KM1A 1C4OA 3T3PB 2WWRA 4D96A 3IBGA 1FPQA 2OC4A 4HG2A 1R6BX 1QCYA 1T2DA 3SVLA 1W96A 2BSAA 3AUUA 1X7DA 4YCAA 5JSFA 5IRCD 2REQA 4B1FA 1FW6A 3L6UA 1LBTA 1XL1A 2D1FA 2FSIA 3ZE2B 5LIRA 1GAJA 3C43A 1LC0A 4P53A 2QZJA 5ICMA 2IWHA 1BOFA 3B5EA 1U0FA 3DHNA 4NFSA 3PQFA 4G1MB 5JZVA 2DPXA 3GJTA 1VI2A 1OB5A 1AUXA 1P8AA 2Q7OE 3R0JA 1E5QA 1L7BA 3NYQA 3VR4D 3K3PA 3WAJA 4PG5A 4A36A 3UA3A 1RU3A 3SSMA 1RQNA 1T2CA 1YDGA 2JHGA 1XP5A 2LP4Y 4DREA 1PDVA 2IYUA 3ELUA 5L3VA 4AP6A 3G2NA 2C2KA 1Z5PA 4R5HA 3ODPA 1D4AA 3G1UA 1GRRA 4HX9A 4V2UA 2JFXA 3TL6A 4OKSA 3TPZA 3ZZUA 4BVHA 4NYMQ 3WKEA 4ZK2A 4AY6A 4MGKR 2WMDA 3MRXA 4UJ3A 4YQFA 1ECLA 4NARA 3RVMA 3TO5A 1U3TA 2WQ7A 4IF4A 2Z2KA 1YVDA 3O9MA 3HADA 4EF5A 3BDIA 1XZNA 4KAXA 1SXHA 4C5BA 5BQOA 3HG7A 5EWMB 3FGZA 2QTHA 4M0LA 5KTNA 4Z8XA 1KJNA 4YRQA 1W76A 1KMCA 1NQUA 1Y37A 3FUCA 1XKLA 3LHDA 3SVZA 1V48A 5CYPA 4DDWA 1F8XA 3BXEA 3JYPA 4EY7A 4NONA 1I2ZA 4CLXA 2UV8A 1UXKA 2CNKA 2RGWA 4ZXFA 4MCAA 1CQWA 4B8ZA 1JSCA 2Z5VA 3MELA 5KUTA 2O8FA 4LHZA 1P31A 1QLJA 4NYIR 4FWTA 5FEUA 1RM0A 2VKQA 2ZYDA 2QVBA 4R1UA 4CHGA 4NBLA 4OMCA 5HZGA 1GXSB 1CY6A 4OB6A 1Z5VA 3GHHA 4BJ3A 8ATCA 1YDEA 5K8UA 1I80A 2B35A 2OAGA 4XTCS 3G7NA 2O0HA 2UVPB 2VYNA 2IYFA 2NV0A 4QO8A 5IN4A 4OHRA 1ADCA 1WU8A 2D54A 3GRPA 1XPJA 3SJUA 1L5FA 4QDJA 4RTJA 5AI6A 2VPIA 1AK9A 1YAHA 2I3GA 3EMDA 3JAWA 3MGAA 4FOPA 4REQB 4YRMA 3MSCA 1H4QA 1H93A 3P9QA 1EVIA 4F97A 2OCKA 3T7AA 1X14A 2G07A 1G2OA 2WKSA 3L77A 1Z38A 1RJEA 1SU7A 2IYLD 4B81A 1G21E 3AU9A 2VUUA 5ELLA 3B38A 1EXMA 2CLOB 2DAPA 2H7CA 3EEQA 4UEJA 5CVDA 1IRXA 3NTRA 3FTNA 2ZSBA 3ZU5A 2OBNA 3BGVA 3D8RA 1UWVA 3L93A 3BWBA 4TLBA 3RW9A 3UMSA 1DT5A 1KJIA 2XVAA 4RY8A 4RK6A 3CR7A 3VC3A 4AM8A 2ZUBA 2CZQA 3CCBA 4DMLA 4EJ2A 2RBEA 2NXJA 2Y1GA 2WSSD 4I50A 3G6WA 4HLDA 1WP9A 4KO4S 1Z4JA 3AW8A 4HAVA 4IIEA 4Q4JB 3OEED 4C7BA 4H31A 3GVPA 5K3BA 2JEZA 2ZRQA 3PFFA 3C5WP 1NXVA 1LTHR 2J0UB 2MINB 2ZLBA 1LKZA 2WV9A 4ND7A 1NXTA 1YCGA 1XDZA 3ESRA 3O83A 4PFKA 4Q9LA 4YQZA 2C8LA 4O29A 1XZHA 3K0EA 4A27A 1L7RA 1MGOA 3L1HA 4MIYA 5IBPA 4RXTA 1ZUWA 2CYAA 3ZVNA 1ZH8A 2POCA 3CONA 1U1IA 3O9ZA 3QI7A 1UP7A 1QO0D 2GVZC 2WLSA 4AX4A 3CUKA 4LBWA 1QXSA 4GOND 4JYAB 4UW9A 1SCJA 2C98A 4H3KB 4UFNA 3SZGA 4BLOA 4WKOA 4MR7B 1WG8A 4OQDA 4BDTA 1KI7A 3KXKA 3QLVA 1Z9BA 1A27A 1OX6A 2C1ZA 2I33A 2PMKA 1SQGA 3G2PA 4H7FA 3SBDA 5CFPA 2YXDA 1NG9A 3BERA 1NSTA 1ARZA 3UJAA 4UVGA 3UJDA 3T35A 3FGNA 3STYA 3RVLA 3HEMA 1HT0A 1OGIA 3ED5A 3G88A 3K2QA 3OZGA 1WV1A 2WILA 2XKJE 4HWKA 4KIWA 1ZINA 5BSFA 5CGZA 2POQX 4YNBA 1N3YA 3EGWA 4I4CA 4RKQA 4UDXX 2R9VA 5KOJB 1M34B 4JL5A 2PV0A 1UBNA 3VJLA 3FNGA 1RXYA 2C04A 1EUZA 2H3HA 2WTAA 3FVVA 2F3UA 3GGDA 2EWVA 2C4NA 3UJ9A 3CH4B 1RC8A 3E2MA 4RFLA 1EUQA 4IQGA 3P0HA 4O1HA 1M2VA 2XXBA 1NOKA 2CD9A 2R2GA 2ZITA 1VL6A 3OWOA 4ACAA 4AMYA 4D3SA 4AICA 1S01A 4Y6GB 1HGXA 1Q20A 1LX7A 4BB6A 1BFUA 3GJZA 4C4YA 3CRW1 5ALFA 5J23A 3X44A 2JK1A 3WIUA 1UPAA 2K4MA 4OX9B 2WIGA 4X3OA 3D1LA 1H1LA 4FLEA 5LJLA 1BEUB 2DC1A 1P17A 2VTVA 4IZOA 2QM3A 2H11A 3H5IA 3ASVA 4XQEA 1NI4B 2AYXA 1VZ2A 2H0RA 3O8OA 4M9CA 1Y3FE 3RBZA 4FEGA 1B1AA 1M2FA 1Q7GA 1XA4A 2AQIA 2N46A 3QYPA 3TG2A 2WP0A 3FDZA 5J4YA 4DV2B 2RGRA 3QXJA 3JWJA 2X5JO 2B61A 3FZGA 4XUGB 4BNWA 1N2JA 3T5BA 5LSAA 4Q3OA 1R12A 2QTRA 1VCNA 1H0KA 3AFHA 3JQAA 1RNLA 2XGMA 1UPCA 5JMWA 1MO2A 3HP4A 3K96A 5F3DA 4R3UC 3SNKA 1R8QA 4RPGA 3DAPA 3TL3A 1NY5A 4QICA 4HEQA 3CF4G 3ZI7A 1N77A 4Y0NA 1IUNA 2FPWA 4OQMA 2KB0A 1DDGA 1Z3CA 5ANRB 4LSZA 5BORA 2I4RA 3H86A 4W8HA 2CL5A 2UVQA 3ORSA 4DXAA 4CEIB 1UBHS 4WDRA 3DLBA 4MTCA 1XQVA 1OI3A 1PAUA 1V4NA 1RI5A 2Q46A 4CUJA 3QX3A 3BICA 4L1KA 3F7NA 1MJGA 1A2BA 3OMWA 1U65A 2GCEA 2PZ8A 3MRTA 3UMBA 2HWUA 4CTOA 4OB8A 4BMYA 4PCLA 4E2WA 3ASYA 3QJYA 2HSWA 5TQJA 1X1SA 1NBEA 4NFHA 1AXEA 2BRUA 1GZUA 1F51E 1XXHB 3QVVA 4CIYA 2HRZA 3DHVA 4FXOA 1U2SA 1WDKA 1A9XB 1ZM4A 4GHWA 1WMDA 3KSRA 3F3MA 2FR8A 2R97A 4M8LA 3UICA 1NLUA 1VJGA 3AL3A 2HT6A 3RK0A 5FF9A 1V37A 4FIZA 4KN6A 2JANA 3NV9A 1VSQA 1FRNA 2BBWA 2H7XA 3KJHA 3WWZA 4BMOB 5HP4A 1SVUA 2J0EA 2NSJA 2AMJA 3LY5A 4RIEA 3V00A 8GPBA 3N2EA 1Y7TA 1HDOA 3ASUA 3GQBB 5CJJA 1E3WB 4FK8A 4FN4A 2ZSHA 3EXEB 1I51A 4JN6B 4TMKA 5BSTA 1MJGM 3KAJA 4O4JF 4S04A 2WB4A 5C52B 2GDJA 2YRFA 5TMPA 4MS3B 5IBQA 3HDHA 2GHIA 2RBGA 3CLTD 5K9ZA 1IJEA 1PWXA 1XXLA 1XJ0A 2NSYA 2ZBPA 4V0OA 1ETUA 5EJEA 3L7LA 3VSDA 1DIGA 2FZVA 4DZZA 1X8LA 1QZXA 4CQLA 5F9FA 1HE2A 1MDBA 3G2OA 1I7NA 2IUYA 4MX8A 2HA2A 5CH8A 1TYEB 1JE0A 5KYUB 1DEXA 1ODIA 2OVFA 4OQPA 3OU2A 3WICA 1JDNA 4MITA 5K99A 2QN7A 5EFOA 3HY3A 4YWJA 1KDTA 4DBZA 4P98A 3U26A 2XUJA 1P7YA 4ZGGA 5CA0F 2B34A 3VR0A 2RGNC 3FPLA 4JZYA 1KEVA 1V11A 1QYXA 1T4GA 2AD1A 1G4HA 3FNRA 4KVAA 5C7LO 3M6AA 2BFDB 1XX6A 4H0CA 3R0QA 2AG8A 3ZG6A 2H06A 5DHSA 4FEEA 2RC5A 1BXRB 1ZUIA 3ZW9A 3NIDB 1Z82A 1JTEA 1YE3A 3BTOA 4KX5A 2EQBA 1BCRB 1EJ2A 3DTYA 4F4JA 1CK4A 3FFTA 5LC1A 5JQGA 1AGYA 1NVVR 2O3QA 2FSHA 1UJBA 5I9LA 3OHPA 1M6HA 4Z53A 2P27A 1ESCA 2Q9AA 4BMPB 4C6HA 2VJNA 1UPXA 5AM4A 1Q84A 3WLEA 3TIGA 1BMFD 1OWOA 1XCMA 3FZEA 1ACLA 1CFZA 3PHJA 5E9QA 1LF0A 5IANA 1OXSC 4EMBA 4IJKA 5F73A 1A4RA 2B30A 2CDNA 4YP7A 5JAUA 1IWOA 4AY3A 1KS2A 2ATXA 1S2DA 2EGUA 4HPJB 4RS3A 1W94A 3U60B 4S12A 1AKEA 2HA5A 4TL9A 4UXJA 1YC5A 1T0JB 5AW2A 1YTLA 3EPJA 4LDQA 2QLNA 4MB0A 1DFGA 2OOSA 3UVEA 1SUAA 3GCZA 1N9GB 1OTXA 1UM9A 3OAAA 2H5EA 5EPEA 1EFVA 1QDEA 2LD4A 2YHIB 4TTVA 1WHTA 3ZNQA 4CMJA 3R09A 2H0AA 4PXAA 4RMHA 5HW0A 3BDAA 1YD7A 4IV8A 3ZV5A 5LZ4A 2DSNA 1IY9A 2JL1A 1DJQA 2HZ7A 3S4YA 1K86A 1SMKA 1FL9A 1IWPB 2JFUA 4FYJA 5E6RA 4AMBA 1JAIA 3DA8A 1A9OA 3EXHA 1Z2CA 2M1ZA 4OFBA 2C5GA 2W6JA 2YS6A 3AZOA 3DOOA 4JU8A 3S29A 3H0KA 2P9TA 3A6ZA 4ZN6A 4BMSA 3AJDA 4DSAA 1ZR2A 2H08A 1Z4LA 1ONPA 5EE5B 3DVLA 3AKDA 1E60A 4G0QA 2Q5QA 2II6A 5BWMA 1T8YA 3ADBA 3C3JA 4BU1A 2OV6A 4A1FA 3NVKI 4JQCA 3EVGA 3QBEA 1I14A 4RELA 4I4IA 5FD8A 2P9YA 4HWOA 1J5EB 3LRPA 4FFBB 2Q0XA 4L8LA 3C3BA 5ALWA 4ZV9A 1R16A 3PPIA 4LNUA 4C1BA 1Z6ZA 1EHCA 2O0LA 4NMHA 1TO6A 4EVQA 4KUHA 2IKSA 3NATA 9MHTA 2XTNA 2A9JA 1GG8A 1V6AA 2W2TA 2JLZA 3NWOA 4WZAE 4R9SA 1KJJA 3QUBA 1Z33A 1BMQA 4WBNF 3BZUA 2Q8QA 4P33A 3RYHA 4DQVA 2I80A 3BMQA 4MUAA 1SHKA 2P78A 4QULA 4FCTA 3ICEA 3RJZA 2PMBA 3D8SA 3IEMA 2X8JB 2BKEA 3GGJA 5JNTA 2V9ZA 4DMFA 4QC2A 1NUSA 3TDMA 2FJ0A 2J30A 4KQXA 1GTG1 2SBTA 3I9FA 4W9RA 1H5QA 1HBJA 3WKCA 3WZ2A 1U9YA 1H8HA 1GILA 1G42A 2ZYUX 4X62B 2WWFA 1PVOA 1ZU5A 1SKQA 2LE0A 2PL3A 3OPYB 4Z1MD 3TZEA 2BH2A 4ROTA 3MAGA 1RPTA 2PXHA 5K3FB 4YDQA 1ZCZA 2H1OA 3M4XA 1ZD5A 1Y4UA 4IF6A 5BVGA 4CUZA 2Q2OA 5FTKA 2QP3A 1O9GA 4FHGA 3KD3A 3U3OA 2CLEB 4PAWA 2JH8A 3TZKA 4G5YA 3DZIA 2PG3A 5T3YA 3BF8A 1K88A 1U2TA 1J56A 1ZGHA 3Q87B 4L7QA 2SNIE 2NUPB 5LOVB 1A7KA 3FB1A 1FMLA 1XFDA 1CJCA 3EA5A 1RXCA 1XAJA 3EULA 3R7DA 1O5IA 1EFCA 3AXSA 2EX4A 1JDBC 2WYVA 5F1PA 3Q41A 4HBZA 5FRDA 1E1CB 2Y1FA 2L2QA 3UFXB 1O77A 1NUUA 1P2FA 3DV2A 3UPTA 1B74A 3RTAA 4IKOA 3PITA 4KFRA 4HYEA 1U2DA 1UZMA 3PRYA 3GDWA 3UJBA 1TU3A 4RV5A 2Z56A 1UFRA 5A0FA 4OTZA 3R9IA 1J2UA 3O3NB 3Q7PA 3UWSA 5IT9A 1T8UA 1S2IA 4X84A 1AHNA 3Q1LA 4PSAA 4EA7A 2WWXA 1EGHA 5CTAA 2WUVA 3H11A 4WT7A 2XODA 4JV5B 4WY5A 2V58A 2H1FA 2PMCA 3DUWA 2IRWA 4ILKA 2K7ZA 3T9FA 1PQWA 4ENWA 1JIIA 3DDOA 4IIHA 1AT1A 1L4EA 4FBGA 2FPPB 3TB6A 4PPFA 3T4EA 3T1TA 5JR3A 1RHQA 1EHIA 4CIBA 1WS6A 1ZN9A 1YAJA 1RBQA 1HE1C 4G1EB 3IS3A 3FYUB 4W1PA 3WK4A 2O1EA 4HMQA 4HZIA 2PV7A 1CUDA 3LT1A 5IC6A 3WWCA 4CR7A 5BXQC 2VBFA 1O3YA 1DIRA 2BTQA 3BHNA 4PTYA 4MWEA 1H4SA 4O4HF 3W9BA 3ADKA 1XWWA 2V7EA 1ND6A 1P5HA 1V8DA 3KEOA 4YP6A 3QXXA 5LBUA 2Q4RA 3PFKA 5TF4A 3GLGE 4EI8A 4MLDA 2O8BB 3G23A 1YQDA 1IWBB 3MJRA 4YBZA 3WK7A 1GNVA 2X86A 6ADHA 4M37A 1PV4A 3U3DA 1RRVA