3L0IB

Complex structure of sidm/drra with the wild type rab1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
162
Chain Sequence
b'SMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSRGAHGIIVVYVTDQESFNNVKQWLQEIDRYAENVNKLLVNKCDLTKVVDYTTKEFADSLGIPFLETSATNVEQSFMTMAAEIKKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DrrA
publication title Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Protein binding/protein transport
total genus 28
structure length 162
sequence length 174
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l0iB00
1KY3A 4LZZA 1XFAA 2J3EA 1GAJA 5ANRB 4D4JA 1HURA 2E9SA 1P9NA 1UBGA 2AWNA 1ZCBA 3PR1A 5EE0A 5EXPA 3T15A 4URUR 1UKVY 2EWWA 3VMFA 5K8LA 2ZAOA 3NVAA 1CJMA 1OYYA 4Q19A 4ZKDA 4P4SB 3A6PC 2J1LA 2J0QA 2XSZD 1T3HA 4FMDF 1Z63A 3KQNA 3V4RA 2CHQA 4DSTA 1AJEA 1MOZA 1F2UB 4LJ6A 5HR5A 5TMPA 2ZS7A 4FIDA 3CZQA 2CDNA 3UIEA 1XX6A 2A5FA 4TYPA 2QTHA 4A82A 3QEOA 3T1QA 4CGZA 3AKDA 4BFXA 1ZW6A 3B60A 4YMTA 4IDHA 4JJZA 4G5RA 4KV9A 1S0UA 2OBNA 3DDCA 2BC9A 1TX4B 1NVWQ 3TE6A 3R8FA 2BCJQ 1T4GA 5G41A 4HDCA 4ACBA 2VRWA 4C0HA 3U7GA 2ZI6A 4PSVA 4C7OB 4PAOA 1Q1ZA 4HAUA 1FP7A 4KBFA 2AR7A 3BB3A 1KKMA 1JQLB 2FPKA 2GTPA 1XPOA 4JL6A 1A5TA 1GSIA 3RNLA 1KI9A 2ZQ5A 3AGQA 3CBQA 2GVZC 3O8BA 3H84A 3EPHA 3U4QA 1GRQA 1U94A 4JLBA 3UMSA 2RGDA 1RJ9A 3K0FA 4JBYA 2JLQA 3B78A 3CPHA 4B6EA 4KO8A 1G5TA 3O8CA 1IN8A 1U0LA 3K70B 4NCJA 4JYBA 4Q02A 1E9FA 2QGNA 5JSZB 1VIAA 4OQXA 3TGPA 1G6OA 1GDDA 2PCJA 1D9ZA 1RYHA 2JLVA 1US8B 1NL3A 4JKIA 1NN1A 2NIPA 3GJ3A 5L3QB 4D6PA 1T9HA 5FUXA 2WIAA 1XD9A 2QPTA 1IHUA 1G8FA 1VKJA 4QBFA 3FMOB 4RCYA 2BWJA 3QBTA 1FX0B 4TYNA 4RVCA 3TJZA 2WWXA 3X2SA 1R5OA 3PEWA 1D2NA 2QSZA 3CRRA 2REXB 3WNBA 3KZ1E 3ZD6A 1SHZA 4DEXA 1DO2A 2VLIA 4V03A 5J4HA 1COWA 1Z0IA 2P65A 4P33A 2R6AA 2W6JA 5JLJA 3R20A 1N6RA 1TU3A 2RAPA 3BAFA 1D2MA 3CNLA 2AFIE 3G82C 4JJKA 4OQNA 4YQFA 2G3YA 2Y8EA 3B13B 2YWEA 2O0JA 1Z08A 1W4AA 2GHIA 3BD9A 3G5UA 3ADKA 3CO5A 1P60A 1HTWA 2QQ0A 4HZUB 3K9LA 2HLDA 1KI8A 4B3BA 5IF9A 1OYWA 1K6MA 3RWOA 1XF9A 4FI3C 3AP2A 3B1XA 2O52A 4LHXA 3C5HA 5EP2A 4O25A 1Q3TA 4L15A 2VP9A 5FTLA 3FHTA 4HYYA 2XTNA 3QKTA 1UKZA 3UANA 4HLUC 4EPXA 4AG5A 2O8EA 2ZYUX 1XCMA 1TNDA 3HR7A 4LBVA 4EJSC 4GZMA 1DARA 4NCKA 1EGAA 1YRBA 5B57C 4OI1A 3AVTA 4C0SA 3CUEF 4DT1B 2G9NA 1KNXA 2FJUA 2P6NA 4PO9A 3KKMA 1JQJC 1COWD 5DIFA 5DISB 2IUUA 2XNDA 4HLUA 2W6JD 5HZKA 4Q47A 1ANKA 1PJRA 2GXUA 2PCLA 2WM9B 3QBVA 4IEEA 5LBIA 3U3KA 4EJSA 5FOSA 4DB4A 1NMYA 5KNBA 4XD7A 2IWRA 4PANA 4N3NA 1P62B 3MSXA 4OI4A 1Z6YA 3ADCA 421PA 2BMJA 3PUZA 4QGFA 2GK6A 2FWRA 1WB9A 1W7AA 3AM1A 1KK1A 4F92B 3IKJA 4HZIA 4P32A 4Q03A 3QF4A 5LPNA 2YVUA 2J0SA 1S3GA 2OV2A 2ORWA 2WWIA 5TDHA 4Q1AA 2FMXA 1U81A 1QBKC 1NN5A 2FN4A 4EQ6B 4LYFA 4Q1EA 2W0SA 2CMKA 2DFKB 1VDZA 2GJ9A 3EPKA 4JSTA 1W4CA 3AP1A 3DZ8A 5K8UA 1KI2A 1JAHA 2I1VB 4XH9B 1ZNYA 2XJ4A 2FGJA 5CJPA 1E4YA 3U7FB 4CZ2A 4V0OA 1E2NA 3I1FA 2B8WA 2XNDD 4D4MA 2IYWA 1KMHB 1P2UA 1QZXA 3I73A 5IHPA 3CB4A 1Z3IX 4XD7D 2EW1A 2NG1A 1RRPA 1W49A 3BH6A 2JIZA 5CYOA 1XMSA 4JVLA 5A0FA 2WSSD 2YOHA 1E32A 3ONWA 4BLOA 4PTLA 1U8YA 1Z6GA 3FKSD 4LCBA 1UFQA 3UWOA 2WWGA 1ESMA 3KKOA 5JECA 4BEBA 2VEDA 4BRUA 3SHWA 4XVQA 1KY2A 1P2TA 4KLZA 2DWPA 4DLVA 4PC6A 1HY3A 3A1VA 1NVVQ 1QHYA 4URYR 1NSTA 1F5NA 2P5TB 1ZNXA 5JS7A 5FTJA 5DH9A 1T91A 3ZQJA 5JZVA 1YZQA 1HT2E 2WAYA 5TXGA 3GQBA 1Q1BA 1CRQA 2ODWA 5B2ZA 2ZVQX 4GMXA 1VTKA 2BIFA 1TMKA 4DLTA 2Z5FA 3MWKA 1E79A 1R2QA 4MKIA 2QMHA 2IXGA 4OQFA 2XAUA 4RD1A 2AD1A 3HPRA 2FFAA 3N70A 2JIZD 1T3SA 3UMFA 4DKXA 2DR3A 3LDAA 2Q21A 4US0R 1OXSC 2BEKA 3B7GA 4YMVA 5FPYA 1G7TA 1U0JA 4GP7A 3GLFE 4IVQA 3PITA 1N6IA 4R2HA 2QT1A 5FFMA 4IXNA 3HPQA 4NHOA 3WP1B 4LYAA 4DDWA 3OIUA 3U7HB 2QE7A 1J8MF 1PUJA 2D7CA 3BOSA 3DOFA 3LNCA 1FFHA 2NO9A 3CX6A 3RS7A 1F3OA 2C77A 2ANBA 2XZPA 1DAGA 3AF3A 1NIJA 1XTRA 5DLQC 3NHBA 1X8LA 2GJ8A 3VX3A 4TLDA 2KBFA 2GZAA 4IVRA 4NZYA 2D2EA 3HU1A 3L43A 3NC1C 5C4GB 2ATVA 2QTVB 1CR0A 3D3QA 4RJLA 2BHRA 3QKSB 4AKGA 1ZC3A 2VP6A 3MD0A 1E79D 4HB4A 4KVAA 3QXSA 1HQCA 3GFOA 3I5XA 1G19A 2ZR7A 1TADA 2QQEA 4G0NA 1KMQA 3TUJC 3GLGB 3V9PA 3O8RA 2N46A 1TEVA 2ZRMA 5JWHA 3WRXC 4ARZB 5FBLB 1XEWX 1E0JA 1Z5ZA 2ONKA 3QJYA 2CK3A 3GJ0A 2GJAA 2QE7D 5EXTA 5JEDA 1E2LA 1XEFA 5IT5A 4JL5A 1UAAA 3GD7A 1KO5A 2QY9A 2ZYTX 3H2YA 1TF2A 2CNWA 4W5HA 3I8SA 4N1AA 2YC2C 4Q4AA 3GEEA 1LW7A 3CW2A 4M22A 1OT3A 4URXR 4L9SA 4YMSA 2WV9A 3MJHA 3U44B 3EW9A 4A1FA 3GLFA 4WZAE 4CEHB 1NG9A 1RKBA 3AB3A 4ZDIA 5KOYA 3QVUA 3C4JA 2Q9BA 3QXHA 5FTMA 4BFSA 4PPNA 4PZZA 4YONB 3SQXA 1YE8A 3V00A 2RGGA 2WOJA 3S1AB 3KTAA 2QAGB 3OAAA 4I1UA 3SFVA 4OHYA 4HSEA 5GJBA 1DS6A 4Q48A 4TMTA 2OSBA 5A5GA 1L4YA 1ZD9A 2ZRNA 2WJYA 3LQQA 2CK3D 2NTYC 1LF0A 3AEZA 3Q5EA 2BM0A 3B5JA 3VR4A 1XTQA 2GK7A 3GCGA 2CNWD 4JLMA 2F43B 3PG5A 3HP1A 3BE4A 4KCGA 5H68A 1KO7A 2OE2A 4EPYA 4JVSB 2KI5A 1VG0B 3I4LA 3FMIA 1Z0DA 2CXXA 2OILA 3UKDA 2BM1A 1SHKA 2QN6A 5AUOB 1CLUA 2GEDA 4DBLC 2GILA 2GEVA 3M1IA 2QP3A 4WXPA 2ZR9A 2I1QA 4LPSA 1MKYA 2EFCB 2HV8A 3BFKA 2AX4A 2XXAA 2D62A 1WA5A 2WKRA 1NG1A 2HXSA 3BB4A 2F1HA 4LBZA 4NONA 3K1JA 5FPHA 1TQ2A 5FR1A 1KDTA 1P7CA 3OAAD 1C4OA 1M8PA 1TTTA 1FZQA 4ZPXA 3SZRA 4K8OA 3CLVA 1JALA 4CW7A 3T61A 2CLSA 3D31A 3NDBB 4BLPA 3EPJA 1XRJA 1P75A 1K5DA 3R7WB 2N1BA 4OI2A 4A6XA 2K5UA 4URZR 4F7WA 2IYRA 2ZXUA 2DWQA 4P4SA 2V1UA 4M1WA 1KYIA 3B1VA 3OEHD 4Q9KA 4LY6A 2LKDA 4G3XA 2OXCA 3T5GA 1XPRA 1F2UA 1KI6B 3QPUA 3QNUA 3B6EA 1AS3A 1LS1A 4BWYA 2V1XA 1LTQA 3AF1A 4KITB 3BC1A 3EIQA 2FFQA 2CCJA 2G0NA 1Z2AA 2HF8A 4B3CA 2IHYA 3L0PA 1R0WA 3T5DA 1Z6AA 1EXMA 1GRRA 1BH2A 4M4SA 3NEYA 1W4RA 1CXZA 4DJTA 4GBMA 2QI9C 3CX8A 4I1OA 4Q4LA 2ZEJA 3DM9B 4DRZA 3IGFA 4URWR 3TLXA 4C7OA 4TMWA 2PH1A 1R0YA 2GXAA 1R6BX 2ZE7A 3RVBA 4XJXA 3K70C 3PQCA 4MYHA 1SXJE 1AKEA 3BXZA 1R10A 2DB3A 3RAPR 4XIGS 2IF2A 1JEEA 2IL1A 3NEJA 4ACAA 2D7DA 2ZUDA 2KE5A 4A0HA 1JJ7A 1OH8A 5JS8A 2PEYA 1MV5A 3AKEA 2IUTA 5GJVC 5HE9A 2ZI7A 3A4NA 4EKDA 5JSZA 2IBMA 1NJFA 1TPZA 4B34A 4CT4B 1SKQA 1VECA 5CM9C 1US8A 3CPJB 2F55A 4DIDA 4GT1A 3BS4A 5L3QA 1UPTA 1YJ5A 2CHGA 1VCIA 1VG9B 2G88A 3FYHA 2RMKA 4RD2A 1QHHB 1Q20A 2IS2A 4Q1CA 4BFTA 3LH5A 3QKRA 3FDIA 1M34E 1EX7A 3P32A 3VU9A 3DZDA 3LQRA 4MGKR 4GL2A 4QHTA 2PZEA 1ZM3A 2PX3A 2QAJA 1TAGA 2CL6X 2E1RA 1KI3A 3ZD7A 1E2MA 2AK2A 4FMBB 4IDQA 2QEQA 3LVQE 2VP5A 4JBXA 1N5KA 4LJ4A 4Q9LA 5FI0B 4JS0A 2B92A 1AN0A 4ITRC 2J41A 2VTKA 2J7KA 2X1VA 1T8TA 4X8OA 2Q3MA 3FKQA 5EXSA 3RRZA 3TAUA 3T34A 3QSYA 5C18A 3K70D 2G1KA 4ZKEA 1E69A 1C9KA 2C95A 1IQPA 1Z6TA 3A37A 4HZUA 4DSOA 1XP8A 1DADA 3KXLA 5J4KA 2QROA 5CYPA 4PC1A 2IXEA 4AKIA 3QF7A 1XEWY 4B73A 2GCOB 1E9SA 1TL7C 1ZC4A 4LYJA 4F38A 1VCNA 1NMZA 2ERYA 1BIFA 4OKSA 1BYIA 3BK7A 5FPTA 3NG1A 5SZHB 3D6TB 3ECCA 2ZVPX 1VHLA 4CVNA 1U9IC 1G8PA 1XZPA 1ZD1A 4WA7A 3GFTA 4HUQB 4QRHA 1SZPA 3MWJA 5BW8A 3GJXC 2W2XA 4I1SA 1EWRA 4DT1A 3V4FA 1Z6XA 3CWZA 3ZDQA 4ESVA 3U6BA 1Z06A 1U9IA 2WBLC 5P21A 4Q4HB 1RRFA 3SJCA 2BMFA 2QU8A 1J70A 4Q9IA 2FZ4A 3VTKA 1AK2A 1XB2A 2ZITA 5FUWA 3T1VA 5G3YA 3CRVA 4KYIB 4L8GA 5F3WB 3LD9A 4YMWA 1SKYE 1LY1A 2QRZA 1KO8A 3SYLA 1E9CA 2GZDA 2CL0X 1GL7A 2GA8A 2MMGA 5EUMA 5H70A 4DDUA 1ZMXA 3KXKA 1SXJD 1G21E 4D81A 2NO7A 4EQ6A 1NLZA 3ETLA 3BH0A 2N42A 2YHSA 4DB2A 1E2EA 3L0SA 1XJCA 3SNHA 2WMOB 1W0JA 2WVJA 2IWHA 1CR2A 2DCUA 2FSGA 1ZCAA 2RHDA 3W8NA 5EUQB 4RKFA 1F2TB 4NE2A 1MRNA 4GOXA 4KU4A 2BMDA 2PZGA 3FPAA 3EZ9A 4MGZR 4TLEA 2QRNA 2P67A 3KDSE 5CJ2A 1KDOA 1OHHA 4R9UC 3E5HA 2VH5R 1N6HA 1W5SA 2OXRA 4OQMA 3U3RA 4DZZA 1N6NA 3MG9A 4KHZA 4OI0A 1S3SA 1UDXA 2P3SA 4CEIB 2EWVA 1VCOA 2HUPA 4TL6A 1CEEA 1W2HA 4LV8B 5SZIA 4BFUA 3SEAA 1E99A 1E2QA 3Q9LA 4HI0E 3X1ZA 4QBHA 4LJ8A 5DHFA 5FI1B 2Q9AA 3GLGE 2WICA 2OHFA 1W0JD 4BECA 1MO3A 1IONA 3BIFA 1Z29A 5JEEA 3U3MA 4JZKA 2F3RA 3VX4A 2FZLA 4IDNA 4U7DA 2IHBA 1D5CA 2QG6A 4HAXA 2JDIA 3GJ6A 2ERXA 1GWNA 5EZ6B 2NOAA 2R62A 3QI2A 1CF4A 1KGDA 1IJFA 1NY6A 5DNYB 5C46F 1OHHD 1G3QA 2IS4A 3KB1A 1NBME 5GVSA 4A8JB 1GNPA 5A4JA 3IQXA 2CE7A 4DSNA 2TMKA 1BOFA 1S9HA 4JLDA 3IIMA 2FEOA 5LB2A 1NJGA 3RSOA 2F3TA 1N3BA 2CVHA 4C0BA 2Z4SA 3HDTA 3ZJYA 1SVWA 2UKDA 4E09A 1E3MA 4MYCA 5TY0A 3SBEA 2CVFA 4B47A 4OHWA 2GJKA 4EFNA 2FPMA 3UWKA 3LRPA 3FMFA 1J7KA 1S9DA 3HJNA 2C98A 4IOMA 4V0LA 4A2QA 1IM2A 2WJHA 4HAYA 2JDID 3CIOA 1A4RA 3BORA 3QKSA 3GPLA 2BJVA 2J5XA 3JZMA 2AK3A 5JJIA 3A4MA 4JLPA 3THWB 4P4TA 1UJ2A 2O8FA 1G16A 3AF2A 4TN1A 1G7RA 4TYWA 2W2TA 1ZYUA 3GLGA 2BEJA 3W90A 4PSAA 3LV8A 1O87A 4ARZA 2AL7A 5KYKA 1R5NA 4JT2A 4AKEA 5LD2B 1UKEA 3JVUA 4D82A 4FD2A 1G4AE 4JLVA 4W7SA 3H1TA 3F0TA 4HLCA 4Z8XA 4Q66C 1M74A 1SVKA 1E4VA 5FL7A 5JHHB 3GJ7A 3T1TA 4QKQA 1XTKA 5FBWB 4C0AC 3ZZTA 5KSYA 3WNDA 4IKEA 1NBMA 2HJVA 2ZYVX 3R8CA 2BMEA 5CLQA 3RRNA 1N6LA 2VSOA 4G5SA 1MO5A 4NYIR 4XVRA 1IY0A 3TNFA 4C9BA 3GEIA 1G3IA 5KDLA 3U44A 1SVLA 2QAGC 3CF6R 4CEHA 1Z0AA 1AQUA 2IS1A 3WBKA 4A15A 1G7SA 4EPWA 3VR3A 4M2LA 4ZCMA 3I3SR 4GOJA 2RH5A 4MKGA 4S35A 4Q4JA 5B64A 1XD2B 2NO6A 4FMCF 4MKHA 1OXUA 3KFVA 3S1AA 3KJEA 1M2OB 3ZS8A 1HUQA 2QAGA 2P2LA 2DFNA 2NQ2C 5GJCA 3PUVA 4KI0A 2VP4A 2WJJA 1NRJB 2J0UA 2XTMA 2ZI3A 2CEAA 3EPLA 5FL7D 2Q9CA 2R65A 4H9GA 3KUDA 3AKCA 2F43A 5L3SB 5J5CA 2DY1A 5TB5A 1NBMD 3SDZA 2JLUA 2ZUCA 3RABA 4C0QC 4LJYA 4OYHA 1W2GA 4NU0A 4ZIRB 4TMXA 4D80A 4ZO4A 5GVRA 1X3SA 2UZIR 4B3XA 1N6OA 2WWHA 4D4LA 4QM6A 1TF5A 1IJEA 5KSPA 1YR9A 5CK4A 4W5WA 2FEMA 2FGKA 2IX3A 1VIYA 1MO6A 3DKPA 2C5LA 2BDTA 2EFHB 4RD3A 3CX7A 4BPBA 3GJ5A 4MQBA 3QENA 1QHNA 5FTNA 1BKDR 5FPSA 2F1JA 1KIMA 1ONBA 2WWWA 4RKEA 2ZSDA 2WIBA 3B9QA 2C8VA 3BGWA 2UZ3A 3R7WA 1UDWA 1W5TA 5G53C 1N6PA 4BFWA 1KK3A 3QQ5A 2XOKA 3CH4B 1UF9A 3WHLA 3F5FA 1XU4A 2D3WA 1OXTA 2I4IA 3AUYA 1SXJB 4U00A 1KI6A 4WXRA 4HDOB 5HTKA 1G291 4JVNA 1KOFA 2GXSA 2VHJA 4TTQA 2V7QD 2CHVA 3SHFA 5AWFC 1WP9A 3B85A 1U90A 2ZRPA 3MLEA 4EPTA 1G64A 4OHVA 4PZYA 2A30A 4NMMA 3I61A 1OJLA 2GBLC 4M1SA 4UNNA 2NMVA 2VHUA 1CP2A 1YZNA 5KO2A 4HLQB 1O3YA 1FL9A 3DMDA 4UQOA 5EE5B 4D26A 3MAAC 3KL4A 2ZRBA 3VR2A 4X8LA 1LVGA 1XMIA 1YZTA 2MMCA 4BZQA 1ZM2A 2F7SA 2WSSA 3ASZA 2JLSA 2GBLA 3FKSA 4O2LA 2XOKD 2B21A 2IF0A 4UXIA 4BLRA 4JLAA 3AVYA 1XTIA 2ZI9A 2ZJ8A 1OPXA 1GG2A 4M1MA 3C5CA 2ZAMA 1CJTC 2JATA 3ND9A 2Q3FA 1U98A 4FINA 3LX8A 5B30A 4Q5IA 2AN9A 2XEXA 2EFGA 3ZVLA 4B71A 3NBXX 3N5CA 4WW0A 2PBRA 4IW3B 3X1XA 4MDFA 1T6NA 4QGAA 3TIFA 1RIFA 1RRCA 1Z28A 4OL0A 4MGIR 3R9WA 3FHOA 1OB2A 4A6PA 2KJQA 2FA9A 521PA 2WJIA 3AVUA 4RCZA 4A9AA 2ZETA 4Q7LA 1OFIA 2ZRAA 4QJ4A 4TSFA 1QHHA 5E7JA 4E22A 2Z83A 4FWTA 1QF9A 3RS2A 1OXVA 3GJ8A 4NCHA 1CJUC 1FW6A 3EAQA 3WBJA 2V6IA 2GF0A 3RWMB 1FTSA 2PT5A 4ASUA 4OK3A 4FCVA 1NI3A 2LKCA 1N5IA 4DWJA 1MR3F 2QORA 3P4XA 1QVRA 2VO1A 2A9KA 4B33A 5SZKB 1G5RA 4QBIA 2QTFA 4KAXA 4TTRA 1PLJA 1ZJ6A 1DAKA 2H57A 4B74A 2HXYA 4CEJB 1JEDA 1MRSA 821PA 5K8TA 4BLSA 3QEJA 2QGZA 3NWJA 3UG6A 3QXCA 4DSUA 2VSFA 4IDPA 2QP9X 3CF0A 3R9IA 4TYQA 4OJKA 1SVSA 3VR1A 1DG1G 3EA5A 3L82B 5EQTA 3SJBA 2XNSA 1SKYB 2GCOA 5E7MA 3WMFA 4NKRA 4QOSA 2OAP1 4TSFD 2B6HA 2JLWA 3ICQB 2FDCA 4XSHA 1OH7A 1JNYA 3SU8A 1ZAKA 4B3GA 1G1MA 4LHWA 4Q7KA 3RS0A 4AWXA 4ASUD 1YZLA 3QVVA 3BFXA 3LVRE 4F4IA 1XJQA 2OG2A 2JAQA 3I92A 2O8CB 4IHQA 4LC0A 1IN5A 1Z0FA 3OIYA 3ZS9A 1J90A 2L0XA 3DL0A 4LWZA 3OF5A 2A5GA 3IHWA 3LWNA 2CL7X 4Q4HA 2ODBA 1Y3AA 3K0SA 1KKLA 1YVDA 4WIAA 5FBVB 4JYCA 3TR5A 3VKHA 2R9VA 4RFSB 3PEVA 2BV3A 4FMCB 3TAHA 1IY2A 1SULA 1NLYA 2CE2X 4Q01A 3FFBA 1ETUA 2VYFA 4L16A 4QL3A 4KFTA 2ZJBA 5FPKA 2ZS9A 1XD8A 2ZE8A 3F3YA 1WXQA 5C4MA 4ZV4A 3OHMA 2XTZA 4IXMA 5EP4A 2AWOA 4MRSA 1XTSA 1TUEA 121PA 4FW9A 1XEXB 2BVNA 2EU8A 2QMEA 5EP3A 2ONJA 5CB8A 4BFVA 2B7BA 1DAHA 3UXMA 4DCVA 3WY9A 2QA5A 3ZH9B 3RRMA 1QG2A 4ZI3A 1VG1A 3K53A 3TRFA 2IYTA 3D7MA 2NO1A 2VHCA 3NC0C 5KPDA 5AK0A 4DCSA 2IYUA 2GDJA 2FSIA 4MUAA 5AUNB 4M9ZA 4WBSA 2NGRA 4CEIA 2ZJZA 4LC1A 4QGGA 4TLBA 3EARA 4I4LA 2YWGA 3IILA 5DI9A 2XZOA 3WP0A 3LW7A 4LV6A 2ANCA 1OIVA 1OV4A 4B3FX 2REOA 1IN4A 4W5JA 5J40A 1U2RA 2XGJA 1P9RA 3EC2A 3NBFA 1ZVQA 1QHSA 1Z47A 4NP6A 1GFIA 1N5LA 3NBYC 4NBSA 4PR0A 4DDTA 4A8JC 3AVQA 2C03A 1NLFA 4DUGD 2QBYB 5D3MA 2JJ2A 4EFLA 2AHOA 1Z2CA 2EFDB 2OCBA 2J46A 5SZJA 4O3MA 1WBDA 1KO1A 3EWSA 1FQJA 1L4UA 3PVSA 4G01B 4M1TA 4TQUS 2C96A 4TT3A 1ZU5A 2IC5A 4B6FA 3BB1A 3W8RA 1LS6A 3A58B 2C9CA 1EFTA 3DHWC 3EC1A 3OFNA 1MT0A 2AD5A 1P4SA 1JJVA 2FH5B 3MWYW 3OEHA 3SFZA 1GP2A 3K09C 4A36A 1E9BA 1NVXQ 1OKKA 1GVNB 5CDFE 4Q18A 1KAOA 3LW8A 3ASYA 2OLJA 1N0WA 2ZIAA 1FNMA 2IW3A 3FFAA 1OW3B 2ORIA 5BN4A 3EX7C 2LCFA 3KKQA 1YZUA 1X86B 3K09A 4BGDA 1T3LA 4MYUA 5HE8A 3WHKA 4A92A 3KQUA 1IN6A 1M1YE 3CPEA 2R8RA 3QUSA 3BRWD 3TKLA 2Z43A 3HU3A 1UADA 2JJ2D 2D2FA 3WXMA 1PVOA 1R4AA 3K9HA 2ZRJA 5LD2C 3K9NA 5KPJA 1KAGA 4I99A 1KSGA 4M8NE 2JJ1A 4TT3D 4KSBA 4EIWA 1Q22A 3W9YA 3I62A 1ESNA 4DIEA 5LDDC 1FUKA 3OFND 4D0NA 3TW4A 4D2IA 3RLFA 2IEYA 2H1LA 2VP0A 4JVMA 3CZPA 2GXQA 1OKKD 2QP4A 2YWHA 1QDEA 2YZ2A 3C41J 3TW8B 2FSHA 2OLKA 2V3CC 3WMEA 1Z0JA 1E2FA 4X8MA 1JR6A 1G9XA 2ZJ2A 4A2PA 1NY5A 1KJWA 4XTRA 1HE1C 2NZ8A 1FNNA 4LBWA 5L3VA 2RGCA 5FR2A 1Z8FA 4ZDJA 2AKAB 2HF9A 3P27A 4R2IA 2G0TA 3MUFA 4KXFB 4V02A 5KNDA 2V55B 3SOPA 5F98A 1KZGB 4XOIA 3B1ZA 3GLIB 3EIHA 5FOUA 3TSZA 4W9MC 2QPAA 4JLKA 2ZRDA 4RZXA 2JJ1D 1Q44A 5KHOC 1EG7A 5DO9A 2ATXA 1K5GA 2IYSA 5BN5A 1ZIPA 2UVQA 1HT1E 1LNZA 4YDHB 3VFDA 3C16C 4C0LA 4M0LA 3THXB 3HR8A 2ZRHA 4S2EA 1NKTA 4AD8A 1VPLA 1DG3A 1FP6A 1UKYA 3UMRA 5BYKA 5L3SA 1UBFA 1G6HA 2A78A 5EE3A 1P2VA 5KU1A 5DSZA 3MGCA 4ZIRA 4ON9A 5JWRA 5FOWA 2VF7A 2YJTD 1FX0A 1OF1A 1JR3E 5KUTA 4LSGA 1JI0A 2W0MA 4MRPA 1ZRHA 4EAQA 2JGNA 4AYXA 1U8ZA 3AH8A 3RRYA 1A7JA 1ZM7A 4QNRA 2C9YA 3U5ZB 1W36B 4BUJA 4LUCA 2OCPA 1MABB 1X8KA 1GITA 2WJGA 2QMOA 3IIJA 3ND8A 4HB0A 3REGA 4XSGA 4C30A 2XJ9A 2GRJA 1P73A 4M53A 1II8B 2WJVA 4O0MA 4Q7MB 1E9EA 1UEJA 4ABYA 1E0AA 3RSLA 1GNQA 5FH9A 1N6KA 1SXJC 1G3UA 2P0EA 3NH9A 1QHIA 3A8TA 2OFOA 3K8YA 2F6RA 4B2IA 4B48A 1E98A 1LF5A 1K8RA 3TMKA 4Q9HA 5KNCA 3RANA 3TVTA 1G5PA 1S1MA 4URVR 3AVPA 3B1WA 3DO6A 4NPHA 1NN3A 1DAEA 5CM8B 1SXJA 1KK0A 3K0CC 3BFVA 5JJKA 2G6BA 2CLDX 1E94E 3HWSA 5FOTA 5H8WA 4ZCIA 2XB4A 3H0KA 1CIPA 2WAXA 3G0HA 1DO0A 4POAA 1ZUIA 2B7CA 4U02A 4DCNA 2QMUA 5KSOA 2ZJAA 4PC2A 2FNAA 4PHHA 3LBNA 1IAQA 5L8VA 1KSJA 3WMGA 3ZVMA 4PC7A 3I72A 1EK0A 2AXNA 2FPLA 2FX3A 3K0CA 1DVRA 3SS8A 1E2HA 1E2KA 1JXMA 4EPVA 2HT1A 1SGWA 3KJGA 3VNUA 2J9RA 4QG7A 3THOA 3EASA 4TQAA 3CM0A 3TQCA 3BWDD 3MFYA 4OBEA 2GCNA 3FVQA 4IRUB 1JR3A 1M7GA 1P61B 3OZXA 1E9AA 5GADl 1ZINA 1WMSA 3VKWA 3T12A 1TEXA 1LFDB 2GF9A 2OEPA 4H1UA 3QPVA 3PEUA 1GKUB 2IYVA 1T5LA 3LY5A 4N0DA 4ZDWA 3QXXA 4XWKA 2VA8A 2HYIC 1MO4A 1PUIA 5TVKA 4DLZA 4Z1MA 2DYKA 2GCPA 1P72A 1KHTA 5FBQB 3VR5A 3Q72A 4LX0A 3ZZUA 2V6JA 2GEUA 1KK2A 4D25A 3AUXA 1AZTA 5EE1A 3M0EA 1KMHA 1ZBDA 1GM5A 1UBCA 3SR0A 4ZDKA 1GKYA 1GKIA 4B2PA 1ZU4A 3NBZC 1RPZA 1EWQA 3BJIC 3W5IA 2AKYA 3LFUA 4U5XA 3REFA 2W83A 3CH5A 1IOZA 1E2GA 4NH0A 2OCAA 4TL7A 1II9A 1U99A 1VYVA 4AKHA 221PA 1JR3D 1L2TA 2NZJA 4QBGB 5C1BA 1FMLA 2ZPTX 3AQ4A 5JCZA 1Q0UA 4GOKA 4XTCS 4CEJA 1XTJA 3EG5A 3LAWA 1PZNA 2H92A 2J45A 5BYJA 1W48A 2C99A 5HCIA 4ERNA 4K46A 4Z1MD 1VG8A 5IDVA 3A1UA 1GNRA 5TARA 1GL6A 2OFWA 2GVDC 4C3ZA 4TMKA 1P3JA 3LBHA 5JI3E 3CKLA 4QM7A 2QUZA 1G8GA 4BZXA 2BBSA 4LI0A 1V43A 3RDPA 2NPIA 2QNRA 3QG5A 2ZM5A 4RFVA 1AKYA 3QE0A 4KFSA 1AS0A 3W6PA 4DC9A 2V4ZA 3SJZA 3NDPA 1J8YF 1CR1A 3M4YA 2O0KA 3RHFA 1NVVR 2VPPA 1RRGA 4DCTA 5DN6A 1E1QD 5GJWC 2O8CA 3UPUA 1BS1A 2O8BB 2JJ8A 1W4BA 4KBGA 4AIIA 2J7PA 1IXRC 2ZRCA 3QXJA 1D2EA 3CONA 1TQ4A 4TMVA 2ZSBA 1RW4A 3CR8A 3QIAA 2FF7A 3T1OA 2MSCB 2OUKA 2RGNC 2VF8A 4A2WA 4RFSA 4BASA 1WQ1R 4DHEA 3LLUA 2G1JA 1Y63A 4N0EA 3ADDA 4JIMA 1DBSA 3FWYA 2BJWA 4DLWA 4AYTA 2R2AA 1CJKC 3K0EA 4L9WA 2RGNA 3RYTC 4LRWA 3Q8XB 5F2EA 2HEIA 1KJYA 2GJSA 1D9XA 5JRZA 2IYZA 3EZ2A 3AP3A 4FN5A 1CKEA 1QHGA 2KWIA 4RY2A 3VAAA 1XEXA 3PUXA 1R8QA 3AKYA 3P20A 2JEOA 1I2MA 4PO8A 5DN6D 1N25A 6Q21A 4LGMA 4D4KA 4F91B 5EJEA 3W3AA 5KSZA 3OE7D 3WYGA 1DAMA 3KFXA 1XZQA 2J7PD 2Z4RA 1B0UA 3A1WA 1X1SA 4IOLA 4WZ6A 3ZIAA 3U6KA 3B1YA 3HYRA 4PFSA 2VSXA 4QGHA 5CK5A 1WBBA 5CLLA 1DE0A 3SE0A 4TZ6A 2W6ID 4QFMA 3HU2A 1XDBA 3I8XA 3RS5A 3GP8A 2IA5A 2QPOA 5AR1A 4B3DA 5HKKD 2DHRA 2ZJYA 2W2VA 3B9PA 3GLHB 2KSQA 2VBCA 3M6AA 4CYMA 5JBQA 2XITA 4RD6A 2YINC 4C0JA 1YHNA 4DLUA 3IPYA 3TUZC 1OB5A 1IBRA 2DFTA 3TBKA 1T0JB 5CITA 4LJ9A 4LPKA 4GDFA 4NYJR 2YKGA 3AF4A 3MMPA 5BQ5A 3BBPA 1CRPA 4LDJA 2ZE6A 2C2HA 3LA6A 3TUIC 1OIXA 1ZM9A 4CDGA 3GMTA 3TVDA 2E87A 2Q3HA 4KFUA 3IQWA 2J59A 1HEIA 1EESA 1JAIA 2QBYA 3IDQA 3P26A 2ZJ5A 2GAOA 1DOAA 1N5JA 3ZIAD 3GFPA 2A5YB 4IOJA 1XPUA 4HB3A 2BCGY 5EE9A 3OIWA 2REBA 4XVUA 1W44A 5JWOA 4P0TA 4E07A 2ZS8A 1DAFA 4MITA 3PIRA 3RS3A 4A4DA 2A5DA 3THYB 2IK8A 3KB2A 2O5VA 2W00A 2QM7A 3GLIE 1R5BA 3MRSA 3SYKA 1WF3A 4F4JA 5KDOA 4HEJA 2V7QA 1GZSA 1KDPA 2ASEA 1P6XA 1QVAA 3IBGA 8OHMA 1G20E 1RYFA 5J4YA 4IFBA 2KB0A 4K81B 3W6OA 1Q57A 4IJMA 2FG5A 3BH7A 4GZLA 2J87A 4KFRA 4YXWA 2P5SA 1OE0A 2VHTA 1D6JA 1E2IA 3NHAA 4RSGA 3R9XA 1N0UA 2RHMA 4TLCA 1VCMA 1V5WA 3QKRB 4MKFA 3VU9B 5BN3A 1CU1A 2DFLA 3CF2A 2GNOA 5DGXA 1KJZA 4PPQA 4Q7JB 3CRW1 1JPJA 2WWYA 1F6BA 2PEZA 3EXAA 2H16A 2HJGA 2IT1A 3JZAA 2FSFA 3A1TA 2CBZA 2VL7A 4OJQA 1G4UR 4PPFA 3ZVRA 2HYDA 2V54A 4BFYA 2JASA 1AGPA 2D06A 4PQFA 3PUYA 1W1WA 4FCTA 3DEFA 3KQKA 5AJWA 4YXWD 1T8UA 5E7IA 2O8DB 1E96A 2D74A 3W3ZB 1ZM4A 4A0RA 4V0NA 4UXJA 2WPDA 2RCNA 4I81A 4L4UA 3WRYC 4P3YA 1EFRA 4WZBE 3GLIA 5ELXA 2RB4A 3TR0A 3LLMA 2BBTA 4CF7A 1FMJA 3U60B 2WOOA 4LBYA 4P4UA 4Y0VA 5F9FA 4JLOA 4EPRA 1KNQA 2YC4C 4BRWA 1T0HB 4XWOA 721PA 3N2IA 2JCSA 3VR6A 3T06B 2H8KA 4FXPA 5DI3B 1X1RA 2HCBA 1SVIA 1XWIA 4NL4H 4LK2A 4DDVA 1OH6A 3WYAA 3J81k 2WKQA 3THXA 5G40A 3VHLB 2YV5A 4DEYA 4MH0R 4KYUA 1W46A 2JLYA 3CNOA 3EA0A 3OIVA 4NCNA 5FUVA 1ELOA 4LV5B 3B82A 3Q7QA 5HCNA 1Q21A 1GL9B 4R7ZA 5AUQA 1IN7A 1KDRA 2HLDD 3MJRA 2CJWB 3EZ6A 2VHQA 2QM8A 5DHAA 5JI2E 3DM5A 2IS6A 1A1VA 4GNKA 1XBTA 1XNJA 2OBMA 4PZLA 1W36C 4CT5A 4JMPA 2WPDD 3Q5DA 4OK6A 1S2MA 2I3BA 1EFRD 2V9PA 4MGYR 2RGEA 4Q21A 4HAZA 3DKVA 4C0KA 4DVGA 2GESA 1G7CA 1JB1A 4M1KA 4BEJA 4NTZA 1MABA 2RGXA 3H4MA 4MRRA 3I32A 5FOXA 2B8TA 2DWOA 1F48A 2ECKA 2SHKA 1II8A 2MSDB 4TL8A 5FUYA 3IEVA 4LOAA 1XCGB 2R6CA 2F9MA 3SN6A 2C04A 4HLDA 3GEHA 1L8QA 1X8JA 1UM8A 1I4TD 4AURA 3TSWA 2F1IA 5L3RA 2IYXA 1E6CA 3UK6A 1XXHB 2PJRA 2YYZA 1OSNA 3C7KA 1E9RA 1NNEA 1SVOA 4UJ5A 621PA 3ZQ6A 1XMVA 1L7VC 4GP6A 1E9DA 1RVDA 4HUQA 4PAQA 5C2JB 1NMXA 4FMDB 2OESA 3ZVNA 4Z51A 1DPFA 2XZLA 1W47A 1I2DA 4YMUA 5EP1A 3BERA 1W36D 1PLLA 2WKPA 4FCWA 4R71A 1NP6A 1R8SA 3K0AB 1H8EA 4UNRA 3KQLA 1PLKA 2O0HA 3U3OA 2CCGA 3U2QA 1CR4A 1YR6A 4TLAA 1WE2A 1YR7A 2YOGA 4NYMR 4BLTA 2BBOA 1PV4A 3T35A 5AUPB 3QPWA 1SVMA 5G3ZA 1ZUNB 3IUYA 4B76A 5LB4A 3LXXA 4B32A 4EFMA 2F9LA 3PCRB 4P31A 2EYUA 2HT6A 4GI7A 4YLGA 4HB2A 2P6UA 3X1DA 4AI6A 1NIPA 3UG7A 4MDEA 2QSYA 4WOPA 4C2TA 3CNNA 3KQHA 1Q1QA 4H1VA 3PENA 1CJVC 3KJHA 3L8YA 1JXOA 1IXZA 1E2PA 3IO3A 1WCV1 4FWIB 4OHZA 1I4DD 3KXIA 2PZFA 4MRNA 5E3HA 1BO6A 1Q1EA 2IUSA 1F2TA 1NN0A 2OBLA 3DVLA 3JVVA 4KJZA 4IOKA 2ZSEA 3L8ZA 4DUGA 5CIWA 4AK9A 1S1CA 2JLZA 2OFXA 1G17A 1H8ED 3EWAA 3DOEA 3SBDA 3L0OA 1C1YA 3FTQA 3C8UA 4KVGA 1NSFA 3CWQA 2RGAA 1KI1A 4TL9A 4A0GA 2O8FB 1AQYA 1FTNA 2OM2A 4NYIQ 1S8FA 4PHFA 3MWLA 1Q3HA 3L2OB 3QG1A 3A1SA 3IHLA 3O47A 1A82A 3TSOA 4DLXA 4NYJQ 3GJ4A 2G77B 1AS2A 4A0FA 3AVXA 1OFUX 2ZRLA 4G1UC 2WWFA 1KO4A 3IIKA 5FBRB 2ORVA 2FE4A 1EFCA 4QJ5A 1X6VA 3NXSA 4EDHA 4US2R 4BQSA 1HYQA 4F4CA 2V8OA 1GOTA 5F9HA 2ZUBA 4RD4A 3FOZA 4Z54A 3FE2A 3IO5A 1OFTA 2PL3A 4YC7A 1M7BA 1MH1A 3H86A 2CCKA 3GLHE 4A8JA 5E95A 5J47A 1G41A 2H18A 4ESHA 1AM4D 5CIQA 2VQSA 2W58A 3SJAA 1YRAA 4OK5A 4Q4JB 2O8BA 1G8HA 3PV0A 2OZEA 3U4QB 3HYTA 2EYQA 1WDTA 1N0VC 1RJ9B 2PMDA 3AV0B 3K0FB 1II0A 3KUCA 1JECA 3QOFA 3VHXA 2J0UB 1VMAA 3LO5A 2ZSAA 4JKYA 3TH5A 1FPMA 2X19A 4BFZA 3E1SA 4F93B 5JHGB 1AIPA 3QY0A 4G5OA 4B35A 4M21A 4JL8A 4DLYA 2VP2A 5HZHA 1ZD8A 2ZRKA 1GILA 4JLJA 3SC3A 5KDDA 4M9QA 5KTYA 3SYNA 4X8HA 1A2BA 4II7A 4E5UA 4IFEA 2Z6VA 4B44A 3THWA 2ODEA 3KJIA 4WAUA 1H8HA 4KLNA 1GRNA 4GRAA 3ZZ0A 4DXAA 4Q1DA 1E2DA 1XMJA 2R6DA 2OAQ1 1YKSA 4B43A 3PFIA 2AXPA 3OESA 1HA3A 5UKDA 3FB4A 4B2LA 2NO0A 2PX0A 2ZRGA 2YNMA 1Z22A 1OXXK 1P2SA 1S4QA 3O8DA 3TQFA 4TTPA 4LJAA 1QG4A 1FOEB 2GETA 4M9SA 4Q00A 5D3QA 4QHYA 4AY2A 1OFHA 5JCPA 2C9OA 4CRWB 1G18A 1UEIA 2DPXA 3GLHA 2NPFA 4GSYA 4HAWA 2RKOA 4Q1BA 1KTVA 5DYIA 5H1YA 3NIBA 5J4LA 5JMTA 3SI7A 4ZCLA 4UKDA 2O8EB 5JJLA 2EFEB 5CDFA 1H8HD 4OQLA 4QHSA 1E0KA 2QZ4A 4UJ3A 3X1WA 5EZ5A 4V0KA 1XD2A 2GKSA 1GIAA 2PLRA 4RZ3A 3Q3JB 1VYUA 2H17A 2ZREA 4PPGA 2BBWA 4NDZA 1FQKA 1JPNA 4HAVA 4BZPA 3AGPA 4EJSB 1R7RA 1B23P 2JLRA 3PUWA 1J99A 4AYWA 3I5YA 1ZUHA 3THYA 3LX5A 4C2UA 3L0IB 2IYYA 1G3MA 3A36A 3CRQA 4LJ7A 2HCJB 1W0KA 3QF4B 5CB6A 3EZ7A 5BWMA 3FGNA 1HV8A 1NF3A 1CBUA 1N2CE 3D8BA 4LJ5A 4PO1A 3Q7PA 3ICEA 4DCUA 4M1YA 1ZNZA 1CTQA 5EXXA 4JBWA 2FFBA 1A2KC 4GFDA 4M9XA 4RZUA 1T5IA 1JBKA 1DTSA 1YR8A 4PHGA 3C15C 2EVWX 4LYHA 2ZU6A 3PXGA 4G5QA 2IXFA 2EQBA 2XX3A 4UNQA 2PT7A 4C4PA 3PJRA 4MYTA 4TYYA 2QT0A 4DLRA 2MSEB 4IVPA 2FFHA 3B8HA 4RZ2A 2R6FA 5JFGA 2A3RA 2FU5C 2RGBA 2YWFA 1HQYE 1DAIA 4PSKA 1NVUQ 4ILEA 2A5JA 1BMFA 3NH6A 4PX9A 2X2FA 3U3JA 1OLOA 4E03A 1G8YA 2QL6A 3LXRA 1RC8A 1W0KD 2PMKA 4DLSA 3UATA 1QHXA 5E4FA 2A2ZA 1XCPA 3Q85A 4HATA 3KX2A 4YDSA 1TQDA 3IPXA 3AVVA 2CLCX 4LHYA 3W5JA 4Z8YA 3TK1A 4CIDA 2ZRIA 3AVOA 4Y0AA 4QXAA 1HE8B 2BOVA 2AFHE 4AC9A 1F60A 3RC3A 1KZ7B 1GUAA 2O8DA 2X77A 3DMNA 1CULC 3IBYA 5FL3A 4KODA 4L5BA 4PQRA 1GTVA 4NYMQ 4V0ME 5FOVA 1ZIOA 4OHXA 2GZHA 2JLXA 1M7HA 1XXHE 2GAAA 4M1OA 2J0VA 2P6RA 5DYGA 2ODNA 1DEKA 1BMFD 1XJ0A 4MUBA 4GMDA 4PXAA 1AGRA 5AJVB 2ZYWX 3E70C 5DI3A 4PC3A 2H5EA 2R6GA 1SQ5A 4JLNA 3SQWA 2X8AA 3U7EB 1EX6A 2BKUA 4RD0A 3OEEA 4HUTA 4J0QA 2IEZA 4AG6A 1U0HC 4WVFA 4D0LB 2Q6TA 2IYLD 1KSFX 2HDNB 2ZRFA 2ZSFA 4IEIA 1CS4C 3WNCA 1KSHA 2ZI5A 4G5GA 2CJWA 2OO7A 5IK2A 1KI4A 2LWIA 5HPYB 3CRMA 3AVWA 1R0ZA 4IDOA 3EZFA 3P1JA 1D8TA 1RFLA 2Z0MA 1J2JA 1NKSA 3F8TA 1YQTA 3P4YA 1VYTA 2A7QA 2DBYA 3B2EA 5JRJA 1E1QA 1Z07A 4MRVA 2H7VA 1ODFA 4KSCA 1BYUA 1H65A 5B58C 4JSYA 4TZ0A 1E2JA 2Q0HA 2GWHA 3KKNA 4PQYA 2ZE5A 4HDQB 4US1R 1OH5A 3IEUA 2FV8A 1Z0KA 1R0XA 4UNPA 1FUUA 1Z83A 2G83A 3K9GA 5AJYA 4ZI2A 3OEED 2WSMA 1LB1B 1E0SA 1OIWA 2ZTSA 1YU9A 3CR7A 4PHTA 1QRAA 4QNMA 3VKGA 4NCIA 1ZNWA 1AA9A 1KI7A 4V0MA 1TF7A 2BKEA 2D4HA 4TQ9A 5AJZA 2F1RA 3X1YA 4UXHA 1VHTA 1XXHA 4Q4AB 2VIIA 4Q9JA 5IK2D 3RC8A 1Q12A 3ADBA 4BE7B 2WTUA 5DE3A 1E1RA 4XWAA 3FMPB 4O2RA 2JA1A 2ZANA 3GLFB 2KBEA 5M04A 1M6NA 4UNSA 3W6NA 3A4LA 2FOLA 2ZR0A 1IXSB 1EFUA 3E2IA 2R44A 3KKPA 2OCYC 4QJ3A 4TMZA 2OT3B 4GPTA 2ZI4A 1U8AA 1TQ6A 1S96A 3N2EA 3OE7A 4PAMA 2C78A 1LV7A 3KTAB 3ZYCA 3K0AA 1TU4A 5D3MB 2PJZA 4BLQA 2IYQA 2ZJOA 3PEYA 1RZ3A 5J4VA 3MCAA 1YZKA 3ZLJA 2W6IA 4I1VA 2WZQA 1TUIA 2ZU0C 4LHVA 4MA4A 1YZGA 3QKUA 5AJXA 5HKKA 1EFHA 4QC2A 5FTKA 1ZP6A 4LHZA 2XB2A 5BXQC 1DELA 1HH4A 2XSZA 3WYFA 3W34A 3EIEA 1P9WA 3U61B 3VNVA 2WHXA 4R98A 4Q1FA 5TV2A 2PLFA 1E1RD 2X2EA 1RE0A 1I4LD 4TWZA 3RS4A 1WRBA 3ZGXA 3AF0A 3C14C 3NTUA 4JT4A 4D0GA 3VQTA 3LBIA 2YOFA 3DPUA 3NKVA 5K8IA 2XXAB 1AZSC 1P5ZB 2QENA 3FHCB 5IRCD 4EUNA 2WMNB 1UBEA 1IY1A 4B75A 2ZROA 1G3RA
chains in the Genus database with same CATH superfamily
4MINA 3U9SA 3NCHA 2J3EA 3N2KA 4JC8A 4TRNA 1GAJA 4X24A 2P79A 5LYYA 1HURA 1QDUA 4WD3A 3T15A 2AWNA 1ZCBA 3BXGA 3KSAC 3AKZA 4URUR 1UKVY 2IQ5A 2K6GA 3GRKA 5AK4A 3SDBA 2ZAOA 1OYYA 4Q19A 4WPGA 4P4SB 2J1LA 1M6VA 2XSZD 3CX3A 4EF6A 3OBIA 4F46A 3V4LA 5IXJA 3KQNA 1Z63A 1WY5A 1GSHA 2CHQA 5A7FA 1AJEA 1MOZA 3GG9A 1GAEO 4LJ6A 4DREA 5IT0A 1Z5PA 4R7GA 2VHZA 2CDNA 4O2BB 4Y6LA 4OB7A 2GAFA 4HH1A 1HI9A 2A5FA 3AJAA 1F06A 3GAMA 2NV2B 4A82A 4CGZA 3AKDA 3X2EA 4ZK2A 3E35A 3EZXA 1LVUA 3BM5A 3CYFA 2BI4A 3H18A 3TQSA 1Z5WA 4FMPA 1C0PA 1Z2PX 4PLPA 5KQLA 2PG3A 5BSEA 1JG4A 4LFAB 2ZSUA 2HTEA 3DZCA 3JWIA 4L1KA 4ZVUA 1IU9A 4WBNA 2BC9A 1C9YA 1NVWQ 3TE6A 4QE3A 1T4GA 4HDCA 3WO0A 2XB8A 3KK0A 5A5FA 4PSVA 1NA5A 2H07A 5J1TB 1PJ4A 1VGRA 2ARKA 4KBFA 4NENB 4UDXX 2HWUA 3BB3A 3BIOA 5ADVA 4M9RA 3I6IA 3RFXA 2UZ4A 2WAMA 3Q0TA 4IJ6A 1GSIA 5F2KA 5I3ZA 2RHOA 5AVVA 3SQNA 4YJGB 2GVZC 4BNTA 9ATCA 3EPHA 4I55A 1KZ4A 3OIGA 3TZCA 1H6BA 4CGYA 4ZDJA 1GRQA 2Y0PA 5ECGC 4CBVA 3FOBA 1XA0A 2IYAA 3K0FA 3O1JC 3PI7A 1XZLA 3CTMA 4NNJA 2VTEA 4QFBA 4DA9A 2OGZA 4LJLA 5K0GA 4HGYA 4Y6SA 1L1RA 1WUKS 4U8HA 2AOXA 4ANFA 1K7SN 3EXFA 3JATA 3A1DA 4JYBA 1E9FA 2Z58A 1PKXA 2P6MA 3H9BA 4OQXA 3ZDRA 3TGPA 1GDDA 3N2NA 1CRLA 4DQXA 1RYHA 5HFJA 5D00A 1Y1LA 4KZKA 2M6KA 4B4WA 4MO2A 5FUXA 5AI4A 5F4BA 2ILTA 3EXG2 2NVUB 4EGQA 4MW5A 4KLRA 3F6RA 3IODA 3AHIA 4BB0A 3Q2OA 3OM1A 3DDUA 1IM8A 4IEFB 4GDMA 4QBFA 3NVKI 4RCYA 1XRLA 2IW1A 1R4NB 3CNHA 3ITEA 3PHJA 5E0OA 1FX0B 1NQUA 4AZVA 4TYNA 5JU6A 3T4EA 5A7GA 1R5OA 3PEWA 4RVGA 2NAFA 4J75A 2VH1A 2REXB 4IYRA 3ZD6A 3M6WA 4GEKA 4U7WA 2P69A 1XLTC 3T9EA 5J4HA 2Q3CA 2Q4TA 2P7IA 3QHQA 2P65A 4P33A 4UBJA 1VJDA 1J1ZA 3CZ5A 2FEAA 3R20A 4LIPD 3FCUB 3R7LA 3AR7A 1D2MA 2WNHA 2AFIE 1STOA 4OQNA 2YVAA 2Y8EA 3ID6C 4II3A 3B13B 4QDJA 2O0JA 2Z1NA 3EVBA 1M2HA 1Z08A 1W4AA 4BNDB 2GHIA 1XLTA 1LDMA 1UAYA 2AW3A 2B98A 1V5GA 3DSRA 4H3SA 2FMTA 1LJ8A 3K9LA 1GQ2A 3BWYA 4B3BA 5JADA 2A59A 1K6MA 4Y2PA 3M6LA 2ODPA 4KMSA 2XMCA 2ZK7A 4XYGA 3ZV4A 1XF9A 1KTIA 3UJAA 2IXTA 1HBJA 1AO3A 2Y05A 3B1XA 2O52A 1JSZA 1KP9A 1WR8A 2FCAA 1FRNA 1PGPA 2P9FA 2XRMA 4TMYA 3AEUB 4Q6BA 4RL6A 1L9KA 1N8NA 1I24A 2AQKA 2VAVA 2ZKIA 3QKTA 3ZWYA 4CLHA 5C8ZA 4HLUC 1PJCA 4EPXA 4AG5A 3PFFA 2DOKA 4WVLA 3DBHA 5A3VA 1TNDA 5D87A 3CMCO 1TYAE 2EARA 3C6ZA 2PHZA 3EZYA 3OZFA 3L9WA 4KN9S 4L3VA 1DARA 4EJSC 1JHXA 3QE4A 4JEIA 1F0NA 1T9AA 3VZQA 3CGWA 3CUEF 2FJUA 1WETA 5DIFA 1Y80A 5DISB 1HSZA 2XNDA 4HLUA 4LVCA 1KMIY 2EQAA 3K1TA 1W59A 2PCLA 1BROA 2QZ9A 2WM9B 1K8YB 4EJSA 2WQ7A 4XD7A 3ROFA 2CD7A 4GM1A 3ZWOA 3R9KA 1IEVA 5HIJA 2NZYA 3LXUX 3ADCA 1I6MA 1PR0A 3I52A 2G7ZA 2BMJA 3ZUPA 3OE5A 3AM1A 4YHHB 2C2YA 1B76A 3HUEA 3KJFA 4G86A 4F92B 3IKJA 3E9MA 4CKBA 4ZQHA 2IGTA 4D9FA 4JI8B 2HRQA 3ROPA 3UHPA 5A1JA 2YVUA 3P9ZA 1NV9A 5LPNA 2OV2A 2WWIA 3F2IA 1N8TA 1TA0A 1U3CA 4RVOA 2FMXA 3ZTWA 3GAAA 2WMYA 5ERGB 4LYFA 3PL5A 2DFKB 2FPWA 3IUEA 4BJ1A 3D4IA 1SZDA 1DBPA 1VDZA 2ZLBA 1V9CA 3HJBA 3GPBA 1Z2NX 1PUXA 2WHPB 3DZ8A 3ISJA 4K1XA 4J1NA 4KOAA 3RQIA 4OD0A 3WGJA 4G6ZA 1U6JA 1KIFA 2I1VB 2QRQA 2GQ0A 2Y9PB 3EB9A 3KNZA 2WIGA 1Z7WA 5IC5A 4I50A 2XJ4A 2FGJA 2WUEA 5CJPA 1GUYA 4QARA 1AUQA 3U7FB 1E2NA 1WDKA 2XNDD 2IYWA 5CA0B 1NQOA 3D7RA 1KMHB 2WA1A 1MXHA 2JZCA 3HWX1 4IHJF 4GM0A 4XD7D 2O1WA 2Q46A 1AKMA 1WNFA 1Q74A 4KL8S 4EEZA 1TC1A 5CYOA 3AR2A 4WZBA 4RKWA 4NSNA 2VWGA 2WSSD 1SVUA 3IC5A 3ONWA 3VAYA 2EZTA 4PM4A 4LCBA 2O50A 4WJZA 4BUCA 3LBYA 1N2GA 3D3WA 1GG5A 3W05A 1C8BA 2CSXA 3QVKA 1UC9A 4DLVA 1TKBA 3W5CA 4PC6A 4P54A 1P2GA 3A1VA 4EI7A 4Z0TA 1NVVQ 1FQOA 1F5NA 1RSZA 4UDNA 4EF4A 2ID4A 1ZNXA 2VBGA 2X1MA 3PFGA 4MHOA 1ZEMA 4QULA 1C4XA 4DUYB 4FFSA 3S2ZA 1QONA 1YZQA 2FN3A 4QTZA 1IHYA 2BGNA 2HSWA 1D6SA 4XD2A 4CKEA 3TEJA 5B2ZA 2CSUA 3QPCA 1NI4A 4CM7A 4ID3A 3OCVA 3M7IA 2J5RA 4BNXA 3OM8A 4ZRMA 1AMUA 1HE3A 1Z4OA 5CVVA 3RFVA 4LWPA 1QTRA 2H1OA 1UOPA 2YJGA 4J3FA 1QC5A 1NNSA 1S3IA 3MB5A 3AFHA 4CHGA 2QMHA 5JR3A 1OVGA 1P4RA 1LLFA 4RD1A 5AVSA 3QFHA 1WXFA 3HPRA 4JB3A 3UMFA 4KR2A 1BFDA 2Q1SA 5K3BA 2Q21A 3VZDA 3FFTA 1YI8A 3KYBA 2BEKA 2ZDQA 1G7TA 3NUQA 5FPYA 4FYKA 2Y92A 1NOIA 5TRTA 1H6CA 3Q3CA 4AU1A 1BXRA 3OA0A 2QT1A 3CV3A 2JFGA 4I50F 5ES3A 5BOVA 4NHOA 4KXQA 1X92A 4UM7A 1SWWA 4IG4A 3WB9A 1O9HA 1J8MF 3BOSA 3NT4A 4G26A 4EHAA 2NO9A 2G09A 2QTAA 3V4PB 3CW8X 1OWPA 2JFVA 1F8GA 4GE0A 4IIJA 4MW6A 4NXNB 1BVHA 2Y1XA 1L6IA 1NIJA 1JFTA 3N87A 3EQ6A 3S1LA 3WQBA 4RV4A 2KBFA 3PDWA 1V3TA 4IVRA 2D2EA 2OCKA 2CXTA 3DDOA 3NNNA 3OJEA 2IE8A 4RWZA 1K6JA 2QTVB 1CR0A 2Q29A 3E6AA 4V3CA 4AKGA 3HYNA 3R7BA 2VEOA 3MD0A 1J56A 4KVAA 1ZHOA 2QJFA 2XMPA 1RLOA 2PKYX 1THGA 3HCFA 4UOQA 5D51S 5H3CA 5I7AA 3ZDZB 1CEYA 3QBJA 4ZQEA 1TAUA 1DTWA 1EZZA 1T25A 4R1PA 3FYTA 3G2PA 1Y81A 3TZLA 5CDUA 1Z9BA 3I5XA 5EINA 1G19A 2QRLA 3C85A 3N8KA 2WM3A 3BCRA 3TUJC 4DPKA 3H19A 1RWQA 2YXEA 3STXA 4ARZB 1XEWX 3OT5A 1E0JA 1K7YA 2CJXA 2DUMA 5ALOA 4AJEA 3ZKWB 1JV2B 5J2TA 3GJ0A 3T0GA 5AI9A 2J3DA 5CT9A 2C57A 2YN4A 3GFSA 1IBMB 1XEFA 4JH0A 4JL5A 1Q2XA 3DEAA 4U3JA 4RS4A 4YBRA 2QJOA 5DASA 1GCAA 1E5VA 3TMYA 1KO5A 4OQEA 4QU5A 5DZSA 2P8JA 4Y0NA 2HFJA 5CX1A 1Y6GA 1X19A 3N28A 4N1AA 2Z2IA 2A1UA 5CDSA 4MA5A 2G07A 2AT1A 4GECA 1JEYB 4BFLA 5JYDA 1ORWA 1GA1A 1OT3A 3B3JA 4FE3A 3C98A 4BNLA 4U6NA 1Q7TA 4D8TA 1P17A 4L9SA 2AEFA 2DH6A 2WV9A 3MTEA 3QH4A 4DRXB 3U44B 3A27A 3L40A 1ISPA 1G5HA 1WPQA 3H11A 3LCMA 4HN4B 2PYZA 1QZTA 1KEZA 2ATIA 4NBNA 3IE1A 5FTMA 2FSPA 3OECA 4Q82A 4BFSA 3BXPA 3STWA 2FUKA 2BFEA 4I4CA 4AO6A 4ENWA 5I7FA 5LQMA 4FYYA 4N3BA 5TGDA 2I6TA 3CUWA 3G23A 3SFVA 1XMPA 2AB0A 3OAAA 4OHYA 4J0JA 3QMWA 4Q48A 5A5GA 2QF7A 5BUZA 1JUDA 3VC1A 4URFA 3C3EA 3WSVA 3PXAA 4GSLA 1NBWB 1T2AA 1NKVA 4WT7A 1BVUA 4P93A 2BEUA 4XUGB 1TZBA 3A6EA 4XJTA 2VCEA 3PUIA 1GUDA 3OFVA 1YIDA 3PNMA 1PG2A 2GK7A 2J4DA 1L5SA 4JBIA 1L7BA 2O48X 3HP1A 2CWDA 3BE4A 1XE3A 2ZB2A 2ABWA 3H5LA 3PR3A 4H3KB 4KCGA 4W99A 3OOYA 5H68A 2JFXA 3RSCA 3OQNA 4G1MB 2OQRA 1GEEA 1DIOB 1KYVA 1MVNA 3I4LA 3PGKA 1Z0DA 4CMIA 2IUFA 2OILA 3DNMA 4UU8A 4EYOA 2WDPA 1CLUA 2ZP1A 3QX9A 3E03A 1EK1A 1OCEA 5C37A 1DIGA 4N7BA 3AJRA 4KLCA 5EKSA 3STUA 4R68A 2PGIA 2I1QA 4KFCA 4LF5B 2XXAA 3BFKA 5HGJA 2H29A 4MQFB 1WA5A 2WKRA 4ZVTA 1EFDN 1MAUA 5FPHA 4XPIA 4E88A 1OX4B 1U04A 3H6KA 4FHEA 4J29A 4C2BA 1GARA 3OAAD 3RRJA 1VJTA 3DA8A 2PSEA 4CG2A 4PLYA 3DHEA 1VCHA 1EGHA 3E9CA 3PT5A 4M1ZA 5ARDA 5C53B 1QIEA 1LCIA 3GK3A 5IBRA 1JALA 3N7UA 4CW7A 4LF6B 3NYQA 2XMDA 1Q3KA 2BEWB 4BLPA 2LCIA 3AZPA 3GQVA 3EPJA 1CQIB 4GPIB 1MGOA 3DEHA 2H1SA 4AJJA 2GNPA 4LRUA 4X1IB 3D5EA 5D01A 2X4DA 2DPMA 5A3QA 3VTFA 4IHJB 2PKQP 1V9SA 3ILVA 1OC2A 4JEHA 2X0JA 4G3XA 3PX2A 4MQLA 4PEVA 5CH5A 1KI6B 5D5HA 3WLTA 1B15A 3AHEA 3C87A 5HEKA 3GFGA 3B6EA 3JQPA 4K9QA 1LTQA 1YFLA 5G1OA 3EIQA 1A4XA 2TMGA 4FOSA 1Z2AA 2VDRB 3AHJA 1HDZA 4GX0A 3IB3A 1FP1D 1JH9A 1Z6AA 3CUTA 4NH4A 4ALLA 1EP2B 1Q0QA 4G4IA 5CEJA 1EXMA 4RS3A 5LWHA 4LOIA 4CIAA 1RT9A 1CDZA 2GBGA 1V7CA 2FKNA 3BD6A 3ZWPA 1EUCA 3DWFA 4GBMA 3N2GB 2QI9C 4RY0A 5HOEA 2DSTA 4R3NA 3VDQA 3IGFA 1Y7IA 2V7TA 2PH1A 3FUXA 1JKMA 2GXAA 2I8CA 3QW4B 2QRMA 5DGHA 3PDHA 3RVBA 4W9RA 1A72A 4GQIA 3UHAA 3BGDA 1SXJE 3SIPA 3LUDA 2EW2A 1E7YA 3JTMA 3TLCA 3QKWA 4I2VA 4BC0A 4CPDA 1H2XA 1JEEA 4A23A 2D7DA 2EZ8A 2ODAA 3G8AA 2KE5A 5K45A 4CFSA 1QO0A 4FFWA 1PT6A 1JT9A 3FCEA 5GJVC 5I7VA 1LK5A 4A1OA 5IUNC 4EMSA 3EIFA 4BV8A 5J5AA 2AE2A 3HN6A 1QP4A 1SOUA 5JXWA 2IYNA 1OFUA 5JS1A 3E7WA 1XG5A 3RJ9A 3CPJB 1S7CA 4DIDA 2G88A 5FBKA 3FYHA 4B4VA 2P3LA 2GSDA 1MJFA 3PA8A 1IQRA 2AW5A 3C45A 5G4KA 3RSGA 5FP0A 2UUCB 3DXXA 1I3CA 1Q20A 4K86A 1ENOA 2IS2A 1R0LA 2VYQA 4BFTA 4NR0A 3FDIA 1SUEA 1M34E 3DTTA 4IO1A 1EX7A 1FE8A 1RU3A 2O3TA 1LSOA 1TYEB 3HB9A 3LQRA 1ZIYA 1XKLA 3PNOA 4MGKR 2KPOA 4GG1A 4J0CA 1WHSA 4PGMA 4GL2A 1OASA 2IITA 2MIIA 3QI7A 2QUIA 1KI3A 3E5NA 5JAQA 4IDQA 4RXTA 1TM2A 4YMLA 1K9SA 4RETA 4GC5A 4F1JA 1LRJA 2QX9A 2B92A 1QKKA 5KJFA 2QJRA 4BDSA 1QO0D 1E59A 2X5OA 3FKQA 4N7RA 4RSHA 3RRZA 1X7ZB 4TLMB 1HDIA 3BKXA 4ZAZA 2H9AA 2G1KA 2QTZA 3A37A 3O95A 1Z6TA 2VZ0A 3ZDYB 4DSOA 3KXLA 2HMVA 5J4KA 5GGYA 4MGEA 5CYPA 4PC1A 3JAKA 2VDOB 2RBGA 4FE4A 4MV8A 4OP2A 4U7TB 5ITWA 5DHUA 1QX4A 4PZDA 2IV3A 2C94A 5LLTA 2WT4A 4LYJA 2V6GA 3HS3A 1NMZA 1QUEA 4Y2UA 1FTGA 2PUWA 3BK7A 3FWNA 5IVDA 4TROA 1BMTA 1HFWA 1NBEA 2ZVPX 5AKKA 1XZPA 4GGPA 4ME6A 4AKSA 3AJ8A 4JXXA 2G25A 1G0OA 1PL7A 2VRCA 3ZDXB 3ZE8A 3M1LA 4I1SA 1XDUA 4DT1A 4UZSA 3V4FA 1VPWA 3OIFA 4AJ1A 2LDBA 1Z6XA 5DXFA 4OXYA 3ZDQA 1H0KA 1Z06A 1FU8A 3KDAA 3CEAA 4WOCA 4XCVA 3SJCA 1GTSA 2RCYA 4NICA 3J80A 1C9DB 4DV6B 2ZITA 1D4FA 1YTUA 3NYRA 4L8GA 3KQTA 5G3YA 1O96B 4OXRA 4RK4A 3B2NA 3GELA 3LQ4A 1HF3A 3TAXA 2F8SA 2AI2A 4YAWA 2HX1A 1VP9A 2FHPA 5TLSA 1QGUB 2CMDA 2GA8A 4R40A 4UMEA 5EUMA 4PYLA 3JALB 2OAEA 4S05A 4FEAA 4EQ6A 2NO7A 4B80A 3EYAA 1PNQA 3JYNA 3F9IA 5KTTA 5LDHA 2YCLA 1TGVA 2UXDB 3SNHA 4M76B 5SY4A 1CR2A 2FSGA 2O8VA 3WLPA 1EH5A 3W8NA 4DDTA 1TM4E 2HBYA 3AR4A 1DC5A 2VRCD 3FDJA 3IJEB 5SV2A 5FQOA 5IABA 3PHBE 1PNRA 5IXYA 1KYZA 4W5TA 4KU4A 2YUTA 1UXIA 2VPQA 5ALTA 4XQGA 3MTIA 5A9RA 2YDXA 3OUUA 4GW3A 1A9ZA 3FSRA 2QRNA 3E9NA 5CJ2A 1KDOA 4R9UC 2WF9A 4LCJA 2Z9DA 5DB4A 4I6JA 2O2EA 3MG9A 1IWOA 3I0ZA 1EI9A 1S3SA 2P3SA 1M66A 1VE7A 3DBVO 4MR9A 1FXUA 1VCOA 1KYQA 3PNSA 4AQ7A 2HUNA 1L4KA 1CEEA 3N2LA 2QQ5A 3F3MA 4ALNA 2B3TA 4NEHB 4BFUA 3SEAA 4OTZA 3WWYA 4K6GA 3E18A 4HI0E 3LP6A 1JLLA 3AW9A 4JSRA 4QODA 3U5TA 4D96A 4MPDA 1SO8A 3HCNA 3PUHA 4UU1A 2I65A 1J42A 2P9BA 5EVJA 1FVXA 2FZLA 3GBVA 4JLUA 4M0KA 2BMVA 4M38A 1GWNA 4RK1A 2NOAA 5G0VA 3OY2A 1E4EA 4YASA 2ZTUA 2D5IA 3DT9A 3AF6A 4UMVA 4LSMA 4Z3DA 4U9IS 4RNDB 4YQEA 5C46F 4MUNA 3DT8A 3GRYA 1G21A 3KB1A 1T36A 4Y2HA 4XOUA 1Q0SA 5C4IA 3DR3A 1YBMA 4DSNA 4BNJA 4EGAA 4NQRA 2GUWA 3M3PA 3M6MD 3TG8A 2UYCA 2PSJA 4NBUA 3LT0A 1YAHA 4MR7A 1IYZA 3IDAA 4EHKA 3WNZA 1K7CA 1Q7EA 3DLAA 2CVHA 3NDRA 3RSOA 4P4NA 4C0BA 4DMMA 5HF9A 3LG2A 1P19A 1SVWA 1W4LA 4Y9DA 3B38A 4OP1A 1BCRB 1I10A 2EGHA 3D0OA 3ILSA 5TY0A 2CVFA 3SBEA 4B47A 4AY6A 3LTEA 4OHWA 3PZRA 3UWKA 2R1TA 2AQHA 3CCFA 4A8PA 2EJWA 2R5FA 4GR4A 1UKAA 3TLZA 1J0CA 4L85A 1S9DA 4JJIA 2C98A 4BMOB 4FX5A 4OEHA 3CIOA 4DOMA 5BR8B 4JJ8A 1XZCA 3BORA 3QKSA 3SX2A 5AJUA 3NIGB 4RUKA 4BVLA 3A4MA 5B3AA 1Y8RB 1EVEA 1NXWA 2IV2X 4B81A 4TN1A 1AXGA 1H42A 1KMMA 2ZZMA 4JCCA 4IIUA 1RAHA 3W90A 1FTYA 5CXUA 4HZGA 5EQDA 3KSBC 2AL7A 3H8VA 3WLEA 2JFYA 1D6MA 1UJBA 4ND8A 4OYLA 1JLMA 3Q87B 1JHAA 2C61A 2RGRA 2GEJA 2OGWA 3F6YA 2C29D 4R84A 4RX1A 2M1XA 4Y67A 1SVKA 1E4VA 3E9EA 3CLHA 1O6GA 1Y6FA 5JHHB 3S3TA 1CUSA 2H52A 3ECSA 4QKQA 4BAGA 5EC8A 5KSYA 4C0AC 3ZZTA 5LP1A 1Y3HA 3UKOA 2O07A 4URHA 3R8CA 1JHDA 2I33A 1KDVA 4EB3A 2HCFA 2R1ZA 3WIVA 1NRXA 2H4XA 3GEIA 3MWFA 4B3JA 1JDBC 4CEHA 3U09A 3SSOA 2R8BA 1AQUA 1KFCB 2OHXA 3AILA 4ENRA 4DY6A 1REQA 4G4GA 4S35A 1J0AA 1GL3A 1BW9B 2KLHA 3GPCA 3HSKA 1OXUA 3KFVA 4F0JA 1M2OB 3ZS8A 1U3GA 4EK9A 2UUBB 1ZGZA 3HEAA 3FGPA 1KDYA 1M1YB 2DFNA 3T4UA 5BP7A 4CQNA 2OXIA 1WZ2A 4UTVA 5GJCA 1AV6A 4Y2GA 4CT0A 4KI0A 3LF2A 2J0UA 4XGKA 2XYVA 3B51X 3PUJA 5BQFA 3DEYX 2ZI3A 4JWKA 4KE7A 5KYUB 3EPLA 1PGJA 3COVA 1R4MB 1U0GA 5CAEB 2PXCA 3AKCA 3DZJA 2GS9A 1N2OA 1FUYB 2I1WA 2XUHA 3RUCA 4DUZB 3GJTA 4DNOA 1QYXA 3E7FA 1R64A 3DF9A 3G1UA 5BO5A 3DEIA 2JPDA 4NG4A 2B4RO 4RK7A 1MX5A 2NTEA 5C1DA 2Q99A 2PO5A 3ZGOA 2BFCB 1NZJA 4N3AA 3CINA 2ADOA 4NDNE 3BCHA 3HN7A 4ZOCA 4ZVRA 1USGA 3C3JA 3ODGA 3KJZA 1M9NA 5BV8A 1ZG3A 2Y77A 3BEOA 2FEMA 1ZJ4A 2FGKA 3G9QA 3U13A 2BFOA 5BVHA 1MO6A 3DKPA 5KKCA 3M5WA 1H2AS 2HXGA 1EDDA 2R0QC 3QYFA 4ZEOA 5GM2A 4AUEA 3U31A 3CX7A 1XU7A 3LCVB 4GMKA 3DTYA 2XQIA 3TSAA 2DETA 1QHNA 1XRQA 5M34A 1FNCA 3EIWA 3HL4A 4P3NA 2ZSDA 1PT5A 2AE1A 4FLFA 1ZVJA 3B9QA 2FPPB 4MVJA 4ZP1A 3LK7A 2Z2JA 3UAXA 3M3HA 3KEOA 3QKIA 4PBRA 3AUFA 3JQ8A 4S1PA 4O2AA 3FAZA 2XOKA 3LI2A 4EA8A 1CC1S 1BN6A 3CH4B 2CFRA 4FFMA 4R3UC 4C7XA 5IXSA 1BZYA 1G98A 1Q1NA 1SA0B 1RIIA 2NSYA 2BFFB 2D3WA 2Z04A 3D6MA 3L8FA 2OXTA 3ZBUA 4OHMA 4P7BA 3AUYA 4Y7CA 5AK6A 5KYGA 1EXWA 5IZ4A 1T1JA 1G291 1H85A 4JVNA 3MJCA 1B74A 2W42A 4QDXA 4EP1A 2G71A 2W2NA 4CMJA 1F4PA 5IT9A 3SHFA 5IM5A 1HX7A 1WP9A 3W2EA 1OBVA 2J4CA 3B85A 3IIIA 1E3JA 3FVRA 3MWDB 4TUYA 2JI6A 2D59A 5DYNA 5EWLB 2O9JA 3MGKA 2XMSA 3I5MA 1CZUA 4NMMA 5TS3A 4QG3A 1O54A 4M1SA 1T9DA 4YN3A 1XNHA 4YI3A 2HPVA 1CP2A 1Z7GA 1IK6A 2JHGA 3O9ZA 4C01A 1O3YA 4ITUA 3DMDA 4OSOA 1I6LA 3O8NA 1MC1A 4YAUA 2CLLB 3ZY2A 2C0CA 2ZRBA 3EDCA 4MVJD 3VNBA 1SUFA 1XMIA 2I3AA 4BZQA 4YAGA 3FNGA 3CLSC 3ASZA 5EKTA 3Q41A 7AT1A 1XQWA 3PXBA 4P81A 2XOKD 4ZI7A 3TD2A 4N12A 4UXIA 2DSNA 1L5GB 1NXXA 4BLRA 4B9AA 3SWWA 1T6YA 4ABTA 2JD1A 2ORED 2ZJ8A 3Q4GA 4PHCA 4M1MA 4O5AA 3C5CA 2YH2A 2IY7A 4OXKA 2ZWAA 4FINA 4JGGA 4KXYA 4E46A 2Q6KA 4B71A 4CF3A 3NBXX 4WW0A 1ONPA 1XGKA 2AFIA 1BAPA 3TIFA 1L4LA 3REOA 5ESRA 5M7EA 4KAFA 1Z28A 3I6YA 4OL0A 3BMQA 2VK4A 1R27A 4E32A 1OB2A 1SZJG 2R4UA 3SBOA 1EM8B 2GT1A 3S40A 3AVUA 2QHXA 4CF4A 4Q7LA 1ZRNA 1CUFA 2H1RA 5GAJA 1QF9A 1UC5B 1U4SA 1JYFA 4BN4A 4XVHA 4HX5A 2VOJA 5AVKA 2WU1A 4Z7QB 2JAOA 1MW9X 3GDHA 4WKBA 5DCLA 2V6IA 1NJ6A 2R87A 3S5JA 7ADHA 4D6XA 1ZISA 4OK3A 4G37A 4IKOA 3C1AA 1MR3F 3NTXA 4YGXB 1QVRA 4C76A 4D02A 1QRTA 4Z53A 5DTQA 5SZKB 5K0FA 4KAXA 3I23A 3VI4B 3OY7A 4QICA 1ZJ6A 5LU8A 5CEFA 4D98A 4CEJB 4O4IF 2I8LA 3CLSD 1X3LA 3NOOA 4RH1A 1QGOA 3FCAA 3NWJA 2VKQA 5WRFA 1UJMA 3PQ2A 3QXCA 1OBCA 3WGZA 2VSFA 3R9IA 4QOHA 2P9YA 4FDMA 2BKXA 3O92A 1SVSA 2ZW9A 1NONA 4RLFA 3G8CA 1WHTB 3E0QA 1KVRA 5ITVA 1SKYB 3DDZX 4ZI7F 4D3DA 4ZYXA 1JFRA 3U39A 4X54A 4NKRA 5DGCA 2JLWA 3L0CA 3F2VA 1OH7A 1DFIA 4YPFA 1J00A 1G1MA 1L7DA 4Q7KA 3MGBA 2TRSB 2ZWIA 3GLQA 3RS0A 3HUFA 5FKJA 4JR2A 4AZ3A 3EISA 2OG2A 5DKFA 3UJ8A 2JAQA 1QLHA 4KWTA 3SQLA 4BNZA 1GPKA 5CX4A 3ND5A 5BUQA 3PDJA 2BEVB 2X1LA 5JNLA 1DBVO 3DZFA 2HR1A 3ZS9A 2ZBQA 3T5TA 2L0XA 3DL0A 3T3OA 3LWNA 5E38A 1X8XA 1UIRA 2EJBA 3W9BA 1E6MA 1MAVA 1YVDA 2X58A 4WIAA 4EG7A 4JYCA 1JH8A 4DJJA 4RFSB 2VHWA 4BS9A 2ENWA 1TM1E 1P2FA 5ENZA 5LIRA 3UPTA 1PTKA 2VYFA 2VTBB 3TNDA 2PKQO 2V6BA 4RIFA 2NT3A 1JTFA 1KFKB 2O2CA 5JNVA 2EJUA 3U1TA 1IPEA 4BGIA 3CTPA 3R5TA 2XTZA 2Q41A 1XQ9A 2Y2UA 2AWOA 1AKWA 2I66A 5JSKA 2YV2A 3VGPA 2AR9A 1XEXB 2BVNA 1NYTA 2GK3A 2X0IA 2EZ9A 4FJ1A 4MUKA 3E7PA 4NJMA 4UE3S 2SCUB 3K53A 4KRGA 1PHRA 1IBSA 2NO1A 1DUVG 3PXCX 5ICEA 2MWMA 3ONVA 1L1FA 4Q7QA 3U37A 4GWKA 4BOYA 3H17A 4X1OA 4BKPA 3SEZA 5LWQA 5DNEA 3QLVC 2WG0A 1LQ2A 4A10A 5KPDA 1TE2A 1XC7A 2QZPA 3D43A 3T9BA 3P2IA 1UBTS 5GP1A 3VI3B 4GXNA 2NGRA 4WBSA 1JT2A 4D3YA 5AUNB 4CEIA 4I4LA 4JUDX 3TLAA 3LW7A 1V6CA 4O3MA 2Z57A 3FDZB 3JWEA 2VXYA 3IALA 3QLVA 3T4XA 3V3KA 4CDRA 2C5HA 4X41A 5IS2A 5INTA 1GPUA 1DTEA 1EZ4A 1NQAO 1BHO1 5ALUA 4UUOA 5IAOA 1RVV1 5IKXA 1JHZA 1SOMA 5CLHA 3WGMA 1PEYA 3EC2A 1MN6A 4ND6A 5JDIA 4BMYA 1CDEA 5EKUA 5JAUA 1RYNA 1RYYA 1JGTA 4P38A 4KGXA 3FW1A 4NP6A 1GFIA 2OD2A 1BNCA 4DEVA 3VTAA 1NLFA 2FZ5A 2XW6A 3PTZA 1KJ9A 1XZIA 4B4DA 4MJXA 1NULA 3RVPA 3UUWA 3PYMA 2EFDB 3UCFA 5HHTA 1YHYA 1SURA 4DJ5X 2ZYHA 1BGWA 1C29B 1KO1A 3KG2A 5IM4F 1L4UA 2X0NA 4G01B 1OLSB 4JX9A 4NJEA 2YRWA 2IC5A 3QZUA 3J81A 1LS6A 4G4SO 2DRIA 2Z8ZA 3EC1A 4BKQA 3DYBA 3FIUA 2P4QA 1P4SA 3RV4A 4MVXA 4FGLA 2FH5B 3MWYW 3OEHA 3SFZA 3K09C 5DM2A 4A36A 3SX4A 3Q2KA 3KU1A 3KYIB 3TD9A 3ORSA 5CDFE 3ASYA 3LFTA 3R24A 5LQAA 3HVUA 3KQWA 2Y0DA 1DC8A 2IPAB 2R79A 1KJQA 2ZIAA 4C5AA 2IW3A 4MZXA 3EHDA 3TRJA 2C7GA 1FNDA 2NUBA 2O54A 1CJBA 3LZ6A 4N5DA 3K09A 2H3EA 4I9FA 1T3LA 4PIMA 5HE8A 4YMIA 1K3TA 3VYWA 4A92A 4X61A 1M1YE 2GN4A 3ZXXA 2ZWOA 4LRTB 1TA4A 5ILQA 3LKBA 4WUTA 3AL0C 2Z43A 5ALWA 3BL8A 3BWCA 1UADA 2CDAA 3DBIA 3HU3A 4XAQA 4AZ0B 5KJCA 1G38A 2QVZX 4I0WB 5I45A 5DEIA 2O2JA 3K9HA 5FNVA 1VJGA 1P33A 3PTLA 5IVPA 1A0OA 2QNIA 5KPJA 1KSGA 4EIWA 4M8NE 3EF3A 1Y6ZA 1ZDMA 3H75A 3ZTYA 3QVGA 5A5EA 2D1RA 3IFSA 4WGFA 1ESNA 4DIEA 2QTWB 5HKAA 1GR0A 2Z1DA 5HG0A 5JJBA 1XVTA 3GGDA 3TW4A 3T3NA 5C0OE 3FCXA 3GHYA 1U9ZA 2R2GA 2L42A 3T7KA 1TFRA 2QP4A 4XQCA 4GMFA 1QDEA 2YZ2A 2D1TA 1DRWA 1RQRA 1GUZA 3MTDA 1YS6A 6REQB 1L3CA 5TT0A 3WMEA 3X1KA 3RIMA 1T1SA 2JKVA 2ZJ2A 1N0HA 3IEXA 1JYEA 1HE1C 4LBWA 3OKCA 4LDZA 1ZIXA 1IULA 2RGCA 2QYTA 3Q6MA 3AONB 4O4IB 5LZ8A 4X00A 4ZYYA 2G0TA 1E6UA 2UYYA 3CUYA 3DTVA 4V02A 5KNDA 5ED4A 3FLBA 1JNXX 2ZQYA 4BYMA 2ENUA 2JGLA 2XB6A 4XOIA 2PS3A 3L1KA 1O57A 3EIHA 2M9MA 1G2OA 4Z0NA 3PP8A 1IBKB 1FSPA 2B0JA 3X0DA 4LRXA 4RZXA 2IY8A 3QEMB 4RZSA 3CR3C 2EZUA 1EG7A 3JVIA 3LLVA 1JKJA 4X1YA 3RM3A 1L5VA 2IYSA 3GCXA 3RVJA 5BN5A 1ZIPA 1KA9H 4HY3A 4B84A 1KGSA 4X95A 1SOAA 1JFFA 3WWZA 2OQ2A 5LXTF 3TJMA 4XM1A 4ER7A 3ZHVA 1NR5A 4M0LA 3S70A 4GPAA 3T3EA 2XMRA 5A2GA 4EFDA 4WMLA 3THXB 3P0HA 3UMYA 4H59A 1L3BA 4U0KA 3TB6A 3GUVA 4RSMA 4TZTA 3O4HA 2HA5A 3K9WA 4LNAA 1TJYA 1AU9A 3QA9A 4WESB 5FNVF 3M5DA 1UKYA 1Z37A 2YYSA 4YCDA 1IVYA 3HFRA 2DZDA 2I7TA 1B3BA 2PH7A 2AJCA 2YHBA 3EEYA 2I71A 5C8YA 4MVJI 4F8JA 2QM0A 1EQ2A 1PDOA 2A78A 3R7SA 3NTLA 3EXHB 4QQRA 1Q83A 2CF5A 3U1BA 4HGOA 3DO5A 3CN9A 3DTVD 3MGCA 5KNDD 4ON9A 3D2LA 1NUQA 3SVZA 1FX0A 1OF1A 1JR3E 4W6ZA 4LXHA 5DM0A 5IYZF 4AMBA 2HBRA 3I04M 3RUPA 5F35A 1SBZA 2W0MA 3QVMA 4ZI5A 1W2WB 1WXGA 4IUCS 1AH2A 2E82A 1E3WA 3AH8A 5J5VA 1A7JA 3RRYA 2R1VA 5SYNA 1DCTA 1XYYA 3STHA 3C6XA 3ZR4B 4JOQA 3DE6X 4CTNA 4KO1S 3E7DA 1UAGA 4LUCA 1Z4NA 3ESQA 1U4OA 3ND8A 4AN4A 1GITA 2WJGA 2I8AA 2B4TO 1DQYA 2P9CA 3AM4A 4F3YA 4YRKA 1DNPA 1WEKA 1M1ZA 3DOHA 4M53A 4OLFA 4Q7MB 1G55A 4IRMA 4YAOA 1UEJA 4ABYA 3ZNPA 2VVTA 2A0WA 1GNQA 4IUYA 1UQRA 1N6KA 1SXJC 1ZCZA 1G3UA 2VWQA 1AKQA 2P0EA 2V3WA 3NH9A 3I4FA 3MILA 2JIRA 3V4VB 3CMMA 5BY2A 1SBHA 2RHJA 4B2IA 1E98A 2HRCA 3II6X 4BMPB 1QGED 2UZ0A 4JI4B 4IPTA 1J2TA 4BCDA 2YRFA 1G8JA 3R6TA 4FJ2A 2FZKA 3DO6A 1PV1A 3EN0A 3G1TA 4OCZA 1OU4A 3B6MA 3CURA 1NN3A 4OQQA 3RVLA 5HRCA 4MARA 1SXJA 3FYCA 1PG5A 5B7QA 3HACA 4YO7A 5JJKA 2G6BA 3RLIA 4FLEA 1IDN1 2XB4A 3H0KA 2Q5HA 2WAXA 3G6KA 2BHTA 2B7CA 2JGFA 1D6NA 4PC2A 3S8YA 4OUDB 3I9OA 4P7FA 2OLEA 5L8VA 3OWOA 3WMGA 4BN0A 1EHYA 1RJEA 2AXNA 1U8FO 2DT5A 2I62A 1ECJA 3IOCA 4OXIA 4UUPA 1ZN8A 1K75A 2WJ4A 2YWCA 4X7BA 3SS8A 2WMDA 1DX9A 1SGWA 3PLRA 5ADUS 1IWPB 3OCJA 5I7HA 2AKEA 5KQMA 2FRVA 2R7NA 4RVUA