3L0IB

Complex structure of sidm/drra with the wild type rab1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
162
Chain Sequence
SMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSRGAHGIIVVYVTDQESFNNVKQWLQEIDRYAENVNKLLVNKCDLTKVVDYTTKEFADSLGIPFLETSATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Protein binding/protein transport
molecule keywords DrrA
total genus 28
structure length 162
sequence length 174
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l0iB00
4CRWB 1ZUIA 2ZYVX 3UIEA 2RGBA 4OJKA 3B1XA 4LJ9A 4ABYA 4P3YA 4NE2A 3MAAC 2QU8A 1FNNA 1ZBDA 2ZE6A 1KKMA 3LWNA 5GADl 1U94A 4QJ3A 3RANA 4E22A 4EQ6A 1R2QA 1HUQA 3W6NA 3IO3A 1CR2A 3QKUA 2WJIA 4AI6A 1KO7A 4QHYA 2FGKA 2RGNA 1R6BX 1G8HA 4EDHA 2JLYA 1P2SA 4A0GA 5EP1A 4Q48A 3W9YA 1T3LA 2ZI6A 4KYIB 3KX2A 2G9NA 1E9SA 1WA5A 3GEIA 1L7VC 1ZNZA 3BH6A 4JMPA 4W5JA 5DI3B 5BN4A 4XWOA 1N6KA 1R5NA 3SFZA 1UEIA 1NN0A 1MV5A 4MKHA 4ZCLA 3TRFA 4HYYA 4XVUA 5C4MA 2NZJA 3CKLA 4FWTA 2BBOA 4LJ5A 2QT1A 1GWNA 4A0FA 4B75A 4UNQA 4C0JA 2Q3HA 4IW3B 1P2UA 3CBQA 4RD2A 5C46F 3AVOA 1PLKA 1YKSA 3BE4A 5TDHA 1S9DA 2B7CA 1G9XA 4DB4A 3B7GA 1OIVA 4D25A 5FOSA 4LC0A 3R8FA 2QMEA 1X8LA 1KO8A 2D74A 3CF6R 5GJCA 2OM2A 2IYTA 4QRHA 4LJ6A 3DVLA 3K0EA 1YZKA 1FQKA 2IF0A 3B1ZA 4FN5A 2C99A 1NG9A 4MRSA 3Q7QA 5B58C 5DYGA 3LLUA 3T1VA 2CLSA 2ZSAA 4IOLA 1YZGA 3W6OA 1TADA 2XSZA 4LHVA 2XEXA 2FWRA 4KHZA 1G8GA 2FEMA 2W6ID 3IGFA 5SZKB 4LHWA 2FV8A 5A0FA 2GCNA 1QBKC 5JZVA 2RGCA 5JHHB 5BQ5A 2EYQA 5FR1A 3OHMA 1WQ1R 1SXJE 3NEYA 1JXOA 4CVNA 4QJ4A 1VIAA 4RKFA 2IYUA 1T6NA 1X8KA 4LV5B 5DN6A 4BFZA 4GZMA 1L2TA 4IFBA 4KYUA 2GTPA 2HXSA 2QT0A 4LCBA 4U02A 3U2QA 5EE9A 4IXMA 5TVKA 3SHFA 1VG9B 2EVWX 3QEJA 4TN1A 3R9XA 4XTCS 3BH0A 3TSWA 5CLLA 1XEFA 4Q9IA 1XD9A 1WMSA 4LC1A 2GZDA 3OEED 2OLKA 3MD0A 2O8BB 4LI0A 2QI9C 4CDGA 2AD1A 2HCBA 2ORVA 4CT5A 5FOVA 4MH0R 5KSPA 3IHLA 4EPVA 4I1OA 1Z0AA 5L3VA 3RRYA 1JECA 2SHKA 3CRMA 5L3QB 3AUXA 4D0NA 2KWIA 1TU4A 1H8HD 2R6GA 3RS3A 2ZE5A 3EPLA 3HPQA 4OQXA 4TT3A 3VR3A 1TMKA 3TBKA 5F2EA 2OCPA 1FW6A 4OQNA 2QM8A 2Z83A 5JWHA 2CHGA 1KHTA 1ZAKA 4XSHA 3W3AA 1TF7A 3KQNA 4OQLA 1T0JB 2ZRPA 3IILA 3O8RA 1EESA 3RS2A 1OYWA 2DWQA 2N1BA 4JVSB 1TUIA 3VKHA 1KGDA 2CCJA 4IVQA 4U00A 1KJZA 1NJGA 2ZRIA 1ZMXA 2JCSA 4XJXA 1JR3D 2FU5C 2Z5FA 4V0MA 4XD7A 4Z8YA 2ZANA 1HY3A 2O0JA 2ZRHA 4B3XA 2JJ2A 4M8NE 2O8BA 2BEJA 1BH2A 1NNEA 2J7KA 4IEIA 4MRRA 2KBEA 5FTMA 3PUVA 1IXZA 4XSGA 4G5OA 3SJBA 2WOJA 4NZYA 1ZNYA 3SR0A 4DEYA 2OFOA 3ADBA 5FR2A 2IHYA 3BOSA 3CX7A 4GMDA 1GM5A 2J3EA 2JLRA 1DARA 3AF3A 2ERYA 2WAYA 3K09C 3H2YA 2BV3A 1NVVR 3PUXA 3QBVA 4OHZA 2BJWA 3GLHA 1NLFA 4TSFA 1IN4A 2DYKA 4B43A 1P2TA 1CF4A 1S1CA 1GNPA 2IYYA 2W6JD 1WF3A 1XXHE 1E2IA 2Y8EA 2ZREA 4G5GA 4L8GA 1FOEB 4RZ2A 5LD2B 1DADA 3HPRA 4D4JA 4DCTA 1RPZA 5FBRB 2H17A 1QHHA 3A1VA 2ZRGA 2IYQA 4XH9B 4TL8A 3K53A 4E5UA 5IF9A 1X6VA 3PENA 1Z07A 2ZI9A 4PHHA 1KO1A 1G64A 4LV6A 4M9QA 1SXJB 4NU0A 3T5DA 2QBYB 3OIWA 3TIFA 3Q7PA 2WKPA 3L0IB 2DFNA 3LX5A 2J1LA 4BRWA 2GHIA 1OH8A 2JDID 2XTNA 4XVQA 2F1RA 1YRBA 1OT3A 2FSHA 4YDSA 2PMKA 1N6LA 3FE2A 4GSYA 1GKUB 3I3SR 2JJ1A 2F1JA 2VP2A 2ZU6A 2GA8A 2FA9A 2Z4SA 3ZD6A 4JLDA 2X1VA 4PXAA 1F60A 1W4BA 3H86A 2ORWA 1MO3A 1H8EA 1RZ3A 2BC9A 2PEZA 2C78A 3IPXA 4QBGB 4ZDJA 2XZOA 3U4QA 2WPDD 3I32A 3W90A 2CDNA 4P32A 2QPTA 4Q47A 3D7MA 3FMFA 4BZPA 5DNYB 4KFTA 1NI3A 4US2R 2H16A 1IY0A 4X8HA 2REXB 4ON9A 4XTRA 4LZZA 3VR5A 3VX3A 2RGGA 1ZINA 3QOFA 4JVNA 3D8BA 1KDPA 3ZVMA 3GJ5A 2X8AA 2RGEA 1ZM4A 1E4VA 1COWA 2VHUA 1Z0IA 4TQUS 4LYFA 3TE6A 2JLXA 3FFAA 4A6XA 1NL3A 4QJ5A 4NHOA 5DGXA 2CLDX 4BLRA 2MMGA 1ZVQA 4Y0VA 1E2PA 4HB2A 3WBJA 4D6PA 4M1YA 4QG7A 1IBRA 2UKDA 2CVFA 3A58B 4LHXA 3LAWA 1GL6A 2FPLA 2X77A 5AJWA 3O8DA 3U3RA 4FMDB 2J59A 1JQLB 2XJ4A 2YOHA 4KFRA 2R6FA 1CEEA 4JLOA 3V4FA 1VDZA 1Z83A 2O5VA 1MR3F 1MRSA 2W2TA 1P73A 3QJYA 3QXJA 2J41A 4KODA 1KI6A 2EWWA 4TLAA 3RSOA 1P7CA 4DLSA 4TYWA 1TQ2A 1Q1EA 3VHLB 1OIWA 2BOVA 5ANRB 2QEQA 1E4YA 3EW9A 1XPOA 3EC2A 3I62A 1XEXB 3X1WA 3HJNA 2IL1A 4Q9KA 5HKKD 2HF8A 3REFA 1DAIA 1KAGA 1P2VA 3CO5A 3PR1A 2JLZA 2OXRA 4AC9A 4UXIA 4C0QC 3P1JA 5P21A 1UBEA 3CF0A 2H5EA 1CRQA 1KMHA 1A7JA 1E2EA 3BGWA 3FHOA 5FPSA 2WM9B 1ONBA 2F55A 1ZYUA 4PO8A 3UWOA 1F3OA 3E2IA 4P4SA 1OHHD 5IHPA 2VHTA 2AX4A 1G3IA 3QG5A 5CJPA 5L3SB 4DC9A 1J8MF 5K8UA 4LOAA 2A5GA 5B64A 4BFSA 3RYTC 5FL3A 2XITA 4DZZA 5FUYA 5HE9A 2JIZD 4CEJB 4EAQA 2AFIE 2ANBA 1S9HA 2QE7A 4M9SA 4HLCA 2IS6A 3VQTA 1VCNA 5CB6A 4TMVA 4EPXA 4I1UA 4CEIA 4JT4A 4NP6A 4JZKA 4BLTA 4QKQA 2H1LA 2G0NA 3WMFA 4E07A 1AGRA 3UWKA 1G21E 3TLXA 2JATA 4RCZA 1M7HA 4DDWA 1DS6A 2ZEJA 2BBWA 2Q9CA 2NGRA 2KSQA 2F7SA 2OAQ1 3NBZC 4PAMA 1ANKA 1XTSA 2A9KA 2VH5R 4URWR 3VMFA 3WMGA 3WXMA 2ZUCA 5FL7D 3U60B 3TJZA 1Z5ZA 1PUJA 2EFEB 3B6EA 3UKDA 1RE0A 2FZLA 4Y0AA 1Q21A 4Q7KA 2PZFA 1GITA 1NVWQ 2CL0X 3DOFA 3FDIA 3NBYC 2JJ8A 4ZI2A 1IXSB 4RD3A 4BFXA 1DAEA 5J4KA 3CWZA 4IOJA 1VG1A 4DT1A 4LBWA 1ESNA 3OE7D 4B3CA 1Z0FA 2IS1A 1G5PA 3BK7A 1RIFA 3TW4A 5CM8B 4JVLA 2VRWA 4LHZA 2NQ2C 1S2MA 4FCVA 1UDWA 2Q9AA 2CE2X 2GAAA 1N6RA 1OV4A 1TQ6A 3DEFA 4UQOA 2DWPA 5EUQB 5F9FA 2WSSD 3FKSD 1SGWA 4P31A 2PX3A 3NVAA 4KFUA 4JSTA 1KO4A 2WWGA 4GMXA 5HCIA 4AYTA 4BUJA 1HA3A 2JJ2D 4LY6A 1US8A 1IY2A 4DLVA 4Q7LA 3O47A 4V0NA 3H1TA 4AD8A 1E69A 4KI0A 4QM6A 3CPHA 1AZTA 1CR4A 3B82A 1G6OA 1RKBA 2IC5A 3TH5A 1T91A 2QORA 2ZRFA 3L0PA 4AWXA 3J81k 2ZRNA 3OEEA 4TWZA 4XIGS 4ZKEA 1E1RD 1CJVC 4Z54A 1KKLA 3FHCB 4M1KA 2N42A 3PEUA 2OE2A 4A6PA 1XJCA 1ZD9A 2ZI5A 3QXSA 1KSGA 2CL7X 5HPYB 4W5HA 3CONA 4LSGA 3OIVA 2D4HA 1XB2A 3SYLA 2VP4A 3IDQA 1M1YE 4D0LB 1W5SA 3X1DA 4C7OB 3CRW1 4B3GA 1B23P 2AWNA 3HR7A 4JBYA 1NBME 1RRGA 2XOKD 5H8WA 1OIXA 1JJ7A 1Z3IX 4O2LA 5IDVA 3QXHA 1BO6A 1G16A 5TARA 4GT1A 3UATA 2J0VA 3K0AA 1NN1A 1W0JD 1E2MA 4LUCA 4HB4A 1NJFA 2HV8A 4M21A 2AKAB 4EJSA 3N5CA 3VR2A 4BLOA 4LX0A 4ERNA 1OXSC 2GXUA 4CEJA 1FNMA 1FX0B 3LFUA 4W7SA 3TR0A 1E2GA 1N6IA 3GP8A 2V6IA 3AUYA 5LPNA 2E87A 1I4TD 3BRWD 2HLDD 4AK9A 1I2MA 4DWJA 5DN6D 4JIMA 1XXHA 4MA4A 1VYTA 2H18A 5FPHA 3TW8B 1FL9A 5KNBA 1CIPA 2QUZA 3NC0C 2GCPA 4IVRA 4EKDA 1LV7A 3K0FA 2RCNA 3A4MA 1HEIA 3I5YA 1U9IC 3K1JA 2GBLA 5EUMA 1II0A 3E70C 3OEHA 1N5LA 4OHXA 2BCGY 4B2LA 1E79D 4MKGA 4G3XA 4A9AA 1G3UA 1W46A 3KJHA 3QENA 2XSZD 2UVQA 1PUIA 1E9RA 2ORIA 3FKQA 3KZ1E 1NVUQ 1ZUHA 2J46A 2HEIA 4TQ9A 3WYAA 3LW7A 1KDRA 1QZXA 1U8ZA 3T1OA 1AIPA 2GF0A 1X3SA 2IK8A 1Z6TA 2NIPA 2XJ9A 4FI3C 4GPTA 2XNDA 4IDNA 3N2EA 3QF4A 5TB5A 4ZV4A 1N0WA 3HDTA 4AKIA 3NH9A 1ELOA 4UNRA 1UKZA 1RJ9A 2ZQ5A 1MO6A 2XB2A 1KI4A 4TLEA 2WWYA 2PJRA 2C95A 1XX6A 1ZM7A 5A4JA 3DZDA 1AK2A 3WP0A 2JLUA 2OBMA 5AJVB 621PA 1EX6A 5BN3A 1J7KA 2YV5A 3I8XA 3FPAA 3BS4A 3P26A 5GVRA 1IONA 1TUEA 3W5JA 2OZEA 2P67A 3VFDA 5L8VA 4LBVA 2O8FB 3SC3A 5FI1B 3BWDD 3KKPA 4G5QA 1MABB 2QTHA 4PANA 3AV0B 4LPSA 4MGIR 1KZ7B 4BRUA 3TK1A 2WHXA 2WSMA 2YYZA 3T12A 4AYWA 2R62A 2BMJA 2ODWA 2W0MA 3ZQJA 1GNQA 3GLFB 3KQHA 1G8PA 2O0KA 1EFHA 3RRNA 3EZ9A 1GRRA 1TEXA 4HUTA 3JVVA 1ZC4A 1SKYB 1T3SA 1XTRA 4AIIA 1BMFD 1E9CA 3KTAB 5JRZA 4FCTA 5CJ2A 4HAVA 3DO6A 4OHYA 5D3MB 2ONJA 2IXGA 3QQ5A 4F7WA 4UNSA 5B30A 3W8RA 1U81A 1S8FA 2I1QA 3I8SA 1NIJA 2QA5A 5CK4A 3RRZA 1ZIPA 4YQFA 2W6IA 3U3KA 3U61B 1SXJC 2RB4A 4NYMQ 5FOWA 4Q02A 4TTRA 1VIYA 3AEZA 4NTZA 2JJ1D 2F43A 3Q9LA 2BWJA 2O8FA 3U7FB 3TGPA 1YR6A 1NF3A 2ZR0A 4TMKA 4A0RA 1HT1E 1SULA 2ZRDA 1EFRD 2NZ8A 1XD2B 2EWVA 1E3MA 3VTKA 2RGAA 2WWIA 3QEOA 1JAHA 1Q0UA 3CR7A 3ND9A 4XWAA 1PVOA 2C8VA 4YC7A 3QVVA 2BDTA 2DWOA 5E7MA 5A5GA 1WRBA 1P75A 2Q9BA 1K5GA 1JBKA 5EXTA 3IBYA 5K8LA 5DE3A 2FSGA 2OESA 4GOKA 1G5TA 4ARZA 1MT0A 2XNSA 5DLQC 4KITB 1JEDA 2FPKA 1D2NA 4LJ8A 4TL9A 4LDJA 2G83A 1CJKC 3S1AA 1QHGA 4QGHA 2OLJA 3RRMA 2WBLC 3MWYW 4DKXA 3MUFA 3K0SA 3U4QB 1N2CE 3LW8A 3OE7A 2GILA 3AVQA 2RGDA 4CYMA 1GSIA 3ICEA 3LH5A 3SQXA 2AR7A 2ANCA 1E2HA 3FTQA 1W0JA 3GJ8A 2GF9A 2KJQA 2VYFA 3AKDA 4B48A 2OILA 1JALA 4YMTA 1XJQA 4PPFA 1SKYE 2WSSA 2VHCA 4PZYA 1WB9A 2FG5A 1YR7A 1G17A 2BBTA 2F1IA 4BZXA 1XMIA 3AKYA 2C9CA 5J47A 3PUWA 4WW0A 3KQKA 1RYHA 4OI1A 1NSTA 3A37A 1UBGA 3CRVA 4QGGA 2TMKA 5JHGB 1SKQA 2JLSA 2IXEA 2OFWA 1E2JA 1NY5A 3NC1C 2QG6A 5H68A 3GMTA 3QF7A 5KPJA 4YDHB 1ZP6A 3OFND 3THXB 3K0CA 2VSXA 1ZNXA 2R6DA 3TUZC 2KE5A 3U6KA 3A4NA 4B71A 1U0HC 3KQUA 3EA5A 4Z1MD 2WVJA 1JB1A 4DCNA 2QP3A 4TYNA 3FKSA 4Q4AA 1LW7A 1WCV1 2V55B 2YJTD 3UANA 3SI7A 1BIFA 5FPYA 2DFTA 4R98A 3OFNA 4YXWA 4A36A 1FTSA 1ZIOA 2PT7A 5JRJA 2QQ0A 2IYRA 5TMPA 2I4IA 2D3WA 1OFIA 1AM4D 2QPOA 2NPFA 1NN5A 1XF9A 2VHJA 4YMVA 4BLPA 1X1RA 2CXXA 2WOOA 5TV2A 1VG0B 1YZLA 3L43A 1F48A 2CCKA 3CNLA 1LTQA 1ZCAA 2BJVA 2FF7A 3NBFA 2ZJYA 1UKYA 3I73A 2VP5A 2ODBA 4TYPA 1E2NA 1J70A 1YZNA 2YWHA 3G82C 4PAOA 3MWJA 4R9UC 3CZPA 3R8CA 3JVUA 4DLXA 2OSBA 4ZKDA 1A4RA 4ZDWA 1CR0A 2PJZA 3ZZTA 3B9QA 5JECA 1XZQA 2D7CA 1TEVA 2RHDA 1CTQA 1OFHA 4DLWA 1OHHA 4M1MA 2ZR9A 1OYYA 2FGJA 1XD2A 1LNZA 2J7PD 4Q4HA 4QNRA 2ZRKA 5K8TA 2E9SA 2GK6A 2ZIAA 4OK3A 2PBRA 4NH0A 1I4LD 2Z4RA 2CEAA 2F6RA 2WPDA 1W36D 4AKGA 3DHWC 4HAYA 1CU1A 2JAQA 1P61B 2EQBA 4V0KA 4C0KA 5JCPA 2XXAB 3FHTA 4GFDA 1XTQA 4DLTA 2Q3FA 1OFUX 2GEUA 1SXJD 3CR8A 1H65A 2MSDB 4PZLA 4G5RA 3WNBA 1COWD 3PIRA 1F2TB 2BM0A 4HDQB 2DHRA 4YMSA 2P0EA 4L9SA 3AF0A 4PSVA 1UKEA 2ZTSA 2VL7A 2YWGA 4E09A 4B34A 3IIJA 4QL3A 2XTZA 5DI9A 2NPIA 1WBBA 1YZUA 3VR1A 1UBFA 3WNCA 5KNCA 1GIAA 2BIFA 3VKGA 5KSOA 4HLQB 1IHUA 1Z29A 3QNUA 5AUQA 4TLDA 4Q4HB 2ASEA 2GNOA 4DRZA 5CDFE 1QHIA 1ZUNB 5DHAA 2O8DA 1RC8A 3AGQA 1W0KA 2FMXA 1W4CA 4GZLA 2QAGC 2ZJOA 5K8IA 3PV0A 3HP1A 2BKUA 3CUEF 2P5TB 5FTJA 4YXWD 3PEWA 2AKYA 4DIDA 3ZIAA 4NCIA 1T0HB 1XTKA 4WXPA 1I4DD 1T5LA 3R7WB 4KSBA 3CB4A 4TMTA 3I61A 4LWZA 1P60A 3RS4A 3EIHA 4EIWA 1ZD8A 4ZIRB 1FUKA 3ZIAD 4YMWA 3ADCA 1X1SA 3T35A 5AUOB 1AS3A 3THXA 2J45A 2ZAOA 3PEYA 4DSNA 4Q19A 3A36A 3PVSA 2JLQA 3GFOA 4TL7A 2EYUA 4NMMA 2A5YB 3GJ6A 4GRAA 4AKEA 3GJXC 4GP6A 2YWFA 4C0LA 1JR3E 1VKJA 4TL6A 3HYTA 3ZH9B 3AVWA 1N5KA 4Q7JB 2J0UB 3F0TA 5FOTA 2G77B 2IHBA 2GXQA 1XCGB 2HF9A 4V02A 2FFHA 1N6PA 1FP7A 3R9IA 1Z0JA 4LBYA 4FCWA 4OHWA 4QGFA 3D31A 1E1RA 2PMDA 5JJLA 5C1BA 2OT3B 5IRCD 4BEBA 4A8JC 2Q21A 3T1QA 1PV4A 1V43A 1NBMA 3K0AB 3NIBA 1JPJA 5LB4A 4XD7D 5IK2A 821PA 3F5FA 4EJSC 4NCJA 4FIDA 3UK6A 1ZU5A 2EW1A 2QQEA 4C0SA 1NBMD 5F3WB 4W9MC 1Y63A 4HEJA 4PC6A 3L0SA 4QHTA 2XGJA 1ZC3A 2FSFA 2IYLD 1DELA 2WZQA 1G41A 4URYR 2VA8A 2AN9A 3A1WA 2A5JA 4EPYA 1WE2A 3KKOA 1EFCA 1UFQA 1OXVA 4OI0A 2OXCA 3EZFA 3IO5A 3REGA 1JPNA 4D4MA 2IT1A 2WJJA 3TAUA 3UXMA 5HZKA 3C16C 5DSZA 4YONB 4CT4B 1K6MA 2F3TA 1DBSA 1SVMA 1ZU4A 3CRRA 3WY9A 121PA 4BFVA 3NG1A 1IQPA 3OAAA 5CYPA 1RRFA 4DB2A 4PPGA 1G20E 5J4YA 3LQQA 4KXFB 3SU8A 4P4SB 5JWRA 1Z6XA 4TZ0A 4TT3D 1Z22A 1OKKD 4WIAA 1DE0A 1E98A 2A2ZA 1KY2A 3AF4A 5JJIA 2IBMA 3ASYA 4BQSA 2EFDB 1KI8A 2VSOA 4H9GA 3PG5A 1XDBA 3Q5DA 2QMUA 4MGKR 2K5UA 4P4TA 1LFDB 5EE3A 1E9FA 3CX6A 3BXZA 3ADKA 3F3YA 3GFPA 3G5UA 4JLAA 2QP4A 3A8TA 5EXSA 1ZW6A 3SJAA 1CR1A 1E2KA 1MOZA 1Q3HA 1RJ9B 2C5LA 3A4LA 2LWIA 2CMKA 1SVWA 2DY1A 3PFIA 4G0NA 1AS2A 3AVYA 4JLMA 1QG4A 4AURA 1Z0DA 3EZ2A 4AY2A 1AJEA 1YU9A 1KSFX 3ZS9A 4A82A 1KNXA 4PZZA 3WNDA 4TTQA 3LY5A 4KV9A 2R8RA 4JLBA 1E99A 5KU1A 3GLHB 3OIYA 3RWMB 3U7HB 3B60A 1DO2A 2ZI3A 4MDFA 3AVTA 4M1OA 1X8JA 1XTJA 2QRNA 2C98A 3VU9A 2G3YA 2N46A 2ZS7A 2ZS8A 1UEJA 1Z6GA 4L9WA 5GJBA 2YNMA 3LX8A 3DKPA 2CLCX 3E1SA 1FZQA 2IYXA 2ZAMA 4PQRA 3ICQB 4PO1A 1Z06A 3I4LA 4DLRA 2ZYUX 3K8YA 5JS8A 5IK2D 1CRPA 2AK3A 4M9ZA 1Z8FA 4QNMA 3EPKA 1D8TA 4FW9A 5AJZA 1SZPA 4DDVA 1E0SA 1FFHA 1DPFA 1EFTA 1XMSA 1JI0A 1FPMA 3FMOB 5JI3E 3IPYA 2WJGA 3EIQA 3HU2A 3QKRB 4NCHA 4B74A 5KPDA 2R2AA 2CJWA 2ZUDA 4C0AC 4KVGA 2D62A 3GD7A 4MRPA 2AHOA 1IN5A 1XWIA 4Q1CA 4IKEA 2HYIC 4CW7A 2NO1A 3AF1A 3KUDA 1KI7A 3CW2A 4Q18A 1HV8A 4QXAA 4BLQA 3TR5A 3L0OA 2QROA 1DAGA 4P0TA 4QGAA 3ZVRA 2WICA 4O0MA 2BMDA 4C7OA 4JLJA 2GJ8A 2P2LA 1DAHA 4LGMA 3UG6A 3MWLA 2GZHA 2V54A 4D82A 1KK1A 3F8TA 4Q1AA 4TMWA 1S96A 4M22A 3H0KA 3AP1A 3WRXC 4GP7A 4Q9HA 1XTIA 3QPVA 4JKIA 4B73A 3SEAA 1EFRA 3VAAA 4J0QA 1EWQA 3KJEA 1P9NA 5F9HA 1P5ZB 1CBUA 2ZI4A 1IXRC 1M2OB 1YR8A 3TMKA 1UAAA 1DG1G 3I5XA 1IN6A 3DMDA 4V0LA 2A3RA 1KI6B 3QPWA 3SBDA 3TNFA 1K5DA 5HE8A 3SZRA 4AG5A 4BGDA 2YC4C 2REOA 1NP6A 3N70A 1GTVA 1W2HA 3EIEA 2ZRLA 1Z08A 3KB2A 1KJWA 1II8A 3QY0A 2C77A 2GCOB 1YR9A 2GVDC 1MKYA 2RKOA 1XD8A 3ONWA 3SE0A 1G18A 4EJSB 2WIBA 1XNJA 2ZJBA 3Q85A 2WWHA 1VG8A 1R0XA 2V9PA 1I2DA 2X19A 2X2EA 2XOKA 2PLFA 1N6NA 1ZM9A 3L8YA 1BMFA 2GZAA 3MCAA 4G1UC 5EZ6B 1G7RA 2ZI7A 4PPQA 3EWSA 1VCIA 4KJZA 5EE0A 4G5SA 4D80A 1DOAA 3LV8A 1MH1A 4JL5A 4QBFA 2E1RA 4HAXA 3ADDA 1NY6A 3VR4A 3SN6A 4DSUA 4C2UA 2KBFA 2VP6A 2ZXUA 4IJMA 4ZPXA 1DG3A 5IT5A 4OQMA 4RD4A 4FD2A 4MQBA 1PZNA 1PLJA 1ZM3A 1E6CA 3BFVA 4PHFA 4B76A 2BEKA 1DAKA 4F92B 5E3HA 2C96A 5LDDC 3MG9A 5DYIA 4C3ZA 2JASA 2HLDA 3NH6A 2YVUA 5AR1A 1E2QA 2O52A 2BMEA 4RD0A 3UMSA 4JL8A 1NLZA 1C9KA 4OBEA 2MMCA 3QUSA 4JYBA 3OAAD 1NVXQ 2PZEA 3DPUA 3BB4A 4UXJA 3X2SA 4D81A 4YLGA 3Q72A 1KMQA 2F9LA 1BS1A 4PC7A 4HAWA 3TAHA 3TVTA 4C2TA 4ESHA 3M0EA 4K46A 1Q1ZA 4ARZB 1OSNA 2B21A 3EG5A 1RRPA 4URVR 3AM1A 2PLRA 1JQJC 1YZTA 3EZ6A 4BZQA 4K81B 5C4GB 1BYIA 3QIAA 2Z43A 4RD6A 2GESA 5EXXA 3P4YA 1S0UA 2NG1A 5C18A 5JCZA 3B1WA 4NYIQ 3GLFA 1S1MA 4Q4LA 2CJWB 2WAXA 3CX8A 5KSZA 4DT1B 5DIFA 3C8UA 5AK0A 2GDJA 1E79A 5D3MA 4GNKA 2ZUBA 2GAOA 2ZJZA 3FFBA 3QKTA 4Q1BA 1KIMA 5B2ZA 4A15A 1UKVY 4DDTA 1U9IA 3PCRB 4HB3A 4MRVA 5EZ5A 2HT6A 4F93B 5LB2A 4DCSA 1IAQA 1D2MA 4OQFA 3E5HA 3U5ZB 3R9WA 3LBIA 4LJAA 4NL4H 4PO9A 2GJSA 2XNDD 4B3DA 1U90A 1XU4A 2G1KA 1EX7A 2GXAA 2DFLA 2V1UA 4EPWA 1BYUA 3BH7A 3BFKA 1Z6YA 1NKTA 1KDOA 1Q1QA 3NHAA 3ZJYA 2LKDA 3KUCA 5CM9C 1SVOA 2XB4A 5HCNA 5EP3A 1XRJA 4PTLA 2QN6A 3KJGA 4A2QA 1ETUA 1HE8B 1E1QD 1OE0A 4C4PA 2OO7A 4IDPA 2R44A 4Q00A 1GRNA 2NO7A 5HZHA 4PHTA 3WYFA 3AVVA 2HYDA 1ZRHA 4Q9JA 3WP1B 3ZZUA 2YZ2A 1YHNA 2ODNA 1LF5A 1G5RA 4URXR 1II8B 3MGCA 2PEYA 3KQLA 3K70C 3SBEA 3LBNA 4PHGA 4POAA 1CS4C 2LCFA 3MLEA 3SFVA 3QVUA 4M4SA 1S3SA 1W0KD 4CEHA 4WZ6A 2DCUA 3LXRA 1EWRA 2ODEA 2H8KA 2H57A 4CF7A 4ZO4A 2QTFA 3CF2A 2ATXA 2B92A 2YOFA 2RAPA 5FTLA 1B0UA 1UBCA 1U99A 1YE8A 2ZR7A 1XPUA 4GOXA 3CM0A 4ZCMA 4PC3A 4QOSA 5CDFA 4NKRA 4GDFA 2FFBA 5G41A 3THWA 2DB3A 3ND8A 2JIZA 4R71A 3BB1A 4Z8XA 3PEVA 4L16A 4KSCA 3LVQE 1G291 3BB3A 3QKSA 1S3GA 3QXCA 4RZUA 2JLWA 2GK7A 2QSYA 2O8CA 4WXRA 4C9BA 4Q9LA 3H84A 3NKVA 1M8PA 1JEEA 1SVIA 3U44A 4B6FA 1JNYA 3T5GA 1A2KC 4RCYA 1XXHB 1G8FA 4A8JA 4ACAA 4OI4A 4D2IA 5BYJA 5DI3A 4JVMA 1TAGA 1C4OA 2V7QA 1KNQA 3EAQA 4ZDIA 1T8UA 1EFUA 5HKKA 3VR6A 4RFSB 1U98A 3AP2A 4JLVA 1HH4A 3C15C 2YINC 4A0HA 3IKJA 4GBMA 1KSHA 2CK3A 4PQYA 5GJWC 3M4YA 4RZ3A 3O8BA 1AA9A 1TPZA 3W5IA 3VX4A 4KU4A 1TL7C 1XJ0A 1T3HA 1NVVQ 3PUZA 4B6EA 4EPTA 3FB4A 2IYZA 1TX4B 3I72A 2NOAA 2QGNA 3THYA 3BD9A 3CLVA 4LBZA 4MYHA 1OFTA 4IEEA 1AKYA 3RABA 1U0LA 4D26A 3IIMA 2O8CB 1FUUA 4ASUD 3QPUA 4GI7A 4I81A 4M1TA 4R2HA 3RS5A 1G7CA 4Q4JA 2ZYWX 4MYUA 1ZJ6A 1QHYA 2GETA 2IW3A 1RFLA 4KO8A 1UF9A 4I1VA 1VHTA 1OH7A 1G4UR 2CHVA 1TF5A 1W1WA 2C04A 4MUAA 5JBQA 2H7VA 5M04A 4IDHA 3AKEA 3JZMA 4ACBA 2QENA 4IVPA 1ZM2A 4TMXA 1M74A 1HQYE 2PT5A 4DDUA 3SJCA 4B33A 4IXNA 4KCGA 2ZVQX 3AVPA 3UG7A 5GVSA 5JFGA 2IUSA 1OXUA 2AXPA 1G3QA 4KVAA 3RSLA 1MO5A 1H8ED 1ZCBA 2QAGA 2W6JA 1M7BA 1HURA 1CLUA 2VPPA 4QFMA 3A6PC 2HJGA 4DJTA 4BECA 2D2EA 3GLGE 5JS7A 3C4JA 2HCJB 4TQAA 3B78A 3QF4B 4NONA 4RFVA 3TVDA 3TUJC 3V9PA 8OHMA 3CIOA 1W36B 3KTAA 4JL6A 4CZ2A 4UNPA 1U0JA 2GJAA 1BOFA 3Q3JB 4LJYA 1XPRA 1P6XA 1KTVA 2VP9A 4NYIR 4R7ZA 1M6NA 4NYJR 4CEHB 2FX3A 1HYQA 1GRQA 1HTWA 1OKKA 4KLZA 4DUGD 2A5DA 2OHFA 4X8LA 1UJ2A 2EFHB 4KFSA 1LS6A 4QBHA 2IXFA 5BWMA 2J0SA 1G4AE 2W58A 1JR3A 1QHSA 1NMYA 1R7RA 1QHXA 2I1VB 3OZXA 4JSYA 2IYVA 2B7BA 3NDPA 5LBIA 1GNRA 1D2EA 2FOLA 2ZM5A 4MRNA 4JYCA 3QKSB 2XZPA 3VKWA 3T1TA 1RYFA 2BKEA 5FH9A 1GZSA 2QAGB 4PQFA 5KDDA 3T61A 5G3YA 3RS7A 2REBA 3DMNA 1NN3A 5CIWA 1XMVA 2P6RA 2P3SA 3X1YA 1HT2E 3TSOA 4A8JB 4ZDKA 3QG1A 5JJKA 4LPKA 3KL4A 4TSFD 4DCUA 1SVLA 2OV2A 1EG7A 1Z47A 3HU1A 3EA0A 1IN8A 3GFTA 2FPMA 2V1XA 5FBLB 3R7WA 4ESVA 5E7JA 3FMIA 1XP8A 2W0SA 5E7IA 1ESMA 3EASA 1W5TA 3EZ7A 5HTKA 2OEPA 4D0GA 1AGPA 1ODFA 4GL2A 3QI2A 3EARA 1Z2AA 1F2UA 2YWEA 5LD2C 4ASUA 3O8CA 1VCMA 3B85A 5GJVC 4TZ6A 1VCOA 3MJRA 2RMKA 4II7A 3L8ZA 2ZJ2A 4HATA 3QXXA 4HAUA 4HUQB 2WJHA 4MDEA 4WZAE 5FBVB 3CPEA 4Q66C 4WAUA 1R5BA 4A1FA 3Q5EA 1AN0A 1XCPA 1YQTA 2AWOA 2J0UA 4D4LA 5JSZB 3B8HA 2X2FA 1NLYA 2V3CC 2IYWA 1GG2A 2AK2A 3FMPB 4S35A 3GLIB 2A30A 2VF8A 1FMJA 1TF2A 2ZSBA 4FWIB 4BFTA 4URZR 3GJ0A 3IBGA 2FH5B 4B32A 1L4UA 2HXYA 3JZAA 4N0DA 3ZVNA 2EU8A 2ZSEA 2ZU0C 1M7GA 3KXIA 3MRSA 4UKDA 2W83A 4BEJA 2VSFA 1E94E 5E4FA 1W36C 2C9OA 3QSYA 2ZSFA 1IY1A 4G01B 3VNUA 4A92A 1KK0A 1BKDR 4DSOA 2CL6X 4PR0A 1N0VC 3P27A 4US1R 1Q22A 1MRNA 5FBQB 1QVRA 2QY9A 2IF2A 4I1SA 3G0HA 4IDQA 1F2UB 3PJRA 1P72A 4WZBE 1XBTA 2QNRA 4M2LA 1GL7A 1E0JA 5HR5A 2L0XA 2RHMA 1Z6AA 1DEKA 5E95A 3CH5A 3X1ZA 2AD5A 3LA6A 2V6JA 3RS0A 1KI1A 4KLNA 3X1XA 4MKIA 2BBSA 5FPKA 1OF1A 5JI2E 3GLIA 3WRYC 5SZIA 4S2EA 3ECCA 2CCGA 5F98A 2G88A 1W4RA 2HUPA 5FFMA 5FPTA 4L4UA 4B2PA 3ZZ0A 4TMZA 2VP0A 3DM5A 2WWWA 2FDCA 3NWJA 1W48A 4MKFA 1O87A 1GILA 3RWOA 1N3BA 1P4SA 4TLBA 4FMDF 2XX3A 1PLLA 2Z6VA 5KYKA 2P5SA 1E2LA 3B2EA 1J90A 4V0OA 1KK2A 1LVGA 1Q12A 2VBCA 3AF2A 4RD1A 4O3MA 1P9RA 3I92A 4Z1MA 4F91B 2WMNB 4JLPA 2OAP1 2ZE7A 1KDTA 1NG1A 4M0LA 1JXMA 3TQCA 2WJYA 4A2WA 1RW4A 3ZGXA 4DLZA 3RHFA 4BASA 1E2DA 3K0FB 1D6JA 2MSCB 4HDCA 1TNDA 1E0AA 4F4CA 2XXAA 1FMLA 4LV8B 2PX0A 5CLQA 1NSFA 5G53C 4LHYA 1Q57A 2B8WA 3VU9B 1KYIA 4RZXA 4XOIA 1OB5A 1GOTA 3MMPA 4HLUC 4Q21A 3B1YA 4N1AA 3EX7C 3KKMA 4OK5A 5CYOA 4ITRC 3WBKA 1R0YA 4NYMR 1T5IA 1II9A 4JT2A 1E9EA 3P20A 1SQ5A 3RC3A 5L3SA 1SHZA 1UM8A 4UJ5A 3Q8XB 1TTTA 3T06B 3C14C 4ILEA 1T4GA 4HUQA 1KJYA 4RJLA 3BIFA 4X8OA 5G3ZA 4UXHA 4PC1A 1GDDA 3IIKA 1N5JA 2PL3A 3KJIA 4DXAA 1YRAA 3PQCA 4HDOB 1AZSC 1VPLA 2ZRAA 1QHNA 3OIUA 3ZQ6A 2WWFA 4XWKA 3GLGB 2QRZA 2VF7A 4OJQA 5KHOC 5FTNA 3LRPA 2OCAA 4NPHA 4PFSA 4OHVA 3A1TA 2V4ZA 4B2IA 4DLYA 3KFXA 4O2RA 2QAJA 3W6PA 5EP2A 521PA 3A1SA 3WHLA 1QRAA 4WA7A 2QM7A 1E32A 1D5CA 3BORA 1R0WA 2VTKA 3EPJA 1KMHB 1WBDA 3IQWA 4XVRA 2IYSA 1QDEA 2XZLA 4LK2A 1OXTA 3ASZA 4LJ7A 2ZS9A 421PA 1KY3A 3K09A 4CIDA 1CJTC 1GKIA 2WV9A 5C2JB 2NMVA 5FTKA 2QZ4A 1DVRA 1U8YA 3KFVA 5L3QA 4WOPA 1GUAA 4F4JA 3QKRA 3R20A 4BWYA 2O8EA 3FWYA 1DAMA 3SYNA 3SNHA 3ZDQA 1AQYA 4FXPA 3MJHA 4UNNA 1JJVA 1Y3AA 1CULC 2ZVPX 3EPHA 3B1VA 4FINA 4DIEA 3GLGA 3GJ7A 3IQXA 2J0QA 2FSIA 4JBWA 3MSXA 5FL7A 1LY1A 4B44A 2GEDA 1KAOA 1V5WA 3SJZA 3GPLA 1E9BA 5D3QA 3U3MA 4NYJQ 3GEHA 4JJZA 2RGXA 4QM7A 4IOKA 2OFXA 3WYGA 4HAZA 1W47A 1XMJA 2CHQA 3FVQA 3GLHE 5CK5A 5JEEA 2HT1A 2IUTA 5BW8A 4M53A 1KZGB 1FTNA 1LS1A 5JMTA 4WVFA 1QHHB 1IOZA 4DCVA 3AGPA 3GLFE 4YMUA 2CBZA 3KXKA 1R8QA 2JEOA 1XZPA 3LQRA 5J4VA 2F3RA 1Q1BA 3LNCA 2ZPTX 4U5XA 4DEXA 1RVDA 2ZE8A 1N25A 2WJVA 5CITA 3OEHD 5ELXA 4M1SA 2ZJAA 1AQUA 1G7TA 5SZHB 3TUIC 2UZIR 4US0R 3QBTA 2B8TA 1VECA 3FYHA 1G3MA 4DBLC 2FE4A 2WIAA 1TU3A 3A1UA 2GCOA 3WHKA 3AH8A 3GJ3A 4AG6A 4LYAA 2BVNA 3KB1A 3GLIE 4Q1EA 5AJYA 2ZROA 4JKYA 4DHEA 5KO2A 4NBSA 4RKEA 2V8OA 1UADA 2QBYA 2QTVB 4QC2A 3S1AB 1CKEA 4IOMA 2A7QA 1NKSA 4B35A 5AUPB 1D9XA 3PUYA 4CGZA 5BXQC 2W00A 2OG2A 2FJUA 4OI2A 4IFEA 2J87A 3DDCA 2GJKA 3HU3A 1T9HA 4Z51A 1JAIA 4FMBB 3ZLJA 4HLUA 5J5CA 3RNLA 5AWFC 3K70D 2OBLA 2WKQA 3THYB 1GVNB 1ZNWA 4L15A 4V0ME 5DO9A 3AB3A 3ZS8A 4JLNA 3U7GA 1KI2A 6Q21A 4EPRA 1OXXK 1G1MA 1J99A 2CK3D 4BFWA 4ZI3A 1N6OA 2ONKA 1KO5A 2C2HA 2IA5A 4GOJA 4B3BA 4D4KA 2B6HA 5EQTA 5J40A 5J4LA 1U2RA 5DHFA 5SZJA 4EFLA 2WKRA 4HI0E 3RVBA 2F9MA 2JA1A 4BE7B 4DUGA 1N6HA 1KK3A 5H1YA 3CH4B 1H8HA 3LD9A 3V00A 1G3RA 2BCJQ 3CWQA 5EXPA 1KOFA 4HZUA 4N3NA 3DKVA 1NRJB 3FOZA 3IEUA 2JLVA 4AYXA 2IX3A 3GCGA 3K0CC 2J9RA 3WMEA 4DVGA 4Q1FA 5JWOA 1JR6A 4TYYA 3IUYA 3DL0A 3TKLA 3PXGA 3EC1A 1CXZA 3VHXA 3IHWA 1A82A 2IEZA 4LJ4A 2A5FA 5EE1A 3C41J 3ZD7A 1IN7A 1XEWY 1OW3B 4OKSA 1M34E 4JLKA 1VMAA 2FFAA 3MFYA 1W44A 4LYJA 4Q7MB 4V03A 1L8QA 2ZETA 3AVUA 2NO0A 2C9YA 3BAFA 2ZITA 1CJUC 3DM9B 4I4LA 1VHLA 3C5HA 1W7AA 2HJVA 3B5JA 1E2FA 1SVKA 1NMXA 2XTMA 1R5OA 1GP2A 1YZQA 2WWXA 1P62B 2AXNA 3CNOA 2QPAA 1E0KA 2CNWD 2ZYTX 1A5TA 4OL0A 2V7QD 1G6HA 2I3BA 4M9XA 4QBIA 1NMZA 1EGAA 1KSJA 2LKCA 4MGYR 1WP9A 4EFNA 2QL6A 2C03A 3U3JA 3V4RA 1J8YF 2RGNC 3NBXX 4PC2A 4ZCIA 5KTYA 221PA 4IRUB 5G40A 1GFIA 4HZIA 1QVAA 5H70A 3K9LA 5AJXA 2QMHA 3T15A 1XEWX 2DR3A 1E9DA 1E9AA 5KNDA 4U7DA 4WBSA 2ZRMA 4NDZA 4CEIB 1J2JA 3OESA 4UJ3A 2P65A 4TLCA 1OB2A 1GL9B 3AP3A 2ZRBA 2P6NA 4PAQA 2FFQA 3UMFA 1YJ5A 4C0BA 2O0HA 5FI0B 4EFMA 2GVZC 4P4UA 1KI9A 4I99A 2VQSA 3D6TB 3U44B 1T8TA 3CZQA 3L82B 1TQDA 2JGNA 2R6AA 3RAPR 1X86B 2F1HA 2R9VA 3LDAA 3SHWA 1MABA 3NTUA 4W5WA 4QHSA 2OCBA 3B9PA 3TQFA 1OH6A 3U6BA 3BFXA 4PPNA 3THWB 1U8AA 2W2XA 3D3QA 1SVSA 4RVCA 1FQJA 2VHQA 2DPXA 1W4AA 2G1JA 1UPTA 2Q0HA 1VYVA 3LLMA 1SXJA 2VEDA 1FP6A 3C7KA 3AVXA 1LF0A 5J4HA 3K9HA 1GAJA 4MGZR 1US8B 4K8OA 1E96A 3N2IA 2O8DB 1VTKA 5UKDA 4MITA 2G6BA 4BFUA 2NO6A 1AS0A 4OYHA 4EUNA 1MO4A 1A1VA 4URUR 3K70B 4DLUA 1R0ZA 1DAFA 1GKYA 4FMCB 1Z0KA 4KBFA 2VO1A 3KKNA 2FZ4A 2VLIA 2KI5A 4MYTA 3VNVA 4ZIRA 2OBNA 2A78A 4B47A 4Q5IA 3QE0A 5FBWB 2IWHA 1QF9A 1Z2CA 2GWHA 3AKCA 4N0EA 4RFSA 4JBXA 2R6CA 1G7SA 5EP4A 4E03A 4HZUB 4Q4JB 2BHRA 3NXSA 1RRCA 4KAXA 1WDTA 4H1UA 1KI3A 1OH5A 4HLDA 2F43B 2XAUA 1W2GA 3C5CA 3UMRA 3W34A 5TY0A 2QE7D 1N5IA 4IDOA 3M1IA 5EJEA 4P33A 3FGNA 3SDZA 1Q3TA 3SYKA 3M6AA 1L4YA 2IEYA 1YVDA 5JEDA 4MYCA 3GQBA 4F4IA 1EK0A 1XCMA 2FEOA 4LRWA 2CNWA 4TTPA 3BERA 5AUNB 2EFCB 1Q44A 2HDNB 2H92A 2EFGA 2J5XA 4HSEA 2JDIA 4A2PA 2AL7A 2YKGA 3CPJB 1QG2A 2R65A 2GBLC 2GRJA 3LBHA 1O3YA 721PA 3DZ8A 3MWKA 1F6BA 4EQ6B 4JJKA 1Z28A 1FX0A 4LYHA 2IS4A 1N0UA 3EWAA 2YHSA 3K9GA 3KDSE 3ZYCA 4R2IA 1UDXA 3BBPA 4H1VA 1LB1B 1NIPA 1R4AA 4NCKA 1PJRA 3PITA 3CNNA 4Q01A 1CP2A 1CJMA 3ETLA 2GJ9A 2D7DA 1XEXA 4F38A 4AKHA 1Z63A 2OUKA 3NDBB 1K8RA 2PH1A 4Q4AB 2ZJ8A 2P6UA 2FNAA 3SS8A 3P4XA 1G19A 2KB0A 1P3JA 2GKSA 3AQ4A 4BPBA 1OJLA 2PCJA 1IM2A 4B3FX 2G0TA 4PX9A 4HB0A 4RY2A 3SOPA 3RC8A 1Q20A 1S4QA 4KBGA 2J7PA 4RSGA 3UPUA 2BMFA 4BFYA 2NO9A 2ZRCA 3GEEA 3CRQA 3GJ4A 2QP9X 5FOXA 2ZSDA 2CVHA 2NTYC 2ATVA 3NEJA 2GXSA 4BLSA 1OPXA 3U3OA 3T34A 3W3ZB 1AKEA 3KKQA 3EXAA 2IUUA 2Q3MA 2ECKA 5KUTA 2Q6TA 4X8MA 1C1YA 5FUXA 1EXMA 3P32A 4NCNA 5BYKA 2QMOA 3BJIC 2DBYA 5CIQA 5KDLA 3B13B 1WXQA 2AFHE 2D2FA 5BN5A 1IJFA 2IWRA 4A4DA 2RH5A 4Q1DA 1W49A 2CE7A 1HE1C 3L2OB 1A2BA 4O25A 5DISB 5KOYA 4JS0A 3LVRE 2OCYC 3NHBA 2WMOB 2D06A 3LXXA 5FOUA 1IJEA 5TXGA 3RDPA 1HQCA 2BM1A 5KDOA 2FN4A 2PCLA 5CB8A 4OK6A 3H4MA 1VYUA 2QSZA 5B57C 3HYRA 3TSZA 4M1WA 5DH9A 5JSZA 3IEVA 1R10A 1TQ4A 5KSYA 4L5BA 3K9NA 3KXLA 3OF5A 4Q03A 1F2TA 4C30A 1XFAA 2GEVA 2UZ3A 5EE5B 3SQWA 1DO0A 2MSEB 1E1QA 3BC1A 2WTUA 2YOGA 1G8YA 1OLOA 4FMCF 4DSTA 3THOA 5FUWA 1SHKA 3I1FA 3U7EB 3LO5A 2ZRJA 4TYQA 3W8NA 5JLJA 4PSAA 5L3RA 1F5NA 2VIIA 2W2VA 3HR8A 4IHQA 4MUBA 3RLFA 4C0HA 2O8EB 2DFKB 1ZD1A 3ZVLA 3DOEA 1D9ZA 1P9WA 3HWSA 1R8SA 1DTSA 2IS2A 2QGZA 4PSKA 5FUVA 2YC2C 2ZJ5A 2PZGA 2ERXA 2Z0MA
chains in the Genus database with same CATH superfamily
1BU8A 2WINI 2ZYVX 3RK1A 3UIEA 1B76A 2BUBA 2CWDA 3H4VA 3O95A 3AUKA 4QOJA 5LQCA 2C3UA 5KQSA 2QVCA 1EVLA 1MV8A 3WWZA 2EV9A 3MAAC 2QU8A 3Q6IA 3Q8WA 1ZKMA 3JATA 3PFBA 3PQEA 3L8MA 4QJ3A 3RANA 2PIDA 4I55B 2QI9F 4M9UA 4M6WB 5JZBA 3IO3A 5DRYA 2CN1A 1ABBA 4XDGA 1G8HA 1XK6A 1DKUA 4JHXA 5ULLA 4WV3A 1RAIA 1FU7A 2GAFA 1DKNA 5EP1A 4YECA 3HKCA 5CFRA 3W9YA 1RHUA 2JI9A 1OLSB 4BVFA 3PWSA 3KX2A 2RB5A 2DHDA 2QYTA 3B38A 4IEFB 4D8XA 3GEIA 3VU8A 1L7VC 1ZNZA 5JNLA 1NUUA 3AG5A 4NBKA 4JMPA 1PKEA 4BY9E 5BN4A 1OAKA 1USKA 4PZCA 5C4IA 1N6KA 5JDCC 4KN9S 2BGNA 3DBHB 3R41A 4FZRA 4MW7A 5H02A 3RU7A 3TSYA 4MKHA 4EZIA 3DFUA 3CVVA 1PI3A 4C01A 4W5QA 3IOYA 4FHEA 1Z35A 2QT1A 5A0VA 2BKVA 4JR1A 5IN4A 3H16A 4RD2A 3H3FA 3OQ6A 5FUMA 4WCDA 2FWBA 3FD8A 3FMGA 1M0TA 1ITZA 1T0IA 2AEFA 5I7OA 3BE4A 4RKQA 4DB4A 1G9XA 3GJYA 5BT9A 4YRAA 3RBVA 2CLMB 3WGKA 4LC0A 3SM3A 3DCIA 1FTWA 1RBZA 1NMQA 1TZBA 3CF6R 1Z4KA 1S8OA 2IYTA 1E77A 2R68A 4P58A 4QRHA 4LJ6A 3C3YA 4MKZA 1HRKA 1QUEA 1FQKA 1H1LA 1O94D 1YZKA 2CXHA 2Y1KA 2YCLA 4PG4A 1U7UA 5ENZA 4MRSA 5F12A 4XVCA 4YPVA 2IHNA 3USZA 2GPJA 5GP1A 4MPTA 5DYGA 4FNGA 2MOKA 3VR0A 3G13A 3HM2A 2CLSA 3CX4A 3GRRA 4N7JA 3T9BA 4CV1A 2X0IA 4FOTA 3W6OA 3CVWA 1TADA 2VWGA 1Y9EA 2XSZA 3I05A 4R4JA 4Y1EA 3DBVO 1K89A 1G8GA 2BM9A 2ZWOA 4P5PA 2W5UA 1K86A 3VO2A 4LOJA 3A6FA 2XIJA 3IGFA 1GPKA 1UBNA 1GR1A 4FS8A 4LHWA 3G5TA 4G07A 5A0FA 5BN5B 2WF5A 2BLNA 3UOWA 3W4IA 3BF8A 2AJBA 3ZI0A 5GZ1A 3GT0A 1P4RA 4EI9A 1KMMA 1TJYA 1YVRA 1QGZA 2C31A 5TMBA 3VZBA 4EYKA 3ND7A 4E5YA 1NUSA 4YK7A 4P7BA 2GBCA 1Z13A 4QJ4A 1HT3A 4IDFA 4LJSA 4UOQA 2IYUA 1X8KA 3PCXA 3BRSA 4IFBA 1E4EB 1DEOA 1KVTA 3ANTA 1C9YA 4TN5A 1PK9A 2I22A 2JCVA 3O8NA 4ID3A 3A6HA 3VI3B 3VMMA 3AESB 4LCBA 2BJHA 4TTAA 4U02A 4IXMA 5EE9A 3RD5A 2VF2A 3SJ7A 4C03A 1T43A 2SICE 1FSFA 3O03A 4UTPA 1VG9B 3QEJA 1I9GA 2VH2A 4X6YA 1KAQA 1X1CA 1SR8A 3CH6A 5E6SB 4N76A 2RGWA 3DJYA 4YP5A 3LS2A 1XEFA 4DW8A 3KTOA 1H69A 4Q9IA 1WEKA 2BD0A 2VCHA 1D0IA 3MD0A 3OEED 4IYJA 1YAJA 1A5SB 2EXXA 3NDIA 5CURA 1C1DA 2JZOA 2VPWA 3HZRA 3IE2A 4CDGA 2AD1A 2PMBA 2HCBA 5FOVA 2GK4A 3K73O 3LK7A 5IKPA 2GN0A 3RUFA 4B82A 4OXNA 3QZUA 2I8AA 4MV6A 3UH0A 1K9VF 1Z0AA 4RA6B 3N8GA 5DYWA 4PTYA 4RF4A 5AHOA 1JECA 3UGQA 4EI8A 3QX3A 2NZVG 3AY7A 4JITA 3WNVA 3DE1X 4WBXC 3I0ZA 1LW6E 2BM8A 4HX5A 2OBYA 5KOJB 3EY4A 3QOWA 1Q7BA 2FLWA 2JFPA 2Z3WA 3RS3A 2IYFA 2VYNA 3BRQA 4IO1A 3BXGA 4FFOA 5HA5A 5BMOA 4CKZA 1QCCA 4TT3A 3VR3A 3N0TA 4AQYB 3D0RA 5ERGB 1CUVA 1U2QA 2NV2B 2Z83A 5HRCA 4XSHA 1C0EA 3NCTA 4HWGA 2Q07A 3RODA 1FQOA 1ICIA 1WPGA 3KQNA 1Y3CE 3IILA 4W9NA 4YCNA 4DV3B 3CZAA 1EESA 1I1QB 2DWQA 4D9GA 1BDHA 4O4LF 5JQWA 3VKHA 1B8NA 1EGVB 2EOAA 4U00A 3BL5A 2MR6A 5LM3A 4PGFA 2AQ8A 1X77A 1ZOLA 2GOYA 4V0MA 4XD7A 1BDIA 1BW9B 3ZW7A 4UCWA 4XA8A 1HY3A 4KVZA 2ZRHA 5ALYA 5CBKA 3RCBA 1ETHA 3KAKA 3I01M 4MB0A 5JYBA 4X97A 2J7KA 1K6JA 3ZPXA 4ZU1X 4OFBA 4AMGA 1Y8QB 4RETA 1UBTS 1IXZA 5FTMA 3ZWWA 3ETEA 4LECA 3KOZA 3SJBA 4C89A 2NUTA 4DEYA 1JBEA 2OFOA 4D56A 1MIHA 1T26A 3MRXA 3PD0A 4QOEA 2IYNA 4NECA 2J3EA 2XF2A 3C5WP 3T7EA 2DY0A 2JLRA 2PXAA 3C39A 1DARA 2WT8A 3PQ4A 2WAYA 3HCWA 3L04A 4CLOB 1H93A 3WIOA 4XWTA 4YROA 1ZD4A 3K1TA 5EZYB 5JQGB 1P39A 3GJQA 1XIVA 1NLFA 3U7IA 2Z56A 1IN4A 4TSFA 3HQ4O 4AO7A 4DA4A 2GYVA 2W6JD 1J7JA 3JYLA 1WF3A 4YJKA 3FBWA 5LD2B 2H5JA 4WEOA 4FYHA 3NWEA 2WTBA 4KE9A 2O2DA 3DV9A 4J6FA 4RIHA 3EDCA 1SBYA 1V39A 4UZEA 5FBRB 1JIJA 4LRTB 3ZHQA 2W43A 3BPSA 3ODPA 2R8BA 3FWPA 4B7ZA 3TLKA 4E13A 1OC4A 4JQZA 1Z5NA 5IF9A 4LXTA 4PGGA 1T0BA 4E5UA 1IHYA 1XQ6A 3PENA 1Y3FE 3FPHA 4WDQA 2VCEA 2ZI9A 3C3JA 4EHAA 4LV6A 5AKKA 1L7RA 4ZEXA 3OIWA 2P4QA 4PLHA 3TIFA 2VK2A 3E9CA 1M34A 1PL7A 3ELUA 4KNWA 3ZE7A 4RLHA 3SPXA 2FXIA 4EA9A 4ARVA 4M37A 3QBDA 1PG0A 4R1QA 4F60A 1I33A 3QLVA 2JDID 4PCVA 2OAEA 4XVQA 2Q4TA 2AFHA 2JIPA 2PMKA 3WKDA 1N6LA 4U7JA 4GSYA 1JYSA 1AG9A 3RV3A 2VP2A 3HFSA 4OHMA 1C3OB 1TM2A 3H8WA 4KWTA 3V42A 1VL2A 4HWOA 4JUDX 4JLDA 1W4BA 2C5AA 2QRQA 2PRJA 4DR5B 2BC9A 2PEZA 1R74A 2C78A 4BKPA 2YV3A 2FPXA 2G5TA 2WPDD 3I32A 3L8CA 1QH1B 2VUSA 3W90A 2FCAA 3D7MA 2E4AA 5AP9A 5A03A 1KH2A 1FUIA 1NI3A 2G67A 3P2OA 4J8PA 4US2R 4OIMA 1RYDA 5EHXA 3L8FA 4ON9A 2I34A 4PYOA 4LZZA 2RGGA 2PFKA 1C0IA 3T99A 3L9WA 3GQBB 2CFTA 3CZ5A 3ZVMA 1IL0A 1TMYA 1WMEA 4BMZA 4ZYTA 3DA8A 3RUHA 3ETDA 4TQUS 4DMRA 4QJ5A 5IULC 3AX6A 3CXRA 5EHZA 2Z5LA 3DOHA 5AVSA 4QVGA 5FA6A 1E2PA 1XL1A 4HB2A 3WBJA 3PFHA 4K6OA 4C29A 2PKRA 1XZ8A 2C92A 3FM9A 3IX7A 4M1YA 5DFAA 1NQWA 4DN6A 1SXQA 4B4UA 4FBLA 1UPCA 3O8DA 4N7MA 3U19A 3RKRA 3GBVA 2XJ4A 5L4LA 2A9JA 2V5VA 2PRYA 3PJRA 2O5VA 2JI8A 2W2TA 4BNTA 1P73A 3D5EA 1BKSB 3Q9UA 1J4AA 1O77A 3RSOA 4RTSA 4TYWA 1YRQA 4ZOAA 3DMYA 1Q1EA 3RUCA 4NAHA 3EMBA 4HGYA 4MQEA 2XNKA 3FOEC 3WKBA 2ILVA 2I6TA 3EC2A 4JP5A 1XPOA 3LKVA 3U9TA 1XEXB 2GEFA 3QJGA 1Y81A 5EJGA 3UQZA 2C4WA 3X1WA 3P4UA 3Q0IA 4Q9KA 1EP3B 4CMHA 1SXPA 3LUHA 1NBHA 3D0OA 1P2VA 3F2VA 2I66A 3NTQA 3PR1A 3VRHA 3QWIA 1U5BA 2VXCA 4AC9A 5HJ5A 1XU9A 1RQGA 4Y9UA 2EQ5A 4TWBA 4QAJA 3CF0A 2H5EA 4HDNB 5DHQA 1E2EA 4FGLA 3BEDA 1KETA 1URPA 2HV9A 4Y2XA 1MRZA 1FBNA 4AJPA 1ZYUA 3WWDA 3UWOA 4BWFB 4C05A 2CNNA 5A2QA 2GTIA 4EJFA 5IC6A 3UA3A 3COZA 4LMBA 3T0FA 3K72B 4CLXA 4YRFA 1J8MF 5K3SA 2G80A 3OZSA 3IBSA 1YQWA 5HMLA 4RADA 3RSQA 2Z2XA 5K8UA 4LOAA 2A5GA 2JVJA 4KO3S 1N5DA 2G8NA 5CTJA 1HKUA 1IBLB 4DZZA 4ZZIA 5BYAA 2GAJA 4EAQA 1IY8A 1FNBA 2FQQA 2AFIE 1QV9A 1Y1KE 1PQWA 2PKQO 1F0KA 3LLSA 1VCNA 3OC6A 4GPD1 4EEZA 2HAEA 5CB6A 1TM3E 3E05A 4EKGA 1W85A 4MV8A 4FC6A 1RQLA 3RVPA 3QEKA 3U26A 1L4HA 2H1LA 3WMFA 4E07A 6AT1A 1AGRA 1M10A 1X2EA 3T1NA 2H7CA 3BCHA 4LXXA 1JDUA 4IQ4A 2V5AA 3RC7A 1CSEE 2P79A 4GZ6A 3OOEA 4DDWA 5AJUA 2ZEJA 3H5OA 2MSKA 1E1KA 2JGKA 3DD1A 3ELBA 3NHSA 3AZQA 2NGRA 4ND4A 4OU4A 5IBCA 4ZC1A 4M86A 4MJLA 4URWR 1KL7A 2NTJA 2OL4A 1YRLA 2KHZA 2ZYIA 1I7DA 1P81A 3ISJA 5FL7D 4HY3A 1ISSA 1TT5B 5JS7A 3GWZA 1GEGA 1UM9A 1IUNA 4OATA 1QRDA 1Q1GA 2EFEB 3B6EA 2FKAA 4H17A 2CL0X 1J5EB 3DOFA 1XRRA 1I7NA 3MFQA 1XLTA 1QAQA 2Q3BA 5E1MA 4ZI2A 5B4UA 1GADO 3EUAA 3LVFO 4QJBA 4E5PA 4JV5B 4E7OA 1DAEA 5I7HA 5J4KA 3CWZA 2ZB7A 4ITVA 3GFBA 4WX2B 2IZ0A 3AQIA 3H7IA 5GONB 1X7HA 4B3CA 4X0EA 3V8VA 3VR6H 3VYUB 1LX7A 5KINB 1GKLA 4DDHA 3H9GA 5LNK1 1HZZC 3TW4A 1LZLA 4JVLA 4NEQA 2NQ2C 3KM0A 1TYAE 1UDWA 1VYHA 1Z25A 2CE2X 2QV7A 1N6RA 1OV4A 1TQ6A 5JH7B 5EUQB 2XV1A 1BMTA 4MDHA 4WACA 1TYZA 4JOQA 3AZOA 3F5QA 3N0VA 4P86A 4QT0A 3RVLA 5CEEA 4KFUA 4DR6B 1EE1A 4ND6A 1CIJA 4BUJA 4ONEA 4OUDA 3VZDA 4A91A 4CDRA 1US8A 4MS3B 1E5TA 1Q74A 3O47A 3PGLA 4TGLA 4UHEA 3EDYA 4AD8A 4KI0A 4KQIA 4NEHB 3BGDA 3ZDYB 3GZTB 3UF0A 4EX7A 1CR4A 1Z4JA 2C94A 2F8SA 1GUFA 4FEAA 3DTNA 3KOMA 1Q0QA 4M8IA 1MAUA 2QORA 2H1RA 2ZRFA 3OOHA 3J81k 5BSKA 1V5EA 1Z15A 3ILYA 4XIGS 1YI8A 1DRWA 4IV0A 1KKLA 1JHXA 1KR2A 2DJIA 2OO5A 3ROQA 3OPQA 1LV8A 2BR4A 3D0KA 3WGUA 4BIMA 4EF4A 1KEZA 1TUBA 3F71A 2AC2A 1ONNA 3Q2KA 4OQYA 1U4SA 2M6KA 3I42A 4EKIA 2JGLA 4C0BA 2ADFA 1PO7A 1UP6A 2KS6A 1UZNA 3E81A 2JIDA 2IU0A 3OIVA 5BN1A 3T3DA 1Q7GA 4JBNA 2JD0A 4D0LB 4CTMA 3X1DA 3CRW1 1Y37A 1FXWA 1V5IA 3DS8A 2OD7A 2QXUA 3R24A 4JNCA 3WOHA 3WIBA 1NBME 3S29A 3LHKA 2OHVA 4G24A 1RRGA 4M0DA 1JAXA 3DQPA 3QXHA 3UJ8A 3WLAA 5TARA 5FP0A 4GT1A 3RI3A 3DAPA 4YCCA 3K0AA 3PTLA 1ECLA 5I4KA 4ND5A 4H18A 5LZ5A 3DEYX 2HJHA 1BVHA 3LBFA 1FVXA 4HB4A 2XTAA 4E30A 3CNQS 4RK6A 1GRVA 1Z8HA 3N5CA 3VR2A 4BLOA 1ORRA 2CJXA 3SAJA 4M9RA 4ERNA 1OXSC 5GGYA 2GXUA 1QJCA 4B7CA 4OLBA 4CEJA 1FNMA 2EGUA 3QVSA 4TRMA 5B3AA 3VH2A 4LYGA 3B7PA 4L5AA 4I36A 3GP8A 1D4ZA 2V6IA 3MA0A 3AUYA 1RXCA 1V1RB 2ZUVA 3HE3A 5BR1A 4J91A 4X45A 4C3VA 2E87A 3BRWD 2HLDD 3DZIA 1I2MA 1XXHA 1VYTA 3BULA 4BMCA 4CLHA 1FL9A 5AM3A 4EW1A 2XCSB 4QLBA 4XPIB 3ZN2A 5MN4A 4QPPA 4WOJA 4V1CB 2H07A 1CIVA 4IVRA 3SX0A 3U7JA 4J0EA 3NHYA 4RTQA 2B3DA 3LX4A 3AXSA 1HI9A 3K1JA 2GBLA 4I50F 1N5LA 1G55A 5D7BA 1AN9A 1UEXC 2H3HA 3DV0A 2PLAA 3TDNA 1EDOA 1PR1A 3ZC3A 2J07A 1HDOA 1W46A 1CQJA 3ZLBA 3RHTA 4GLBA 4E5NA 2PQMA 4R2JA 4RABA 4ER5A 2ORIA 3K5PA 4PN7A 4Z4EA 4R1TA 3WGIA 4RTOA 4QTYA 2HEIA 3AFOA 1CUCA 1KDRA 3BICA 4BB6A 3A3YA 3EFEA 2J3HA 1PIWA 3CNEA 3OCCA 1KFJB 2IE0A 4JB3A 1PQPA 2AOUA 4N3CA 4AULA 5CLJA 2IK8A 5IZCA 4UEWA 2XNDA 2R6ZA 3QPAA 2C1XA 1HDYA 2H2GA 3JYOA 3N2EA 4K9DA 5I5GA 3GBPA 1N0WA 3R9KA 7REQB 1VIDA 2DR2A 3NH9A 2P2YA 2I7CA 4F2PA 3B89A 5D87A 3EJWA 1PEDA 4Z4CA 2WZCA 5KJFA 1RJ9A 2X14A 2ZQ5A 5F4BA 2REQB 2XB2A 2LE0A 3DT6A 1KI4A 5JVDA 3DD5A 1YCDA 3DXYA 4RVOA 2WWYA 2O59A 5U4XA 1GZ3A 3NHUA 5A4JA 3T3MB 3WP0A 4RPHA 2JLUA 2OBMA 5AVRA 1ZIXA 5IF3A 4J3JA 3FPAA 5C7IO 5GVRA 2HHLA 2GBFA 3TWOA 1I3CA 2OZEA 4X7BA 3WGTA 3K20A 4BTEA 2O8FB 3QLUA 2HI0A 3ORQA 3BWDD 3KKPA 1MABB 1QR6A 2C3YA 2XE7A 1X15A 4NK4A 1JEJA 1IC6A 4HNGA 1J9GA 4MGIR 4XIJA 2BFFB 1C4KA 1WCYA 2HQ1A 1Y4AE 2WHXA 1UT6A 2OD9A 2YYZA 1DXYA 3BHMA 5JMWA 2V58A 1QM5A 2W0MA 3QMVA 5ECWA 1JIQA 1V25A 4KKVA 2L69A 1G8PA 2O0KA 3EQ9A 3K2BA 4RK5A 2H9IA 3ROFA 4JXXA 3CCFA 1TEXA 1N75A 3SXJA 1PJ2A 3TNDA 1SKYB 1ZI8A 2Q7DA 1HDZA 3K7EA 1DCKA 3KTAB 1KEEA 3HGTA 2Y9MB 1CQXA 1UIMA 1RXUA 2WNIA 3QEMB 1KEPA 2IXGA 4LXYA 3EYWA 4M1QA 5AW6A 3MXOA 1JT2A 1AX9A 4MB2A 3I8SA 1NIJA 2ZOSA 3P9IA 4IX9A 5CK4A 1ZXLA 4CN8A 2VQ6A 4YQFA 3U61B 3LC0A 1IUKA 3F9CA 3MMXA 4YT4A 2PZJA 3PXXA 3VSCA 5TX7A 2YN2A 4E31A 2DKNA 3AEZA 1ZIDA 2J9GA 2W8BB 3X2EA 2VPYA 4UCXA 1RVV1 3SXUA 5JS2A 2O8FA 3OIGA 3ONFA 1NC1A 2XQJA 1NVDA 4X00A 2UVPA 4W6QA 3PX2A 3COVA 4TMKA 3AJDA 1CQIB 1HT1E 13PKA 1SULA 5TSDA 3UB2A 4A0RA 2YH2A 2IEBA 5CLIA 4Z7JA 5NLLA 1E3MA 5HNKA 1GYPA 2WWIA 4BO6A 1Q0UA 3KUKA 1ZEJA 3CR7A 5ENDA 1ZWKA 5CPBA 2H9AA 2X6QA 4ZT3A 1BNCA 1Y6ZA 3K2EA 3BQNB 4W6ZA 5ADWA 2H00A 3KAJA 3PS9A 3BDVA 2QN8A 1I7QB 4G8JA 1XRLA 4JSRA 2WKWA 2PJUA 1AV6A 2I2CA 1QE3A 5A5GA 4Y98A 1KWGA 2B1QA 1WRBA 3EEIA 1P75A 3JQFA 1JBKA 3IBYA 3II6X 3LUDA 4WESB 3HKEA 4UBIA 5MF6A 1QYXA 1E64A 2FEPA 2E55A 4ZO7A 1VXRA 4WMLA 1AUOA 2WUDA 3EVNA 3KLMX 1MT0A 3SZOA 3ZCVA 4DF3A 3RIHA 3MRVA 3M2TA 4NJMA 3GT3A 4H3HB 5EG5A 2W2KA 4TL9A 3ONNA 2GS9A 1P7PA 4OB8A 3S1AA 2JHFA 2H1VA 1I1NA 2QX9A 3G8DA 4QGHA 1I01A 2P8SA 1DQSA 2BEWA 1Z17A 4H1TA 3RRMA 3VA7A 1QYRA 2VTEA 2WIGA 3IH5A 2PL5A 4AJ4A 1GCGA 2X58A 5HUHA 3LOUA 3AVQA 3U1VA 4U9UA 1GSIA 3ICEA 1NDHA 3CTMA 1JFSA 3TQOA 2R96A 3KEFA 1W0JA 3QTLA 2ZIXB 4B09A 3MHPA 2OILA 3KPYA 2X2OA 3L4EA 2O6LA 1SKYE 2WSSA 3L7DA 2J6CA 4P7GA 3F9RA 3UGTA 4ZZ3A 3D8HA 4JA0A 2F1IA 3DZKA 3ODGA 1Z7BA 1ZK4A 3FI0A 1NF9A 5F33A 3MCTA 4Q3LA 4OI1A 1IJKA 1NSTA 3A37A 2QLFA 4HNUA 2JA2A 4QGGA 3D81A 4XM0A 3ZU4A 2QRVB 3L7YA 2QVZX 4XFDA 5IVHA 4KXYA 4R7TA 3AIIA 3T9FA 1TE2A 1TO1E 2PYZA 5IJXA 3RVKA 5LQUA 2RGRA 1U28A 1MA0A 2JFBA 3LZCA 4QU5A 4CHTA 4MCJA 4N0MA 1ESEA 2O1EA 3LA8A 3QX9A 3TL3A 3QF7A 1BJRE 4L07A 4II3A 3ZKWA 3OFND 4AQDA 4D6YA 4YUZA 3THXB 3EZGA 3K0CA 3U6KA 2Q6IA 2R6DA 3C3XA 4GPAA 2H5IA 2AR0A 3A4NA 3K32A 4INJA 4O8ZA 1U0HC 3Q7RA 4R1OA 3ZWOA 9MHTA 3KAQA 5C1DA 2WY2D 4U0JA 1JB1A 3WDSA 2FWPA 1P80A 2QP3A 4Q4AA 5FUBA 1IH8A 1LW7A 1NYLA 2V55B 1C2YA 1T5DX 3UAOA 5JV5A 2GQ0A 5DYTA 4R98A 3OFNA 3VI4B 1Z9BA 1YJ8A 2D8AA 3VYRB 4RVFA 2IKQA 3DZJA 1F8FA 1X38A 2I4IA 4KDCA 2MIIA 2NPFA 4ZOEA 3IVGA 1J39A 2VHJA 3OJXA 4YMVA 2WD8A 2WOOA 2PMWB 2E4XA 3KHKA 1LTQA 3NBFA 1GCUA 1P6UA 1SKBA 4MA5A 5AK4A 1K7FB 1XCOA 1JP7A 2VP5A 4D0RA 1YB6A 1E6KA 2ODBA 4I1IA 3I2GA 4RIGA 5HTOA 4OX9B 4PAOA 1Z16A 1QZ3A 3HFJA 2UV8A 3B1FA 3IODA 5EJAA 1QQBA 1FC0A 2UXDB 1B43A 2GX6A 4LOKA 4Q9DA 3NHMA 1CR0A 1VLLA 4A8HA 3B9QA 3O1LA 5JECA 4W4TA 3ZKWB 2E49A 1XPJA 4RMHA 1YZFA 4PZDA 5JARA 1OFHA 1PK8A 3AR7A 4Z4FA 1I1OA 1CS0B 3G1WA 4I46A 3VR5D 1KP2A 4M1MA 5KTNA 2NXJA 2FGJA 3SKYA 1BGWA 1KHHA 4GXTA 3DP9A 4ZVSA 1P0PA 5JTUA 3LVBA 3LC7O 3ZWCA 1T5HX 2GK6A 3JAKA 2C07A 4RLQA 5ALWA 2IITA 4AJHA 4BQQA 5M7EA 1W36D 2L17A 2JZCA 1RQ7A 2CMDA 4AKGA 1CU1A 5KJ6A 4K2HA 5DASA 3NVKI 2P9HA 1OGYA 3B1KA 2O8NA 4BN0A 2D1FA 4M9CA 4RX1A 3FNGA 4V3BA 3UV7A 3KZMA 3A9CA 4G0QA 5JCPA 2XXAB 4K9LA 1ZHOA 4DLTA 5LL6P 4G8BA 2GEUA 3P2EA 5TMDA 1SXJD 3K71B 1M0SA 2R6HA 3MJEA 5AHWA 4KR6A 1H65A 3OTQA 3EG9A 4NMWA 3FGZA 4PZLA 3WNBA 2CFSA 4C43A 2ZYGA 2F8LA 4QRIA 3T4UA 1PCXA 4HDQB 2P0EA 2OV8A 5ICFA 1OASA 3M89A 1F9AA 3AF0A 4QLOA 4XFKA 5TPWA 4L8YA 3ZEAA 3ZU3A 2VL7A 2YWGA 3KU1A 2C2KA 4J0GA 3IIJA 4KI7A 4Y6SA 3I30X 5CT5A 5SYAA 3S2UA 5FV4A 1ARZA 3W7VA 1QGOA 2CZQA 3G2OA 1KOJA 4I7EA 1YSCA 5EIBC 1LK0A 5KHAA 3R74A 1OU4A 2RAUA 2Z1NA 1GIAA 2BIFA 4KN8A 2Z95A 4X92A 3VKGA 8AT1A 3GF4A 1QNFA 2FXVA 3WAGA 3WWEA 2VDJA 2FMUA 5CVUA 3VTFA 3QNUA 1Q7TA 4UOEA 2I9KA 2VC2B 4TLDA 2GNOA 4NZ9A 3SHVA 4IYRA 1SK8A 1D7OA 4JU8A 1X13A 2C7GA 1NXWA 1SWWA 1EWKA 1AY0A 2I9PA 3KR0A 2C57A 1VBNA 1W4CA 2APJA 2G70A 3PV0A 3HP1A 2BKUA 3CUEF 2P5TB 3DZFA 3V2GA 3G3EA 1RSZA 4WXPA 3ZIAA 1J5PA 1UOEA 3CB4A 4LWZA 1P60A 3AJAA 4UHJA 2V65A 2GEBA 2Y93A 3EIHA 2TECE 2Z5VA 4R16A 3GLKA 3TQSA 2WIKA 2XQFA 1X1SA 1S3FA 4CR8A 2V4MA 1EJ0A 1AS3A 3RJMA 5DP1A 4KJXA 3EBPA 3GDWA 5AVKA 4Q19A 3A36A 3W8DA 1Y80A 1OCEA 2JLQA 3PVSA 5T3YA 5K3OA 1K8XB 3NT4A 5JALA 4NMMA 4RL6A 4WCFB 5HOEA 1HK7A 1UQTA 1QUFA 4EGAA 1UANA 1H3EA 1VKJA 1AUVA 2W2PA 4MVXA 5E8JA 5FQNA 3M81A 4Q7JB 3ZH9B 1P8AA 2J0UB 2G1PA 4FDTA 1TDJA 2GXQA 3P71T 3PU6A 5AI8A 2DLNA 4V02A 2FFHA 1T4BA 1FP7A 5F1YA 2BGKA 3OD1A 3KSZO 3ZV6A 3TTVA 4D79A 2NZUG 3EVDA 4FGWA 1ND6A 4GM0A 2PBFA 4PSCA 2IH4A 1Z2DA 1W93A 3EXHB 3ICCA 4IQGA 2YXBA 5IRCD 1T0PA 1Q2UA 1BXGA 1GUYA 3SEZA 4U8HA 1XRMA 3R4VA 4KPEC 4HGQA 1R37A 2ISQA 3NIBA 4L51A 1P77A 3JRNA 4XD7D 4JYMA 1EBUA 3CZMA 4YHBA 3ZCPA 1ISGA 4EJSC 821PA 2DKFA 1JEYB 3GUYA 1C9MA 2QQEA 1WDLA 1HLGA 1GR0A 1VE1A 4Q05A 4EUFA 3DAFA 1M6VA 4LY9A 2VJQA 3ZX5A 2IQIA 2FSFA 1EIZA 2HTFA 3RRXA 3FRJA 3N6RA 2WU8A 4A2CA 1AKNA 5HKAA 5ALNA 2Q2NA 3EUEA 4OLHA 3FOAA 2O7RA 4R84A 1U2DC 4RAQA 3L5OA 3O3OB 4GX1A 2IT1A 3WLMA 4F8JA 1RADA 5HZKA 2D5LA 5ARBA 4F2DA 3C16C 3H2SA 5H83A 3JD3A 2CVQA 1N8TA 4MMXB 4YONB 1K6MA 4Y2VA 1V7QA 5BOSB 3W78A 4MKXA 4CQMD 1J23A 3PXAA 4EHIA 121PA 3IVAA 4REOA 1RRFA 3GVXA 2UXBB 3UPDA 2H4JA 2YFQA 4Y6QA 1MVLA 3U9LA 2I3GA 3A4YA 3H8JA 5I01A 4LIPD 1U02A 1SFRA 1PD1A 3WB2A 1OKKD 5CFQA 4D46A 2Y1LA 1X9HA 3AF4A 1PJBA 4FDVA 4KWHA 3QELA 5FJIA 5GINE 1GXSB 2I55A 4ISBA 1FS4A 5AOCA 1OA1A 3PFWO 4H9GA 2B25A 3PG5A 3RT1A 5KYNA 2QMUA 4MGKR 1L3CA 1B6GA 1UZLA 3KCQA 3O74A 2YX1A 1LFDB 4P4TA 3ADKA 3F3YA 3GFPA 1HMYA 3FDZA 1LSUA 1USVA 2MJLA 3OE1A 1YFLA 1E2KA 1ID1A 2C5LA 1ZJJA 3B51X 5ALQA 4E4TA 2DY1A 5LIPA 1T5OA 2G25A 3R9XB 5D6OA 1VE5A 4XWYA 3MJDA 2Y4OA 4V0SA 5EKTA 3UAYA 4YNBA 3DFMA 2PMEA 4DNXA 1U0NA 1TVCA 3ZDZB 4A82A 3MWEB 1KNXA 2Y67A 3BBLA 4W82A 5ELMA 2ZJ6A 3L4SO 4EKYA 1UWLA 3LY5A 5L7WA 4KV9A 4JLBA 3DE3X 3DVAB 3LUAA 2ZYRA 4D5GA 1HLDA 3B60A 5MHTA 4MDFA 1EFVA 4M1OA 4WTOA 1STOA 3CE6A 1Z7WA 1H4SA 3T7CA 3BD6A 2CJPA 2VKTA 5ENVA 1JYEA 1KH3A 4PLFA 5EI5A 3KT8A 3O8QA 1T4DA 3LTNC 4FDLA 2OBXA 3W06A 5GJBA 2FVXA 2NSYA 2YNMA 3DKPA 1FZQA 2ZAMA 2E6UX 2HWUA 3RRJA 2P27A 1QB8A 1GXSA 1BDJA 2DC1A 1SA0B 2DU8A 2J0EA 2XUKA 3TO5A 2BKLA 2PTHA 3CU5A 3K8YA 1I2CA 2PUVA 5HJEA 4JJIA 2NW6A 4QODA 2D5AA 1OWNA 1J00A 1LI7A 1JDVA 1Z8FA 4I4TB 3L7CA 3G0IA 2QM3A 3ZCQA 3RYCB 5DM70 4FW9A 1SZPA 3NHKA 4OF4A 1E0SA 1F06A 4QEZA 4TXHA 4ENTA 2IP1A 1OQAA 5BSGA 1XMSA 2JFWA 3QFCA 4ENSA 1YV9A 3M4ZA 3T3OA 1FPMA 4ER6A 2ZVDA 2HLPA 2QLJA 1F1BA 2BGLA 3I2HA 1VI2A 4GR4A 1BROA 2R2AA 4GYJA 5CVJA 2CJWA 4RM2A 4FCCA 4C0AC 4F46A 1JGTA 3G7NA 3UOGA 4GZ5A 1IN5A 5D01A 1CUUA 2CJYA 4OUDB 3FPGA 3AF1A 4FMPA 4C7VA 2FVYA 5ADUS 1VLJA 2K87A 4E14A 2R66A 1G2QA 1KFEB 4H31A 4NH4A 1QS0A 1ZJYA 1TM1E 1ZBQA 4DRXB 4U1RA 1EEXB 1ZWLA 2FR1A 3R75A 1DJPA 2R7MA 2GJ8A 4JLJA 5LZ2A 5BP7A 4JI4B 1EVKA 1DAHA 1COZA 2IX9A 4D3YA 4E5KA 2VXYA 1CV2A 3OJCA 1NJ8A 1P0FA 2H2AA 3F8TA 4Q1AA 1NW6A 3E7FA 1YJAA 3LCUA 4MV1A 4PINA 4WKGA 1K5HA 1DU4A 2QVBA 4G0YA 4UCFA 4GVPA 1O7JA 3QPVA 4B73A 1D0SA 1S6YA 1EFRA 1VL1A 3DQQA 4J0QA 4W9NC 3CW9A 3SEAA 5K8VA 1KU0A 1P9NA 2Q2VA 1CBUA 1BN6A 3NKLA 4JXKA 5DYNA 9LDBA 1YR8A 3T7IA 2AXEA 3PFKA 5AT1A 2XUAA 1QO9A 1LU9A 3IL2A 4IVNA 3SBDA 3ZHXA 1R4MA 3V1TC 2XTJA 3TZQA 3DNMA 3SZRA 3B53X 4EGSA 3U09A 2RONA 3PPWA 2YC4C 1ECJA 2NZ2A 3E7XA 3N70A 1GTVA 1W2HA 2ZRLA 2QAIA 1KJWA 2BR5A 3QY0A 4IIHA 1FDTA 1HG0A 4LFBB 3HP7A 3MTAA 1FEZA 1ZJ5A 5KAMA 4N03A 5A7FA 1TC1A 2P1DA 3RVMA 4MRMA 1UJ4A 2V9PA 5AO9A 4L2IA 1C7IA 2PLFA 4PQEA 1ZM9A 2J09A 5ALTA 3DZCA 4XAQA 4B2YA 3PXCX 5D8DA 4KJZA 5I7EA 2BFEA 3LV8A 4EA8A 4M46A 4TS4A 1AQJA 4HGNA 4G97A 3LM8A 4QPDA 5EJ6A 1CC1S 4C2UA 3PWTA 4JC8A 2UZ4A 4YJHB 4RENA 3ILXA 2VJYA 4IJMA 4RA9B 1WB5A 2ZXUA 3Q8LA 1NASA 5CJJA 3RADC 4QYIB 1D4FA 4OQMA 3V8BA 4PAWA 1JLKA 3NO4A 4FD2A 5TS2A 1VGRA 4OMDA 4PRYA 3JWEA 4G4SP 3SEQA 3EC7A 1V3VA 4PHFA 4B76A 3CEHA 1DC8A 3KB6A 1DAKA 3DMTC 7REQA 4F92B 3PWZA 4W5TA 3KSRA 5E3HA 3MG9A 3R44A 3AM4A 1QMGA 2X8LA 2ZBDA 3GUZA 3JQ8A 3NH6A 4DIFA 4RD0A 3ZI7A 2HSZA 1SG0A 3DR3A 3GAAA 1E8NA 1CUYA 4JL8A 3IAS1 2NTNA 4MVJA 4QYSA 4WN3A 1KYTA 3QUSA 4JYBA 1E66A 1ZN8A 2PZEA 2PA0A 3L7BA 4UXJA 5DBFA 4D3DA 3NORA 4YLGA 4D81A 4O4HA 1DBPA 2RHHA 3KBOA 4MW1A 4GWGA 3ZDFA 3TM5A 4AW9A 3PQ2A 4OQZA 1ULZA 2FQ1A 2H3EA 3QW4B 4FC7A 3RH0A 3KXPA 3OT4A 3R5KA 4OVKA 3EG5A 4L6CA 4LF4B 4IMRA 2HPVA 2PLRA 3ZV5A 3UJ7A 4CM9A 2ID4A 2VH1A 2ACEA 2F62A 3C98A 4C1NA 1GT6A 2GPYA 3QFRA 1WMFA 3S70A 1G38A 4HRYA 2D1YA 2ZUSA 4B85A 4U5QA 3RHSA 2B78A 4NYIQ 5TR9A 2FI1A 3KHSA 1S1MA 3GLFA 4MV3A 2GM3A 3MWDA 4Q4LA 1G98A 4UATA 4A03A 4DV2B 2R84A 3IAUA 4DT1B 3L93A 4ARUA 4BNJA 1DJNA 1EEHA 1W6RA 3GJTA 3MJFA 4XQGA 1N0IA 4IV5A 5DF1A 3U4AA 1TJ5A 2O2EA 1E79A 3C1TA 3QVJA 4DZTA 5DNUA 5B2ZA 1KIMA 4B7UA 2JLBA 4ZODA 5J59A 3SS9X 2XR1A 3PCRB 1O5TA 2O20A 1AO3A 4F93B 4DCSA 2Q8QA 2P2SA 1HXHA 4EMUA 3EUWA 1D2MA 5AMXA 4NL4H 4LJAA 4QNNA 2XNDD 4B3DA 1VI5A 4EMTA 2YZGA 1U90A 1VOTA 4P1ZA 2A3NA 1EX7A 3R3JA 2DFLA 2DBRA 4XX0B 5KNDD 4PYQA 4JDUA 4LA4A 4H3VA 3WLTA 4DCGA 1BCRA 3A7DA 4WJLA 3EN0A 3HLKA 4PPYA 4YVFA 1XVUA 5IAOA 2NNWB 4DFDA 4H60A 4O2BB 4QUKA 2QX8A 4QUIA 1CQIA 3ZJYA 2DBVO 2I6UA 2XT0A 1SVOA 3OD5A 5CM9C 4GXRA 1CFZA 1Y1RA 2HN9A 3COYA 4H7HA 4PTLA 5AW7A 1IY9A 2HDOA 4NQRA 2I78A 1NI4B 4YXFA 1E1QD 4COKA 7MHTA 2OO7A 2E5LB 4PS0A