3L0IB

Complex structure of sidm/drra with the wild type rab1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
174
structure length
162
Chain Sequence
SMPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSRGAHGIIVVYVTDQESFNNVKQWLQEIDRYAENVNKLLVNKCDLTKVVDYTTKEFADSLGIPFLETSATNVEQSFMTMAAEIKKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of host Rab1 activation by the bifunctional Legionella type IV effector SidM/DrrA
pubmed doi rcsb
source organism Legionella pneumophila
molecule tags Protein binding/protein transport
molecule keywords DrrA
total genus 28
structure length 162
sequence length 174
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3l0iB00
4XH9B 5C1BA 1H65A 1KSHA 2QT0A 4YQFA 1RC8A 1E79D 2ZR7A 5FPTA 3SHWA 4ARZA 1FNNA 3MMPA 4JVLA 1RFLA 3EC1A 4UXIA 2BV3A 1NBMD 5TDHA 2F1IA 3TE6A 2C9CA 2FJUA 3T15A 3GFPA 2SHKA 4NBSA 1TF7A 2ERXA 3BFKA 5HE8A 2NO9A 3HR8A 3ZDQA 3QG5A 2VF7A 4LYFA 5EE0A 5P21A 5JMTA 4F4CA 2R6AA 1Z0FA 4JT2A 4B48A 4XD7D 2H7VA 1VG1A 1GKIA 4MH0R 1VHTA 2RGCA 3K53A 3QKRB 3HP1A 3TQFA 4DBLC 4B32A 5FPHA 2JLUA 1ANKA 2O0JA 4OK3A 3EAQA 2IC5A 2CHQA 4URVR 4WZ6A 1XTQA 2GAOA 3ZJYA 3NC0C 1Z6XA 2W0SA 4IOJA 4AWXA 1YKSA 5LD2B 4GP6A 1QHHB 3VU9B 3CRW1 4CEJB 2QPTA 4GOJA 3TAUA 4P32A 5EXXA 2F1HA 3AVPA 3DDCA 4A82A 4HEJA 4QHYA 5CK5A 2F3RA 3I72A 4KXFB 2ZVPX 3Q8XB 2ATVA 3U7GA 2BJWA 2NZJA 1IJEA 1JAIA 1E0KA 4O3MA 3MSXA 3RC3A 2QM8A 4DLWA 4FD2A 4DB2A 4QOSA 2CCJA 4QBHA 3IDQA 3KX2A 4JKIA 5JEEA 4U02A 2FU5C 1WF3A 2OSBA 4JMPA 1XX6A 3KKNA 1UAAA 1XEFA 1SHKA 1KDPA 4HAZA 2GJ8A 4PTLA 4HAXA 2FWRA 1UKEA 1SXJC 4DLZA 2Z6VA 2NMVA 1YRBA 3SNHA 3B1VA 2QNRA 1CJUC 4JL5A 3R9WA 2IBMA 2ZQ5A 1CR2A 2WHXA 3B7GA 1OH7A 4IVRA 2P5SA 5JWRA 3AVOA 3GPLA 1WE2A 5G40A 3QI2A 1OXTA 4DCSA 2F9MA 1W36D 4V0KA 1SVWA 3BFXA 1Z63A 1RJ9A 2KJQA 1XRJA 5GJVC 4G3XA 4K46A 4JLKA 4PXAA 3P20A 3LLUA 2DFKB 4KU4A 3WHKA 2G83A 4TN1A 5AK0A 3WP0A 4M2LA 2QT1A 4DSTA 1W0KD 2F7SA 1ZUIA 2BMEA 1JQLB 2ZE6A 4C0BA 1G3RA 4EQ6B 1D8TA 3LW8A 2ZJBA 2PZGA 1OV4A 2JJ2A 3DKPA 1KJYA 5IRCD 4UQOA 2XXAB 1KI6B 3QSYA 3ZD7A 1W0KA 2EQBA 3LY5A 4QC2A 2HT6A 1OLOA 2YC2C 2ZJAA 4HAUA 1K6MA 1Z0JA 1IN5A 4QJ4A 3U3OA 3B8HA 2ZUCA 1KO5A 3FVQA 3QG1A 1T5IA 2VHUA 3ZQJA 1GNPA 1OIVA 3LNCA 4OHVA 4QNRA 3CF6R 4X8MA 1Z6AA 1UKYA 1FOEB 1Z06A 2J7PD 2BWJA 4ZDIA 2XNDA 1IONA 3L0OA 5B2ZA 2GXUA 3P27A 4CEJA 121PA 5F9FA 3NEYA 2IX3A 3KUCA 2IL1A 3I4LA 2WSMA 4I1UA 1A82A 4IDHA 5DYGA 3AV0B 5IK2D 4LJYA 4NKRA 4BLRA 5LB2A 4C2UA 2FOLA 1Q1QA 2ONJA 3QF7A 1W4AA 4IDQA 2C78A 2REXB 1P75A 4UXHA 4Q9LA 1CF4A 1P60A 3V4FA 2CMKA 3GJ4A 3KJHA 1UKZA 5CIQA 3TVTA 2D3WA 2R8RA 1R8SA 3DMNA 5JSZA 2ZJ8A 1G7SA 1XMVA 4F7WA 3FDIA 3U2QA 1P72A 4E09A 2OILA 5JBQA 4M1TA 2Q3HA 4LJ7A 4LJ4A 3RS4A 3QJYA 4NE2A 4Y0AA 3G0HA 2G77B 1E1RD 3GEEA 4BGDA 4OHYA 2H57A 3KXLA 1DPFA 2IYTA 3N70A 5J4LA 4RD0A 1TX4B 3K09C 3PFIA 1KKMA 4LUCA 1T91A 1E98A 1OXXK 2JCSA 1TUEA 4NP6A 2ZYWX 4EUNA 3SBEA 4ZIRA 3AM1A 5HZKA 3D8BA 4OI2A 2VF8A 2ZJ2A 4P33A 4YMSA 3BFVA 1DAFA 3CRVA 2VA8A 3LW7A 4B71A 1NMYA 1UBFA 3AUXA 1FMLA 4H1UA 4HI0E 4KODA 5FOSA 3W6PA 5C18A 5EJEA 4QG7A 2BJVA 1DAGA 1GRQA 1M2OB 1PJRA 2GJSA 1IXZA 1A4RA 5EP1A 1ZU5A 3V9PA 1DS6A 3I3SR 4RZ2A 1M7GA 2HJGA 1CEEA 3KFVA 1U8ZA 3IQWA 5C46F 1Z0DA 1W2GA 1OFIA 4R98A 2OHFA 2WWHA 1WP9A 3FKQA 1GRNA 4KI0A 4C0QC 2GDJA 3SOPA 5FL3A 2GEUA 4YXWD 1QHYA 4PZYA 4CEIB 1MRNA 1E2QA 2YYZA 4TL9A 4PC6A 4HB4A 3LBHA 3M6AA 2CHGA 3BC1A 5FOWA 4QBIA 3SZRA 2ZANA 4Z1MD 1EXMA 3L8YA 1ZM4A 3HU2A 1WBBA 5JECA 2CL7X 2OFOA 3SDZA 3MJHA 1OH6A 2AD1A 2GKSA 2ZROA 5TV2A 4OHZA 2AWOA 2G1KA 3GLGA 1ZD9A 4Q7MB 3SJCA 3VR4A 3U44B 4M22A 4GZLA 1HQCA 4P4TA 2QAGB 4IFBA 1QDEA 1U9IC 1RRGA 1S2MA 1KTVA 4Z1MA 3LFUA 1P4SA 3B1ZA 3B1WA 2Q9AA 2XJ4A 3F0TA 4ZKEA 2G3YA 4C30A 1XBTA 3DO6A 3KFXA 4I1VA 5L3QA 4A36A 5CK4A 4MYUA 1NLZA 4KLNA 2ZS9A 2VYFA 3ZGXA 1AJEA 4TTRA 3TRFA 4EDHA 2W0MA 3U3JA 2GXSA 1MO5A 3ZZUA 1OH8A 2VRWA 3IBGA 2DWOA 4PFSA 4E5UA 3CZPA 4G5SA 4ZV4A 3QBVA 3V00A 1P2TA 1XEWX 4URWR 1Q1EA 2B6HA 1IN8A 5FUWA 3EPHA 2ZYVX 2HF8A 1E2JA 3LBNA 4MITA 1BKDR 5CB8A 1IHUA 5IF9A 5LPNA 2G0NA 4IVPA 3F3YA 1NRJB 2ZPTX 3OEED 4JJZA 4M9XA 1XPOA 1X8LA 4P0TA 3VHXA 2VP0A 1YR7A 1MO6A 1N2CE 2HF9A 1C9KA 3SR0A 4EPTA 4ESVA 3JVUA 1R10A 2P6RA 1XJCA 1YE8A 2WV9A 3ADBA 4D6PA 2O8FA 4EFLA 3IUYA 1FX0B 4KV9A 1PZNA 3K9LA 4DSUA 5AJVB 1XEWY 1R5BA 3FE2A 5G41A 2PBRA 2QSYA 4R2HA 3FGNA 2V7QD 4HUQA 5EP4A 3K0AB 2ANCA 4A4DA 1P62B 5EUQB 2GA8A 1CRPA 2F9LA 3I62A 1Q20A 1KAGA 3IIJA 3U61B 1PLLA 2FGKA 1J8MF 3OFND 1U0JA 2QPOA 3CF0A 1T0HB 1KI3A 1G7CA 2XGJA 2OE2A 2XZLA 2O8DA 4BZXA 3F5FA 4QHSA 1KJWA 2P2LA 1NVVR 2I4IA 1PUJA 1NN0A 3A4LA 2QQEA 2FEOA 2AWNA 4TL7A 4TYYA 3M4YA 1RW4A 2ZRAA 4DSNA 2QP3A 1C1YA 2OAQ1 4B3XA 1G8HA 5EXTA 5TB5A 3TLXA 2PLRA 1XCMA 3NBFA 3EWSA 3U3RA 3W3AA 3DKVA 3Q7PA 3TK1A 1NJFA 1U0LA 2X8AA 3SEAA 3T61A 4DT1A 2WAYA 2RKOA 4FCTA 2IUUA 4EPWA 3GLIE 2QEQA 4Q4JA 3G82C 4QFMA 1W0JA 2KWIA 2JDIA 3CH4B 3ZS9A 5CLQA 3BB1A 3FKSD 4D0GA 1HYQA 2AK2A 5JZVA 1L8QA 4GSYA 2QE7D 4JLMA 3O8DA 2DB3A 1JNYA 3KTAA 3OESA 2ZYUX 1Q44A 1T0JB 1T3LA 5L3RA 3HU3A 2OXCA 1OFTA 1QG4A 4YMWA 2BKUA 3B6EA 4LV8B 1OFHA 4Q1DA 1Z0KA 2NPFA 4IDNA 3NH6A 1KI8A 3A37A 1R8QA 1FFHA 3ONWA 4M9QA 3CW2A 1UF9A 2O8CA 1KZ7B 3H1TA 1OYYA 1ZC3A 2IYSA 2LKCA 2FFQA 2W6JD 2ZUDA 4TLCA 1CXZA 2A9KA 1F2TB 1JJVA 2HXSA 2J7KA 4ASUA 4EPXA 3QVVA 2ONKA 3TJZA 3UXMA 2EFEB 2ZRFA 4AKGA 3QEJA 4Q4HA 1BYUA 2AL7A 2VP9A 2FA9A 4JT4A 1AS3A 5BXQC 3WYGA 2OAP1 2WIBA 3LVRE 5B30A 3B9QA 4TWZA 1AKEA 5AJWA 4ACAA 2IHYA 4RZUA 4YMVA 4ERNA 2J0UA 4FWTA 1DAKA 3AB3A 1VCMA 1AA9A 4P4SB 5H1YA 3B85A 2GILA 5JI3E 4HB3A 2ZJ5A 2GK6A 2RGXA 2E9SA 5E7JA 2V6IA 1G4AE 1UEIA 4RFVA 1KSFX 1VMAA 2QBYA 4C0JA 5E95A 3UG6A 4LZZA 4IRUB 4LV5B 1UDWA 1KO4A 1E0JA 4KFRA 3SS8A 3AKEA 2P65A 1SXJE 2WZQA 1G5PA 3KZ1E 3MG9A 4ZCIA 2XNDD 3RAPR 3K0CA 2D7CA 1E9AA 2RGBA 4FMCB 3SU8A 1ELOA 2QMHA 3VQTA 2ZYTX 4LI0A 4WAUA 3FPAA 4L5BA 1E0SA 1XEXB 1ZAKA 2NIPA 2XB2A 1E1QA 2Q3MA 4L4UA 1TMKA 3EA5A 1XP8A 2GF9A 2QL6A 4AK9A 3KQLA 4Q4LA 2IYVA 2QN6A 1KKLA 1X86B 3LLMA 3D6TB 1U9IA 1UM8A 2ZSDA 3OEEA 5TVKA 3BH7A 5JWOA 4WA7A 1N0VC 1Z28A 2JLSA 4LHWA 2DHRA 4LYJA 3QXJA 2OBMA 2KSQA 3IBYA 4TQAA 1NF3A 4C0KA 4JLBA 1JALA 1JPJA 5FOXA 3RS5A 4AI6A 1U99A 2YWHA 2ZI9A 1R0ZA 3DZDA 2OM2A 4LOAA 4BEJA 4DKXA 1DAHA 4PSVA 5DSZA 2FSFA 1CJVC 4CT5A 5L8VA 5KDLA 5LDDC 4OQLA 5C2JB 1W4RA 1CKEA 3EA0A 1A5TA 3NVAA 1YR6A 2VP4A 4PPFA 4B2LA 4NTZA 1G4UR 2R6CA 3FHOA 3T1TA 4KBFA 1F2TA 2GCNA 3S1AB 4ZDKA 3PCRB 1ZC4A 1Z0AA 1BS1A 4Q4AB 1M6NA 4LJAA 4DXAA 2ZAMA 1GNQA 3BH0A 1XWIA 2AKAB 1I4DD 2QMOA 5KDOA 3AGQA 4NYIR 3KQUA 3TUJC 3K0FB 4EKDA 5DI9A 4CW7A 4IEIA 4IW3B 1NIJA 1P2UA 4PQYA 1WBDA 1UEJA 4TZ0A 2FFHA 2JATA 1Z3IX 2RAPA 2H1LA 2ZR0A 1TADA 2PMKA 4M1YA 1G6HA 2ZE7A 4US1R 3SJAA 2VHJA 4I1SA 2A2ZA 1Z6GA 1Z0IA 4O25A 3CIOA 1IXRC 5IT5A 5UKDA 1M1YE 1E0AA 4B3BA 3THXB 1JEDA 2ZRMA 4BZQA 4C7OA 3CLVA 3KQHA 4GRAA 5CDFE 3ZLJA 3GEIA 4ACBA 2YV5A 1IOZA 3ICEA 2WWWA 4JL6A 3VR1A 1XTJA 3X1XA 4EAQA 1N6IA 3WHLA 2GNOA 2JLWA 3BB3A 1E9CA 4NU0A 1DO0A 5A5GA 2DCUA 2YZ2A 3NBYC 4TMKA 4OJKA 3A1WA 3HJNA 5BW8A 1IJFA 4D82A 4MKGA 1J90A 2WWFA 1E9FA 1ZP6A 1SXJD 3SYLA 3M1IA 1QVRA 2NG1A 3QY0A 2D06A 1KI2A 1E9EA 1X6VA 1W4CA 2GJKA 1QHNA 3VFDA 4L16A 4OHWA 4DDVA 1QBKC 1NJGA 3BK7A 3Q5DA 3CRRA 1KAOA 1I2DA 2ZU0C 2Z4RA 1OB5A 4CIDA 1N6KA 3RC8A 2GBLC 1J7KA 4WZBE 3GJ6A 4PO8A 4Q1BA 2BBOA 2QUZA 3N2IA 2WWXA 3M0EA 1DADA 1FQKA 3AVTA 2YJTD 4PC1A 1X8JA 3C15C 3FYHA 1I4TD 4PHTA 3LV8A 3BAFA 4PHGA 1YHNA 5KO2A 3VX4A 1XNJA 5E7MA 1YVDA 4HAVA 1OJLA 2IF0A 1XDBA 2FDCA 1JR3E 2PZFA 1NVVQ 1G1MA 2ZRJA 2FFAA 1D6JA 1YRAA 4QNMA 1KOFA 2F6RA 3AGPA 3TKLA 3W90A 5IK2A 1R2QA 2J5XA 1TF5A 3KB1A 1E2GA 3ADKA 3AH8A 4DLVA 1H8EA 5KDDA 3EZ7A 4M1MA 4NH0A 1JB1A 2ZRLA 3BIFA 4KFUA 2O8EA 4A2PA 3LQRA 4M1OA 4M21A 4OQMA 4ZI3A 1AKYA 4G5OA 4ESHA 1SKYE 2ZS8A 4XVQA 1GSIA 4IHQA 4LWZA 1WMSA 3MLEA 1GWNA 4NCKA 1SZPA 3U7EB 4BECA 5LD2C 4DRZA 2I1VB 1ZIPA 1TTTA 4O2LA 2W2TA 2B7CA 4JL8A 5L3QB 5L3SA 4D26A 4MKFA 4QBFA 1ZNYA 5DN6A 3NC1C 2ODBA 3AF4A 5TARA 1S3GA 4CT4B 4MUBA 2GXAA 3EZ2A 2ODWA 1F48A 1CP2A 1SULA 5ELXA 4B75A 5GADl 1QVAA 4ZCMA 3GJXC 5DHFA 2OCPA 4NPHA 4RKFA 4DCNA 1ZBDA 4PPQA 2ORWA 2OBLA 4PO1A 4A8JA 1EFTA 3NKVA 4OI1A 2ZXUA 2FEMA 2JJ8A 3EX7C 1XCGB 4M1SA 2WM9B 3CR7A 1U2RA 3W9YA 3MRSA 4F92B 1E2KA 1JPNA 4CEIA 3HR7A 2A5FA 3CO5A 5HR5A 1IN4A 4FMBB 4R7ZA 1KSJA 3U4QB 3TIFA 4NL4H 4JYBA 1NSFA 5HCNA 4E22A 3OIYA 4PHHA 5K8TA 3GLIA 1RVDA 1A2KC 2ZRIA 4P4UA 2VO1A 1G21E 1AQYA 1TU4A 2GETA 3HYTA 5CLLA 2IS1A 8OHMA 4YMTA 2VTKA 5H8WA 3UMFA 4LHXA 3OEHA 4TTPA 1B23P 4BFUA 3KQKA 2ZRBA 3FFBA 2AN9A 2VBCA 3TR5A 2ZI7A 1T4GA 3ZZ0A 1W49A 3ZIAA 4EJSB 2GCPA 4ZKDA 3GLHB 3QKTA 1VG9B 1Z6TA 4V0OA 4Q5IA 1GAJA 4KHZA 3C8UA 2XXAA 3LDAA 2R6FA 2OFWA 4Q4AA 1GUAA 2A5GA 2QY9A 2IXFA 4K8OA 4D0LB 4DLTA 3OE7A 4QRHA 3SFZA 2ZIAA 4XWOA 4C0SA 2PL3A 2FF7A 4XOIA 1F6BA 4ZI2A 2IEZA 2DWQA 5FBQB 2YHSA 1RJ9B 1YZGA 3U3MA 2ZJOA 1NVXQ 4NCHA 3JVVA 1IAQA 1O87A 1Q3HA 2NO0A 2V6JA 1KMHB 3SQWA 3MJRA 4Q1CA 3KKOA 1N6NA 2YVUA 2CCKA 2IS4A 1X1SA 3R20A 2VEDA 1TUIA 3GLFA 2CXXA 1FNMA 4RD3A 4TYQA 4M9ZA 3GJ3A 3PEWA 1KO8A 5DISB 4OI0A 3TR0A 2PZEA 2JA1A 1LVGA 2ZRGA 1MABA 3L0PA 5HTKA 3RS0A 3AVWA 4JYCA 2CL0X 4WXPA 1ZVQA 1KY3A 3AKCA 1SKYB 3N5CA 4IJMA 1T8UA 4HSEA 3D7MA 2R65A 1NBME 3PR1A 3GD7A 2FG5A 1KI7A 2HUPA 2V9PA 1DG3A 2WJVA 3AEZA 2DBYA 4BE7B 2QBYB 4DWJA 2Z5FA 2BMFA 1BYIA 1A2BA 3HPQA 5JLJA 3EPJA 3I92A 3NDPA 1NG1A 3T35A 3Q5EA 1E1RA 3ZS8A 5E3HA 1HA3A 1XTRA 1QHGA 2QG6A 5CYOA 3U6BA 1MKYA 2PEYA 5FI0B 2O52A 2XB4A 4LHVA 4NCNA 1TNDA 2Z83A 2GZAA 4KSBA 4B6EA 2BDTA 2CVFA 1X8KA 3D3QA 3RRYA 1P6XA 3KDSE 3PUWA 5DI3A 5FBLB 3W6NA 3L82B 2G1JA 3WRXC 2J0SA 1HEIA 3LXRA 4MGKR 3I1FA 4G1UC 4YC7A 3TUZC 4QL3A 1TEVA 2FMXA 2IF2A 3JZAA 5FPYA 1ODFA 5KNBA 3WYFA 4YXWA 1G17A 3I5XA 1TAGA 4MYHA 4XTCS 1G291 1N5KA 2Y8EA 4RZXA 3SJBA 4FXPA 3QKSA 4LYHA 4BEBA 1WCV1 2IS6A 4Z8YA 2MSDB 3OF5A 1OB2A 2HYIC 4QXAA 1ZM3A 4MRVA 1ZNXA 4OQXA 3ADDA 1ZIOA 1DARA 4XWKA 2CJWB 2J41A 3PITA 3FMFA 3RS2A 4EFNA 4BRUA 5EZ6B 2AK3A 2ZREA 5AUQA 1X3SA 2DYKA 1QHHA 4RSGA 2CE2X 3VU9A 2C2HA 3RANA 5AWFC 1E94E 2Q9BA 1XD8A 2ECKA 3ZVRA 1N0UA 3VKGA 4Q1FA 4RD2A 3A1SA 4FINA 4MRNA 5FR2A 4EJSC 2VP5A 1ZJ6A 3BXZA 3KXIA 2JLZA 3U60B 4URYR 3THOA 1N6RA 2F55A 1RYHA 2MMCA 2WMOB 3GFTA 5J4VA 3VNUA 1BO6A 4DLSA 3NHBA 5EUMA 5E7IA 2PT5A 5B58C 2GESA 4U7DA 1Q3TA 1PV4A 2REBA 5CM8B 1R0XA 1N3BA 1VHLA 4IEEA 1T6NA 5CM9C 4US0R 3QQ5A 4TL8A 3ZQ6A 3H86A 1M7BA 2GZDA 3C41J 4TYPA 4TSFA 4A8JC 2WJIA 3GLGE 2DPXA 3E2IA 2RH5A 1AZTA 3LXXA 1S96A 2XNSA 1HE8B 1VYTA 4LJ9A 4RCYA 4JSYA 4M9SA 621PA 4B3DA 3BBPA 2FE4A 3JZMA 1W36B 3Q7QA 1OPXA 3NEJA 3GLFE 2WJJA 1GIAA 2OG2A 2IWHA 4C0LA 5SZJA 1XXHE 1U0HC 5DO9A 4BFZA 3WNDA 3QUSA 3C14C 2REOA 4HUTA 2QORA 5JCPA 1MV5A 1YU9A 2XAUA 1XZQA 2AHOA 4OBEA 2FPMA 3GJ7A 2WWYA 4KVGA 3MWYW 1Q21A 2BKEA 2ZETA 1VCOA 3UMSA 2B7BA 5TY0A 1XJ0A 3BERA 2KBEA 3MUFA 3LBIA 3QXSA 4ITRC 2Q9CA 2C98A 3ASZA 4MGYR 3DEFA 3CM0A 1LV7A 2ZU6A 3FB4A 1R5OA 2P5TB 2ODEA 3L2OB 5EE1A 1IY2A 3L8ZA 2PX0A 1SKQA 3THYB 2Z0MA 4V03A 3PQCA 2VSOA 5FPKA 5BN3A 2H17A 3FFAA 2QP9X 5AJYA 1QF9A 3BS4A 3LD9A 1U94A 5CB6A 1BOFA 3C4JA 3UWKA 1NN3A 1P5ZB 4PSAA 2PMDA 1VPLA 1I4LD 3BORA 3FMPB 2BIFA 1DO2A 3QOFA 2FX3A 2LKDA 3MD0A 3RYTC 2FFBA 4A2WA 1YZKA 1IM2A 3ECCA 5J4YA 4DUGD 1JXMA 5LBIA 2WKQA 4UXJA 4TQ9A 4KJZA 2QM7A 1UBGA 2C03A 3GJ0A 4FCWA 3BH6A 1E2LA 3VR3A 1E6CA 2OO7A 1OT3A 2A7QA 4M4SA 1KI9A 3SBDA 5K8IA 4V02A 1CR4A 3EIHA 1AZSC 1ZU4A 4Q1EA 4X8LA 1DEKA 2RB4A 5JRZA 2FZ4A 2ZSBA 4LBWA 1T3HA 1MRSA 3MGCA 1E99A 3EC2A 2D7DA 4IFEA 2PCJA 5K8UA 4DSOA 1TF2A 4RFSB 1ESMA 3BRWD 4C4PA 4I1OA 4RY2A 1S3SA 2G6BA 1AM4D 4TLDA 3WP1B 3UKDA 1WXQA 3V4RA 3OZXA 3W5IA 1CBUA 4V0NA 1NKSA 2H5EA 1IN6A 1KNXA 5AJXA 3ZVLA 2QZ4A 2GHIA 3ZVMA 3VNVA 1EFUA 3NWJA 2JLVA 4PPNA 2AFIE 5BQ5A 1GRRA 1ZNWA 4HDCA 1TQ4A 3ADCA 5JJLA 1P9NA 3K09A 1AGPA 4BLQA 3RABA 5HPYB 4MYTA 3SE0A 3MFYA 4DLYA 3A6PC 2X77A 4IDPA 1NY5A 1JAHA 2WKPA 1GOTA 3BD9A 3WMEA 1JR6A 1HURA 1Q12A 5FR1A 1M7HA 3QF4B 5J4KA 2JJ1A 4YLGA 3VTKA 1CIPA 1G7TA 4B35A 2ZRNA 4JLVA 3Q85A 4CDGA 1XTKA 3B13B 4LJ8A 4YDSA 4CEHA 4E07A 5IDVA 4M53A 3IPYA 4GMDA 3I5YA 1D2EA 4FMDB 4GBMA 2QSZA 2F3TA 3WXMA 3SC3A 5BYJA 4LK2A 2XOKD 1KK2A 2QQ0A 4TSFD 4BLTA 4TMTA 2ASEA 821PA 3WYAA 4NZYA 521PA 3A4NA 4X8HA 4KSCA 4RJLA 2IUSA 3H4MA 5AUNB 4MUAA 3DPUA 3I8SA 3W3ZB 5FPSA 1XD9A 4UNSA 1N5LA 1G9XA 2JIZD 2ODNA 1OIWA 3W8NA 3A4MA 3FMIA 1K5GA 4B3FX 1NG9A 3R9XA 1WA5A 2F43A 4WW0A 4B34A 4EFMA 2GCOB 1FW6A 1D2MA 2BEJA 3T06B 4A1FA 5G53C 4D2IA 2IYQA 2VQSA 3OE7D 1WB9A 2WJYA 1S8FA 1E69A 1DG1G 2WSSD 1KI4A 3RRMA 5KPDA 2NO1A 4Q18A 2AKYA 1XPRA 1D9ZA 4LBYA 5CJPA 3TGPA 2XSZA 3T1VA 1NIPA 5IHPA 3CUEF 1N6HA 4DLXA 5C4MA 1AK2A 2BVNA 3TQCA 3K70B 4U5XA 4HB0A 1Q0UA 2OZEA 2JGNA 4Z8XA 4QGGA 1NKTA 1GL7A 4IKEA 4K81B 1NVWQ 1XEXA 2MSCB 4BLOA 3VKHA 3CF2A 2QMUA 1SVMA 4TMVA 3IHLA 4IXMA 1DAMA 4KAXA 4W7SA 4B3CA 2GWHA 1F3OA 1KI6A 3OAAD 4JZKA 3KKPA 2ZAOA 3RSOA 2WBLC 1N6LA 5D3MB 2ZI5A 4DB4A 4ZCLA 2ZRKA 1Z08A 2VSFA 1JR3D 3A1UA 1ZMXA 1LF5A 2J87A 2RGDA 3NG1A 4URUR 4BFYA 3EIQA 3F8TA 3LA6A 3K9GA 1HQYE 3K9NA 2EFCB 3BWDD 4LJ5A 2O8BA 1OYWA 3RRZA 3WMGA 2ERYA 3RWMB 1F2UA 1F2UB 1LTQA 4EPVA 1RPZA 2QROA 1HV8A 1KGDA 2J0UB 1E32A 721PA 2E87A 3KKQA 1CTQA 4NYIQ 3LVQE 1ZM7A 4KITB 4QJ5A 2NZ8A 1NBMA 5GVSA 3NXSA 3OHMA 3EZ6A 3J81k 3FMOB 3E1SA 3RLFA 1NP6A 1E2MA 4B3GA 1JJ7A 1JR3A 3AKDA 3CWQA 2CK3D 5FUVA 2RCNA 4PC2A 3G5UA 1RRCA 221PA 1MO3A 1OE0A 4LX0A 1TU3A 5AUPB 1U8YA 2A5DA 1HH4A 4YDHB 4N0DA 3RWOA 2HJVA 4GDFA 3T34A 3WBJA 1XZPA 3KTAB 1BMFA 4GPTA 2W00A 4URXR 1W0JD 3VAAA 2J0VA 5DNYB 3LX5A 3QVUA 1KDOA 1W1WA 3TUIC 2CLDX 3UPUA 1NY6A 2IYYA 2B92A 4OI4A 2J45A 2OESA 2O0HA 3Q72A 2GF0A 1HUQA 4WVFA 1II8A 5DIFA 1XTIA 2D62A 2OCAA 2B21A 5A0FA 2GCOA 5J5CA 1FUUA 2ZEJA 2WJGA 5GJBA 2P67A 2CLCX 3IPXA 3KUDA 1YR9A 4UNRA 4PPGA 1JQJC 2WMNB 2NTYC 5DH9A 3K70C 3LWNA 2J3EA 2ZSAA 1XD2A 3P4XA 4JJKA 2UVQA 5DHAA 1COWA 5KUTA 4XTRA 2OBNA 1YQTA 4C3ZA 1VKJA 4HZUA 4DIDA 3RVBA 1G16A 3EARA 5JHHB 1TQDA 5CDFA 4C9BA 4B43A 1UPTA 5EZ5A 3U6KA 4WBSA 4GNKA 2D2EA 2TMKA 1JECA 1NI3A 1P61B 1Z6YA 3A1TA 3TSZA 4EPYA 2YWFA 2JLXA 3RNLA 1XXHA 3K1JA 5FBVB 1SXJB 2QGNA 1S9DA 3BJIC 3HPRA 4GI7A 3WMFA 4BRWA 3CRQA 2J9RA 3PJRA 4DC9A 1RIFA 5JS7A 1G64A 3QF4A 4QBGB 2GJAA 2H16A 1LS1A 5L3SB 1Q1BA 2QGZA 2EVWX 1UJ2A 2WSSA 4LGMA 1ZINA 4N0EA 4HATA 5SZIA 2GZHA 1KZGB 3GJ8A 4OK5A 4WIAA 3CBQA 4ON9A 2O8FB 1UBCA 3MWJA 1J99A 2V1XA 4JVNA 2D4HA 1GILA 1GP2A 4TMXA 3TW4A 3P32A 4FI3C 2EYUA 3TVDA 4WZAE 1XCPA 4AKHA 4HZIA 1W5SA 4DUGA 3LQQA 4DVGA 3EZFA 1GG2A 1BH2A 4Q47A 4F4IA 1ZM2A 4NCJA 4IDOA 1MR3F 4L9WA 1XMSA 1BIFA 1Z07A 4BFTA 1NLFA 5FOUA 5BYKA 4DEYA 1NVUQ 4XIGS 1CLUA 2J7PA 4MA4A 5HCIA 1GKUB 2VHTA 1EFHA 4W5HA 3CPEA 421PA 5BN4A 1G41A 2OFXA 4V0MA 2CVHA 2AR7A 4Q7JB 4LSGA 4DDTA 1AS0A 3KKMA 4MGIR 2W6IA 1MOZA 3X1ZA 5EE3A 1XB2A 3EIEA 4QGAA 1QRAA 4GMXA 4H1VA 4A2QA 1N0WA 1GZSA 3NH9A 3O8RA 1ESNA 2HEIA 1OHHD 2XEXA 5AR1A 2ZR9A 3X1WA 4YMUA 1KDTA 2FPKA 1OIXA 4PHFA 4JLNA 4JSTA 5CIWA 2PCLA 3DM5A 3GJ5A 3AVVA 2H8KA 2C77A 4PZLA 2LCFA 4AY2A 5KSZA 2V7QA 3ZD6A 3SI7A 4B2PA 4DLRA 1I2MA 1II9A 1FL9A 1GDDA 4UKDA 2H92A 4E03A 4F93B 4LDJA 3R7WA 2F1JA 2C5LA 2IYUA 4ABYA 4R9UC 2CNWA 2EWWA 4L9SA 2X19A 5FTJA 3TMKA 2W6ID 2Q0HA 3AF0A 1UBEA 1W2HA 2ZI3A 4A0RA 6Q21A 1LS6A 2FZLA 4G5QA 5LB4A 1ZM9A 3C16C 3FHCB 3PUXA 4ZDJA 4XD7A 2O8EB 1V43A 1KJZA 2GXQA 2CEAA 1W7AA 4AD8A 2HLDA 2P0EA 2B8WA 5JCZA 3CZQA 5DLQC 1ZW6A 2IWRA 1NL3A 2BHRA 1MH1A 3I32A 2J1LA 1J70A 4MRRA 3KL4A 5JEDA 2XZPA 1EFCA 1UADA 2W6JA 5F2EA 2R2AA 2OT3B 3MWLA 3VKWA 2WPDD 2NPIA 5FTMA 2QTFA 4IOKA 1VYVA 5FBRB 3CNLA 1KI1A 4MKIA 4TMZA 5B64A 1UDXA 1ZYUA 4O2RA 4YONB 4R2IA 2X2FA 4W5WA 3BB4A 4HLUA 5KSYA 2UKDA 2J0QA 2QRNA 2XSZD 5J4HA 2ZM5A 4AYWA 2XTNA 3RS7A 3TSOA 1AN0A 1IY0A 3P1JA 1AGRA 1XU4A 3ETLA 5EQTA 1NNEA 2JJ2D 4TLEA 1U8AA 3B5JA 1PLJA 1W47A 3QKUA 1GM5A 2RGEA 1CJTC 1W46A 3DZ8A 4LJ6A 4HZUB 3WY9A 4FCVA 4C0AC 4GL2A 4B6FA 2JLRA 3CWZA 3U7FB 1XD2B 2R62A 3VR5A 2UZIR 5J47A 4RD1A 2GJ9A 3AP1A 5FOTA 1TEXA 1K8RA 1P9RA 3EASA 3KJIA 1VCIA 2GBLA 4US2R 3GMTA 2G9NA 4BASA 2P3SA 1DTSA 4L8GA 1EWRA 4FMDF 3NBZC 1XTSA 3A36A 4H9GA 2A5JA 1ZRHA 1SQ5A 5FL7A 3QXXA 4OQNA 5CYPA 1CS4C 4GOXA 1G8PA 2XZOA 3SN6A 1W48A 2C04A 2L0XA 1E1QD 2Z4SA 2FH5B 1P3JA 4KBGA 4IOMA 3L0IB 1KHTA 1CULC 3TW8B 3O8BA 3B82A 3I61A 2HCJB 4A6XA 2J46A 1Q22A 2PT7A 1GVNB 4LHZA 4NYJR 1G3UA 5HE9A 1W44A 4S2EA 4A6PA 3K70D 4BPBA 3B1YA 3W34A 3S1AA 3AP2A 2LWIA 3C7KA 4EPRA 2PLFA 2VPPA 3CRMA 4P4SA 1NMXA 1N6OA 2ZJZA 3HYRA 5DI3B 3Q3JB 1H8HD 3O47A 1GFIA 4MKHA 2P6UA 2FV8A 3RDPA 4L15A 5AJZA 1U81A 4BLSA 3EZ9A 3UWOA 2WVJA 3NIBA 3PV0A 1J2JA 1IQPA 4PSKA 3T5GA 2DFLA 3REGA 1M34E 3SJZA 2R6GA 1P9WA 1H8HA 2QMEA 4KCGA 4Q19A 2YNMA 4WOPA 2GVZC 4NMMA 2YC4C 1HT1E 1G5TA 2JLQA 4O0MA 4Q00A 1LF0A 3B9PA 3K0EA 1NN5A 3SFVA 4D4KA 2YOHA 1FQJA 1T5LA 1G8FA 2O0KA 1C4OA 2ANBA 4HAWA 4B2IA 2WAXA 3GFOA 4V0ME 3IGFA 2ZITA 5TXGA 1R5NA 3K9HA 2XTZA 1CR0A 3SHFA 2QTVB 4QM7A 4B74A 3NHAA 4TYNA 3CX8A 2IYXA 2OV2A 4LBVA 3AF3A 5HZHA 5FOVA 2G0TA 1PLKA 3I73A 4U00A 2RMKA 1DBSA 4DT1B 2JJ1D 3CKLA 4B44A 1F60A 4AYXA 1OSNA 3HU1A 2WOOA 3ICQB 4RZ3A 1P2SA 2UZ3A 1GTVA 3TAHA 1SVSA 5GVRA 1Z83A 2WWGA 4AKEA 4CRWB 1A7JA 3OIWA 1KMHA 4BFXA 2GAAA 2WIAA 1QZXA 3T5DA 2F43B 2C96A 5E4FA 3CPJB 5FUYA 1G3IA 4Q48A 3QKRA 4MDEA 1E2NA 4FIDA 1KK1A 5SZHB 1E2PA 1OXUA 4F38A 3PUVA 4GZMA 2IYZA 4PZZA 2EU8A 4Q7KA 4Q9HA 4Q4HB 4P31A 3ZIAD 3B78A 1OH5A 1E3MA 2VLIA 1T9HA 5FTLA 4TYWA 4PAOA 1Z47A 1JBKA 2ZI4A 2I3BA 1P7CA 4UJ5A 3THWA 1OXVA 1RE0A 2AXNA 2IA5A 2WKRA 4ARZB 5KTYA 4CF7A 3AF1A 4JBWA 4AKIA 3GLHA 3NBXX 4TT3A 2R9VA 4G01B 2QENA 1EFRA 5H70A 3P4YA 4HUQB 3RRNA 1F5NA 2KE5A 2CCGA 4CEHB 2JEOA 5KSPA 1NMZA 3SYNA 1GL9B 4BFWA 4V0LA 2DFNA 4DLUA 5HKKD 2NO7A 1N25A 1CRQA 1G18A 4DCTA 2GVDC 2JLYA 1U98A 4D4LA 2ZTSA 4UNNA 1H8ED 2CHVA 1CU1A 1E9DA 3FTQA 1L7VC 4HYYA 3NDBB 1W5TA 3IHWA 1GL6A 5KU1A 3L0SA 4I99A 3U4QA 3UMRA 3TSWA 1XMIA 2HCBA 2C99A 3CNOA 1ZCAA 3VHLB 2OCBA 1MO4A 4TT3D 3RSLA 3GQBA 5H68A 3OAAA 4JLOA 1R6BX 4LC0A 2N42A 1E4YA 3IQXA 1FTNA 3TH5A 2RHMA 2PJRA 3CH5A 4LC1A 2IT1A 3B1XA 1ZNZA 4BUJA 2VIIA 2XITA 2DR3A 5GJCA 4Q1AA 4PR0A 3OIUA 4JLAA 5DN6D 3Q9LA 2BBTA 2VP6A 4A8JB 5EE5B 2W83A 1D2NA 1Y3AA 4QGHA 4Q02A 4LPSA 4DHEA 4LY6A 4XSGA 3B2EA 3R9IA 4POAA 1SGWA 2J59A 3DOFA 4KO8A 5JHGB 1IXSB 3E5HA 3T1QA 4PO9A 2EWVA 2GEDA 1AIPA 2GEVA 2VH5R 3U3KA 1EWQA 5FBWB 5M04A 3K0AA 2ZI6A 4D25A 1L2TA 1E9RA 4NYJQ 4J0QA 5JRJA 4UNQA 3QXHA 4LCBA 1VECA 2OUKA 4MGZR 4PANA 1LW7A 1X1RA 1SHZA 3QBTA 4FWIB 1XJQA 2VL7A 4HDQB 1G8GA 2MSEB 3FKSA 1FPMA 1FX0A 4IVQA 2PEZA 2D2FA 5F98A 2KI5A 3ND9A 1G3QA 3AVXA 1E9SA 4JVMA 2C8VA 4BFVA 4WXRA 1JEEA 3QNUA 4N3NA 3PUZA 1VIAA 4OHXA 4C0HA 1UFQA 1E2HA 1L4UA 4Q9JA 5FI1B 2AFHE 1N6PA 5F3WB 4M1WA 5JS8A 1EX7A 1DAIA 1IN7A 2JDID 5BWMA 4BZPA 4JS0A 2A3RA 4Q9IA 4TTQA 2WWIA 2HYDA 3W5JA 4Z54A 1ZCBA 4DIEA 2C9YA 4QM6A 1FP7A 1O3YA 1EG7A 4N1AA 4W9MC 1FZQA 3W8RA 2C9OA 3ZZTA 4XWAA 2V3CC 3CONA 4RVCA 4LPKA 2ZE8A 2CBZA 4A0GA 4TZ6A 4KYIB 1ZD8A 4JVSB 1FUKA 1SXJA 2A78A 1P73A 1XXHB 3FWYA 4KLZA 3WBKA 3GLGB 3U44A 2IUTA 2ZE5A 1UKVY 3CB4A 1YJ5A 2PX3A 3FHTA 3OIVA 3CX6A 1Q1ZA 1G5RA 1S1MA 1R7RA 1PUIA 2BCGY 3IEVA 3ZVNA 4KFTA 2R6DA 3CX7A 4DZZA 3U7HB 3IIKA 1E96A 2HXYA 2X1VA 5EE9A 3T12A 2Q3FA 3PEVA 4KVAA 4PAMA 2Q6TA 5K8LA 4M0LA 1OXSC 4LBZA 2V55B 3RHFA 1G6OA 4DDWA 1QHSA 3LX8A 3EPKA 3H0KA 3EWAA 2PH1A 2BEKA 1Z2CA 2ZVQX 4OYHA 1CR1A 2BM0A 2E1RA 3EXAA 4D4MA 1TQ6A 1TPZA 5JWHA 1E9BA 2R44A 5KPJA 5DGXA 3O8CA 3VR6A 2Z43A 2WTUA 1L4YA 1EFRD 2IYLD 1M8PA 3HWSA 5JI2E 2YWGA 4DDUA 3LRPA 1P2VA 2IYRA 4Q66C 3THXA 3WNCA 1B0UA 4NCIA 4D4JA 5EP2A 3KXKA 1SVIA 1TQ2A 2EFHB 4TMWA 3PXGA 3T1OA 4MDFA 1R0WA 1KMQA 2OEPA 5G3ZA 5KHOC 1HTWA 4RD6A 5HKKA 2VP2A 3K0FA 3VMFA 2O5VA 2ZJYA 4D81A 4C2TA 2EFGA 2GRJA 5FTNA 1ONBA 4XSHA 3THWB 2GK7A 5A4JA 4FMCF 5G3YA 1E2DA 5DE3A 1EK0A 3SQXA 3AF2A 4A0FA 2W2VA 2BCJQ 3H2YA 2ZSFA 3PG5A 1AS2A 4Q7LA 2C95A 2FSIA 1V5WA 1VG0B 1ZD1A 5EXPA 1T3SA 1Z2AA 4KFSA 4PAQA 5CJ2A 1OHHA 2ZSEA 3QPWA 3PUYA 2VHQA 4PX9A 5JSZB 1Z5ZA 1WDTA 1R4AA 4G0NA 3VR2A 1YZLA 3MAAC 2IW3A 3RS3A 1DVRA 3L43A 4TLBA 4JLDA 3DVLA 4LRWA 1E2FA 2W58A 1D5CA 1ETUA 3IILA 1IY1A 1E4VA 3KJGA 1OFUX 2D74A 3CPHA 1K5DA 2EYQA 2YWEA 3GCGA 1II8B 2ZUBA 2QI9C 2BBWA 1E79A 1VIYA 4HB2A 4A9AA 1YZUA 1J8YF 1T8TA 2CDNA 1EESA 1WQ1R 4BFSA 4KYUA 3TBKA 4BWYA 2QA5A 4R71A 5KYKA 1MT0A 4BQSA 4A0HA 2ORIA 4F4JA 1G8YA 4OJQA 1IBRA 4QKQA 4HDOB 2ORVA 1RYFA 3X1YA 2CNWD 1HY3A 2OXRA 2VSXA 4GOKA 2A5YB 1D9XA 2RGGA 3A58B 4NYMQ 3E70C 2AX4A 2FSGA 2ZRHA 2OCYC 4I4LA 4QHTA 4F91B 1DOAA 5AUOB 1LB1B 2IHBA 3D31A 4JIMA 1HE1C 1KO7A 2YINC 1MABB 3AKYA 4CZ2A 1SVLA 3B60A 1RRPA 4GP7A 4Q01A 2WPDA 5FUXA 4Y0VA 3WRYC 4UJ3A 2WOJA 3KJEA 4EQ6A 1Z22A 1DE0A 1Z29A 2K5UA 4ASUD 4DEXA 1E2IA 1Y63A 3A8TA 3I8XA 3DOEA 2NQ2C 4RCZA 2QP4A 3GLFB 4JKYA 2P6NA 4MYCA 2RGNA 1R0YA 5DYIA 4GFDA 1KY2A 1FP6A 1RKBA 4Q03A 1JI0A 3PEUA 4S35A 4IXNA 1A1VA 3ZYCA 2AXPA 2BBSA 1OKKD 4FN5A 1KNQA 4DCVA 3AP3A 2V1UA 2IYWA 4BLPA 1S0UA 2YOGA 3QPVA 5SZKB 2O8BB 4EIWA 2WICA 2QE7A 4I81A 2JIZA 2HV8A 4TLAA 3K8YA 4X8OA 2CLSA 5CITA 2FNAA 4ZPXA 5C4GB 1E2EA 1HT2E 2O8CB 1N5JA 4AURA 4XVUA 5FL7D 3ND8A 4URZR 5D3MA 3BGWA 4TQUS 5GJWC 4JBYA 2FPLA 2RGNC 1XFAA 2DWPA 1Q57A 3QIAA 3H84A 2DY1A 2V8OA 2FN4A 2JASA 3QENA 3REFA 3EW9A 4FW9A 4W5JA 1CJMA 1KK3A 3UATA 1LY1A 2PJZA 3K0SA 4EJSA 4M8NE 5F9HA 3NTUA 2BM1A 2CL6X 2ZRCA 3BOSA 3IKJA 4MRPA 4GT1A 2HT1A 4AG5A 1AQUA 4Q4JB 1S4QA 1YR8A 5JFGA 4OL0A 3UK6A 1VDZA 1PVOA 3QE0A 4AC9A 2IXGA 2WJHA 3CR8A 4DJTA 2EW1A 5KNCA 3N2EA 1QG2A 1DAEA 4HAYA 3GLIB 4AG6A 1TL7C 2XX3A 4CVNA 3OFNA 3KQNA 2GTPA 4OK6A 2QPAA 3DMDA 1W4BA 2Q21A 2IS2A 4RFSA 1S9HA 2QAJA 4ILEA 2EFDB 4PQRA 5KNDA 4JLPA 1KIMA 1G20E 2O8DB 4Q21A 1RZ3A 2NOAA 4B33A 5FTKA 1FMJA 2DFTA 4IOLA 1OW3B 3AVQA 1QHXA 2CE7A 4B76A 1G19A 4NDZA 3ASYA 3IO3A 2ATXA 2B8TA 1GITA 1YZTA 2N46A 4HLUC 2FGJA 1OF1A 3X1DA 2W2XA 3KB2A 2CK3A 3QPUA 1XMJA 2V4ZA 2BMDA 3HDTA 3GLHE 3PENA 3IIMA 3GP8A 1SVOA 3UANA 4LHYA 3LAWA 3LH5A 4AIIA 3PEYA 4RD4A 3FOZA 4G5RA 4PC3A 3QEOA 2FSHA 1WRBA 2XJ9A 1US8A 2HLDD 2NO6A 3UIEA 2X2EA 4OKSA 1KSGA 3U5ZB 1FTSA 3IO5A 1JXOA 4CGZA 3VX3A 2IEYA 5JJKA 2YKGA 2QRZA 4B73A 1KK0A 4RKEA 4NONA 1BMFD 1US8B 3IEUA 3EG5A 1KYIA 5FH9A 3R8CA 5BN5A 3R7WB 1SVKA 4UNPA 4LYAA 1XPUA 4ZDWA 1VCNA 4A92A 5B57C 1S1CA 4CYMA 4NHOA 1M74A 4LV6A 1COWD 4G5GA 3ZH9B 3QXCA 4AYTA 3DHWC 2NGRA 1EGAA 3A1VA 4A15A 1LNZA 2HDNB 3CNNA 1NSTA 2QAGA 1U90A 5TMPA 5J40A 2MMGA 1EX6A 2BC9A 1VYUA 2AD5A 2IXEA 5FFMA 2XOKA 3DL0A 1OKKA 1VTKA 3OEHD 5L3VA 1II0A 3AQ4A 1N5IA 1GKYA 1YZQA 3PVSA 4JLJA 4ZO4A 5ANRB 3DM9B 5EXSA 1G3MA 2F1RA 1ZUNB 4PC7A 3MWKA 1Z8FA 3AVYA 4XJXA 3PIRA 3SYKA 3C5CA 2ZRDA 4B47A 1ZUHA 2KB0A 2ZRPA 3GEHA 4M1KA 2H18A 2QAGC 2QU8A 4HLCA 2V54A 5EP3A 1RRFA 4D80A 2OLKA 5KSOA 4HLQB 4JBXA 2KBFA 1YZNA 1G7RA 2N1BA 2A30A 3THYA 3MCAA 4II7A 1QHIA 5KOYA 3AVUA 2JAQA 3W6OA 2ZS7A 1NN1A 1GNRA 2BOVA 4Q9KA 3BE4A 4XVRA 5D3QA 2RGAA 1DELA 1VG8A 1W36C 3UG7A 4NYMR 2VHCA 4QGFA 1XF9A 2BMJA 4MRSA 3K0CC 4P3YA 1KO1A 3X2SA 2CJWA 4QJ3A 2OLJA 1CJKC 4C7OB 4D0NA 4HLDA 4MQBA 4Z51A 3C5HA 1KDRA 2RHDA 2XTMA 3P26A 4PQFA 3TNFA 5JJIA 1NLYA 2IK8A 4TL6A 4ZIRB 3WNBA 2G88A 3R8FA 1LFDB 2I1QA 3LO5A 4OQFA 4DCUA 2QTHA 2YOFA 3AUYA 3QKSB 3EPLA
chains in the Genus database with same CATH superfamily
1DV1A 4XH9B 1H65A 4JKOA 3S68A 1PK7A 4L50A 2VDQB 2QF7A 3A4TA 3VYVA 1S89A 1A4UA 4A27A 2W2LA 3LS2A 4G2TA 4TTIA 3QOXA 1U2TA 2IDJA 4KVZA 4LXTA 3ROXA 3PEEA 3BSWA 3GFPA 3R76A 4NBSA 5KC9A 5ELMA 2ERXA 2Y1OA 4RBNA 3UYKA 2VF7A 1HEYA 5ICSA 3H4VA 3LGSA 4WKPA 3O83A 1KYXA 4OHPA 3U9LA 3NALA 3TPFA 3OVMA 1BZYA 1LBIA 2BMVA 1Z0FA 2RJ3A 1Z13A 4Q12A 5CM2Z 5CLJA 3UAGA 2X4IA 2H7VA 1VHTA 2RGCA 4RGVA 3QKRB 1E64A 4W63A 2YRWA 1L4EA 1WB4A 2ZWOA 1N2GA 3KT6A 5A4IS 4I4CA 3EAQA 1B2RA 3PYMA 2G80A 2CHQA 4URVR 3ZJYA 1PGPA 2GEKA 5EWJB 3AI2A 4IOJA 3AOEC 3FIUA 5AW5A 2HFKA 3CRW1 2PDAA 3IP9A 1VLMA 4P32A 3LUAA 3AVPA 5EKDA 3U13A 3DDCA 4PS0A 2Z6UA 4XR9A 5CK5A 1L7PA 1LLQA 4HWKA 4OQ4A 3I0MA 3SCZA 3V34A 4DMCA 4X6LA 3GA5A 3OPYB 3Q8XB 3SQDA 1JTFA 5I4KA 1G21A 4E30A 4ZGWA 3U7GA 3EOZA 1E0KA 4O3MA 3RC3A 4L9RA 1CQIA 1XALA 5JG7A 2B0CA 1RJDA 1TVCA 2PTHA 2CJYA 4DLWA 4DB2A 1RMTA 1I2ZA 4QBHA 1QOQB 2VK8A 4WNCA 1WF3A 3GXBA 1HKUA 4K6OA 2Q7DA 3ABOB 1PYDA 4LN1A 5EKTA 5CT9A 1SHKA 4HFNA 4Z0HO 4PTLA 3HZHA 1UKEA 4XUGB 4AN4A 2NMVA 4M0MA 1QRSA 1EUDB 2FEWB 2NLOA 2QNRA 2VQ6A 2Y68A 3SNHA 3V4LA 3OQOA 2PYDA 2ZQ5A 1CR2A 3B7GA 2JZCA 1I5RA 4Z4FA 3L18A 5JWRA 2XCTB 4G5XA 4HQ6A 2VWPA 5EJFA 1WE2A 1E1MA 1Y3CE 3PHJA 1HZZA 2HIHA 1OXTA 3BULA 1YH3A 1Z63A 2OECA 4WZBB 2GM4A 5IZCA 3Q11A 2P5UA 2XH8A 2ZBGA 4PXAA 1QZUA 2HF7A 3F6EX 3LLUA 2Q2VA 4TN1A 3QUAA 2W11A 5AK0A 1F3LA 4M2LA 4ALNA 2QT1A 2LE0A 1KAEA 1T2VA 2YRFA 3E9ZA 4DDMA 5EHXA 2Y0PA 3PXXA 3E3LA 2ZE6A 1G3RA 1CX9B 2BTOA 3DDUA 2Q28A 3EXG1 2PZGA 1ORRA 4R5MA 5L51A 4PNPA 2JJ2A 2XXAB 4RNDB 4UQOA 3JASA 3DLBA 1EAYA 1HFKA 1U3WA 1CJBA 2HT6A 2YC2C 3D54D 2ZJAA 3H9CA 1K6MA 3TZKA 3ZOKA 1TGYA 4JH0A 3ZV5A 2ZUCA 3V48A 3NP7A 4W1SA 2IPMA 4M0CA 3T38A 4KWCA 4JGBA 1EUQA 3O6VA 4KUGA 1I36A 5ESXA 3TW0A 1Z6AA 4UDNA 1UKYA 3AUJB 4P7FA 1Z06A 5FJJA 5A3QA 4WV3A 3SKXA 2BTQB 4MEBA 2BPOA 2NXEA 3GHHA 5IH7A 4CEJA 1NDQA 3BMOA 1ORDA 1N1GA 1VLZA 3W5SA 2IX3A 3N05A 3FCXA 2IL1A 3KUCA 2A0WA 1VYHA 2ACKA 1WW2A 2DQKA 2VQDA 3TZHA 4D96A 2RBKA 1CNEA 5IK2D 1FYXA 1AKVA 3EBLA 1GCIA 2C5BA 2YMQA 3BRCA 5IBQA 1JNXX 3GGPA 5KQLA 1CK4A 4C2UA 5GV8A 4LIPD 1RI2A 3QF7A 3UPTA 1FYDA 1P75A 1E1DA 3TQSA 4Q9LA 1P60A 1JJIA 1W4LA 2IX9A 2NZ2A 3EBOA 1T1RA 2FKAA 1T2AA 1A5SB 2V7XA 1SQGA 3GJ4A 4MB0A 3TVTA 5FV4A 1B8VA 2R8RA 3VPDA 1BSVA 3U81A 1D3AA 1EUCB 1R8SA 2Q1WA 2YASA 3DMNA 3GUUA 2E37A 4R68A 4CLRA 1V2HE 2QD3A 1NMQA 2CL5A 3G5MA 2Q4DA 3H4TA 4FX5A 2Q8QA 4H4EA 1P72A 3T7KA 4DCCA 4E15A 1U6JA 2FTKE 3RS4A 1GXSB 4QOIA 4Y0AA 5L4NA 1E1RD 1VXOA 3GEEA 4BGDA 1FU7A 4EFKA 1QKKA 5F35A 3MHPA 1ECBA 1UZNA 2QT9A 4FYHA 2OQVA 4B87A 2JEZA 3DDOA 1T91A 2BGMA 2JCSA 3KOYA 5D51S 4Z4EA 5K0CA 4MRMB 1ZISA 2Q1TA 4ZIRA 3ZCRA 3Q8KA 3AM1A 1GADO 5BPFA 2ZJ2A 2F9FA 3GUCA 2VH2A 4G65A 4UUPA 4YMSA 5LU8A 3ZY3A 3CRVA 3LW7A 1MG5A 1OXBB 2VA8A 3MWDA 3R09A 4B71A 5REQA 5L6MB 3QVOA 4J4HA 3HFSA 1FMLA 4KODA 1DRJA 3W6PA 1DGQA 2QM3A 2BJVA 4BNYA 1DAGA 1GRQA 2D54A 1M2OB 1PJRA 2GJSA 3ANXA 2PL5A 1HYHA 2QYSA 2I2AA 3C3EA 1MF7A 3JQAA 3IMFA 4RPHA 1A4RA 1ISHA 4ZOEA 3V9PA 2I3DA 2HSGA 1DS6A 4RZ2A 2H4YA 1PFVA 2KW5A 3KPYA 5COQA 3D1JA 4P7KA 3IBFA 4X1KA 4QFDA 1XKXA 5L45A 3H2IA 2TS1A 1UMDA 2OHFA 2W93A 4YRCA 5ES3A 4F2PA 5F51A 1YCFA 3FKQA 5HQ3B 4QD3A 2GDJA 2EGGA 4EABA 2GEUA 4OQEA 1L7MA 4L6CA 4LSMA 3DFZA 1DLIA 3YASA 1W52X 3BMQB 1PX0A 1AXGA 4UEKA 4EI8A 4JMLA 3K9WA 1XTBA 3PKJA 1Z6QA 1AA6A 2W37A 3KL2A 3OQ6A 1SU8A 2CHGA 1AV7A 1ODSA 1UFRA 4B7AA 3I9V1 2C4KA 5EWMB 2WQ7A 1M2HA 2D00A 3DWIA 2B82A 3I9NA 1RKUA 1ZM4A 4KB5A 2C2KA 4DTCA 1W8IA 2OAEA 3BK2A 3RJZA 2CL7X 3R5XA 1ENPA 4F9FA 3AJEA 3F5MA 1OH6A 1L8XA 3WS7A 4IS2A 2GKSA 4OHZA 2G1KA 3OM1A 1MG0A 1FC0A 3SJCA 3GLGA 4IMPA 4J16C 4P4TA 5CH3A 4BIMA 3CU5A 3AXTA 1KTVA 1VKHA 4OB8A 1P4SA 4ZKEA 1ZSYA 2ZYDA 2JGDA 3E3OA 3DO6A 4QLBA 1SRRA 1YS1X 3SYMA 3GFQA 1NLZA 1O57A 1TD9A 1LA2A 4H3HB 2VYFA 3ZGXA 5CA1A 3TRFA 1P6UA 2OD2A 4NBLA 4C0WA 4EDHA 4PLZA 4RSHA 3G49A 3G8BA 3CN9A 4W99A 4E5UA 4PFSA 2IVZA 1A5AB 3N7TA 1PR1A 4WCFA 1JJFA 3KE9A 3URKA 4CQLA 4D4IA 4MVJP 2WW8A 3V00A 3BMQA 1RAIA 4N41A 1P2TA 1XEWX 1SM4A 3GIDA 1Q1EA 1PG0A 4JOBA 1IN8A 5G0UA 2GN8A 3EPHA 3WGYA 2BCEA 1E61A 1NW9B 1P80A 2B5WA 3QFRA 4L85A 4XIYA 4ZT6A 5CB8A 5EMMA 5LPNA 4IVPA 3HUDA 1MTZA 1KU6A 3F3YA 3ZHCA 1NRJB 2IRWA 2ZPTX 3AO0B 2M32A 3PPWA 4M83A 3C2QA 1ZGAA 3HV2A 1X8LA 1E4EB 3KJXA 2OPBA 4EDFA 1YR7A 3RJ5A 4OFXA 5CGQB 1HBJA 2D5LA 2F67A 2P9FA 3JVUA 4G1FA 3SR0A 4EPTA 2WV9A 2QDXA 4NK4A 1KS9A 4EGCB 2VJAA 3L8GA 1PZNA 2PWPA 1LSSA 2O4CA 4IHJA 1QZTA 4I36A 4LHEA 1Q0SA 2HADA 4DSUA 5INTA 1R5BA 5G41A 2V0CA 3PFBA 4O33A 4R2HA 1EHIA 3RIEA 2V7QD 4HUQA 5B7QA 5EP4A 1MENA 4RVGA 3WB9A 2ZCJA 3U3DA 3ZWOA 4BE9A 3WMWA 3WKAA 3QEAZ 1T9GS 3TM5A 4LRUA 5EUQB 2DJ5A 4EY3A 5EVCA 2ZATA 2PUCA 3Q7IA 4GKVA 1RHMA 1KAGA 2QK4A 1JJAA 3P0IA 5FKJA 4UPEA 5B5SA 4J3NA 1Y3DE 2QJWA 3NJRA 3UJ8A 1TVKA 2F3UA 3OFND 1ECPA 1QCDA 3RUAA 1U0JA 3CF0A 1VKRA 4IYJA 4O1HA 1KI3A 3HCCA 3DJFA 1RI5A 2XZLA 1IUNA 2O8DA 1CF2O 3RM3A 1O97C 2FZEA 2CLKB 2OZKA 3MT8A 3WQQA 2C5FA 1WUJS 3IC5A 5B37A 1PUJA 2PAAA 3A4LA 4ZFNA 1FYVA 2VQFB 1Z4PX 1VIDA 1BWPA 1X7YA 4DF3A 3NCTA 1OV6A 2RI6A 2ZRAA 1SQ0A 1GEGA 2Q2WA 2QV7A 3NHJA 2RIPA 2XWBF 4MI1A 5JAIA 3FOEC 4N5MA 5HEKA 3AHCA 1WBJB 4AZ3A 1LDYA 4RLSA 5BV8A 2IE0A 5TB5A 3EWSA 3HEBA 3DCYA 3CKKA 5DX8A 3ZXUB 3DKVA 1NJFA 1U0LA 1E3QA 1EHCA 4KPUA 4P08A 2ZWMA 1X7WA 3GP5A 5LZ8A 3GLIE 1FXSA 4S1PA 4MEAA 2JI4A 1NXPA 1WW3A 4JJFA 4REQA 2KWIA 2Q1SA 5FYDA 1JYEA 2JDIA 1BMTA 5L95A 2Q7XA 2ZBVA 2P7IA 3WKEA 5JSQA 4OXYA 4D0GA 1FS5A 2A14A 3D81A 1L8QA 4BNLA 5AICA 5I9IA 3OESA 2ZYUX 2IP4A 1IU9A 1ISFA 5EGSA 3ZCSA 1TTHA 3HWWA 4J1TC 4JJ6A 4NR0A 1OFTA 5IAJA 1UXOA 2BKUA 4E94A 5K99A 1Z4QA 4Q3DA 5HF6A 3NH6A 3J7AC 2ZBUA 4KSYA 1CB0A 1R8QA 5I48A 4LECA 1UF9A 1T24A 4AECA 1ZC3A 2LKCA 2JD2A 4MRAA 3RC2A 3H6HA 1D03A 1WXFA 2W6JD 2A9KA 2J7KA 3M83A 4PNZA 2JHGA 3QVVA 2ONKA 3R3YA 5T57A 4G41A 4H0NA 3J80A 5BOVA 2OOKA 2EFEB 3FTDA 2E7ZA 4Q4HA 3JVIA 2VP9A 3P94A 3LPMA 5HUHA 3RTAA 3RSQA 3V1NA 1YB5A 2OVFA 3FYSA 3LVRE 4Z4CA 1T1EA 2WYWA 3KSUA 2IHYA 3DVSX 4OFZA 2AH5A 1T4DA 3I9KA 5LQNA 4LF4B 1XZAA 4KVFA 3V7YA 1DAKA 1UBSB 1L5QA 1QK5A 3E9QA 3G1UA 3PJEA 5AOAA 1HSOA 2BUBA 4CKZA 4L73A 2GFQA 1Q3KA 1WB6A 2OCGA 3FWNA 3NAZA 2RH4A 3RUCA 4GPAA 3AK4A 1XN4A 4QELA 2E9SA 1U5BA 4P5DA 5K0SA 4RFVA 2PKRA 5L53A 1G4HA 1UBJS 1EUDA 3HGTA 3OTHA 4QSHA 2PUWA 2O6LA 4FT4A 3WOVA 3SSMA 1FMTA 1NXTA 3AHDA 2WSIA 4DIKA 4CMEA 4EVIA 4CM9A 5LMNB 1E0JA 1KZ6A 2FSPA 4INOA 2PKEA 2P65A 2PRJA 2WZQA 1JDBC 3JX9A 4RVUA 2XNDD 3FYTA 5EVJA 4R1TA 4RTOA 3CNQS 2QKYA 2P9HA 1L6RA 3IEXA 1L7AA 4J4BA 3LQ2A 4IS3A 1ORIA 1MIOB 4L5BA 1BEEA 1BCSA 2Q3MA 3IMCA 1TMKA 2RK6A 5CTJA 2PXXA 4NMHA 1XP8A 4V39A 4E5SA 3DVAB 1QLJA 4GU5A 3WZMA 1PF7E 4Q37A 4XWGA 2HU2A 4AK9A 4H17A 4QGSA 4PY2A 1X86B 2FP4A 2VS1A 4RHTA 3D6TB 4L22A 4WADA 1N2JA 1XZJA 3NYQA 4BQNA 1N0VC 4LHWA 4RYLA 5F78A 1BVHA 1I0LA 2W43A 3PXAA 1QRRA 2EKDA 1P7VA 3U80A 1KY5A 1YA8A 1YKGA 4U0KA 1M5RA 2KSQA 1AKMA 4Q05A 3IBYA 4U2KA 5E9WA 5KYVA 4C0KA 4JLBA 1JALA 4XQEA 5FOXA 3FAZA 3RHSA 3T1YB 2ZI9A 1NZFA 3DZDA 1QIJA 3HN6A 1NGSA 4QPJC 4DKXA 4EO7A 1X7YB 4PSVA 3KKEA 1J0AA 3DOJA 3HB4X 3OZCA 1CJVC 2EDAA 4CT5A 2XUOA 4AB1A 1JA0A 5L8VA 2X5OA 4CUKA 4UTNA 5C2JB 3DKKA 1IQ0A 1EWQA 2GPSA 3DF7A 4TWJA 4CF5A 4EVSA 1A5TA 4M21A 2B98A 4LRYA 1LDNA 4B2LA 3FXAA 2R6CA 1UMBA 1R0BA 1WVMA 2GCNA 1JSZA 3O4HA 2XV1A 3PCRB 4REMA 1Z0AA 4DQKA 3WWEA 4ZDKA 5ALXA 1XLUA 5AKIA 2XYHA 3BBLA 3RJMA 4F9TA 4NXMB 2NVWA 2H8GA 4RPJA 2AMVA 2FK8A 1OZ0A 2QMOA 3AGQA 4CU5A 1B74A 1WS6A 2V3WA 4LS3A 4CW7A 4LXHA 1UEJA 4DBVO 4H7FA 4GE3A 2OCIA 1JHVA 2PMKA 4EW2A 3V2HA 4QUHA 1Z6GA 2I4MA 2ZBPA 1IBMB 2C20A 5HFNA 3TLGB 3IRVA 1T0PA 1IXRC 1K4KA 1AF4A 3PWZA 5IT5A 4PZEA 3WC4A 3AR4A 3THXB 1JEDA 2FKNA 2DSTA 2ZRMA 4KNVA 3UJHA 4BZQA 4NC9A 2VJOA 3KM0A 3ZLJA 3A1EA 3N8HA 5FV7A 2W6CX 3RADC 1SB8A 3GEIA 3SMQA 3PNPA 4JC8A 2YV5A 3MJFA 4BLWA 5JH7B 4JL6A 3ICEA 2CYCA 4MMZB 1XTJA 2C4VA 3OCXA 3QVTA 5HF8A 4RVHA 3DT6A 3I45A 5L3ZA 2NZUG 3WHLA 5CA1F 3HK2A 2ZB7A 4NU0A 1DO0A 1VL0A 6ABPA 3NRBA 4GZ6A 4RJJA 5K2MA 5ICGA 2XQFA 4HXYA 4MQFA 4OJKA 1IJFA 1CQJB 1RYZA 2VVTA 3HO6A 2E6UX 1L5RA 3C3CA 4MKGA 5HK8A 1TT5A 2P2ZA 4AO8A 1E9FA 3SYLA 1UANA 3EVCA 1QVRA 2BMWA 3L7IA 3M1IA 3QP9A 3T3DA 2QZPA 4EX7A 1KI2A 4TS3A 1YXMA 2GFHA 4DQUA 4WA8A 3LWBA 1BWQA 2DG2A 3G7NA 4BS9A 4IIFA 3DE7X 1KAOA 1PWXA 4W1RA 4G4GA 1UAYA 4CIDA 3JWIA 5HQTA 1IZ0A 1CUCA 1S2LA 3GJ6A 3VYWA 4BAUA 8OHMA 4Q1BA 5LR6A 2BBOA 2ZJ6A 4MX8A 3N2IA 3Q8LA 2DHDA 3VC7A 4H0CA 1DADA 1XELA 2Q0SA 2YJTD 4J0JA 4PHTA 3ENNA 4E7PA 1U1GA 3VX4A 5E7MA 3WWYA 4EG7A 4OQDA 3WGTA 4YUWA 1F0PA 1DTEA 3R6GA 4KR7A 1MIHA 2IF0A 1SD5A 2Z5GA 3CNEA 4JI7B 5EJ9A 3DF9A 1GTJ1 2PZFA 4M9CA 4AS1A 1A4IA 1PW7A 1R15A 4HVAA 2ZRJA 5F9MA 3QBEA 1D6JA 2Z4TA 4QLOA 2RHWA 4AY6A 4OY3A 4QSMA 5B58C 4BTVA 4J0EA 1RZRD 3IAEA 4JXJA 1T4CA 5CT6A 1NQWA 3ZY4A 1E3IA 3AH8A 4DDKA 5CDHA 4Z53A 1DJLA 1SB9A 1E4EA 4NH0A 1UXIA 4RJIA 4WH0A 4E5NA 5FWYA 2OUIA 1NA5A 2JJMA 3LGXA 1E5XA 4ROSA 4WKBA 3ROEA 3LQRA 4LTMA 5A7GA 3S2GA 2ABWA 2G7ZA 3EPPA 1PT9A 1V8PA 3CMMA 2NU6B 4FGKA 1AKYA 2Q4RA 3KYDB 4HX5A 3IP3A 1JVBA 5BT9A 1M0EA 4G5OA 1AK9A 5D84A 3RRBA 1X8XA 4G2NA 3MLEA 1USKA 4ENRA 4LQLA 2B8JA 4J9VA 2W2LD 3TQIA 3B6JA 4RTQA 2IPNA 1KDZA 4BECA 1DXQA 1GNVA 5LD2C 2GH1A 2XIQA 3A31A 4IWYA 4MPPA 4YRTA 2XYVA 2ACWA 3AKZA 4B09A 1JW9B 2QHXA 4M1ZA 4KYTA 1U0FA 3WQHA 5L3SA 2UUCB 4QBFA 1YR2A 1ZNYA 1NJ5A 1V48A 2IUEA 3MWDB 4ID9A 4IV0A 1XAJA 3OZVA 2PX6A 4OGGA 3RB8A 4KZPA 2ODBA 2WB2A 1SHLA 1TKRA 1DMSA 3EZ2A 3I5UA 1F48A 1CP2A 1OTHA 1OGYA 1O58A 3K1YA 3SC2B 2NVOA 3G0GA 3L46A 3F6SA 3T4EA 1KPIA 1JG1A 1OTXA 2W6NA 2XRFA 1D04A 3OJOA 1XU7A 2YYYA 4RKFA 5DM60 2B2XA 4DCNA 4DMGA 1ECFA 1ZXLA 2HPZA 2ORWA 2Y1WA 1TVMA 1UXJA 4KYVA 4PO1A 4TTVA 4A8JA 4F86A 3NKVA 1ZONA 1CQWA 4YJGA 2Q3EA 3ZCUA 4N5DA 3PX2A 2I2FA 1XTVA 2WIFA 3TVYA 3MTIA 2X42A 3NI2A 4TUYA 4WEOA 5TPZD 3L1JA 2VEOA 3VZPA 1X14A 3VDNB 3U31A 1PJBA 2IU6A 1E2KA 4HJRA 1A97A 1JPNA 5IKOA 2M1ZA 3DJYA 1W19A 2A5FA 4B3IA 5BQOA 3CO5A 4J0DA 1SCJA 5BSFA 4YAGA 2O23A 3ZXIA 2WYVA 2Q1UA 4FMBB 4HFJA 4I8XA 3GDGA 4OH1A 4R7ZA 1EM8B 4WK4B 1XCLA 5H3HA 1DPGA 2V4UA 4JYBA 1L7QA 4IH1A 1O5IA 3JD2A 4CV3A 1CRLA 3KLBA 1RVDA 2PUBA 1OASA 1A2KC 2ZRIA 4P4UA 3D4BA 2VO1A 2BTEA 1B26A 4HK4A 2HXGA 2GETA 3HYTA 1KAHA 3S2UA 2FJPA 2QMQA 4HKTA 1TM1E 3VZRA 1K98A 3OPVA 3LDUA 1TIBA 1NONA 3IT2A 3PJFA 3RR2A 4GWLA 1AHIA 1PFQA 3LF2A 2FZ5A 2WE7A 4LHXA 1QTQA 1B23P 2DFVA 1FJHA 3PP8A 3VVLA 4L6AA 3KQKA 4GPZA 3FFBA 1LPOA 1O03A 3IUEA 4PN3A 3QLVC 4B81A 1RZUA 4HNSA 2BJHA 4V0SA 5DXJA 4D3DA 1MA0A 4FB4A 1TA4A 3OP4A 4F5YA 1ISSA 2O2EA 3GIWA 2GCPA 3QEMB 4GXNA 1Z6TA 3DKIA 3VXKA 1F12A 4BO1A 2GPAA 4E1AA 2IU3A 5CNMA 1J25A 1GAJA 1ADYA 5AKZA 3ROQA 3GX1A 3OZ7A 1Y9DA 4CIAA 3ZWWA 2XXAA 2AQ8A 2OFWA 4Q4AA 4DPLA 1F4PA 3V8PA 4INZA 2QY9A 4ZT3A 5GZ6A 4Z9BA 2BGWA 1Y7LA 2MYNA 2VHZA 3L05A 4O02B 2RC5A 4BV8A 5IZ4A 3SFZA 3QE3A 4MVJF 2NWQA 4H59A 4KO3S 2PL3A 3LTEA 4C0SA 1W35A 1U1IA 3OWHA 6LDHA 4CXMA 3H1PA 1QGUA 2H06A 3DV0A 2DWQA 1SN7A 5KYYA 3HI6A 2V9ZA 1ZI9A 3OQHA 4DHWA 3DLTA 1TCCA 1UWLA 4NCHA 5F1PA 1P29A 3JVVA 4HDAA 1O87A 2W5UA 2WILA 1O2DA 1OFUA 3MJRA 4ZZIA 4OM7A 2CF5A 3VZQA 4FC6A 4ZVTA 2CXXA 2FPGA 3C7DB 4RD3A 4XDYA 3GP3A 4M9ZA 2ID8A 2DUWA 4ZT4A 5E1OA 2ZWAA 3GJ3A 2RARA 1IG3A 1GG5A 2GQ0A 1ZPDA 3N8KA 3PC4A 3UA3A 4TV8B 5DM4A 3EB9A 5C5IA 5DK6A 3ZHUA 1O89A 2O19A 4CLXA 2CSXA 1YONA 4HQOA 4K9RA 3AVWA 4CKBB 3F2IA 1XLTC 3I9MA 4JYCA 2RHHA 2CL0X 3DBOB 1ZVQA 1KY3A 1RXSA 1UBNA 4DGSA 1Y8ZA 2ZJ4A 4AMZA 4IJMA 4M0UA 4UCFA 1T8UA 4Z3DA 4DZTA 4R7GA 1MB4A 3KWFA 4GF5A 5AVYA 5J2UA 3H5RA 1SBCA 2A86A 2O2ZA 3DE0X 2FG5A 2VXOA 3QHPA 1IBSA 2JCYA 3ZDCA 4ND3A 1N7JA 1Y8RB 3K8ZA 1FDVA 5K8UA 2E4VA 4EYQA 3IQEA 3HNRA 1T9GR 4CL3A 5B6JA 2BGNA 3EPJA 3I92A 2CNBA 3GD5A 1P5RA 4IEFB 5ALNA 3T35A 3VTZA 1E1RA 3ZS8A 1HA3A 3L9WA 3U7RA 3RF6A 3WAGA 1Y9ZA 4PX2A 2QG6A 5KOHA 1E3WA 5DRYA 3PFKA 1HORA 2O52A 1TNDA 2NAPA 4BQRA 4G97A 4PLCA 1Z6PA 4KSBA 4WXYB 1X8KA 3EY4A 3JR7A 4L4YA 3RRYA 1Q5PA 4JASB 3CA8A 3MWEA 2R00A 3OJFA 4LJRA 2BW0A 3M2TA 4G1UC 4MHSA 2IZZA 1E1CB 3NAMA 3GWZA 2EGHA 3KPUA 3A14A 3JZAA 3PL1A 5ESRA 1XF1A 5FPYA 1IOWA 3ETDA 5IAKA 5KNDD 2E85A 3E23A 1QO0D 4YXWA 4BNTA 3Q2IA 3DZBA 2DAPA 4XDZA 3TW8A 3I5XA 3EMKA 3EN0A 4G25A 4XLZA 1XQVA 1NYQA 4Z2AA 1P3DA 4X1IA 5BQPA 4H77A 1G2OA 3U3XA 4MAMA 1GG9A 4NVRA 3PQ3A 1A7UA 3OPYI 3Q12A 4MRVA 2B4AA 4E51A 3HSSA 1QJ4A 4BB9A 1XYVA 2QZSA 3NNSA 2WLSA 3B7PA 2ZIWB 4OUKX 1ESEA 5ALSA 4A8TA 2VK2A 4D8XA 2FPIB 1VBFA 1NFFA 4EFNA 3MYRA 3E22A 3DZHA 4E2WA 1ADGA 5FF9A 2ZOSA 1Q50A 5DOVA 4K86A 5ETJA 1VL1A 5AUQA 1HXHA 3JS5A 1FTYA 1QHHA 3T5BA 2CE2X 3AR8A 3II6X 4JVOA 2N0SA 1PJ3A 1TO1E 5JPDA 4O5OA 5FA5A 1E94E 4AZ0B 5J1SB 4HDKB 2NAFA 4DR2B 3ZVRA 4XGNA 4Q1FA 3A1SA 2XYGA 5FR2A 1QX4A 2VP5A 4BWFB 3PYLA 2FEAA 1YB4A 4EG3A 1PEKE 1ZMBA 4L7VA 3UUEA 3IKTA 1LKZA 2WD8A 3CW9A 3IDOA 3VNUA 5LXTF 5BP7A 1AMOA 1Q6YA 3OKAA 3IBTA 3T5TA 1MVLA 1V5GA 2Q29A 2QBYA 4IEEA 5CM9C 3QQ5A 3ZQ6A 3H86A 2GF2A 4TYPA 3IODA 1PD1A 5GIOE 1JSRA 1AZTA 4KQ6A 4QRIA 3KT0A 2CT8A 1C1DA 1U65A 3HZZA 4RCYA 3FWZA 4JSYA 4NY1A 4ARAA 5FNVB 2C9BA 1JU9A 3KV1A 4D8YA 621PA 2O3RA 3BBPA 2FE4A 4MPJA 4B4VA 1X39A 1F38A 2YMPA 3UC9A 2YXBA 1Q0PA 2IUYA 1Q7GA 1JHXA 1R6AA 2P1DA 1FB5A 1QVVA 1WO8A 1V95A 2FRVA 2JFHA 2VZEA 3NEAA 3ELYA 1TKBA 5DO9A 3TGWA 3ZU5A 2Q3JA 4BFZA 4CHTA 2ZUTA 1BG6A 4IIYA 1QK3A 4IDDA 1JG2A 3ET4A 1MV5A 1YU9A 1XYGA 2P9YA 3KOWA 3NONA 3O84A 4UBKA 5FHRA 2HA4A 5I9MA 3ZWQA 4IGIA 1EE1A 1YQGA 4OBEA 4PG4A 4CKEB 1R4MA 2ORYA 2AEJA 2FPMA 2VYVD 3NCHA 4LDRA 3T8YA 2J9ZB 2ZETA 2ZT7A 1VCOA 2CXTA 3WGHA 5FWXB 1M2VA 5TY0A 4XJTA 3AY7A 2KBEA 5FADA 3K8QA 4PIMA 3MUFA 4UU8A 3WLFA 1Y1PA 3GPIA 3L9XA 3ASZA 2Q49A 3DAHA 3ETCA 1YMUA 2MJLA 3CM0A 1LV7A 3O1HB 1UOPA 4GX1A 3QWHA 2ZU6A 3I2IA 4N48A 1R5OA 2WUWE 2P5TB 4NECA 3W1VA 2ODEA 2RAUA 4DIUA 3HFJA 3L2OB 1SIBE 3L8ZA 2XD4A 4I1RA 5TPWA 2O6HA 2QLFA 3BMCB 4GI1A 1M75A 4XI9A 3RYIA 5IVPA 3FFAA 3IV7A 2QP9X 3B9BA 1QF9A 1W9HA 2ZG6A 2BLLA 3HBMA 3PC2A 1NE7A 1SEPA 4HH0A 1BOFA 4Q3KA 3UWKA 4PSAA 3FNRA 2PMDA 5JADA 4CM4A 2LPMA 1HFEL 4B46A 4R7TA 5D3KA 3AEQA 3ZG6A 2JGAA 3VKVA 4ZJUA 2QN9A 2HJWA 2Y1GA 2FFBA 3IE2A 1YZKA 3RYTC 3ER9A 1RHRA 2VN8A 3JARA 4XX0A 4QTUB 2DMRA 4QREA 2E4UA 2VA9A 4UXJA 5K4AA 4TQ9A 3COYA 2QM7A 4NAUA 3GJ0A 3T0IA 4YUXA 3BH6A 4YVFA 1PTJC 1RPNA 3A6DA 4C4AA 1ZD5A 4EHNA 1IL0A 2AVDA 2OO7A 3I3OA 2K7ZA 5EINA 4M4SA 4IMRA 4QXMA 3HJTA 1CR4A 2D13A 2ENWA 2GPBA 2Y1KA 1TAUA 5D87A 1W94A 3WJ7A 1YZFA 2DT8A 3IR6A 4R2KA 3RVJA 1P1JA 3TSYA 4JWTA 1ISRA 3R3ZA 1W29A 3FUCA 5E6UB 5F5XA 4OM8A 1FLVA 1SOUA 2HQ1A 4LBWA 2CW5A 3W4KA 4F6RA 3UPDA 4B84A 2H3HA 1U8CB 3DTTA 3MGCA 4OGWA 2NVBA 2W6PA 2FLKA 5GINE 5ULLA 2D7DA 2YVKA 2PUTA 1UKBA 1ZRNA 4IMIB 2Y1EA 1PZFA 4DSOA 4GWGA 5E4TA 1ESMA 4HNRA 5LSAA 1ZKMA 1C1XA 2X1MA 4I1OA 4RY2A 2G6BA 3CTPA 4IIJF 5E3JA 3UKDA 2YHUA 2OC4A 5H7XA 2JFOA 4EZBA 2V0NA 1KNXA 4ZVNA 5LDHA 1JWBB 1JWAB 1EWTA 3ZVLA 5BQ3A 3NMUF 1I30A 2I67A 3R5KA 1E5LA 3PI7A 1CERA 1M6VA 2IHUA 1YDFA 1AGPA 1B3BA 1ORTA 1GRCA 3MFYA 4L0CA 1QM5A 4BXOA 3A6PC 2VZ0A 1NY5A 1GUBA 3M7IA 3BXXA 4ZYVA 4Z7OB 2A9RA 3FGZA 3VA7A 3GGDA 3QF4B 1O6ZA 4J49A 3GPDG 4NOJA 4BNWA 5BSEA 5J4KA 3QWBA 4YLGA 4B4WA 1CSEE 2Z2IA 3EAGA 3AEKB 4CDGA 3WZ2A 4LJ8A 2BRUC 3MUEA 5FI3A 4CEHA 4R9VA 4E07A 1MB0A 1WW8A 4JN6B 1ZJZA 3S5JA 4BDTA 4GBMA 2SCUB 1FSFA 3SC3A 3IPAA 4IUCS 4Q4CA 4JUAA 4H35A 4KK3A 1P44A 2J08A 3P0EA 4TSFD 1T3GA 4BLTA 3RTGA 4ARIA 821PA 4NZYA 3H3JA 1VL8A 3A4NA 3MERA 1KF0A 1V41E 3SBXA 1JPUA 2BEUB 1LI4A 2CMDA 4MLPA 4XW2A 2AFVA 4RHYA 4UPDA 4MUAA 4OU4A 3U4DA 3MWEB 4RENA 3W5UA 1R8YA 4MUIA 4XM0A 1C8KA 2JIZD 1G9XA 1Y6RA 3AG5A 3CINA 1YA6A 5G0WA 3T9EA 4O63O 3C1OA 4FYYA 4P4LA 4MWZA 4NEGA 3WIVA 4B3FX 4M76B 3JPWA 3CLRC 3SQLA 4PGAA 3TQTA 1GN8A 4EFMA 3KRTA 5TT0A 4YMHA 5IAAA 2XE4A 1EB8A 2WHPB 2LTAA 3WIOA 4YJ3F 2AZ4A 1UJ6A 2CLEB 3OPQA 4WERA 2I71A 2BLNA 2FVYA 2VQSA 3PD7A 5CU7A 3RUHA 1NSYA 2F00A 1E69A 1DG1G 2MYTA 2O8NA 2Q4OA 3AUKA 3LLVA 4RYDA 1DDOA 1E3JA 1EDOA 4YRDA 2W70A 1YGPA 4OXRA 3HXKA 3IBCA 1WHSB 4HNGA 1FDWA 4L4RA 4LDQA 4P80A 5LIRA 1WSAA 4CI0B 1Z5WA 3CUEF 1N6HA 2V7EA 3QWAA 4UHKA 2EBFX 5ICFA 1NUUA 3HJFA 4L5AA 1YL5A 2BI4A 4BAGA 1GL7A 3DL7A 1MIOA 3GUHA 4BLOA 2MYPA 1NQAO 2YV3A 1MAUA 2VPIA 1DAMA 1SG6A 2ZP1A 3QZUA 4B3CA 5FWDA 2PSSA 4K7JA 5IHXA 3VU1A 2WBLC 1QGDA 1J8QA 1E6UA 2XE8A 4FT2A 5DLEA 2RB5A 5ADWA 4FDUA 1Y0BA 3HCBA 3QVGB 4AJ9A 1CUGA 2XUJA 5M2QA 4UHBA 3SS9X 1VE3A 3F5QA 1JEYB 3TLJA 5EJ2A 5GTDA 1JR3D 1XV5A 1NNSA 1O0CA 1K88A 2J87A 3LUBA 2RGDA 2O59A 4G1VA 4URUR 5FLYA 3OX2A 3LA6A 3EHDA 2RHGB 1S5PA 5AVJA 3NT5A 3ZE6A 4D3YA 2EWMA 5HJEA 4IGKA 1F2UB 3RCBA 3K0KA 3HMKA 2YJGA 4JYZA 1ONOA 3FOCA 2XRMA 2ZXEA 1JR2A 2E87A 2X58A 3LFTA 2P2CA 4O08A 1ZM7A 2HNKA 1U9YA 1Y42X 3HADA 3PF8A 3KQYA 2PU5A 3EXHB 5I3CA 1N1DA 2LUOA 3EZ6A 3RKUA 3J81k 4IDCA 4N3CA 3NNNA 5HG0A 3RLFA 5DXFA 4KL8S 1NP6A 4RADA 1E2MA 3WE7A 3EDRA 2CNKA 1C3OB 4YUZA 4PC2A 3G5UA 3I01A 4H6WA 2V4MA 3CSUA 1MO3A 2XIJA 3SX2A 5ICEA 1TU3A 5AUPB 4FYXA 4YDHB 4N0DA 3IS3A 4RXMA 4UREA 3T34A 4WL0A 3WBJA 3HR4A 4RHCA 5HUJA 4XDHA 4F3CA 4CM3A 4JNCA 4MIKA 1BGWA 3E35A 5CFPA 3PC3A 1VRCA 2ZUUA 3D8RA 3QVUA 2VUIB 4ETIA 2X0IA 1DT3A 4H1TA 1W1WA 3A9UA 1T15A 3FNGA 3O4FA 3TUIC 2QTTA 2B92A 7AT1A 1H0HA 2PUEA 2OESA 3COJA 4LZLA 4R1PA 4GQIA 2WNIA 4OLHA 5GPBA 3GRKA 3WL6A 5GZ1A 1II8A 5DIFA 1XNRB 3RHZA 3DAPA 4GE0A 5A0FA 1MEEA 1FUUA 2GHQA 3A04A 3DKRA 1J56A 1XA0A 2WJGA 3FRJA 5GJBA 1YQ9A 4G56A 4N03A 3ETHA 4TRMA 3GW8A 4MINA 3IPXA 2ZIXB 3K31A 3KD3A 1Z7YA 1GYQA 1JRLA 4Q16A 1JQJC 5IBRA 3BWYA 5DH9A 4EM6A 3LWNA 3P9IA 1M8JA 5A4AA 3GJZA 4BV3A 4O0LA 1AGNA 4AVYA 1VKJA 4BBJA 3RYCA 1OVMA 4HZUA 3JWHA 4HUJA 5JHHB 1QGOA 1TQDA 3A27A 4CTNA 3OPNA 4FYWA 4I6JA 1DV2A 1ZWKA 4C9BA 1OI2A 4DJFC 1AMUA 3ELUA 5EZ5A 3TIVA 3U6KA 4DUZB 4GNKA 3CC8A 2D2EA 2HU8A 4FZVA 4K28A 3A1TA 3ZWKA 3GEGA 3GBVA 3BICA 3TYXA 2YWFA 2B4TO 2R6JA 5U1PA 3RNLA 3TSCA 4JP3A 5DLYA 3K1JA 4QT0A 3OM9A 3R7BA 3SQNA 4PRYA 1SXJB 2QGNA 1UOEA 1R0CA 4X3CA 5ALRA 4BB0A 5CLFA 1YBHA 4JQOA