3L0KA

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-acetyl-ump
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine 5'-monophosphate synthase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 101
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l0kA00
2CZFA 2J24A 2QCNA 1LROA 3V75A 3W73A 3CU2A 3DENA 4JIQA 4ZQMA 2C3ZA 1ZALA 2DZPA 1W31A 5MHBA 3LHVA 2XN0A 2LLEA 3RLVA 3JS3A 2VENA 3IVTA 3QH2A 4UFKA 2Z6JA 3GDMA 3LLFA 3L0KA 1FCUA 5D30A 3O1NA 2WKJA 3UWZA 3S9YA 1IIHA 4TMBA 1CI1A 4XBKA 4X3ZA 1H7RA 1QMLA 4BI5A 1CW2A 4JTKA 2A2IA 2Z6IA 1LRTA 1UCWA 1OVDA 2YYTA 1EIXA 1W3IA 1DQXA 3UWVA 1VRDA 3M5XA 3QSTA 1GTEA 1DVJA 1DL3A 1OF6A 1YTDA 3B04A 3S5YA 4Z0JA 1RQHA 1LBLA 3EX6A 3P84A 1SO4A 3G1SA 4JTLA 4MUZA 4IJBA 3P8JA 4FNUA 5E0KA 3TR2A 3U8GA 2X16A 4E0CA 3TH6A 5FF0A 4DO6A 1WQ5A 1OX6A 3SW6A 4BWLC 4O15A 2YW3A 3DZ1A 2GQAA 4A2SA 4LC6A 2XN2A 3W7MA 4DELA 4IX2A 3M47A 5CZJA 1OABA 3C8FA 5FEZA 1O5XA 3DXIA 3TCEA 3KVKA 4OQVA 2Y89A 2ZA1A 1A5SA 3OIXA 5TIMA 5U4NA 1S3HA 3E02A 1T96A 1EUNA 2OJPA 4IPIA 4FF7A 5AHIA 5F1UA 4AH7A 5EPDA 3M6YA 2RH9A 2FB3A 4GC4A 3EWUA 4JTTA 3W23A 3RNDA 4A21A 2CLOA 3N3MA 1OFRA 1H62A 1IIGA 3N73A 3VKJA 4GUFA 1H50A 1DV7A 4JNMA 1WX0A 4JGDA 2HMCA 4PCFA 2VELA 3STCA 4NZJA 3C4UA 2ZZ3A 3B8DA 2E6AA 5T26A 1GG1A 5HR7A 2YCEA 3MYOA 2O7SA 3FA5A 1FDZA 5D2YA 1L9WA 3CIXA 1JJKA 4O17A 2Y7FA 3QMTA 3EWBX 4S2CA 4LS0A 3BG9A 3EWYA 1LDCA 2J27A 3EXSA 2QCGA 3A24A 6TIMA 3LHWA 4IMCA 3W7CA 4UTIA 1GVOA 3C61A 2ALDA 1PHWA 1AL7A 1U83A 3QQ1A 1L6SA 4NQ1A 4QQ3A 4X2RA 3G8RA 4RLIA 3STFA 4FNSA 2W79A 1J4EA 1LRQA 4MJMA 4B5NA 1YXCA 2VFIA 3LCWA 1HUVA 4DF2A 2Q3RA 4Y9AA 1EWEA 4MOZA 3GXPA 1TB3A 3GX9A 3VI2A 3HGSA 3W7RA 5ABTA 1O60A 3DFQA 4WXYA 5D33A 1FCBA 2CFFA 4N9DA 3W1UA 2H3BA 1KTCA 4AWUA 1WAUA 3S6DA 3UWUA 3EX1A 3IIZA 3W1PA 1F74A 3JR2A 2GQ8A 5H2ZA 1TV5A 3IGUA 3TQVA 5DLCA 2QEZA 4K7YA 2JGQA 5E1QA 1W5NA 3NPWA 1JRCA 4GXMA 4UTWA 2YGYA 1SFJA 1W3TA 3TU9A 4JYFA 2B7OA 4O14A 5D38A 3N14A 4NVTA 3WJWA 1SQ7A 3KRZA 2D73A 2X1TA 5I3KA 3L68A 5AN7A 1Z41A 4NXSA 4DF1A 1AW2A 3TW7A 1SO5A 2VEKA 4M5PA 1ZFJA 3O63A 4JTHA 3GLCA 4NZFA 5KMYA 2DZWA 3PULA 3F03K 3EX3A 1XXXA 2F84A 1H63A 5D02A 3LV5A 4M7SA 8TIMA 3P5ZA 5LGXA 2B7QA 1RQBA 3WJYA 5AC8A 4HIBA 1N55A 4NNAA 2ZA2A 5HULA 2GUUA 1W5QA 1R2RA 1EWDA 1GQNA 3ELFA 3THAA 2PC4A 2NZLA 5F4XA 3LI1A 1B57A 3B06A 1L6YA 1GOXA 1V7YA 1JCXA 2Y63A 1FXQA 3HG5A 3PWAA 3ZWSA 4C1KA 2QJHA 5EL1A 4QJ1A 1Q6LA 1SSGA 2QCEA 3KVLA 3L9CA 4AXKA 3TXZA 1K7EA 1BEUA 1W5PA 3P7YA 4N4PA 3L66A 5LSMA 5HQEA 3BW2A 4X22A 4FIQA 3HMJG 4WOQA 1W5MA 1WDWA 2E68A 3MP4A 4DF0A 3T55A 3OA3A 2QCFA 2DZTA 1LYXA 3BLEA 3KRSA 3M16A 3H53A 1TTQA 5D2VA 2FQIA 4NX5A 3PSWA 1S5WA 4N9EA 4MZ1A 1F7BA 4UMAA 2E5DA 3LV6A 3A9IA 3TROA 1G4SA 1KM3A 2PURA 1MSSA 1VHNA 4RKAA 3TMQA 1KM6A 1TSIA 1KFBA 3HOJA 1K02A 4ZZ9A 2FIQA 2X2GA 3W74A 1H1ZA 4MY8A 1FWTA 4O1DA 1CX9A 2OMAA 3KAOA 4FNRA 4LS2A 2C13A 3HQ1A 3NL3A 3C2FA 3M41A 5L6UA 2CZ5A 3G1DA 1GTHA 2TMDA 2XN1A 3B0UX 4O18A 3G8EA 3JRKA 4Z1BA 1X6UA 2A1YA 1TPFA 3QJAA 4ZMGA 2V82A 4QIUA 4DPPA 3BLIA 5LNSA 1ALDA 4AEOA 1N8FA 3QM3A 3O6DA 1H7WA 2JBMA 4U28A 5DELA 5AFDA 1AL8A 1I2NA 3GNNA 1G4TA 1R47A 4K39A 2ISVA 1QPQA 1MEHA 3GXNA 3MI2A 4JS3A 1JR1A 1VYPX 2QUVA 3W70A 1KLZA 4HPJA 3LCXA 4WOZA 4CLMA 4EWND 4JDYA 3W1NA 5D09A 1LCOA 1AMKA 3NVTA 3W7LA 1RD5A 3G1YA 5DN1A 3GR7A 2G96A 3G18A 2QDHA 4ZQNA 1LLZA 2DJXA 4EF9A 5F2GA 3G3MA 3TE9A 4RV8A 5CZ0A 3P5YA 1RV8A 3CEUA 1TCDA 4NT0A 4O8RA 1T0OA 4IOTA 1PL9A 4R7JA 2V9DA 4LNYA 2TRSA 1OFPA 1LOLA 3DU0A 4UR7A 3TX9A 2H8ZA 5K2ZA 4OV9A 2E5CA 5I3JA 3MHUA 3L5AA 1GVRA 4H3DA 1J2WA 3DHDA 2DP3A 4OGZA 1ZHAA 3MBDA 2CLHA 1I4NA 4UTKA 2NUYA 5D2XA 4C1LA 3NM3A 4A29A 4A22A 4OBTA 3D0CA 2OX1A 1ME7A 3NQVA 5D03A 3TUUA 2QCDB 1GG0A 3NXFA 4MKNA 4ZQOA 1KM1A 1O5KA 2YX0A 1TO3A 3ABOA 3NGJA 1W37A 4JTFA 3WJZA 4M19A 5LHFA 3B0VC 3L21A 3LERA 2VFDA 2A6NA 2QKFA 2ZA3A 4IXXA 4RZ6A 1T99A 4ORIA 4N6EA 3T4CA 2WSYA 1M7PA 3LGEA 3TJLA 3MYPA 5AB3A 3P82A 1QPNA 3UWWA 3QW4B 3I65A 4LTSA 3SR7A 2ABAA 3Q58A 4FXRA 4IMFA 3G1XA 1SO3A 4QISA 4YLWA 2VC6A 3BV4A 5HR6A 4RXFA 2RDTA 4ZL1A 3DFOA 1LLWA 3RLUA 5HWNA 4JX5A 3S1WA 1B4EA 2Z1BA 4XUGA 1FQ0A 3KVMA 1VYRA 3DFNA 4Z1AA 4LWWA 4N6FA 1Z42A 1JUEA 1VHCA 1AG1O 1VQTA 3W22A 3ZWTA 3C6CA 4O54A 2WQPA 3G0UA 3STEA 1P0KA 3HPSA 4E2BA 1WV2A 3W84A 3LHZA 3P61A 5EYWA 3C3NA 3FKRA 3L67A 3U6WA 3WJSA 4JY8A 2BSLA 5LKYA 2CZDA 2I1OA 3P67A 3HG3A 1P5BA 1R2SA 4JXCA 3I68A 3M5ZA 1OFEA 2RDWA 2YZRA 2J9ZA 5L9FA 5IBXC 1W5OA 4PA8A 4BWLA 3P81A 4CNPA 1VPXA 3HF3A 4HPXA 4L4MA 3CWOX 3VFLA 2NX1A 5BW6A 1G7VA 3W2UA 3GKFA 2CLKA 4O52A 2QJIA 1R46A 1DKWA 4HNVA 2B0MA 5I3FA 1C8VA 2ISWA 5D37A 3TV8A 3S0CA 1WBHA 4X9SA 3CB8A 3GR8A 3LBCA 4W9TA 2H8XA 1SO6A 4LV9A 1UB3A 4AMAA 3BO9A 4AHQA 3GK0A 2Z2UA 3W9ZA 4DBEA 4HN4A 1GVQA 3NQAA 3QC3A 2ZCGA 3S1UA 5GVJA 1T8XA 5KZDA 3QMRA 1QO5A 1TRIA 5K9CA 3ABRA 4UTMA 3SSJA 3LDVA 2WSQA 4UFMA 3G24A 3FYPA 3CT7A 4I7WA 3UZ5A 2WNQA 4AHOA 5J5DA 1KTNA 4WY0B 4Y90A 4LRSA 1JCNA 1PHQA 3HG2A 1YXYA 1ONRA 2ZQ0A 1C29A 4K6AA 3G3DA 5F4WA 2J9YA 3NR0A 5LZLA 4IMDA 5BMWA 3H55A 4OWGA 1ZAJA 1TJPA 5F2IA 1FBAA 1GT8A 5I3HA 4HSOA 1OFDA 4WD0A 1W54A 4IPJA 2TYSA 1OK6A 4GRSA 3MHFA 3YPIA 3I7SA 3TSDA 1OX5A 3NM1A 4XKYA 5FEWA 5AC7A 4AF0A 3RK8A 1G69A 4YMZA 3KX6A 1X7FA 5G2IA 4LC8A 1WOAA 5D32A 4JR5A 2RFGA 5LHEA 2HS6A 3PB0A 1X8FA 3USBA 1KM4A 1PCWA 3O6CA 1H51A 1UJPA 1FDJA 4LUIA 3RMJA 3CM4A 5AC6A 4Q4KA 1YPIA 3F1QA 2AQWA 5D04C 5HINA 4FHAA 2DZSA 3GZ3A 1QFEA 1KFJA 3LCFA 1FWNA 4DBDA 3T78A 3L2IA 3WK3A 1VYSX 3E9AA 5K3VA 5IM51 3LBMA 3LTYA 1WOBA 3EEGA 1DJQA 3LTSA 4ADSA 3IEBA 2PRMA 4NJHA 1DORA 4K38A 2V81A 3NOEA 2ZTKA 5H91A 3L5LA 3VE7A 2CZEA 4WUIA 2CLIA 5CPNA 3VCRA 2Y7DA 3HJZA 4DO5A 1K8XA 3KFTA 4XWUA 4UTTA 3I6RA 4O10A 4WZHA 1JCMP 4O11A 3HIJA 4CQAA 3F4NA 4M6PA 1UUMA 5CPOA 2WO5A 5DXYA 3GAYA 4FIRA 3W7GA 5KZEA 3CIWA 5K9XA 3EKZA 3MHGA 2E09A 5HWMA 1QO2A 1D9EA 3BGGA 4DXVA 4ALDA 2GJLA 1K7FA 3L65A 1EP2A 3R89A 1UASA 2VKZG 1X1ZA 2ZZ6A 2PRLA 1SZNA 2YYUA 3LCLA 4MJZA 1VJIA 4U4MA 3I7QA 2ZRWA 1PVNA 3R13A 4TMCA 1K8YA 3DBPA 4XQ6A 3B4UA 4O4VA 3O16A 4HHPA 4XZ9A 4PL1A 3TXVA 4UTHA 3ZFHA 4JTGA 3T40A 3TDFA 2ABBA 5FEPA 3NPUA 4XTDA 5EBUA 2ZYFA 4LRTA 4MPQA 2Y7GA 3TC6A 1H7NA 4JTJA 4ZQPA 1RR2A 3OHIA 3NQ6A 4O0ZA 3W2LA 4UNLA 2P1FA 1QCWA 2GPTA 3OVQA 2C19A 4CNOA 1KM5A 1C9DA 5LNRA 1IF2A 4Z1DA 3MO7A 4YL2A 1FWRA 4IMGA 4N9BA 3IGXA 5G4EA 3BW4A 3UD6A 2F7FA 4L4LA 1NAL1 1MZHA 2OCZA 3DHFA 1RPXA 2WSRA 2Q8LA 1OFOA 1OK4A 4K37A 4LOCA 3LCHA 3VNDA 2QJGA 3QQ0A 4N02A 3TQ0A 3M5VA 1UBSA 4FX8A 1XI3A 3MW7A 1GZGA 1P1XA 4TR9A 4UXDA 1VCVA 5AHEA 3G1VA 2XFWA 3MI3A 1YYAA 3WJXA 1KBIA 4JYEA 1KFEA 2DZVA 1FX6A 4TIMA 5U7SA 1OYAA 1ICSA 1M6JA 2WPBA 3HBLA 4D2JA 3UPWA 1SZFA 2R8WA 2V0TA 1AW5A 3BVJA 1JCYA 3N9RA 4UFLA 3HGJA 4JN6A 3TMLA 1TPUA 3A5VA 2ISSA 3W7EA 3ZS4A 4ORMA 3EWXA 4GE8A 1DQWA 3SI9A 3NZRA 4LVDA 1VCGA 3L0NA 4FXSA 1H7OA 4K8HA 2CLEA 2V8ZA 4O1CA 2G5WA 5E93A 3GAKA 3Q94A 2CWNA 2V5BA 3S8HA 2BLEA 4Q32A 4FNTA 5EY5A 1XKYA 3A23A 1QAPA 1XDLA 4NJIA 3W1AA 5AHLA 2NWRA 3GDKA 5G4WA 3CHVA 2YXGA 4LVAA 1S5VA 2ZZ5A 5C55A 1F76A 3NQFA 4AAJA 4ML9A 5AYYA 1RQEA 3MWAA 3PBVA 2RDUA 3FFSA 4KFNA 3B0PA 1VH7A 1I8JA 2OT0A 2ZDRA 1YLVA 3M1ZA 3R8RA 3ABQA 3RU6A 1HL2A 2VFGA 3LTPA 3M9YA 4MZYA 1FCQA 2Y61A 2ZFAA 2Z0IA 5F2MA 1IXQA 4JX6A 1ME8A 3S1XA 3C52A 4AHPA 1TPDA 2FPYA 5LNUA 4OE7A 1MEWA 4UFJA 4IQLA 2BX7A 4QM1A 1GPWA 3C2VA 2NLIA 4QSHA 3P60A 4KKXA 1A50A 4OV4A 3W1MA 2HS8A 2FDSA 4ADTA 2V2DA 3THQA 2H90A 1ZCOA 2ZTJA 1A5CA 1GYNA 3TC7A 2DU2A 3W76A 3OVRA 4UFHA 1OG0A 2A6LA 2PRHA 3QFEA 3S5NA 5KTLA 1PV8A 1PCKA 4CQ9A 4AB4A 2RKXA 3DFSA 5C2XA 1IXPA 5K4XA 3HB9A 3GXTA 1ADOA 2A85A 4KFOA 4NU7A 3W2NA 2E1DA 2C16A 3G22A 4BR1A 2BWGA 4QNEA 1FXPA 1ICQA 3IVUA 4UIOA 4DPQA 1B9BA 1Q6OA 4XBSA 3PG8A 4TU1A 3UWQA 5LNWA 1PE1A 2WNNA 1K3UA 1TTIA 4PL2A 3G1HA 1EA0A 1YDNA 2YPIA 1G4PA 3E12A 1GVSA 3O15A 2FJKA 1EUAA 3GB6A 3NL5A 3PAJA 4GJ1A 4NX0A 5DCDA 3TFXA 1XM3A 3MI6A 1BWKA 5CKSA 1I2OA 3Q2DA 5DCEA 4NUWA 2CW6A 5FI8A 3W3OA 3LX9A 3W7NA 4LVFA 4MYAA 4Q33A 4ONVA 4HKPA 5AYZA 3P80A 3UXAA 1OX4B 5G1YA 3O6YX 4GUGA 5IBXA 1SW3A 4JDBA 2B4GA 3W1XA 1I2QA 4YCOA 2DZXA 2HTMA 3NQMA 1ZNNA 2E5BA 2H6RA 2JK2A 3TKFA 1VGAA 1OF8A 4DQWA 3TJXA 2QAFA 4O1AA 3W7QA 3RF9A 3NL2A 1ZJIA 3M43A 4O13A 3SY5A 3B03A 3BG3A 3W7KA 1G7UA 3IVSA 3V1PA 1TPC1 3NPVA 4ZQRA 4WXZA 3TIMA 3EXTA 4LT9A 1W1ZA 1SR9A 3PBYA 5LNVA 3OVPA 3W85A 2VOMA 2AAMA 2Y70A 3RFAA 1KFLA 5CPLA 3AO0A 1K8ZA 3MUXA 5AHNA 1TMHA 3W71A 4P2VA 3EWZA 4S2BA 1XBVA 5AOUA 2R94A 3SGUA 1QPOA 3KXQA 3W7IA 2IQTA 3GDLA 1LRNA 5DBUA 3GIYA 3P62A 2PE4A 5A8GA 2QUTA 3MJYA 2EKCA 5BOOA 5AHFA 5FF4A 2R14A 1D3GA 1JRBA 2WV8A 2YDAA 3BARA 1HO1A 1YDOA 2Y6ZA 2NXIA 4M6QA 4FX7A 3NA8A 1R30A 4UR8A 2E6YA 3O05A 1WBJA 2V30A 3CQ0A 4TX9A 4UTUA 3H54A 1OJXA 3F4WA 1KV5A 5K4ZA 3IGSA 1AW1A 4MFDA 3PS7A 1JUBA 1FWWA 3A21A 3TW6A 2JGYA 1FUYA 3P74A 2I9EA 3UPBA 3DAQA 3BLFA 2A7NA 1SZGA 3N9SA 4UMBA 5DBTA 1N7KA 5J5RA 1TIMA 4EVZA 1HG3A 2V5LA 4O4WA 3UZJA 4JTIA 2VFEA 3FJLA 1XL9A 4TO8A 1LP6A 2A7RA 4RZ5A 1W56A 2BTMA 2QCDA 3QEZA 1U5JA 1RZMA 4RR4A 4HNUA 1QPRA 2J6XA 4CCEA 2DZUA 4JICA 2Q8ZA 3HGOA 3EKLA 2KZHA 5EMUA 5I3IA 4WY0F 1KM2A 3DKJA 3O8AA 2E6DA 4OT7A 4IGHA 1IGSA 3T44A 1TRDA 4IMEA 1B3OA 3PM6A 4OU1A 5D05A 1TPVA 1DBTA 5K9DA 3PY2A 3VE9A 2A4AA 2QUUA 1EPXA 4JD4A 3OG3A 3QYQA 1WYIA 3UQNA 3DFPA 2GVLA 3TFCA 1VZWA 2E6FA 1R2TA 1XCFA 2C15A 2EPHA 4NJKA 5CZTA 1VS1A 2CLFA 2P0OA 2QDGA 3DKLA 4R34A 3N2MA 3DGRA 1XBYA 3C2EA 4HT3A 1FY6A 1B4KA 1KLYA 1XFBA 1JQXA 3TA6A 4G1KA 3LI0A 5AYXA 1MXSA 2V2CA 3GNDA 4UC5A 4LVGA 3M5YA 3PUEA 2QCMA 3ATYA 3TSMA 3KRUA 3LXAA 1GEQA 5DY3A 3QMSA 2O7QA 3W87A 3HO8A 4RX0A 2QR6A 2ZZ2A 3QSRA 3KVJA 1IXOA 2ZRXA 2Y7EA 3MBFA 4Z0SA 2Y62A 1H1YA 3QZEA 1QWGA 3SECA 4K8EA 5F4SA 4AWTA 1LOQA 3W7JA 2ZZ1A 2P10A 2W6RA 1F73A 2FLIA 2ZRZA 5HUPA 3EX2A 3MP5A 1I45A 4QNWA 1FWSA 4O12A 4UTJA 5K7JA 4IX0A 4NJJA 1UUOA 2FPTA 3IIOA 5CSRA 3NG3A 3INPA 1A5BA 2NV1A 3NPXA 3FLUA 1A53A 2A21A 1JCJA 1GVFA 4UCGA 5F1VA 3PC0A 3ATZA 3N19B 2CU0A 1LOSA 2YSWA 1SFLA 1L2UA 1RVGA 1P0NA 2Q3OA 4FNQA 3TSBA 1YADA 1F6PA 3PUOA 3CEPA 1AK5A 4Y8FA 1SPQA 4GFSA 1KV8A 3CTLA 2H3DA 1TV8A 3EXRA 1O4UA 3MMTA 2WOQA 1KA9F 1EP3A 3FKKA 5CPMA 1VLWA 2ATMA 3EB2A 2VEIA 5FEXA 3TQKA 1EB3A 2HSAA 4LUJA 2QCCA 4UNKA 2J9XA 3W86A 4Y6GA 2Y85A 4WY0A 3M7WA 1NF0A 3FYOA 2NXHA 1G6CA 5A5WA 4MFEA 5DCBA 3L5MA 3IIVA 4O28A 4JEQA 1Z44A 3GDTA 2C18A 2BZNA 3UY7A 4EF8A 3NDOA 4I9AA 3NEVA 3K30A 5I3GA 1J5TA 1HFBA 1MEIA 3DH7A 3UWYA 4ZVJA 3G1FA 2X1RA 5KSWA 4BFAA 1FCVA 3W1LA 3NZ1A 4PEKA 4Z08A 4FX6M 2EF9A 1DOSA 1JCLA 1SUXA 1EX5A 3DI0A 4UFIA 1L6WA 4M6VA 4NNBA 1M5WA 1TPB1 3W1QA 1QNVA 3NYZA 4E2DA 1TQXA 3W2KA 3PBWA 3W7HA 3E96A 1S5TA 4K7VA 4HSNA 3LCGA 2C14A 1I2PA 3AJXA 2GVGA 2JKPA 3A22A 5SWUA 2EGZA 4O1BA 1F05A 2NUWA 3U2OA 3W7OA 5G2HA 2B7NA 3C0JA 4MYXA 3DI1A 1D3HA 5C54A 4IUOA 4GWEA 4FEZA 3C56A 3C2OA 4JY9A 4KFPA 1OFBA 4QAIA 5KINA 1TV7A 4O0KA 4DEFA 4KWVA 4M7TA 1O95A 2C6QA 4N9CA 3W75A 1VLIA 1WXJA 3EWWA 4BF9A 5TQLA 3PUDA 3CWNA 3GYEA 2DORA 3NO5A 3UY8A 5KITA 4PODA 4N2YA 4POCA 1EEPA 1LBMA 3LLDA 4UTTC 1SW7A 4HNNA 3G0XA 1OFQA 2ZRVA 4PC8A 2WNZA 1OYCA 2FPVA 3ANYA 1TYGA 1ICPA 4FNPA 3LB0A 2GVJA 1F2JA 2YR1A 3HPZA 5HMSA 4GUIA 3W7PA 4GUJA 4NXKA 5D2WA 4MY9A 4YCPA 4RCXA 3R5EA 3N2XA 1NFBA 4JIPA 1H60A 3LRLA 1ME9A 4LU0A 2Y88A 2QCLA 1LTDA 4EIVA 4O19A 1JUKA 3W88A 3STGA 3KOFA 4JTSA 3O06A 2FB2A 3BPWA 4MLJA 3SFKA 1Q45A 2QF7A 1G67A 1NSJA 3TK7A 3P8IA 1I2RA 2B7PA 2W0UA 4QITA 4IWWA 5HWJA 2YW4A 3NQ2A 1XBZA 2BXVA 3W72A 3NNTA 4CCCA 3QF0A 4MIMA 1JULA 2JKEA 2NUXA 3FEMA 2G97A 3UXDA 4JTUA 2V2HA 1PS9A 3PR2A 3W1TA 3LHUA 3QW3A 3LCIA 3WFAA 5BNKA 3FOKA 1SSDA 4CNNA 1F5ZA 1HO4A 2GOUA 2E77A 2C1HA 2YFOA 3C2RA 1BWLA 4LVBA 1DJNA 4WQ6A 4I7UA 3NQGA 3LRKA 4UTWC 1M7OA 4CQ8A 3E49A 3GVGA 3KHJA 4MZ8A 3NQ8A 1OHLA 5CGQA 2J88A 1LZOA 1ZY9A 3BK0A 3G1AA 3NAVA 3UYCA 3TNOA 4NNCA 1K7XA 4LS1A 1H7XA 4CCDA 5G2WA 1KTBA 1TJRA 1GWJA 3R12A 1LM1A 4S1FA 5C6MA 6ALDA 7TIMA 3IIPA 4GBUA 2OZ0A 3G0SA 4O57A 1W0MA 4HNTA 4ZQCA 2JKAA 3W7DA 4H4IA 2VXNA 2FTPA 4Z1CA 3NQCA 3LXBA 1TREA 3PBUA 4BI6A 2X1SA 1ZAIA 2NX3A 1YTEA 1VC4A 3W07A 3GKAA 2VFHA 5TBOA 4GUHA 1KFCA 1SZEA 3NL6A 1QOPA 1KW1A 4O50A 3DFTA 5CSSA 2GQ9A 3BW3A 4WX2A 1Q6QA 1Q3NA 3ABSA 3HPXA 3W1RA 1Y0EA 1ZAHA 1F6KA 5G5IA 1PIIA 4E38A 2YFNA 3WK1A 3SIZA 4UMCA 1SU5A 3PVFA 2VFFA 4O16A 1OYBA 1YTKA 3W83A 2A7PA 2PCQA 3TAKA 4PH6A 5C5YA 4FO4A 1XUUA 1IXNA 1YPFA 1KFKA 3PG9A 3T7VA 1TPH1 3E0IA 3NQDA 4ADUA 4K36A 3MP3A 3TAOA 2G95A 2CLMA 2VEPA 4R53A 2TPSA 2NXGA 4R33A 3W2JA 4N4QA 5BRBA 2X30A 1VR6A 1NEYA 1QR7A 2EHHA 4WJEA 1V5XA 3S1VA 1TPWA 4PTNA 3SZ8A 1TQJA 1HTIA 1VCFA 1SW0A 1O94A 4EOUA 1H7PA 2OT1A 2A0NA 5LGZA 5AHMA 3OBKA 5G1TA 4RZ4A 1KM0A 1TTJA 2NX9A 5FF3A 3SGZA 5BMXA 5D2TA 1MO0A 2VEMA 3LHTA 3LRMA 3NQ7A 4BI7A 3WK2A 4FB7A 2C0AA 1JVNA 3QRHA 3HG4A 4YWIA 1H61A 1G4EA 3FJ6A 2FFCA 3A5FA 3IRDA 4JYDA 1DHPA 4I7VA 3GDRA 3BG5A 4LY8A 5DXXA 4XTIA 5FF7A 3QPZA 3W2MA 1XBXA 4MVAA 5F2LA 1JQVA 2TSYA 3PF3A 2UV8G 4YXGA 1ML1A 4A3UA 1X1OA 3M44A 4JX4A 2NWSA 2GJNA 4UUIA 1WA3A 3N34A 1K03A 1A5AA 1P4CA 4H6KA 4O53A 2QAPA 1LORA 1XUZA 3CLMA 3S42A 2ZRUA 4AWSA 4P61A 1QOQA 3S5ZA 5EA9A 1Q6RA 1NVMA 3R2GA 5CZSA 3LM7A 1GJPA 4GNJA 4BK9A 1LBFA 3BGJA 4OHQA 5CG7A 2ZBTA 3Q37A 3PB2A 2I14A 1YXDA 1E51A 1TPEA 2ATSA 1BKSA 3EX4A 4AVFA 2ZRYA 3I7RA 1THFD 4ICNA 4MLRA 4XKYB 4AF0B 5KZMA 4RXGA 3CPRA 4J9JA 3HGRA 1OFAA 3S5OA 1XC4A 4IXHA 1GYLA 2ZZ7A 1FDYA 5HNRA 3QPYA 1ZENA 5FESA 4RJEA 3M0ZA 1YDVA 3UNDA 2EAWA 4DO4A 2ZZ4A 1TTPA 3FIGA 2CLLA 3WK0A 3PSVA 3IV3A 1NF7A 5EKYA 4RK8A 3LHYA 1XDMA 1QDSA 2R91A 4LV4A 2QCHA 1KBJA 1W8SA 4LW7A 4JTEA 4MY1A 1H5YA 2A5HA 5FF2A 4KWWA 2RHGA 3LXCA 1EP1A 1Z48A 3W6YA 1BTMA 3CC1A 3LOTA 3SJ3A 2AGKA 4Y96A 5HUOA 4NJGA 3B05A 4A2RA 5HJLA 3L0GA 3IIXA 3FS2A 4PFMA 1OX4A 2NV2A 3OEXA 2WJZA 3NQEA 2X1UA 1W3NA 5DY2A 3ZR4A 4UTLA 2DJLA 3O07A
chains in the Genus database with same CATH superfamily
2XH0A 1JDCA 2YDSA 1ECQA 4TVDA 1OEPA 1BF6A 1Q7ZA 4XAZA 3WQDA 4Z2HA 4JIQA 2GZXA 2J4GA 1GCYA 3LHVA 1PXGA 2LLEA 2WQDA 4HOXA 5IFPA 4WEVX 2BY0A 1XSKA 1FCUA 4DBWA 2PLJA 1XLLA 1IIHA 3ZQ9A 3RR1A 2V69A 1QMLA 1QUMA 3QQWA 3U2ZA 1S46A 1CW2A 4CD4A 1LRTA 1UCWA 4K8GA 1OVDA 3UWVA 3DN5A 1GORA 1XR2A 3M5XA 5HPCA 2W61A 3BOXA 6CGTA 3S5YA 4L64A 2VC5A 1BVZA 1FFRA 1LBLA 3MCOA 3GXFA 1SO4A 4IJBA 2X16A 3RHGA 4E0CA 3DIPA 4DO6A 1WQ5A 1O7AA 4BWLC 2WM0A 4DELA 2XVPA 3SUSA 3O9NA 4W87A 1OABA 1IWBA 3DXIA 3TCEA 4MWAD 1A5SA 1UOZA 5TIMA 1WP6A 5U4NA 3AXIA 1T96A 1EUNA 4E4UA 5F1UA 3M6YA 3VKKA 2VT0A 4JTTA 1EIBA 4IIDA 4M1RA 2OKTA 2I57A 2CLOA 2OYLA 2MUCA 3N3MA 1H0GA 1H62A 3VKJA 1NWRA 1WX0A 1EJWC 4DNHA 2HMCA 1WKYA 4PCFA 2EPOA 4P7RA 2VELA 3STCA 3BGAA 4UQAA 3B8DA 3VTRA 4OTKA 2E6AA 1FWGC 5MF5A 3VABA 3DECA 5E0FA 2PPGA 3MYOA 1ELSA 4OUEA 3GFXA 3ENLA 3SQMA 1JL8A 3I6TA 1L8NA 4O17A 3CUJA 2QUMA 4NHVA 3FVMA 2VRQA 4GG9A 2J7CA 3EWBX 4B92A 2PZNA 3VDGA 1LDCA 1RBLA 2O9RA 1RVKA 2QCGA 3GNOA 4V33A 1BRLA 1TA3A 4JPGA 2DY3A 1V08A 4GXWA 4NZCA 2VCBA 1AL7A 1S38A 1RY8A 2OOGA 4ZO9A 4PUMA 3ZVHB 4NP7A 4IF2A 2W79A 4P8VA 3AIQA 3BCFA 3LCWA 3N17A 1HUVA 5A69A 1EWEA 2WMKA 4MOZA 3GBDA 3GX9A 3W7RA 4W89A 4NYYA 5C2CA 3OP2A 1E40A 4JL2A 1HJWA 3ARYA 1FCBA 5D33A 2ZXDA 2CFFA 2H3BA 1KTCA 2PGRA 1XISA 3UWUA 2DT1A 1VJSA 1E1EA 1P0EA 1YE4A 1E3XA 3E38A 4V27A 3E0LA 3RPMA 4X63A 3T6CA 1HKWA 3P14A 3IGUA 1Z7AA 2WJEA 3N29A 1XSJA 3NPWA 4UTWA 1SFJA 1JZ3A 3IANA 3QZAA 3GG7A 1SQ7A 5C71A 4Q8PA 1EJTC 2FFIA 1Z41A 3BAYA 9RUBA 3OHMB 3NWRA 4JKLA 2WMFA 1ZBWA 3TW7A 1F61A 2VEKA 2E9MA 1UR3M 3GLCA 3T1GA 1GUVA 3PULA 2ZIDA 3EX3A 1XXXA 3P2VA 1H63A 4H8NA 5D02A 3LV5A 2FZNA 1IE7C 1UIPA 3P5ZA 5AC8A 3J7HA 5FL0A 2ZA2A 3RGTA 1B31A 3C0SA 1CNVA 1UWTA 2NZLA 5F4XA 3LI1A 3B06A 1FXQA 3HG5A 1ISXA 5I5RA 4QJ1A 1Q6LA 1SSGA 3GH5A 2QCEA 3KVLA 3L9CA 3TXZA 3P7YA 1XRSA 3BMVA 1C3FA 5HQEA 4X22A 1OGGA 1EYEA 1W5MA 1WDWA 2DZTA 2WCGA 3BLEA 1EHAA 2P8CA 3UPMA 3A9IA 3TROA 4LAUA 2NVCA 2PURA 1T8QA 1WZAA 3WNKA 1VHNA 1IQ8A 3WDIA 1R9XA 2XJ7A 4EANA 1K9FA 1SMAA 2NT0A 5CC3A 1IEXA 4L6HA 4MY8A 1KQZA 1P43A 5I07A 2OMAA 1L6FA 3FGCA 4LS2A 3NL3A 1HGWA 2CZ5A 3PPHA 3G1DA 1GTHA 4CNTA 4O18A 3G8EA 3JRKA 1X6UA 2W67A 2GJPA 1L6GA 1TPFA 4B5UA 2J78A 1ALDA 4FR6A 3T09A 1F3TA 1KGXA 1OCBA 4C6OA 1RA0A 1AL8A 3TW9A 4MAZA 2X0HA 3GNNA 1G4TA 1R47A 3TTOA 4EK7A 4QP0A 1GOKA 1QPQA 3VKDA 2AL2A 2BBFA 1YEYA 1JYNA 4GH1A 1KLZA 4FR1A 4QS6A 4PMXA 1WPCA 5A8PA 3TTEA 2CXEA 3NVTA 3W7LA 7ODCA 1P6CA 3T0TA 1RD5A 3DFHA 2YL9A 2Z2BA 4R27A 4GH3A 1JNDA 3G18A 2D22A 4ZQNA 2DJXA 3BC9A 4EF9A 5F2GA 1F8MA 4RV8A 2X8RA 1ADDA 1RV8A 3CEUA 4NT0A 4IOTA 1Z89A 5DMNA 3WELA 3CZJA 4LNYA 1OFPA 3N6HA 4MDOA 1LOLA 1BVNP 3BZJA 1XLBA 3H12A 1UW9A 2OLHA 4L6OA 3H23A 1ZHAA 3MBDA 2CLHA 1GOIA 5M17A 1JZ2A 1A47A 3N2CA 1RD6A 2OX1A 3OQEA 3NDZA 2WZEA 4B15A 1CB7B 2OWXA 3NXFA 3O2LA 2ZICA 2GSEA 2KAUC 3FHAA 1UP0A 4AYGA 1DE6A 3S9IA 4Y9PA 2UY4A 4UOQA 4D9PA 2PCEA 3CHDA 3CT2A 1QK0A 2E1WA 4TXEA 2VFDA 1XYLA 2UBPC 2QKFA 2R1NA 4IXXA 2HVMA 1TWIA 2P88A 1R6WA 5A2CA 2PTYA 1M41A 4IISA 1R3QA 3RX3A 1WNOA 1P0BA 3UWWA 4IQDA 3QW4B 1QBBA 1JYVA 3SR7A 2QMKA 3Q58A 4AVOA 4FXRA 1J6OA 2RDTA 1LLWA 4XAGA 2HNHA 3WQ4A 1VEOA 3FY1A 3SB0A 1U1UA 5HJYA 2Z28A 3RLHA 4Z1AA 4N6FA 3NO1A 4J27A 2DZAA 2DT2A 1V3JA 2OQHA 1Z8AA 3VNMA 2VR4A 1WV2A 3CTTA 2PS2A 1XRFA 3FKRA 2RGMA 4JY8A 2BSLA 5LKYA 1IR2A 4U3CA 1JCTA 4JXCA 4R9XA 2V5CA 4PMJA 2BVTA 4NG3A 9XIAA 3VU2A 5L9FA 2GOKA 5IBXC 1Z6KA 2EJAA 4PA8A 1LL4A 4BWLA 3P81A 1RP8A 1VPXA 3HF3A 2XH7A 2NX1A 5BW6A 4HU8A 3R25A 4ACZA 3GKFA 2QJIA 4Y9MA 5I3FA 1C8VA 4AZ5A 3KBWA 3V35A 4IFOA 4D6EA 7REQA 1DEDA 3MVTA 4W9TA 4LV9A 4AMAA 2G0WA 4HPGA 4B5TA 2C1IA 2UZ9A 2Z2UA 4LALA 2O56A 1TIWA 2E67A 3NQAA 3QC3A 4WGHA 3S2JA 3WEMA 3EA1A 1F07A 2AKZA 3ABRA 4UTMA 2CHOA 1EGVA 4UFMA 1ESWA 3I10A 2WNQA 1KTNA 4UQBA 1PHQA 1C29A 3H7RA 2VZVA 2PDPA 2ICSA 3GTNA 5BMWA 5F2IA 5I3HA 1PIGA 3T08A 2TYSA 3CZKA 4GI8A 1FHLA 1OK6A 3MHFA 3CO4A 3NM1A 5FEWA 5KETA 2WANA 4AF0A 3LNMA 3MUAA 5G2IA 2GJXA 5D32A 3S3GA 4JR5A 4HU0A 4X0NA 4R85A 4M24A 3WUEA 3U2EA 2BOEX 4HYWA 3DOPA 1DXIA 1UJPA 1FDJA 4LUIA 1XRTA 3QR1A 3CM4A 4Q4KA 3WLKX 2FGZA 2DW7A 5EMJA 5D04C 4MHBA 4S23A 1PTAA 2NQHA 3T78A 4P7OA 3EPNA 1LT7A 4AD3A 1ZZMA 2DDXA 3LTSA 4ADSA 4XX6A 1F9CA 4DO7A 4NJHA 4XZLX 2V81A 3FDKA 3L5LA 2CZEA 2BVWA 2YBUA 3RDKA 4XSLA 1K8XA 2DV0A 3AZSA 3KFTA 4J5NA 3I6RA 4O10A 4S3KA 4O11A 1ADSA 1J79A 2YCIX 1OD8A 4JFWA 1UUMA 2J7BA 5GJPA 5DXYA 4FIRA 3W7GA 3C2YA 1X6NA 3CIWA 1UP3A 2HWGA 4CN6A 1D9EA 4C1NA 2CBIA 4ALDA 3L65A 1EP2A 3R89A 3NOYA 2VKZG 4XBJA 3PJUA 4L9YA 3CLWA 2YYUA 5CC7A 4AXNA 1JGIA 1TUXA 3R13A 2X40A 3CO8A 1MZRA 3O16A 4XZ9A 3G6LA 5CSUA 4UTHA 2ADAA 3VKAA 4CN1A 2ABBA 1EJUC 4ZE5A 5FEPA 4Z2KA 5EBUA 1OD0A 2OSYA 1JF6A 1EFZA 1BAGA 4O1EA 4C6NA 1QCWA 2GPTA 4MADA 3EDDA 2Z7GA 2W91A 6XIAA 2JALA 4XZIA 5LNRA 3SUUA 2X7WA 3R58A 3MO7A 1R3VA 4YL2A 3A4AA 3N4EA 1WUEA 3UD6A 1QW7A 3TTSA 5M1TA 2D0FA 3KTSA 4LAMA 3T2PA 1MZHA 1E9IA 3T8QA 2WSRA 1OK4A 2XISA 2EBNA 3LCHA 3VNDA 3BJSA 3QQ0A 1JIBA 1I1WA 3M5VA 1B90A 1Y65A 1XGZA 1Q8JA 1CZ1A 4IQJA 4DJFA 1OY0A 3NCOA 2XFWA 3AMGA 4XZNX 1KBIA 1I75A 1ITUA 4XZBA 1OT2A 1KCKA 4HHLA 2WC4A 1FX6A 4OVXA 4D2JA 3HMCA 3UPWA 4Z17A 1SZFA 2V0TA 4JN6A 4JHMA 5T9CE 2GVEA 1WDQA 3W7EA 2ACUA 4ORMA 4GE8A 2CITA 3E0WA 4UNIA 3K13A 2AMXA 1JI1A 2J7HA 3B9EA 2OSWA 1H7OA 3ZVHA 2V8ZA 1CXLA 1V02A 4B16A 1R3RA 3FX4A 5EY5A 3OIHA 3CMFA 1XKYA 1XDLA 4ICMA 2OYKA 1V0MA 4AD5A 5G4WA 2YLLA 4L4PA 4LYPA 3MPGA 2ZZ5A 3NQFA 3VIKA 5CPTA 2JIEA 4DYKA 4LUTB 2A3LA 2EG7A 1CENA 2WHJA 1N82A 3B0PA 1VH7A 4UOJA 1YLVA 5EGRA 3ME3A 3JUGA 5C9UA 2VFGA 4QBXA 4K3ZA 2NQ9A 3RN6A 1HP4A 1IXQA 3BLPX 3S1XA 3SDOA 3O0FA 4AHPA 3OZMA 2FPYA 4GJJA 3KUMA 1QATA 4RE0A 5DEZA 2BX7A 3VOIA 1V6UA 2C7FA 4QSHA 4E3VA 3W1MA 1O1HA 1KB3A 1QNRA 3GRIA 4B5VA 1XHGA 4HB7A 4UFHA 1OG0A 1UPPA 4NAEB 2WMJA 4HZMA 3B8VA 1WZMA 5B80A 4CQ9A 4FOKA 3VGBA 1IXPA 3HB9A 1ADOA 4NU7A 1DTUA 1R7AA 2Z1VA 3QVQA 4UIOA 2HZGA 4GY0A 4XBSA 5EMLA 3MSGA 1HXJA 5JIPA 2HV5A 3FCPA 1GYMA 1G4PA 3F7JA 2BGNE 3QXBA 1GVSA 4TTUA 4GJ1A 4NX0A 1NDYA 2W66A 3TFXA 1XM3A 1MXDA 3Q2DA 2QDDA 2ANUA 5H1WA 3BXWA 3BCDA 2DVUA 5A6BD 4YYCA 1ZTVA 3OBAA 4MYAA 1QHPA 3IPWA 2FVMA 5EMYA 4F8XA 2EKGA 3LPPA 1OX4B 2YBTA 5IBXA 4M56A 2XZ9A 2Y24A 3ZT6A 2VYOA 3W1XA 1V6XA 4WGXA 4IFKB 4UQEA 3BCJA 4V1XA 4DB7A 2F38A 3V18A 4DX3A 3W7QA 3CHCA 3ABXA 3NL2A 3NXLA 4ZB2A 3OGRA 3M43A 1CCWB 3B03A 1G7UA 1IGWA 3V1PA 2GGGA 1TPC1 3NPVA 2AL1A 4LUYA 3TIMA 1ZGDA 3B8SA 3EXTA 2POZA 2NSOA 1SR9A 3W85A 3HN3A 2AAMA 1GOWA 2WVUA 3AO0A 4ACYA 1VEMA 1UZ1A 1K8ZA 3MUXA 3TC3A 3TP4A 3UWEA 5AOUA 2R94A 3QOMA 1QPOA 3GDLA 1LRNA 4N0RA 3EOUA 2DSWA 3MJYA 2G4FA 4TX8A 5FF4A 1ECEA 2DUZA 2Y8VA 4KT2A 3OG2A 3A47A 4L7ZA 3NA8A 1WBJA 2V30A 5TD4A 1EQPA 3EMQA 3N2BA 3AMKA 3PS7A 4TV6A 3A21A 3TW6A 2HXTA 3G2GA 3UPBA 2I56A 3DAQA 3PZGA 1AFSA 1SZGA 3N9SA 5J5RA 1PZ3A 2VX7A 1HG3A 3UNTA 1QNOA 4Z42C 2DEPA 4JTIA 1XL9A 5A3HA 4MM1A 4AMCA 3WD4A 2E8YA 2E25A 2DZUA 3WL0A 4C6BA 2FTYA 3CQJA 2E6DA 4OT7A 3WN6A 4GMEA 1YQ2A 1IGSA 4WDUA 4P5UA 4IMEA 4OU1A 4I5RA 3ID7A 2QULA 4P8WA 1ZSXA 3VE9A 2FHFA 4INFA 1EPXA 3OLEA 3QYQA 3N04A 3SCRA 5C7HA 2GVLA 3AROA 4PTVA 2WMIB 2C15A 2DW6A 3GIPA 4CVWA 4Y7EA 5CZTA 1OCNA 1VS1A 1GOMA 1TV4A 2CLFA 3BANA 2QDGA 3CAQA 4MWAE 2VC9A 1ZBVA 3C2EA 2VNCA 3M0MA 3WZ0E 4JFVA 1MXSA 2V2CA 3GNDA 3TN5A 5H8UA 3D47A 3PUEA 1ZRQA 2EG6A 2ZVIA 3II1A 3LXAA 1GEQA 3KBMA 3IV8A 1UZ4A 1UR1A 3PAOA 2O7QA 1NDVA 4RX0A 1GK8A 2ZZ2A 2Y7EA 3MBFA 4HPHA 3CZ8A 2QF8A 1QWGA 4K8EA 1VBRA 1KXQA 3CL8A 2W6RA 2D1ZA 3K4WA 1F73A 2FLIA 3MP5A 3GQYA 3B8TA 4QNWA 4O12A 1UUOA 3NG3A 5ECVA 3STPA 1A5BA 2YL6A 1A53A 3HV9A 2A21A 1GVFA 3R11A 4UCGA 5F1VA 3PC0A 2WXDM 4KIRA 3ATZA 2CU0A 1LOSA 1UH3A 5M5DA 1RVGA 1P0NA 4AZ6A 1CGTA 1F6PA 4CEXC 3KZSA 1XLFA 1HIZA 3UG3A 1BYCA 2WHLA 5AZ1A 3WNPA 1S2AA 1TWZA 3G5EA 4MB1A 1MFVA 1JAKA 4H6QA 2X2YA 2WLYA 2FJUB 3ZZ1A 1TJ0A 3SRFA 4ZOCA 1Q2RA 5CXPA 3VPLA 2NXHA 3L5MA 3GO2A 4O28A 4LANA 4ZENA 2G8ZA 2IQDA 2BZNA 5CC5A 4D1IA 3NEVA 1DPMA 2PTWA 4ZVJA 4BFAA 4PEKA 4DWSD 4FX6M 2GSJA 1DOSA 1JCLA 1EX5A 4UFIA 4NNBA 2YCLB 3W02A 1M5WA 2OSXA 1TPB1 1H2JA 2DSVA 4MNKA 3W1QA 1JDEA 4C6JA 3D3AA 3NYZA 3O0KA 1XD1A 3PBWA 4A4AA 5HAOA 3H26A 3LCGA 2HEJA 3AHXA 1XCXA 3S2LA 2EGZA 4H9VA 3U2OA 3M0VA 1X97A 3C0JA 3OTRA 3GC5A 2YL5A 3DI1A 3EWDA 1XYBA 4KFPA 3N18A 3C2OA 3WX7A 3KOYA 5LA0A 4JOMA 4U5KA 4WDWA 4O0KA 1Q2SA 1NDZA 4M7TA 4N9CA 3W75A 2YA1A 4URIA 1WXJA 4BF9A 2RUSA 2YLAA 1PDZA 2JEPA 3CWNA 4CU7A 3NO5A 3UY8A 2WSPA 3HM7A 1GEHA 2P8BA 4N2YA 3CH9A 4KEUA 3LLDA 2BP1A 4M81A 2I5IA 5E70A 4O8AA 3MANA 1UD5A 3ZO9A 2FPVA 1ICPA 4E4FA 1XSIA 3WLQA 4YVPA 4CD5A 1GW1A 1YIXA 1GKPA 4US5A 4H01A 5IDIA 5BRQA 4PRWA 4RCXA 3R5EA 1D7KA 3U4FA 2VDGA 3N2XA 3C8NA 1LTDA 3W88A 1HJUA 2FB2A 3FSUA 4LCSA 4KRZA 1J96A 1BSIA 1G67A 4EPBC 4C90A 2B7PA 2YJQA 2E4TA 1RJQA 3VFCA 1PSCA 3NQ2A 1XBZA 2BXVA 4ML4A 2DIEA 1BYBA 1UR4A 3E0VA 1CTNA 3W72A 3NNTA 4C5YA 3QF0A 4PB5A 2JKEA 2NUXA 4JTUA 4E8GA 1VD6A 2HISA 1N8WA 1TZ7A 4Q6XA 4Z2IA 3T81A 4IP5A 3WFAA 2P5NA 5BNKA 4WCJA 4CNNA 1CLXA 4R7WA 2C1HA 4E6MA 1KNWA 3LRKA 3E49A 1UC4A 5CGQA 2J88A 1DWHM 5GNZA 3WH8A 2J7FA 4N7QA 1VENA 4B91A 3G1AA 4RNIA 4LS1A 3OZYA 3LY0A 2D24A 3CPGA 3ITYA 1GWJA 2VCAA 3R12A 4S1FA 6ALDA 1T41A 2OZ0A 5LXEA 4I9MA 5CBJA 4XO7A 1QI2A 4UCFA 4ZQCA 1U33A 3L4TA 4NZ3A 3RRAA 4Z1CA 2PWGA 3PBUA 1W3JA 3HU7A 5ABEA 4F0MA 1VC4A 4GUHA 1SZEA 2XWEA 7CGTA 4O50A 3SADA 1RHCA 3DFTA 1NWTA 3BJFA 1YE6A 3HFTA 1Q3NA 3HPXA 3IJQA 1WUFA 3CZGA 1BXBA 2BGSA 5I7GA 4AUBA 2OEMA 2VFFA 4ENLA 1XIDA 1GQJA 4JL1A 3TYDA 3B9AA 1XUUA 5A2AA 4D8AA 1KFKA 3PG9A 5HK4A 4GX9A 4ADUA 3MP3A 5BROA 3WBYA 4MWAB 4LB3A 1US3A 2PU0A 3B4YA 3MT1A 1V5XA 4GQ0A 2AKMA 3QLDA 1HTIA 3VILA 1VCFA 1U30A 4FZIA 4KS0A 1XIIA 1H7PA 1IEWA 3EEZA 5LGZA 2J74A 5A94A 3OBKA 1XLKA 1KM0A 5FF3A 5BMXA 5REQB 3LRMA 3V16A 1POKA 1XYCA 8XIAA 3QRHA 4YWIA 1GJWA 4JYDA 4LY8A 3GDRA 3BG5A 3UXLA 5FF7A 5M2FX 3H7UA 3W2MA 4LUTA 1JQVA 2PD9A 1TX2A 1EJSC 2PAJA 1VFTA 1VJZA 5JH2A 1H09A 2OYMA 2UV8G 1ML1A 3IUHA 1ENUA 4W5UA 3GH7A 4CQBA 3M44A 4JX4A 4UUIA 1EQCA 3ZR6A 1SR0A 4GX8A 4H6KA 3N1AA 1KRBC 2GJRA 2J79A 5HANA 3WLNA 3RO6A 2IUZA 5T8GA 5EA9A 1UHVA 3BL3A 2WW5A 2R6OA 3P0XA 1EBHA 1XG4A 2I16A 5CZSA 3LM7A 4GNJA 4PBGA 4RV3A 2ZC1A 2CERA 3B8IA 3PB2A 3AIRA 3ZOAA 2I14A 1YXDA 4WDTA 1E51A 1TPEA 1W3HA 4AC1X 1XYMA 4UWMA 3PN8A 4J3UA 1PYMA 3I7RA 3GHUA 3N12A 1US0A 4RDVA 3ZVIA 1THFD 1XX1A 4MLRA 5KZMA 3CZEA 4MMWA 2WWCA 4MNJA 1XC4A 3OOQA 2YL8A 4XB3A 3UJEA 1ZENA 1WXZA 1YDVA 4ERIA 4YTTA 2FKPA 3AHTA 1TTPA 4J28A 4OOZA 1EDQA 3R10A 5EKYA 3UFYA 2R91A 1JPMA 3EYPA 2QCHA 1UIOA 2OZ8A 1ITXA 1XQKA 4AG0A 1H5YA 5FF2A 2RHGA 1X7IA 3CMJA 3A3XA 2D0GA 5HUOA 1RSCA 3B05A 5HJLA 5EU9A 1TE1A 2VD8A 1H41A 1OX4A 3KCLA 3OEXA 2NSXA 2OGYA 1I6NA 3IJ6A 1W3NA 5DY2A 1A0CA 4IJRA 3AU2A 3ZR4A 4ZO8A 3F5LA 2EXOA 4IFKA 1CECA 1KFWA 4CGTA 2XU2A 2J24A 2PBGA 2QCNA 1ONEA 1ZJBA 3W24A 2C8NA 2G37A 1CEOA 4PMYA 4WJ8A 4QTGA 5XIMA 4R7OA 5MHBA 3KWSA 1D8CA 4DBUA 3AI0A 3IVTA 3QH2A 4FAMA 5D30A 4IJCA 2WKJA 1M7JA 4PMVA 4X3ZA 3LGGA 1ZPTA 2PGFA 3SJNA 3NUKA 1MXGA 4J40A 2Z6IA 2G3JA 3U5YA 1OWQA 3VIMA 1OGSA 4DUVA 5JUVA 1DQXA 3LSBA 3ZLFA 1E6XM 4D72A 4F66A 1CXKA 5IDZA 1DL3A 1YTDA 4Z0JA 2E9BA 3CJPA 3P84A 1LUCB 3G1SA 3P8JA 5E0KA 2D3NA 3GC2A 1TWSA 1OX6A 1QVBA 4O15A 3DZ1A 3F4VA 4LC6A 2XN2A 1EPVA 3W7MA 2HQAA 1TWDA 3M47A 3MSDA 1GOOA 3KVKA 1PX3A 3MB9A 2DGAA 2OZTA 3VINA 2OJPA 4QFUA 3A12A 2V68A 5AHIA 4AH7A 2HK0A 4RW3A 1FWBC 2NQ5A 1XLGA 3EWUA 1A3HA 3W23A 1B5TA 4A21A 2GLKA 2C91A 4L1GA 3UGRA 1XYAA 4GUFA 1DV7A 1H50A 1G94A 4GI9A 1UR0A 3BQ5A 4HK5A 1E72M 2ZZ3A 3DESA 3HZ3A 4RZBA 3VDHA 3O7UA 1N2VA 1WXYA 5HR7A 3M07A 3C0QA 5BRPA 4ATDA 1FDZA 2ACQA 3QGKC 2GVYA 5D2YA 1OZQA 1KCZA 1JJKA 5I00A 5ABHA 2Y7FA 2OTDA 2VDIA 4S2CA 1NARA 2FZBA 2PU1A 3EWYA 3QTGA 1BXNA 3A24A 1T5AA 3LHWA 3PNUA 3KE0A 4RDYA 2P53A 5EFFA 2WMIA 3CBWA 4GA8A 3WNMA 3VK5A 1U83A 4UB9A 3QQ1A 1NP2A 4NQ1A 2FHCA 2IPFA 3STFA 1VPYA 3FVDA 2MANA 1LG1A 4MJMA 1YXCA 4DF2A 3TOPA 3VD3A 1PB0A 3VGFA 3WLTA 3KDOA 3EKGA 3ZJKA 5ABTA 1O60A 3DFQA 4AY1A 3GZAA 1E55A 4N9DA 3W1UA 4AVNA 4GIEA 1Z9AA 4ZGYA 4WRHA 4YU1A 3IIZA 1IZJA 1W91A 3JR2A 3KBVA 5C9RA 5H2ZA 4GFIA 3TQVA 4P7LA 4WLCA 5DLCA 1FH9A 2JGQA 1KGWA 4GZ7A 4JQ2A 4X60A 4GXMA 2YA2A 2YGYA 5BCAA 5HPOA 1HL8A 2B7OA 4JYFA 4DZAA 4O14A 1EDTA 4ZSTA 2O92A 3T07A 3RPTA 3VM5A 2D73A 5I3KA 3L68A 1VF8A 5AN7A 3W82A 4XVDA 5M03A 3VCNA 1O5QA 4R5EA 3GXDA 4M5PA 3MMWA 2H9AB 5CBIA 4NZFA 7TAAA 3GXIA 1R85A 1N8IA 2DZWA 2EPNA 4M29A 3VNZA 4M7SA 3VNLA 1RCOB 5LGXA 3WJYA 3UU0A 2NLYA 4HIBA 1MYRA 1A5KC 1LQAA 1AH4A 2INZA 1W5QA 1RY0A 1R2RA 4BQ3A 1GQNA 3ELFA 1NM9A 3WF4A 4LH8A 1TV2A 3A3WA 1R3YA 1FWCC 1J0YA 3ZWSA 4OUIA 3LG3A 4C1KA 4DVOA 1GVEA 5I02A 4AXKA 1K7EA 3KS5A 1RLCL 3ECQA 4C5ZA 1TVLA 3HMJG 4HA0A 4HOWA 1EXBA 3OA3A 3QOKA 4RE4A 3TYAA 3V5CA 5AC5A 5D2VA 1E0VA 4NX5A 2V5DA 5ABGA 2PGEA 4N9EA 1E73M 3JVAA 2E5DA 2WJDA 3NVDA 4W86A 2PFHA 1E0TA 1KRMA 1KM3A 2YCLA 1WCGA 4AIUA 2O4QA 3GVQA 2AGTA 2WM1A 1AZ2A 1KFBA 1K02A 1E4MM 4ZZ9A 3MCMA 1CX9A 3IJLA 1QW9A 4FNRA 4P7QA 3M41A 4F2BA 3WY1A 4NKCA 2TMDA 1EL3A 3GS6A 3B0UX 4Z1BA 1ODZA 3QJAA 4QIUA 2VVNA 2JBMA 4U28A 5AFDA 3QPEA 3MDUA 1UP2A 4F9JA 1GQKA 5IXEA 4HMEA 4K39A 2ALRA 1MEHA 2Z00A 4DJDC 4QE5A 1EZ2A 3GXNA 4B3LA 3CZLA 5AVNA 3H24A 3RX4A 1P0DA 3WDRA 4HPJA 4WOZA 2PTDA 3DBNA 1Q13A 1H49A 2XINA 1DWGM 1LCOA 2PLKA 2VURA 4YYFA 1PTGA 3PTQA 4C6QA 5DN1A 2G96A 3O3RA 1LLZA 3WLRA 4NZ4A 4R3UA 3TE9A 2PDNA 3P5YA 2DSKA 4Q7BA 1PL9A 2O4MA 2V9DA 1U5HA 2TRSA 2HDJA 2VWSA 3AIVA 2UY3A 1RBAA 1BWVA 1S2TA 3T0CA 1GVRA 5FACA 1J2WA 3T9PA 4I5XA 2D20A 5JIWA 2YCJA 4MNMA 3ERPA 1BD0A 4U2ZA 2NUYA 3I4EA 4BJHA 4OBTA 1REQB 3NQVA 2CC0A 2F2KA 1GG0A 3KLLA 4ZQOA 1KM1A 1A5MC 1DJYA 2PWHA 3CAKA 1O5KA 1FOBA 4DAIA 2EPMX 1JPIA 2AQVA 1W1YA 2PTXA 1W37A 3CUXA 4JTFA 3WJZA 3B0VC 3L21A 3LERA 3SCQA 2Q8XA 3ARWA 1P6WA 2JE8A 2ZA3A 1EBGA 4G8TA 3FEQA 3T4CA 3LGEA 1C9WA 1R86A 1W1VA 3TJLA 3ES8A 4H9TA 5AB3A 2RJHA 3GFYA 3P82A 1U1HA 1UG6A 4LTSA 3W25A 3G1XA 1SMDA 4CKQA 1B3XA 3ZLGA 3RMEA 3RLUA 1B4EA 4XUGA 1FQ0A 1JZ6A 4AZCB 5DX7A 1VYRA 2ACSA 2WYSA 1CDGA 4AX7A 4Q8OA 1WE5A 2WBKA 3ZWTA 1BKHA 4FXJA 2I5GA 3AQUA 3WLPA 1H4PA 1OC6A 2BHUA 2G41A 1DWAM 4HOZA 2O9OA 5KEZA 4GQQA 2Y5JA 1US2A 4IFRA 1JF5A 2I1OA 3P67A 3T2OA 3HG3A 2W92A 1P5BA 1R2SA 5A8MA 1DHKA 4QDMA 4MWAA 2OLAA 6REQB 4UR9A 1OFEA 2PDQA 2YZRA 3ARQA 2I5QA 2J9ZA 3ITTA 1PKMA 1HJXA 4KQNA 3SFWA 2V5KA 3ITVA 1Y5VA 4CNPA 4M6UA 2HNEA 4L4MA 1K9DA 4ZE4A 5REQA 1FH7A 3W2UA 2CLKA 3FNDA 1DKWA 1PTDA 3IK2A 4HNVA 2ISWA 4YTRA 1WBHA 3MZNA 3FV9A 3LBCA 3B8UA 3DYOA 4KCVA 2H8XA 1SO6A 4EE9A 1P1MA 3VGHA 4GHRA 3GNRA 3W9ZA 1UD3A 3GTXA 3AICA 4Q4MA 5GVJA 4RNJA 1T8XA 4S38A 1UWIA 5KZDA 5DT7A 3OZOA 1QO5A 1XV8A 2IPGA 4AU0A 1J0KA 3DDMA 4Z1YA 4M51A 3SSJA 3BH4A 4S3AA 3G24A 1OADA 4R9OA 3FYPA 4I7WA 3NURA 4NRSA 3LS9A 1CGVA 1MMFA 4Y90A 2FGBA 1AZ1A 1JCNA 2PDFA 3HG2A 4H7CA 1SZRA 3S46A 3H4GA 1RK6A 5F4WA 6ENLA 5LZLA 3SBFA 1OFDA 3UZWA 3HQOA 4Z2JA 1RH9A 3I7SA 4J1OA 4H00A 5AC7A 2GFTA 4YMZA 3KX6A 4AIOA 4B2DA 1J11A 1I60A 1WOAA 2VM8A 3QHNA 4IIFA 4PCPA 4G9PA 2ZUSA 5LHEA 1X8FA 4MB3A 4WHBA 1DJIA 1PCWA 4YPJA 3R0KA 3AJ7A 4GZJA 2VMFA 3GZ3A 3SCWA 3WLJA 4RPPA 4H9ZA 1KFJA 4JCLA 4DXXA 1IWPA 3PZMA 5K3VA 3MSYA 1MI3A 3LTYA 1WOBA 3EEGA 2YXXA 1LF1A 4QLKA 2BHZA 1DORA 3UP8A 3QHOA 2CLIA 1J0ZA 3B97A 1K4HA 4XWUA 3S47A 4L5ZA 4UTTA 3BWWA 3SN1A 3PTDA 4WZHA 2DH3A 3AIEA 3RITA 3F4NA 1WZKA 2WK2A 4AY7A 4Q8TA 5GQBA 3UA4A 4RPQA 2WO5A 3IACA 1QJWA 3SM0A 2XVLA 2WNWA 3PWGA 5CZKA 2WJFA 1EJVC 4M8UA 5HWMA 1QO2A 1A4MA 3E2QA 4DXVA 5I06A 3BSHA 3R94A 1EJXC 1K7FA 5G4HC 1TZ9A 2PWVA 1YMYA 4DJEA 1UROA 2PRLA 1VJIA 4U4MA 4D6JA 4O4VA 3V0TA 4HHPA 3WMLA 2J75A 4PL1A 1LUCA 4OJYA 1O6IA 3T40A 1OZMA 1UH4A 4ZO7A 4MPQA 2Y7GA 1NTHA 5HDRA 4JTJA 4TUFA 2X41A 2QPSA 4XUYA 3PZTA 3NQ6A 2XYLA 4AZGA 4UNLA 1CGYA 6XIMA 2G3MA 3OVQA 4CNOA 4QLLA 3VIFA 1IF2A 4Z1DA 2YDQA 1FA2A 4JQ1A 1E6RA 4IMGA 4N9BA 3IGXA 3BW4A 2P3ZA 1A0DA 3M0XA 4L4LA 4XK2A 4AYSA 4PE8A 4Q8MA 5BU9A 1RPXA 2Q8LA 4ZB5A 1OFOA 1BPLB 1JFHA 1ITQA 2QJGA 4W84A 4CD7A 4N02A 4W88A 4ES4A 3TQ0A 3MW7A 3KZPA 3UBPC 1PDYA 1GZGA 4TR9A 1OM0A 1P6BA 3MI3A 4AY8A 3WJXA 4Q8UA 4CNUA 4XG1A 4JNYA 3N3TA 1JPKA 2DZVA 1HT6A 3HFYA 4TIMA 5U7SA 1DIOA 1OYAA 2WPBA 1HKKA 3GM8A 2R8WA 5IOBA 1AW5A 1JCYA 3N9RA 1QOXA 3HGJA 3TMLA 1HVQA 4E8DA 3WDQA 2J7GA 3URQA 4WIWA 3NZRA 4OBRA 4FXSA 2CLEA 4O1CA 5D4YA 1FP9A 3OB8A 2CWNA 1F4AA 3WH5A 2V5BA 3KP1A 2BLEA 4Q32A 4FNTA 5E6YA 2VWTA 3A23A 1VBHA 1QAPA 4NJIA 4J35A 3FAXA 2YXGA 3LYEA 2IXVA 4A35A 5C55A 1F76A 3V3WA 2OG9A 1XH2A 3PBVA 2YIHA 3WQOA 2WMHA 4KFNA 4QEHA 4B90A 2OT0A 4PUNA 3M1ZA 3WH7A 3FSTA 3R8RA 1HQTA 3TTYA 4E3TA 1HL2A 3EGJA 4A8NA 3BV7A 3ALFA 5IHRA 2Y61A 2ZFAA 2Z0IA 5F2MA 4G7EB 2OQLA 2CBVA 4IPNB 2D3LA 1NFGA 3ARTA 4G5DA 4OE7A 2O55A 3TWBA 2HCVA 4FLOA 2O9PA 3W00A 3ZMRA 1EJRC 1A50A 3KBSA 2FDSA 4ADTA 2H9AA 3VIOA 3THQA 4PULA 2H90A 4LAZA 1KCLA 1JNEA 1PAMA 2DU2A 2SFPA 2CNCA 2IW0A 3D5HA 2YCKX 2PRHA 3QFEA 3S5NA 5KTLA 2XWDA 3FW6A 1PCKA 3XIMA 4AB4A 2RKXA 3BE7A 3DFSA 4L80A 3W2NA 3RCNA 2E1DA 3G22A 4BR1A 2QHAA 4BEQA 1ICQA 3IVUA 1CGXA 4DPQA 1B9BA 4AFYA 1WO2A 3PG8A 3S1GA 3UWQA 5A8NA 3VMOA 1EA0A 1UD4A 2BOFX 2XM1A 1ZB5A 3O15A 4GPNA 1EUAA 3GB6A 3VMPA 3MI6A 3TOYA 5CLWA 5DCEA 4NUWA 2XGIA 4LVFA 1W32A 1UD8A 4Q33A 2E40A 1EHNA 3PUGA 3DERA 4HKPA 2WHKA 1QW8A 3UXAA 1TR1A 1A5NC 4GUGA 1FH8A 3APGA 2XSXA 3O6YX 2BGQA 3P93A 3LSCA 4JDBA 2B4GA 1VP5A 2GUYA 1I2QA 3NQMA 4UQCA 2BOGX 4LFYA 2GUBA 2QW5A 3TEVA 1FTXA 1RJPA 1OF8A 3TJXA 4O1AA 3RAOA 5B7ZA 4Q4SA 3ZT5A 4MSSA 2VP8A 5DMMA 3AOFA 3M46A 3BG3A 3IVSA 4ZQRA 4UQDA 3WKZA 4F48A 5CC6A 3GNPA 3LQLA 4LT9A 1FHUA 5LNVA 3OVPA 2Y70A 1KFLA 5CPLA 3EMZA 4LBSA 2PB1A 2IPJA 1TMHA 2QV4A 3W71A 3EWZA 3HPAA 5JVLA 3ZT7A 3KXQA 2CKSA 4LEQA 4DWSB 1GZ1A 3GIYA 4Q7NA 4ERAA 2BNJA 1FWAC 2PP1A 4GY7A 4XV0A 1NU5A 4BEUA 1JRBA 2WV8A 4HD5A 2G3IA 3BARA 3HA1A 1HO1A 3K46A 1YDOA 1JZ8A 4M6QA 1V6VA 3N2OA 4AZ7A 1BYAA 2E6YA 2Y8KA 3PHAA 4TX9A 3H54A 2XTKA 4JTAA 1JUBA 1FWWA 2VC7A 2JGYA 1FUYA 1E70M 3EDJA 1A5OC 4JQAA 3LMZA 2R82A 3BLFA 1DP0A 2JEQA 5DBTA 3WO8A 3K1GA 2ZC8A 4FI4A 1TIMA 1UYQA 4O4WA 3UZJA 4K1WA 3H2CA 4TO8A 1REQA 3WD0A 2XH2A 2XH4A 3QEZA 4CVUA 2PDUA 2TODA 4HNUA 1QPRA 2GYIA 4CCEA 1AD4A 5HA7A 1NQ6A 1AQMA 4E2OA 2XFFA 3HV8A 4XIMA 4QGCA 2GGEA 4LYQA 3F4DA 2Z1SA 1BQCA 3N9KA 1EGZA 1G01A 1BGGA 1TRDA 1B3OA 3T2QA 1MQRA 3GDBA 2VGFA 3PK7A 3GSMA 1NWSA 3S6TA 2ZXQA 1WYIA 3DFPA 3TFCA 2CETA 2E6FA 1KR0A 1XCFA 4JQ3A 1V4YA 3KL5A 2EPHA 4Z2GA 3OO2A 4Q4OA 4AZCA 4YTQA 3VDAA 3F2BA 1EF3A 3CUGA 1XLEA 4HA4A 1J6PA 2QVHA 3N2MA 3AXMA 3CL6A 1I9CB 1B4KA 4G1KA 4UC5A 4IMAA 4LVGA 3M5YA 1XFCA 3AS2A 3UXIA 2ZE3A 2R1PA 4ZOBA 4LYKA 2A3HA 1CPUA 1E4NA 3DYPA 3KVJA 1IXOA 4HCLA 5LA1A 3GFZA 1A4LA 4HK6A 3BAJA 2Y62A 4HYVA 2JQXA 6REQA 1TFVA 3WIJA 3W7JA 2ZZ1A 5D9MA 2P10A 4GQRA 2OO6A 2YBVA 4FP1A 5HUPA 3UR8A 4F0RA 4ZSUA 3F5KA 2FPTA 4HGXA 4U2YA 1AA1B 2NV1A 3NPXA 1S1PA 5JQ9A 1JCJA 1E9ZB 4ZXOA 1SFLA 1L2UA 4FXFA 1S1RA 4HMDA 3TSBA 1LT8A 5ENLA 4S3JA 3QLLA 1C92A 3CEPA 1LQ2A 5I78A 4Y8FA 2VGIA 3CTLA 3EXRA 2ZUMA 3URNA 3MKVA 1O4UA 1U2YA 1GHRA 1QU4A 3EB2A 4DM2A 3T42A 2HSAA 4LUJA 2WSKA 2OZ3A 2QCCA 2Y85A 4Y8EA 1C93A 4GY1A 1W9DM 1NF0A 4WKAA 1E0UA 1G6CA 5DMYA 4MFEA 5DRCA 5DCBA 1UBPC 4JEQA 1Z44A 1MFUA 2VEGA 3PPCA 2C18A 3UY7A 3K30A 5I3GA 1MEIA 2F8QA 4KGJA 3G1FA 2X1RA 1FCVA 1GZJA 2EF9A 1SUXA 3DI0A 3ABZA 1XD0A 4DAFA 2FZDA 4QQUA 4I6KA 1QNVA 1Q6EA 1TQXA 3W2KA 4A6GA 1H3GA 1S5TA 5CCZA 4HSNA 2E0PA 1XH0A 3RLGA 2AMGA 2PDXA 1MW0A 3QFWA 4Q4RA 1UMYA 4O1BA 3S2MA 3W7OA 2B7NA 2ISDA 3S2NA 4LF1A 4KCTA 1TWWA 3GTIA 3JU2A 4FEZA 3G1RA 5KINA 3C3UA 1UC5A 3GY1A 4KWVA 3EOLA 4L56A 1VLIA 4GVIA 3D46A 3BICA 3OLDA 4I9TA 1H0IA 3SRHA 2DIJA 2DORA 4KEMA 1K6WA 3M64A 1EEPA 4C7FA 5C9WA 1SW7A 4HNNA 2G4JA 3G0XA 2HVOA 4KRTA 5I24A 1OFQA 2DT0A 2ZRVA 3EDEA 3ZR5A 1H11A 2OFJA 2Z27A 3LB0A 5DT5A 1XICA 4H19A 3W7PA 1JZ5A 3UT0A 2OEJA 4MY9A 3UETA 3GIQA 2QXWA 1W1A1 1NFBA 3BAXA 3BLKA 1H60A 1ME9A 2Y88A 4L6DA 1JUKA 1LWHA 2ZUTA 1E9YB 3STGA 4JTSA 2CCRA 1SM9A 3O06A 4OBSA 3MUIA 1P7TB 3BPWA 3SFKA 3SEPA 2QPXA 4V2XA 1NSJA 3TK7A 1D8WA 3U48A 3P8IA 2W0UA 3GW0A 3UZXA 4QITA 5HWJA 3QBUA 2VDHA 1M68A 1OCQA 4CCCA 4JTQA 4MIMA 1BSLA 5LXXA 4IL2A 3L4WA 2V2HA 3PR2A 4REQB 4F3HA 1F8IA 3FOKA 4K2SA 4EWJA 1F5ZA 1HO4A 1EC8A 4HMNA 4PMZA 4WQ6A 1M7OA 2WHMA 4CQ8A 2QDEA 3GVGA 3KHJA 4S3FA 3UXKA 3H2EA 2A3BA 2GGIA 4S3EA 3NAVA 3VAVA 3MY9A 1AJZA 4XAYA 1V6WA 5G2WA 3CK5A 3UR7A 3GH4A 2XGZA 4GBUA 1XDJA 3ZJ6A 4WVXA 2JKAA 3W7DA 4NI3A 3NQCA 3LXBA 4BI6A 1V93A 2X1SA 1UH2A 2PWEA 2J13A 3GKAA 1LJYA 3WBXA 1UPMB 4DJFC 2Q01A 1O68A 1J0JA 1IZKA 4W5ZA 3V5FA 1XIEA 5CSSA 4B4FA 4WX2A 1Q6QA 1Y0EA 2HE8A 1E5NA 4IGNA 1J18A 3TQPA 4E38A 4US5D 3MQTA 3SIZA 4UMCA 1SU5A 1HJVA 4YIWA 3MVIA 2PCQA 3TAKA 3M7SA 4FO4A 4IT1A 3ZJ7A 3W37A 4NL1A 1P48A 2ONEA 2WCSA 3NQDA 3AALA 1OGBA 1OCJA 4V15A 2VQUA 2G95A 4MJ2A 3IUIA 1VFLA 4GYPA 2V67A 4KWOA 3VKCA 2TPSA 2NXGA 2UY2A 4R33A 3O6AA 1HKIA 4N4QA 2X30A 4WJEA 3AMLA 5D9PA 5PTDA 4JEJA 2HXUA 2XIBA 1C8XA 3EBVA 4B9ZA 4YTSA 4H7ZA 3GR4A 2IS7A 3GG1A 3KL0A 3SGZA 2VEMA 3LHTA 2J8FA 3WK2A 4LPCA 2VGGA 2VRKA 1JVNA 3HG4A 1DIEA 2QNEA 5CPSA 3WL1A 4QJ4B 3MV11 4QAWA 3A5FA 1DHPA 4I7VA 5A8OA 4A3QA 4XTIA 1JG9A 1E6NA 1ZS2A 4QG9A 3REQB 5F2LA 1B3WA 3WQGA 2HROA 2TSYA 4ZB0A 4GLEA 1Q85A 2NWSA 1R7OA 1TELA 3RCYA 3SGGA 5EBAA 4IZGA 7PTDA 1LORA 4G7EA 3TLLA 5ECUA 4AWSA 5IHSA 3S5ZA 2XZ7A 2D2HA 2QS8A 4H2HA 1NVMA 1QHZA 4GI4A 1LLOA 3RYSA 3BGJA 5CG7A 2XUCA 3H4XA 3S9ZA 2BODX 4GNKB 4X61A 3SO7A 1Q7QA 4S3GA 2ATSA 1BKSA 4AVFA 3CH0A 3QGAC 1E3ZA 4ICNA 2HBXA 3K1DA 1TG7A 3WLMA 4RXGA 3H22A 2DZBA 4J9JA 1OFAA 1RUSA 4RNHA 4IXHA 2QYGA 2ZZ7A 4FMVA 5HNRA 4RJEA 1JEZA 3UNDA 2ZZ4A 3NZGA 1EO5A 1YDYA 1E1CB 4C7DA 1E71M 3QV8A 1XDMA 4EP8C 3RXZA 1W8SA 4MY1A 1S2VA 4KWWA 4XZMX 1R0MA 3CV7A 3L7RA 3DCPA 3PZIA 1C8QA 2RGLA 3W6LA 4A8LA 2GDUA 2OPJA 3FS2A 3E5PA 1M03A 3VNJA 3RPDA 4D8LA 2WJZA 3S4TA 1DWFM 5AKQA 2OU4A 2X1UA 4UTLA 1AD1A 3O07A 5BXPA 2J6VA 3AAMA 2CZFA 7XIMA 4AQLA 4PSRA 3CU2A 1HX0A 1C90A 2VJXA 2C3ZA 1W31A 1GVIA 2XN0A 4GCAA 5F7UA 5HNTA 4HNCA 1QXLA 2WZMA 2C71A 3JS3A 2VENA 2Y0FA 4UFKA 3KOWA 1RALA 2GDVA 2CXGA 3LLFA 1LL7A 3WQFA 2I9UA 4TX6A 4JTDA 3O1NA 4W93A 3UWZA 2VVSA 1EKOA 3S9YA 1CI1A 1ZJAA 4XBKA 5HJXA 1H7RA 1C8YA 2YKKA 4PMDA 4BF5A 2WKGA 2DUXA 4JTKA 1FWIC 3GU1A 2PZ0A 2YYTA 1EIXA 1W3IA 3RX2A 1VRDA 4DWSA 4FA3A 1GTEA 5I23A 4E2VA 1RQHA 3EB4A 3EX6A 3TR2A 4RL3A 1EX1A 4UZUA 4C60A 3V36A 1CLKA 3SW6A 4H83A 3VCCA 3HQNA 6PTDA 3AWNA 3S6OA 2D0HA 2XVGA 5C9ZA 1VEPA 3RRXA 4HHHA 1QT1A 1JGMA 5FJTA 3WLSA 1O5XA 1JFXA 1XS2A 1CGUA 3VOCA 4OQVA 2IKGA 1X8CA 4AWEA 2ZADA 2RH9A 4L9XA 2FB3A 4QG8A 4PGLA 3QGVA 1TJ1A 1C7SA 4QXIA 1CYGA 1IIGA 1GHSA 2OODA 4Q7IA 4JNMA 2Q71A 2XIQA 4EPEC 5A6MA 4GO8A 4NZJA 4DIAA 1FFQA 3PFMA 4EPKA 6TAAA 3TR9A 4LAOA 1CT5A 2O7SA 1Q5MA 4D6DA 1XLAA 4Y2WA 3CIXA 4NF7A 4JIEA 1EC7A 4GJIA 4UQ9A 4ATLA 3U9IA 4L65A 4LS0A 3XINA 2J27A 3EXSA 4M0XA 4F2UA 1ODUA 4IMCA 4UTIA 2Y5SA 1GVOA 3C61A 3OYZA 1PHWA 2Q6ZA 4PR4A 3PZNA 1J0HA 5HNNA 4X2RA 4RLIA 4JN8A 3N6QA 4JTCA 3ZYZA 1LRQA 1WKEA 2VFIA 1L0PA 3GXPA 1A80A 2Y4SA 3HGSA 2BY3A 4S3CA 4WXYA 1V7AA 4J3ZA 1L2QA 1VFSA 3WSUA 1W9PA 3S6DA 4J3TA 2MNRA 3EX1A 3W1PA 1F74A 2GQ8A 1TV5A 4K7YA 1XPGA 4IICA 3D3FA 1W5NA 5HMDA 1JRCA 4DBSA 3UZZA 1W3TA 3TU9A 2X7VA 4NVTA 3OYXA 4HCDA 3PZOA 2X1TA 4C7GA 3SUWA 4KPLA 1EGMA 3IJ7A 4DF1A 1J5SA 1XLDA 1U1JA 4UZSA 4F0LA 1SJCA 1UQZA 4E8CA 1SO5A 4HK7A 1ZFJA 4EAMA 4EX4A 2F84A 5JH1A 8TIMA 3VOHA 1PZ1A 1VIWA 4AEEA 4DN1A 2GUUA 4N42A 4JFUA 1JDFA 2Z26A 5I6SA 1EWDA 5HQLA 1KBLA 4I9JA 3THAA 1B57A 1V7YA 1ZUAX 1J10A 1JCXA 2Y63A 3PWAA 3DFYA 2QJHA 5EL1A 3A4WA 1YHTA 5A2BA 4IP4A 5I79A 1BEUA 1W5PA 2DPEA 2TAAA 5CJ5A 5LSMA 4D1JA 3H2MA 4WOQA 2W27A 3MP4A 2E68A 4DF0A 3T55A 1NH6A 3NIYA 2QCFA 2REQB 1UJQA 3B3DA 3KRSA 3M16A 1TTQA 3VNYA 2FQIA 1S5WA 3IJDA 4UMAA 1XYZA 5FJOA 3VYLA 1U22A 4IIHA 1MSSA 2VGBA 3GG8A 5AYIA 2PDWA 2Z2AA 3TMQA 1TSIA 2ON3A 3HOJA 3FJNA 2X2GA 1H1ZA 1W6TA 3SCTA 3H2NA 3C2FA 3GW3A 3FJ4A 5HXMA 2XN1A 2WB5A 3MUCA 1J8VA 4H9MA 1KR1A 3ANVA 4DPPA 3BLIA 5LNSA 4AEOA 1N8FA 3QM3A 2FMOA 1DWJM 3FXGA 5DELA 2PDHA 2Z24A 1I2NA 2HRWA 1HVXA 3AYVA 1FWEC 1NY1A 1JR1A 2NV9A 1VYPX 1EC9A 4CLMA 4EWND 4JDYA 3W1NA 3AS3A 2EPLX 2PI6A 3CQIA 5I3DA 3GR7A 1PKLA 2QDHA 5T9BG 4BKNA 3AHVA 2CYGA 3GUWA 1P7TA 1XRVA 1T0OA 4W8AA 1TV3A 4LAKA 2VI0A 2J62A 3DU0A 3TX9A 2H8ZA 2E5CA 1WAWA 5I3JA 3L5AA 3DHDA 2ZUWA 2DP3A 4KCUA 4CD6A 1D2KA 1YBQB 4REQA 2WVSA 1I4NA 4UTKA 4C1LA 5CH9A 3NM3A 4PUDA 2CBUA 4A29A 2PDYA 3D0CA 5D03A 4GGBA 1GVYA 2WZIA 3VDCA 2QCDB 2VR2A 4MKNA 2BY1A 3E3HA 2ZX9A 3WUFA 2OXNA 4D6CA 4M19A 3NSNA 2WZHA 5AZ0A 1W2PA 1XF0A 4FLRA 2OELA 1EZWA 2J47A 4RZ6A 4ORIA 3OZPA 1ISWA 2OWCA 4FALA 2WSYA 4H9YA 1AUSL 4NI8A 2Q02A 4PBFA 3AXXA 3UJRA 3I65A 2ABAA 4IMFA 3IJ9A 1SO3A 4QISA 5HR6A 4RXFA 5LIYX 4ZL1A 3KHDA 3S1WA 2Z1BA 4QR6A 3DFNA 4LWWA 1XG3A 1Z42A 3W22A 1DXEA 4O54A 1NP0A 1GW9A 2GJXB 4HHMA 5CAKA 3STEA 1P0KA 3HPSA 1EJ7L 1S39A 3W84A 4DWDA 3AXKA 3P61A 4B3KA 1NJJA 1O5RA 4XSMA 2B81A 5EYWA 3C3NA 1LQ0A 2GSHA 3VGGA 1EYWA 5HMFA 1H1NA 5C8BB 3VX0A 2PBOA 2X0SA 3K5XA 1X39A 4AZIA 3A4JA 4ECLA 3VA8A 3BMWA 3E1F1 2PEVA 4CNSA 3NSMA 1W5OA 3VD4A 1W9XA 4WSHA 1BF2A 3CWOX 4A8RA 4JFTA 3L4VA 1VAHA 3IJIA 3VIHA 4QX4A 2OO0A 1V3MA 4UTFA 3MUY1 3PZUA 2I7GA 1X96A 1F3XA 1HGYA 4CD8A 3UCCA 1UB3A 1W1PA 3REQA 1SGJA 4AHQA 3KS6A 4MB4A 1DXFA 3VXGA 4HN4A 1GVQA 3NJ3A 3QMRA 1E6ZA 1HKVA 1Q6DA 1IR1A 3LDVA 2WSQA 3IRSA 2J8GA 3GTFA 3SUTA 3WBEA 3UJFA 3CHEA 1Q8AA 2ZXBA 1KRCC 4C1NB 5J5DA 4LRSA 4HJWA 3WH6A 1YXYA 1UWQA 1ONRA 2ZQ0A 4K6AA 3G3DA 5A6SA 4JKKA 4IMDA 3AIUA 3E5BA 3H55A 3S2CA 3LUTA 5FAGA 3RJXA 1GT8A 4HSOA 4WD0A 1W54A 4IPJA 2ZWZA 4GOAA 1XCWA 1V0LA 3GC4A 1OX5A 1UWRA 2WC3A 1AQ0A 1BG9A 1X7FA 1PO9A 4D8ZA 2FZMA 2YB4A 3EA2A 2HS6A 3PB0A 1ITCA 3USBA 1KM4A 1KO0A 1H51A 1E1CA 3O6CA 3PJXA 3RMJA 5AC6A 3F1QA 3AWOA 4C6MA 5HINA 1A3WA 2DZSA 4NSBA 3GG0A 3W26A 1FRBA 1MVYA 3BLLA 1AH3A 1VYSX 3E9AA 4I90A 5A1AA 1ZP3A 3ES7A 3SUVA 3IEBA 2PRMA 4LYRA 4BZYA 4PMOA 4HCHA 2BHYA 4PUJA 1DE5A 2ZTKA 2NW0A 4HTYA 3VCRA 2Y7DA 2ZWYA 3WLLA 1OBAA 3CXOA 3OJGA 5RUBA 5JMUA 3MKKA 2D2GA 4M3PA 4TQTA 4DI9A 3GNXA 4XZWA 2ZX5A 4FOJA 1V79A 3BOLA 5KZEA 1DJXA 1IT0A 4QE1A 1EXPA 3MHGA 2E09A 3BGGA 3Q65A 2GJLA 2GWNA 4YNGA 4AD4A 1UASA 4L1WA 3LD5A 3UG5A 4HNOA 3RCMA 1B9ZA 4EXQA 4W7WA 2WPGA 4C65A 1VPQA 4Q8QA 5FJIA 1OC5A 1UWSA 2ZRWA 2PD5A 1PVNA 3DBPA 1PX8A 3POHA 4XQ6A 4AIBA 4B2DD 5CJMA 1AQFA 4PZVA 2OB3A 3AXHA 1HN1A 3EWCA 2PSNA 3ZFHA 4JTGA 3TDFA 4B4HA 2POTA 3NPUA 4XTDA 5LIUX 2ZYFA 4LRTA 3TC6A 1Z3NA 1H7NA 5DO8A 1JXJA 2DVTA 2OGJA 1RR2A 1W1B1 2F2HA 3WFZA 4O0ZA 1PZ2A 4GINA 3FAWA 4DYJA 3PJWA 1KM5A 4HP5A 1C9DA 3QR3A 4EPDC 3WD2A 1FWRA 1MDLA 1XC6A 5G4EA 2F7FA 3LEPA 1NAL1 2VZTA 2CEQA 3ORWA 1SFSA 1VFHA 3W53A 3Q45A 4D6FA 3SN0A 1HKJA 2UY5A 4KEVA 4IGSA 4UXDA 2FDMA 2QJMA 2Z4GA 4NRRA 4JYEA 3M0YA 1ZBKA 1HL9A 3ZSTA 1M6JA 1B3YA 4PRRA 5D8WA 2QIIA 2DH2A 4EXAA 1M9HA 1W17A 1ZJHA 3BVJA 2BXYA 3TA9