3L0KA

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-acetyl-ump
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 101
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l0kA00
4O15A 3PB0A 3UD6A 4GFSA 3LCIA 1VJIA 1UUMA 4O17A 4LUIA 4K36A 5FF4A 1JUKA 5DCBA 3S5ZA 1CI1A 1GJPA 3DU0A 4MLJA 1E51A 4UFHA 3G18A 5C55A 1RPXA 4O50A 1ADOA 4EVZA 1YTEA 4OQVA 1SW0A 3W7MA 4GBUA 4UMAA 4FNQA 2OCZA 2QCHA 3QFEA 3QSRA 2R91A 1TPDA 1G4EA 3EXSA 1TPEA 4GUFA 3OG3A 2ZDRA 1QOPA 4CQ9A 1U83A 4JYDA 5F4SA 5AYYA 3O16A 4O13A 1K8YA 3O15A 4M6VA 1YXDA 2WNQA 2CFFA 2FB3A 3M16A 3BK0A 5AHFA 4JTEA 1MEHA 1OFRA 2EKCA 2BTMA 1KBJA 1TSIA 3BARA 5DXXA 5D32A 2PC4A 1GOXA 5BW6A 4MZYA 4WY0F 1DJNA 3BGGA 2X1UA 3RNDA 3B06A 3G1VA 3G0SA 4CNNA 3TQ0A 1QAPA 1VYPX 3NPUA 3GKAA 5AYXA 4DPPA 5HULA 3DFSA 4Y9AA 1Z48A 3UY7A 1B4EA 4EWND 2LLEA 1TJRA 3GXPA 4LC6A 4FNUA 3G1HA 3EX4A 2YR1A 1VHNA 3P62A 3NM1A 4UR8A 2R14A 4NQ1A 3GVGA 3GYEA 3P82A 2Y62A 2QUVA 1PHQA 4WOQA 1XDMA 1F6PA 4Y90A 2E6DA 3W7CA 1OG0A 3LRKA 3OVQA 5CPLA 3WK3A 2Y88A 5H2ZA 2OZ0A 2XFWA 3BLFA 4AWSA 1FCUA 1CX9A 3FA5A 3I6RA 3QMRA 1U5JA 3PSVA 3W1QA 2FIQA 4K37A 4O18A 4LRTA 1VS1A 2JBMA 3NQFA 3KX6A 3E0IA 2PRHA 2ZYFA 5TBOA 3LCWA 2DZTA 2GJNA 3QMTA 3O6YX 4JIPA 1QCWA 1LOSA 3GB6A 1N7KA 4MJZA 3P67A 4CQ8A 2RDWA 4PA8A 4OU1A 4BWLC 1GT8A 4DXVA 1W54A 3EWYA 3L66A 1DHPA 2GQ8A 4JXCA 1K8XA 3DFQA 3M5XA 1BWKA 3MYPA 1R2SA 1ZFJA 1IXOA 1TTQA 3BVJA 3P5YA 3GAYA 5K9DA 1Q6QA 3KVMA 1H7NA 1ZY9A 3U2OA 4D2JA 1SSGA 5DBTA 4Z1CA 3P60A 4JTKA 3W87A 2HSAA 4O11A 1KLYA 1NEYA 3IEBA 4KFPA 4XZ9A 3FFSA 3KFTA 5CZSA 3W83A 4UUIA 4LUJA 3F4NA 3QC3A 1KFLA 3ABQA 3R5EA 2V9DA 3W2LA 3W1MA 4NX5A 5H91A 4IPIA 3W6YA 2DZUA 1EWDA 3P5ZA 4FNSA 1BKSA 3W7IA 3W3OA 5CKSA 3UNDA 1ICPA 3C61A 4JNMA 3S6DA 4HKPA 4UTWA 1H51A 4L4MA 1L9WA 5DCEA 4O16A 1ME7A 3DAQA 1TV5A 1GG1A 3KAOA 3NPXA 4TIMA 2A4AA 1UUOA 1XUUA 4DF2A 2A6LA 2FTPA 3DI0A 3EWBX 1S3HA 4O1BA 1RR2A 4KWWA 4MY1A 3W1UA 2NWSA 1TQXA 3HG5A 2OT1A 4BK9A 1Q45A 3B04A 3W23A 1GQNA 5CPOA 3W7LA 1XBYA 2JK2A 4JX5A 3P80A 3N9RA 2A5HA 1W5OA 3NQGA 4ADSA 3FJ6A 1MO0A 2TPSA 1XBXA 1W3IA 2FPTA 2QKFA 3CEUA 3P61A 3W74A 1P5BA 3TSDA 3UZJA 3ZS4A 5LGXA 2X1SA 3LXBA 1I2NA 1WBHA 4JN6A 3DKJA 3CEPA 3PC0A 2V2CA 1JRCA 3PF3A 1IF2A 2VFDA 5C6MA 1JCMP 1RZMA 3O05A 3LCXA 1QO5A 3TQKA 1PIIA 1VC4A 3LDVA 3E12A 3PBUA 3M7WA 3EXTA 3C3NA 4QJ1A 4IOTA 4UTTA 4UR7A 1VCGA 2VFFA 4ZVJA 1KFCA 3D0CA 2G96A 3W1RA 3TDFA 3W1XA 5D05A 3NZ1A 4IMDA 1W8SA 2X1RA 4ZQRA 1KTBA 3IGXA 2QCDB 4WXZA 2ZRUA 3STCA 4QITA 1C8VA 3LI0A 3M9YA 4PH6A 1FWNA 2WV8A 1NFBA 3NA8A 3LLFA 1V5XA 4LS0A 2VEPA 4K38A 4O14A 3HQ1A 3BPWA 3I7SA 3EWUA 1MEIA 1ZCOA 3EKLA 4FNTA 3N9SA 1ZAJA 1ME8A 2VOMA 2BXVA 4FIQA 1JCXA 2QCNA 3S1WA 1OFOA 3JRKA 3GZ3A 2DJXA 5AHLA 1FY6A 2A7NA 3AO0A 4BWLA 2PRLA 4E2BA 3OBKA 2ISWA 3LTPA 4G1KA 4LNYA 3E02A 3L65A 4X9SA 2C0AA 4UTIA 2PRMA 1SSDA 5E1QA 5L6UA 3W72A 2GVJA 5D2XA 3W2KA 3M5VA 4UCGA 3W1AA 4UTKA 4M6PA 1T99A 1SZNA 5CZTA 3A5FA 3IIXA 4GXMA 3W7QA 3A5VA 4O0ZA 1H61A 1FDJA 4DPQA 4GWEA 3A9IA 2JKAA 3M5ZA 4CLMA 3BW4A 1VH7A 4FX6M 4NU7A 1MZHA 2Z6IA 3SIZA 1QO2A 2ZA1A 1A53A 2ZZ1A 2J9YA 3LCHA 4YL2A 3O6CA 1KFEA 3WK0A 4CQAA 4HSOA 2ZRWA 3QM3A 1VYRA 3DFTA 1DQWA 4UTJA 4A22A 5D37A 3HG3A 2HTMA 3EX3A 3TJLA 1PVNA 5AC6A 3GR7A 1LM1A 1LTDA 4Q33A 5F1VA 3DFOA 4KWVA 4DBDA 4BFAA 3N73A 4POCA 2V30A 1UASA 1OJXA 3L5AA 5HWJA 3WK2A 4UNLA 7TIMA 1OF8A 2Q8LA 1TPC1 3A24A 1G4PA 4PL2A 5G2IA 1IGSA 1G4TA 2P10A 5HUOA 4BR1A 1PCKA 3HO8A 4I7WA 4R34A 1OFEA 4TMCA 3NQDA 1H7OA 3UWVA 2C3ZA 3BO9A 2GJLA 3TJXA 4NNAA 2QDGA 2V5LA 2BLEA 1LLWA 5F1UA 3S1VA 2YZRA 2RHGA 3UWWA 5EYWA 4HNVA 1FCBA 2QUTA 1R46A 3LRLA 1JR1A 2A0NA 3HIJA 5F2LA 2FB2A 3LX9A 1TPFA 3MBFA 3TX9A 4NZJA 1Y0EA 1SZFA 1NF7A 1G7UA 5D2WA 2ALDA 3G24A 2WSYA 4UFJA 6TIMA 1K7FA 3QH2A 3S5OA 2E5DA 4Y6GA 3BG5A 4CCEA 2FFCA 4MFEA 3C2OA 1VLIA 1G7VA 3MP3A 5D09A 5FEWA 4MVAA 5D30A 3NDOA 1LZOA 3NR0A 1X8FA 3LGEA 2OJPA 4OT7A 1S5VA 2YX0A 3MJYA 4UMBA 3IVTA 5HINA 3C0JA 3OIXA 2VELA 2ZRXA 5K7JA 2XN0A 5D2VA 3DXIA 2VKZG 1LBFA 2DZWA 1NSJA 4ONVA 3N2XA 3SFKA 1UCWA 4FXSA 3NQMA 3C56A 5U7SA 1XXXA 4DELA 4A21A 1QPNA 3W88A 4N6FA 4RLIA 3KVKA 1R30A 1FWRA 2Z2UA 5C54A 2V81A 2B7NA 3W1TA 1ZJIA 1VPXA 3MP4A 3DH7A 4ZQPA 2HMCA 5AHMA 1KA9F 4QQ3A 3BW2A 4K7YA 2VENA 3VNDA 4H3DA 5F2MA 1HO1A 4IMFA 4A2RA 2FLIA 2YYTA 5EKYA 4Z1DA 2DZSA 1K03A 3IVUA 4NJHA 2VFGA 1VGAA 4OGZA 3GDRA 5AN7A 3LOTA 1F76A 5HR6A 3ZR4A 3FOKA 1LDCA 1TJPA 3NPVA 2E68A 3HBLA 3V75A 1YPFA 3NXFA 3G8RA 4O57A 3C8FA 3WJYA 1TPWA 2YFNA 2C13A 4GUIA 5F4XA 1R2TA 3NL3A 2WNNA 1KFKA 5FEPA 3NQAA 2KZHA 1K7EA 1TREA 3WJWA 2B0MA 3U8GA 5FESA 2H3BA 3GXNA 3L0NA 2QDHA 3LHUA 3B0PA 1DVJA 1XM3A 1Z41A 4LVFA 2Z6JA 3QZEA 4UFIA 4LVBA 1SPQA 3SY5A 1O60A 4MOZA 1BEUA 4QM1A 2YSWA 5F4WA 3P8JA 3W7KA 2R8WA 4EF8A 3CWOX 4JTIA 5HJLA 3OA3A 3QMSA 1YTKA 4LRSA 2Z0IA 1KFJA 3HOJA 2RH9A 3THAA 2GVLA 1TV7A 4N9EA 3IGSA 4JDBA 1I8JA 1TV8A 4S2CA 3G22A 4JTJA 3GK0A 2JGQA 1B57A 1SR9A 1XC4A 1F05A 3I65A 3NQCA 1IXQA 2A7RA 1LBMA 4QSHA 1KM2A 5DCDA 4GNJA 4RZ6A 3M43A 4AMAA 4MFDA 1TB3A 4O4WA 2F84A 3NM3A 2HS8A 3HPSA 2E6AA 4NNCA 1FWWA 5CZJA 5EBUA 3PS7A 3F1QA 2ZTKA 3EXRA 1C9DA 2V2DA 3LLDA 3MHUA 2RFGA 5K4XA 3ELFA 2ZBTA 3IGUA 2C15A 4YLWA 2WJZA 3LXCA 1LP6A 1TPB1 1OF6A 3LHTA 1QNVA 5A5WA 1WV2A 3HG4A 3L5LA 4EF9A 3UYCA 5CZ0A 4FO4A 4XUGA 5F2IA 4BI7A 5D04C 4LVDA 1WBJA 3ABOA 3S5NA 4O10A 3TC6A 5CG7A 4PFMA 3DHDA 3HG2A 4CNOA 3TXVA 4MY8A 3T44A 1EIXA 2C18A 3GDLA 4UFKA 5DY3A 4CNPA 4FNPA 3TMQA 3YPIA 1PV8A 4JGDA 1W31A 4OBTA 4RJEA 1EUAA 5CSRA 4PC8A 1DQXA 1DBTA 3NQ2A 4FEZA 1JUEA 4ML9A 3TR2A 3TXZA 1JQXA 3NVTA 4NJIA 3HPZA 1Z44A 1S5TA 3PULA 3NG3A 2Y89A 3L2IA 4UTTC 1JUBA 3DENA 3WFAA 2NXIA 5KMYA 3NQ6A 3TKFA 3W76A 4UNKA 2ZTJA 1K3UA 4QAIA 1M7OA 3W85A 2A7PA 3M44A 3NNTA 2TMDA 1GZGA 3O63A 3RLVA 1O5XA 1HFBA 2ABBA 3CC1A 3CIWA 4LC8A 5I3FA 3W71A 2ZRVA 3HMJG 1TMHA 4Z0SA 4AF0A 5KITA 1SZEA 3PSWA 1LRQA 3UY8A 4NJJA 3L67A 2B7QA 4E0CA 5LKYA 3CT7A 3WJXA 4WOZA 1XFBA 1GTEA 4ALDA 1YADA 3FYOA 3IVSA 3CLMA 2B7PA 3PR2A 5LNSA 4Z08A 2DU2A 3LHVA 3MI6A 1RQEA 4XKYA 4MYXA 1VHCA 4M5PA 2QEZA 5FF7A 1H7PA 3OHIA 1FWTA 1H7WA 5KZEA 5DELA 3G0XA 1AW1A 2WNZA 2V5BA 4BF9A 1ALDA 2YCEA 1I2PA 3W22A 4CCCA 3GDKA 3MYOA 1FWSA 1RV8A 3B03A 4WX2A 2G95A 1FCVA 1DORA 1F6KA 3KHJA 1QFEA 4YCOA 1SO5A 4RXGA 1SW7A 1D3GA 4O1CA 3Q94A 5LHEA 4PCFA 2CZ5A 2CLEA 1AW2A 4IX2A 1SFLA 2ZRYA 1FDYA 1EEPA 1I45A 1ZHAA 2NUWA 1AW5A 3W7JA 4UMCA 2QJGA 5IBXC 2BSLA 2QAPA 3NL2A 2QAFA 4FB7A 3W70A 2Q3RA 2QJIA 1OFBA 3GDTA 4RR4A 2P0OA 1P0KA 3QPZA 2J88A 1TCDA 3JS3A 5TQLA 1OFPA 4YMZA 4OWGA 3O07A 3SSJA 3SJ3A 4C1KA 2EHHA 3TAOA 3LM7A 1XKYA 3PVFA 3PWAA 1DKWA 5G5IA 4PL1A 1EX5A 1LCOA 3P74A 1TTPA 3IV3A 4JYEA 4Y8FA 5AHIA 1XUZA 1VYSX 4K8HA 1XCFA 4UXDA 1H62A 3M6YA 1AG1O 4JD4A 4AHPA 2J27A 3KOFA 3TC7A 4MYAA 3E96A 3Q2DA 1DOSA 5F2GA 1YTDA 5EA9A 2CLMA 1OHLA 4LVGA 1KM4A 5K3VA 4AH7A 2E6YA 3LCLA 3F4WA 4KFNA 2EPHA 1OX6A 1UJPA 1IIHA 3RMJA 4MZ1A 4FF7A 3TIMA 5G4WA 1PHWA 4GJ1A 2J6XA 4IX0A 1OABA 1W56A 3L0GA 3IIPA 4EOUA 4PODA 1TPVA 3CU2A 2UV8G 1ICQA 2BWGA 2Y7GA 3DGRA 1OFAA 4B5NA 4HNUA 4ZQOA 3UPWA 1TYGA 2HS6A 4OE7A 3T78A 1AMKA 2ZZ3A 1WYIA 5CGQA 5G1YA 3B4UA 3HGSA 5BOOA 5LGZA 3LCGA 2CW6A 4GE8A 4HNNA 3W7HA 4JDYA 4HSNA 3P7YA 4ADUA 4JTSA 3NL6A 2O7QA 1ZENA 2V2HA 2WKJA 3EX6A 3RU6A 3G1DA 2TYSA 3RLUA 4M7TA 1W5NA 2ISSA 3LI1A 3ATYA 1SQ7A 1FDZA 3L9CA 5ABTA 1LOLA 1GEQA 2WSQA 1KM5A 5CSSA 5J5RA 3BGJA 4FHAA 2B7OA 3C2FA 1L6YA 5G2HA 3FKKA 2ABAA 4PTNA 4DO4A 3W1LA 4QNEA 3W2MA 4R33A 3W7EA 1ML1A 2A85A 4O1AA 1KV8A 2C6QA 4O54A 2ATMA 1XBVA 4HPXA 1K02A 2Z1BA 2XN1A 3UZ5A 5BMXA 4AAJA 1H1ZA 3EX1A 3CHVA 1VZWA 1EPXA 5AC8A 2C14A 1P1XA 1F73A 1J5TA 1KTNA 4JTGA 2Q8ZA 2H90A 4U28A 5LNWA 1SO6A 1OX4A 3M41A 4RV8A 3LHWA 5DXYA 3WJZA 1HO4A 3S0CA 4JTFA 3KXQA 3LRMA 1RD5A 1I4NA 5CPMA 1G4SA 4UFMA 3W2JA 1JJKA 1TIMA 3PM6A 1YYAA 2GQ9A 5AHEA 2ZFAA 1KM3A 4JY8A 2X2GA 1L6SA 1M7PA 1SW3A 3FEMA 1SZGA 4IPJA 5DBUA 5D33A 1CW2A 3A22A 3C2RA 4FNRA 1EA0A 3MI3A 2YXGA 3TSMA 5U4NA 2GOUA 2ZCGA 4NZFA 5FI8A 3W2UA 4O19A 2VFIA 4LY8A 3HJZA 3TK7A 4UC5A 2VC6A 3DFNA 1EP3A 2V82A 4JTTA 3KRZA 2Y7DA 3S1UA 1UB3A 1X1OA 2QR6A 1H50A 2IQTA 4UIOA 1H63A 1KV5A 4DF1A 3RK8A 2ZQ0A 4YWIA 1ZALA 4FX7A 5G1TA 1F2JA 4X22A 3STFA 1A5AA 3GAKA 4Q4KA 2RDTA 2DZPA 5D2YA 3T40A 4DQWA 5KSWA 3VE7A 3V1PA 3TNOA 3NGJA 1VLWA 3BLEA 4HPJA 2X30A 3S42A 3NEVA 4HN4A 3NYZA 1ZAIA 5C5YA 3G1FA 4FXRA 4LV4A 5D02A 3F03K 1YDVA 1FXQA 2DZVA 1FCQA 2CLIA 4NXSA 4ORIA 1W5MA 3TAKA 5GVJA 4YCPA 5SWUA 1RQBA 1X1ZA 3PUOA 2W79A 4A3UA 4O8RA 5BNKA 2E5BA 2ZZ6A 3ABSA 4MZ8A 2RKXA 3N2MA 1GVRA 2QCFA 3ZWTA 1AK5A 3GLCA 4NNBA 4M19A 1FBAA 3GDMA 4UTHA 4Z1BA 1DL3A 3LXAA 1ZNNA 4I7UA 4K8EA 4P2VA 1JVNA 4AHOA 1W5PA 5DY2A 2VEMA 4MUZA 3CWNA 2X1TA 3GNNA 2JKPA 4N9CA 3N34A 3PUEA 4E2DA 4IUOA 4JX6A 3EWZA 4NJGA 1LLZA 1JQVA 3A23A 3L68A 4ZQNA 5HNRA 2DZXA 2F7FA 1SU5A 5HQEA 1LYXA 1TQJA 2EF9A 3LV5A 4M6QA 3USBA 3C2VA 5LNVA 2CLHA 5LZLA 3W7GA 2NZLA 3TH6A 4AXKA 4TX9A 5I3KA 5IM51 1EP2A 4TR9A 2P1FA 1IXNA 2ZZ7A 1V7YA 2BZNA 4GUGA 2E6FA 4IMGA 1QWGA 3MI2A 4LV9A 4LS1A 4M7SA 3GR8A 4BI5A 1J4EA 1EB3A 3HB9A 5LNRA 3CIXA 1NF0A 4K7VA 4H6KA 4X3ZA 1G67A 3FKRA 4L4LA 3M0ZA 3W7DA 1HUVA 5E93A 1XDLA 3HGOA 1H1YA 4WZHA 1LORA 4O28A 1WX0A 1PL9A 3UPBA 4MPQA 4JYFA 4R7JA 4LT9A 3R89A 1FXPA 3BV4A 4NXKA 2G5WA 1SUXA 1WOAA 2E5CA 2WSRA 3Q37A 1TO3A 1GVOA 1G69A 5G4EA 2ATSA 3DBPA 3C4UA 2GQAA 1GVQA 2EGZA 5I3GA 3MO7A 4J9JA 2Y61A 3NQVA 4N9DA 1UBSA 5AOUA 3G1YA 3BW3A 1XL9A 1B4KA 4FX8A 3UXAA 3G3MA 3SZ8A 5AB3A 2EAWA 1A50A 4NX0A 4AVFA 1SFJA 1A5SA 4XBSA 2VEKA 1BWLA 4HNTA 2D73A 3P84A 4JTHA 2CZEA 3OEXA 4XKYB 1S5WA 1MEWA 3GIYA 4ICNA 2AQWA 4JIQA 1KM0A 3I7QA 2AAMA 4NJKA 1QMLA 2QCEA 4JX4A 1VCFA 3LBCA 1WA3A 2CWNA 1X6UA 3NAVA 2WQPA 3SW6A 1WAUA 3L21A 4ZQMA 2YFOA 3DFPA 5AFDA 3NL5A 4AEOA 3NQEA 2PURA 3M1ZA 4Q32A 5IBXA 2CLLA 2CZFA 1P4CA 1LBLA 1H60A 1DJQA 3LERA 1T8XA 4AB4A 2RDUA 2I1OA 3N19B 5G2WA 3UWYA 3W75A 3STEA 1XI3A 1QR7A 1OFQA 2TRSA 1GTHA 4O53A 3PAJA 2C1HA 5KINA 3MHGA 5A8GA 2QCLA 1KFBA 4A29A 2YYUA 1B9BA 1W3TA 5D2TA 3ZWSA 1F74A 5T26A 1X7FA 3QEZA 2ZRZA 3H53A 3EWXA 2NV2A 4K6AA 3VCRA 4HT3A 2ZA3A 4DEFA 3N14A 2VFEA 4MKNA 5L9FA 3THQA 1BTMA 3W2NA 3BLIA 1HG3A 3EKZA 4IMCA 4AF0B 3TW7A 4MIMA 1R2RA 2E1DA 1TRIA 3IIVA 1WDWA 4XWUA 1JCNA 1AL8A 2PE4A 3TA6A 4N6EA 3VFLA 3TSBA 1KW1A 3VE9A 5DN1A 2FQIA 3I68A 4HHPA 2H6RA 5LNUA 3GX9A 2DP3A 3B0VC 4TU1A 3E49A 3MW7A 1JULA 2Y85A 5FF3A 1GVSA 2I9EA 4Z1AA 3QW4B 4NT0A 1JCJA 4FIRA 2Q3OA 4UTUA 3MBDA 1FQ0A 4WJEA 3RFAA 3STGA 3R2GA 2WOQA 3ANYA 3QPYA 3P8IA 1GYLA 4NVTA 1H5YA 4DO6A 1T96A 1KTCA 4GRSA 4S1FA 3UWZA 2W0UA 1TPUA 2CLOA 5EL1A 4U4MA 5E0KA 4UTMA 2X16A 2O7SA 4ZL1A 5EY5A 1IIGA 3S5YA 1KBIA 4KFOA 1RQHA 3C2EA 2E77A 4PEKA 2V0TA 4XTIA 2I14A 1GWJA 3GNDA 5KZDA 3CTLA 2A2IA 3H55A 5I3IA 2NX3A 3I7RA 3SECA 4IXXA 4N4PA 1O5KA 1PS9A 3PY2A 3QJAA 2QF7A 1L6WA 1YXCA 1ICSA 4O52A 2Y7FA 1RVGA 1FUYA 1LRNA 4I7VA 1K7XA 3EWWA 5I3HA 2ZZ5A 1LROA 1SO4A 3SI9A 2BX7A 1W5QA 2NX1A 3PBYA 4O0KA 1LOQA 1D9EA 1D3HA 1HTIA 1MSSA 2QCCA 3G1AA 2XN2A 1GPWA 4LU0A 1FX6A 1QOQA 1VQTA 2E09A 3MWAA 1QPQA 5BMWA 5FEXA 1YDOA 4H4IA 1W0MA 3U6WA 4Y96A 1WOBA 3KVJA 3VKJA 1YXYA 2CZDA 5AC7A 2DORA 1K8ZA 1O4UA 3IRDA 2QCMA 3PB2A 2NUYA 3SGZA 3L5MA 4JY9A 3OVRA 3R8RA 2QUUA 1OYCA 2YDAA 2H8ZA 1NAL1 3W1NA 3C52A 4GUHA 4DBEA 4IGHA 2ZZ4A 2YW3A 1L2UA 3NPWA 2QJHA 4OV4A 3MHFA 6ALDA 4IWWA 3E9AA 1OX4B 3LB0A 3LTSA 4UTLA 4X2RA 4GUJA 1B3OA 3MUXA 1OYBA 1EWEA 4YXGA 4LW7A 1Q6OA 3UWUA 1PE1A 4ZZ9A 4LS2A 4XBKA 1DV7A 5HR7A 4WD0A 3IIOA 2ZZ2A 3O6DA 3FS2A 3W84A 3W7RA 3KVLA 1WQ5A 4AHQA 1M6JA 4K39A 5J5DA 2FPYA 4KKXA 3W86A 3B8DA 5K2ZA 4IMEA 4UTWC 1HL2A 3TFXA 1F5ZA 1R47A 3W1PA 3RF9A 1H7XA 4P61A 2WO5A 3TV8A 1EUNA 1YPIA 1W37A 3LV6A 4ZQCA 1W1ZA 5LSMA 3W07A 2CU0A 4N4QA 1XBZA 1VR6A 4O1DA 2J9XA 3FJLA 3LBMA 5TIMA 3W7NA 3NQ7A 4N9BA 2B4GA 4RXFA 4WY0A 3M47A 3GXTA 3QF0A 3W9ZA 5CPNA 4JICA 2JGYA 2GPTA 5MHBA 3WJSA 2Y63A 1KLZA 1O95A 3ABRA 5FEZA 4MY9A 1VCVA 5FF0A 4WQ6A 2W6RA 8TIMA 1KM1A 4WXYA 4RCXA 3O1NA 3HPXA 3LTYA 4JEQA 4WUIA 5LHFA 3FIGA 3UWQA 1I2RA 3M5YA 4IQLA 2A6NA 4S2BA 2YW4A 2C19A 2FJKA 4O4VA 4JTUA 1Q3NA 1Z42A 5FF2A 5AHNA 2NLIA 3PG9A 4XTDA 4O12A 5AYZA 2PCQA 1GYNA 2C16A 5KZMA 3TE9A 2Y7EA 3NO5A 3CPRA 4ZMGA 3SGUA 4N2YA 3OVPA 4MLRA 3R13A 1G6CA 4AWTA 3W7OA 2ZA2A 1OK6A 1OFDA 1O94A 5K9CA 1GVFA 2Y70A 3NZRA 5HWMA 4TMBA 4IXHA 2H8XA 3DI1A 2R94A 1VRDA 3T55A 3DHFA 5HWNA 2H3DA 3TROA 3TFCA 2NUXA 4ADTA 2QCDA 3ATZA 3TUUA 4OHQA 1MXSA 1N8FA 4BI6A 2G97A 3HF3A 3LCFA 5D38A 4XQ6A 1KM6A 5C2XA 4WY0B 3NOEA 4E38A 3CM4A 3W73A 1TRDA 3WK1A 3QQ0A 5D03A 1QPRA 1SO3A 4RKAA 4RX0A 1N55A 2YPIA 5KTLA 3QRHA 2JKEA 4OV9A 1WXJA 1P0NA 5EPDA 2GUUA 5BRBA 2J9ZA 4RZ4A 3G0UA 5K4ZA 2VEIA 2VFHA 3BG9A 3INPA 4LVAA 2NXGA 1F7BA 3VI2A 3A21A 3S1XA 5HMSA 3TMLA 1TTJA 3EX2A 1ONRA 2OMAA 3G1XA 3CB8A 1T0OA 4QISA 2NWRA 2QCGA 4EIVA 3P81A 1YDNA 4C1LA 4QNWA 4QIUA 3AJXA 4I9AA 5EMUA 3TU9A 3LHZA 2A21A 2J24A 3HGJA 4IJBA 1JRBA 3SR7A 3S8HA 3PUDA 1JCYA 3MMTA 3BG3A 4JR5A 4TO8A 3W7PA 2AGKA 4CCDA 1GG0A 4HIBA 3JR2A 1H7RA 1A5BA 1OK4A 1OVDA 1I2QA 3B05A 1A5CA 1Q6LA 5DLCA 4UFLA 2NX9A 5K9XA 1IXPA 2A1YA 2OX1A 4A2SA 2GVGA 2CLKA 3LHYA 3EEGA 1J2WA 4Z0JA 3B0UX 4RZ5A 2FPVA 4ORMA 3HGRA 5HUPA 4N02A 1M5WA 3QYQA 2CLFA 3H54A 1QDSA 3Q58A 1TPH1 3CQ0A 3QSTA 3PG8A 1AL7A 3IIZA 2VXNA 4AWUA 3GKFA 4RK8A 1LRTA 5I3JA 3T7VA 3PBVA 1TTIA 4NUWA 4LWWA 3O06A 1C29A 2TSYA 1JCLA 3TW6A 3O8AA 1THFD 4GC4A 2OT0A 3L0KA 4MJMA 3C6CA 3QQ1A 3G3DA 3KRUA 4R53A 2ISVA 4DO5A 3G8EA 2NXHA 1YLVA 1EP1A 1Q6RA 3DKLA 4DF0A 2YGYA 3T4CA 3N3MA 3S9YA 1W3NA 4LTSA 4LOCA 3DZ1A 3MP5A 3FLUA 3TQVA 3QW3A 1PCWA 1I2OA 3KRSA 1QPOA 3TCEA 3UXDA 2NV1A 3FYPA 2DJLA 4JS3A 2V8ZA 2WPBA 2FDSA 1NVMA 3UQNA 2Y6ZA 3G1SA 3PBWA 4W9TA 3NQ8A 3ZFHA 3R12A 1OX5A 3K30A 1OYAA 1ME9A 1ZAHA 4JTLA 3EB2A
chains in the Genus database with same CATH superfamily
4KW2A 3E1F1 4K36A 2ZX5A 3PZ9A 1BAGA 2DVUA 2EPMX 4QRNA 3S5ZA 4MLJA 1E51A 4UFHA 4U5IA 4A3HA 3EPOA 1RPXA 4LXFA 5C55A 1DQUA 4O50A 1ADOA 1YTEA 5ABFB 1SW0A 4E2OA 2GSHA 3W7MA 2DH3A 2OCZA 1V6VA 1P48A 2R91A 4C60A 1G4EA 1IR1A 3SCTA 4NILA 1TPEA 2ZX9A 1E9LA 1C9WA 1LT7A 4RNFA 3OG3A 4NI8A 2ZDRA 1QOPA 2C7FA 4JYDA 3CV6A 4O13A 4M6VA 4GI8A 5DX7A 4JTEA 4KWUA 2WCGA 5FJRA 4DAIA 1N2VA 1AH3A 5D32A 1Q85A 2PC4A 2ZUTA 1UD5A 2VUNA 1VJSA 4WY0F 3KHDA 1VPQA 3B06A 1ZGDA 2WCSA 1XD0A 3AZTA 1I1WA 4ERIA 3S4TA 3W00A 4DYEA 5HULA 3UY7A 1QI5A 1PDZA 1TJRA 4LC6A 3ARQA 3CZKA 3PZNA 3OP2A 2WHLA 3P62A 4IP5A 4UTFA 1P0DA 1GQLA 1WZKA 1PHQA 4WOQA 4CUCA 3ZJKA 1F6PA 2E6DA 4KCVA 5CPLA 2PPGA 1JNEA 5H2ZA 2VVSA 1W1YA 3BLFA 2P88A 1FCUA 1CX9A 3AXKA 4Z17A 3EMCA 3PSVA 1QRQA 4HMCA 1VIWA 4C6NA 3WDRA 2JBMA 2W62A 3IGHX 4L9YA 4PUKA 4MGGA 4CN4A 3QMTA 4WSHA 4JIPA 3U4FA 2XU2A 4WJXA 1MYRA 1XHGA 2RDWA 3VKDA 3QY7A 3LMYA 4HA3A 3VOJA 4OU1A 1XC6A 2W63A 3S5SA 3EWYA 4MB5A 2X09A 2GQ8A 3KL3A 4JXCA 4KWOA 5FACA 4V1XA 3M5XA 4F2TA 5K9DA 1ZY9A 4D2JA 4QTGA 2VD8A 2AKMA 1XIIA 4JTKA 4Y9PA 2HSAA 2PTYA 4XZ9A 2BXZA 3KFTA 1HGYA 3ABQA 3WD1A 4B90A 3W2LA 1AD4A 4C6OA 5H91A 2DZUA 1EWDA 3VMNA 4FNSA 4NZ1A 1O1ZA 2X2YA 4PSPA 3QGAC 5CJ5A 3WZ0E 1JYWA 4QAWA 1H51A 4BY3A 3TZFA 1JD7A 1LWIA 1L9WA 1BLIA 3DAQA 1TV5A 1GG1A 3FXYA 3KAOA 2FTPA 1WKYA 4YTSA 5I09A 4BCEA 4CEXC 4MY1A 1JPHA 1WDSA 1M1BA 3W1UA 1TQXA 1QNRA 1EOMA 1J9YA 3HG5A 4JFWA 1Q45A 1FWJC 4DI9A 2DSWA 3W7LA 2JK2A 4G7EB 3SUWA 1K8CA 3P80A 3N9RA 2A5HA 1W5OA 2XIBA 1UR9A 4DZAA 3WENA 2XSBA 1DJGA 2ZX8A 2TPSA 1W3IA 2PDHA 1QJWA 1JF5A 3MSDA 3CPUA 2OB3A 1QW9A 3SSZA 5LGXA 1I2NA 1E9YB 1J6PA 3PC0A 2V2CA 4UBPC 3WG6A 3PF3A 2VFDA 1JCMP 1UOKA 2FTWA 3TR9A 1PIIA 3LDVA 3UJSA 1PXGA 1NH6A 4Q8PA 3PPFA 4IOTA 2NQZA 3T2QA 4UR7A 2VFFA 4ZVJA 5HATA 1HP5A 1GNXA 2G96A 4DZIA 5DO8A 2YBTA 3CZ8A 4ZBCA 3WQWA 5A3HA 5DRIA 5D05A 3PUGA 4NIRA 4IMDA 2X1RA 3CZEA 4FF5A 3MTWA 4XD6A 4H04A 2WVTA 3STCA 3D46A 4NYUA 3QYSA 1KQZA 3M9YA 2WV8A 1NFBA 3NA8A 4K38A 3HQ1A 5H6HA 3BPWA 3V36A 3VKAA 1MEIA 4JTRA 4FNTA 2Z2AA 3S1WA 1JCXA 2QCNA 1IR2A 2DJXA 2QMJA 3BAJA 2A7NA 4XD3A 4S3EA 4ACZA 3AALA 4E2BA 1E6RA 3LTPA 4G1KA 3E02A 1I9CB 2PBGA 2C0AA 4X9SA 2J77A 2G50A 1P6BA 3OIHA 3RG6A 3CV7A 1JDAA 4PMDA 4QROA 3PNZA 2PGFA 4Y2WA 3UZXA 4UTKA 2O9TA 1T99A 1SZNA 2P0IA 3IIXA 1XGEA 1E6XM 3W7QA 4JIHA 5CQ1A 5DEZA 4O0ZA 1RA0A 4OUIA 1FDJA 4P7QA 5H8PA 5MF5A 3A6OA 3BW4A 1GZ1A 2A3LA 4Y9MA 2Z6IA 3SIZA 1QO2A 2QPXA 2ZA1A 5GQBA 2GJRA 2FH6A 3MA8A 4C7DA 1KFEA 1V0LA 3IACA 3VO0A 2E7FA 2R1PA 2ZRWA 1HN1A 1ZU8A 2CC0A 4LYRA 5AYIA 4A22A 4NG3A 1LM1A 3UT0A 3O9NA 2V3GA 3NZPA 5F1VA 2HJPA 3DFOA 4DBDA 4BFAA 4GH1A 3KBVA 1XW8A 4NZ3A 2F38A 2NT1A 5JBEA 3A24A 1G4PA 1Q8JA 5D8WA 4ACZB 4AIUA 3OGRA 1BG4A 3C0LA 1E6SM 4L4OA 1IGSA 4E3VA 3P6LA 4J35A 5HUOA 2PDXA 1PCKA 4BR1A 2GVYA 4TMCA 4YTTA 2C3ZA 3CUIA 5JVLA 1K1DA 1RBOB 3N9KA 1Z32X 3BTNA 4GVHA 2V5LA 4MSSA 3I6TA 4YJ5A 5F1UA 1L8PA 2A3EA 3WDJA 5EYWA 3APYA 3VIMA 1PSCA 3ECQA 3AROA 1KRMA 2PLCA 3CWHA 2A0NA 5A6AA 3SN4A 2QNEA 3GXIA 3N4AA 2QJMA 3HU7A 1PTDA 1Y0EA 4W89A 1SZFA 3NDYA 2PWDA 4US5A 6TIMA 1SJDA 3C0SA 3M7SA 1VLIA 5D09A 3MP3A 5FEWA 2KAUC 1CIUA 1W3LA 4ZSTA 1TR1A 4RDVA 3IVTA 5HINA 1NTHA 5B80A 3E0VA 2ZRXA 2XN0A 5D2VA 4J2MA 1AH0A 3WF3A 3GU2A 3SFKA 3VDCA 3CIVA 3OTRA 3AHVA 3OOQA 2V38A 4A21A 2FFIA 1CXKA 2YCLB 4DN1A 4M56A 3T0DA 1E6NA 2PDWA 4N6FA 1R30A 5A69A 1FWRA 2B7NA 1BXCA 3W1TA 1ZJIA 1A3XA 4HK5A 3ARRA 2IXUA 3UXLA 3ME3A 5AHMA 4K7YA 3VNDA 3O0KA 3R0KA 2W91A 1HO1A 2FLIA 4Z1DA 2YA0A 2D1ZA 1RPKA 2CEQA 3DYMA 4W5ZA 2INZA 4IFKB 4CGTA 2ZUWA 3BQ5A 4GXPA 1SYTA 3GDRA 3ZR4A 3MUCA 1J5SA 5I78A 2DT0A 1HKIA 4UR9A 1IHIA 3ZLGA 3SQMA 2BY0A 2XIQA 3WLNA 1TPWA 3RPMA 4FXFA 3MUZ1 1R2TA 2WNNA 3AYVA 4KGJA 5FEPA 1X8CA 5C2CA 3GTNA 1UIOA 5FESA 3L0NA 2QDHA 3LHUA 1XM3A 4GY0A 3V0TA 3RPTA 3SY5A 5F4WA 1W2PA 3FN9A 4X60A 4EF8A 4DLFA 3N6QA 2PDGA 3ZMRA 2RGLA 4JTIA 5HJLA 1W1A1 1YTKA 4TVUA 1KFJA 3ZJ7A 3AIEA 3TTEA 1TV7A 4JDBA 4S2CA 4IQJA 3G22A 2PU1A 1IXQA 1NWSA 5JBFA 1CXLA 2ZOXA 4G6CA 4QSHA 5DCDA 4AMAA 1JI1A 1MQRA 2F84A 2PDKA 2IW0A 3GTHA 4AD4A 3T9PA 1FWWA 5EBUA 1L0PA 1E3XA 1LL6A 3EXRA 3VFCA 2PLMA 3BOLA 3V5FA 3SCSA 1V0NA 4ZR8A 3LLDA 3MHUA 3ELFA 3W4RA 1FHLA 2WJZA 3KP0A 3LXCA 5DANA 5A5WA 1WV2A 3HG4A 1H0IA 3L5LA 2YL9A 4EF9A 5CZ0A 1QU4A 3MU7A 3BDKA 1WBJA 1M9HA 2I9UA 3S3GA 7A3HA 4IJCA 3DHDA 3MKCA 1LLOA 3LSCA 3FK4A 1UKOA 2C18A 3GDLA 4H8VA 4LYKA 4CNPA 1W9XA 1KNWA 4DUXA 3BSHA 1PZ2A 1EUAA 3WH5A 3AYRA 5I79A 4PC8A 3CPGA 3BC9A 1J0HA 5BOEA 3HPZA 3WH7A 4PR4A 1QW8A 1RK5A 3PULA 3NG3A 3PZUA 2Y89A 4MWAD 1JUBA 2VVNA 2QIIA 4LF1A 3EMQA 4UNKA 1EXPA 1CGWA 1M7OA 2ZIDA 3VCCA 1GZGA 3RLVA 4DBUA 1ZCCA 3SCQA 1HFBA 4QGCA 4JKLA 3KZSA 3LN3A 2V6AA 2FZDA 4LCSA 3LQGA 1SZEA 4ZA0A 3PSWA 1LRQA 1MXGA 4BQ4A 5CC5A 4E0CA 5LKYA 1US0A 3WJXA 1GVEA 1XFBA 5LXXA 1YADA 1XRVA 1TJ2A 3FYOA 1V3HA 2P8CA 3EKGA 3CLMA 4HZ8A 5E0FA 4XZNX 4Z08A 1RQEA 3DECA 4XKYA 1VHCA 3E0FA 2G3MA 4HN8A 2HCVA 3AAMA 2VMFA 2G4JA 1FWTA 4IQDA 1UR4A 2D22A 2DFAA 3T8LA 3ES7A 2HXTA 4HU4A 1QI4A 3T8QA 3UYIA 1P7TA 2YCEA 5IHRA 3B40A 4ZOAA 4FLOA 3B03A 4WX2A 4DRSA 1FCVA 4NP7A 1LWJA 3GZAA 2OZTA 3UR7A 3AU2A 1QFEA 2YA1A 4NSBA 4BF7A 5I07A 4PCFA 1IWPA 1SFLA 1I45A 1ZHAA 4IP4A 2NUWA 3W7JA 5AYBA 4U10A 3NL2A 4HZMA 2PDYA 3IUDA 1GCYA 4XAPA 3KRBA 2J88A 5M1TA 3IAQA 4YMZA 1OFPA 3G2GA 4OWGA 3GNRA 1R3VA 3A3HA 4C1KA 2GUYA 3L4XA 4PCPA 3PVFA 2ZUNA 3S47A 5G5IA 3P74A 1EIBA 1KKRA 4JYEA 4Y8FA 1RAKA 1MVYA 4K8HA 4OIFA 1H62A 3BH4A 1LL4A 1E71M 2V5CA 4AHPA 2J27A 2VM8A 3K4AA 4GABA 2ZADA 4MYAA 1R3WA 5EMLA 1OCJA 1Q5MA 1NQKA 5EA9A 2PWGA 3HJEA 3Q4DA 1DWFM 2YJQA 1BQCA 1UR8A 5HQMA 1I60A 1UC5A 2FDMA 1SMDA 4AD5A 1E0VA 3LCLA 3SCVA 3CUJA 4KFNA 1Z69A 3WYZA 2EPHA 4DJFD 1IIHA 2G8ZA 2DSKA 1OABA 1W56A 4EOUA 3NQBA 1O7AA 1OFAA 4ZQOA 2D2JA 3OQ8A 1AMKA 3WLPA 3WMCA 1D7KA 5CGQA 1YNPA 4D6IA 3HGSA 3GY1A 1DXEA 5BOOA 1Q4NX 4HNNA 2HPIA 3W7HA 4GPNA 4HSNA 4ZE5A 3NL6A 3ARXA 1D8CA 2FMNA 4B2DA 1HL9A 1S2WA 3OZMA 2V2HA 4H00A 1TZ9A 4JCLA 2Y5SA 3RLUA 3LI1A 3ATYA 4XZWA 3F5JA 2ZVIA 4FHAA 2B7OA 1ZP4A 4Q8TA 3AS3A 3U7BA 1Z89A 1T40A 4QNEA 4R33A 1ISZA 2DQWA 4LAMA 4TVDA 4O54A 2EPLX 2NLYA 4H6EA 1QK0A 3VXGA 4TTUA 1DJWA 3IS4A 5MKGA 4RPQA 1CTNA 3EX1A 1EPXA 2C14A 3GIPA 2FKPA 1J5TA 1EJVC 4JTGA 2Q8ZA 3GSMA 3WFZA 5IRPA 1CGXA 4JTFA 1XR2A 4QX4A 5CPMA 5H8UA 1G4SA 3KTSA 1QW7A 1JJKA 2GQ9A 1GZJA 1E70M 2ZFAA 1XKJA 2QPUA 1VP5A 3FEMA 5GJMA 3NGFA 4J3SA 4D8LA 1EA0A 3NSNA 1AUSL 4NZ5A 2YXXA 2YXGA 3TSMA 5U4NA 1TZZA 3K5XA 4NZFA 3EDFA 2XWDA 5FI8A 3TK7A 3VUSA 2V82A 4JTTA 4RNJA 3KRZA 1GKQA 1UA7A 2UY5A 1H50A 1B2YA 1OC7A 5C9ZA 3REQB 4ZFCA 4DF1A 1XYAA 4B9YA 1BSIA 4YWIA 2IPFA 4FX7A 3T09A 4JQ4A 4X22A 3STFA 3V18A 6XIAA 3GAKA 4Q4KA 2RDTA 5D2YA 2CBUA 1TWDA 5HNUA 2QV5A 2YZ5A 2AL2B 3BLEA 5IOBA 3KTXA 3R7MA 1U1JA 3NEVA 4DJED 5D02A 1DXFA 2HRWA 1EJWC 3E2SA 1U2YA 4IFRA 1FCQA 1A5OC 4MPKA 1XYFA 4O8RA 2JEQA 3L4UA 2E0PA 4DBWA 1GVRA 4J28A 3ZWTA 3GLCA 5TAOA 4PCNA 4HA1A 4QQUA 1JYVA 5REQA 4AD3A 4UTHA 1AQ0A 4Z1BA 1NWUA 5M5DA 1TKKA 2F6XA 2QVNA 4PBGA 4YHEA 4P2VA 1JVNA 3BAXA 2PODA 1W5PA 5DY2A 5A6SA 4MUZA 2OWCA 3GNNA 4U5KA 1AVAA 2YOCA 4DUVA 3PUEA 4WJ8A 4E2DA 2QIWA 4JX6A 3A23A 4ZQNA 2BODX 2DZXA 2F7FA 3VKCA 3WD3A 1CLKA 1TQJA 4M6QA 3USBA 2CLHA 1QI0A 3TWBA 1H0GA 4AXKA 4TX9A 5IM51 2VR5A 4TR9A 4L64A 1IXNA 2ZZ7A 1OCNA 1NU5A 2XH7A 2E6FA 4IMGA 1QWGA 4YYCA 3SIMA 2XGIA 3H23A 1JYXA 1DWJM 1EB3A 1FRBA 1TJ0A 1B9ZA 2RJHA 1ZZMA 1EKOA 1HUVA 3TZNA 3W7DA 3EOUA 5J8LA 1LORA 4O28A 1JL8A 1PL9A 3UPBA 2PDIA 4RW3A 1DE6A 3UR2A 3E0LA 4UQEA 5FAGA 1WOAA 3Q37A 1YE4A 2AL2A 1G69A 2OTDA 2XHYA 3T0AA 3C4UA 2GQAA 5CPQA 4XVDA 4BF5A 4J9JA 3OZYA 3NQVA 5LA1A 1MW2A 2VR2A 4GGBA 4D8ZA 1XL9A 1UKQA 3G3MA 3SZ8A 4LQ1A 4XBSA 2X0HA 3ISIX 3LSBA 1TG7A 2IMRA 2WKLA 4JTHA 1SR0A 4I9MA 1CBGA 4IM4A 1LUCB 3G5EA 3ZIZA 4NJKA 4JX4A 1MRAA 1UZHA 1XISA 4ML4A 2CWNA 2WQPA 2J78A 4E6MA 1BQGA 1WAUA 4ZQMA 2J8GA 2YFOA 5AFDA 3HFYA 3NQEA 3E2QA 3M1ZA 5FIPA 1P4CA 1RSCA 1EF2A 3DOPA 3WO8A 1DWHM 1T8XA 4LYQA 1GKPA 3A4JA 2JQXA 3U0HA 4R7WA 2DEPA 4RE0A 3W75A 3AUOA 1OFQA 2C1HA 1XRSA 3BJSA 4L6HA 2CESA 4A29A 1W3TA 1F74A 1BXNA 5T26A 1Q7MA 5A6LA 3QEZA 4GMEA 2WVUA 3H53A 2ZA3A 4MKNA 2TODA 3T07A 5C71A 1BTMA 3BLIA 4F0HA 3IIVA 3QY8A 1AL8A 1LUCA 4DWDA 3S6TA 3ARTA 1NIUA 2CYGA 1V8EA 4A3QA 3I68A 3LQLA 4ZO6A 2H6RA 3M64A 3GHTA 2X42A 3SN0A 3SUVA 3WUGA 1JPMA 2OLHA 4AZIA 1GVSA 5CZKA 2I9EA 1JCJA 4FIRA 3MBDA 1FQ0A 5BXRA 3PZIA 2ISDA 3QPYA 1EJSC 1H5YA 1SFTA 2P76A 4DO6A 4V28A 1KTCA 4GRSA 2GGGA 1GHSA 3PN8A 1IEIA 5ABFA 4Q3MA 1TELA 1RLDA 1OIFA 3QTGA 1KCZA 5E9XA 4KRUA 1RQHA 2PWHA 2E77A 2MUCA 4YVVA 2F9RA 3CTLA 2A2IA 3UW6A 4LAUA 5EMJA 3KM8A 1QI3A 1JIBA 3QJAA 2AQVA 4O52A 5E5CA 1NELA 4IHCA 3ARZA 2CHOA 1LRNA 5GPRA 3WBYA 5I3HA 2ZZ5A 1V77A 2DV0A 1BYDA 3GXDA 1GPWA 4LU0A 1DIDA 2VC7A 5E70A 2E9BA 2E09A 1PPIA 1QPQA 4RNHA 5FEXA 1E56A 1YDOA 1B3WA 3U6WA 2DQXA 3WH8A 4LUSB 1DWIM 3WUEA 3THCA 1E4NA 4JFSA 1OINA 1JCTA 1XLBA 2QUUA 4G5DA 4IF2A 2H9AA 3SY1A 1NAL1 1HJSA 4S3AA 4DBEA 4AEFA 4GOAA 4FP1A 1IZJA 3MHFA 4B4HA 2L5HA 3KOYA 2Y8UA 4X2RA 3VABA 3QKEA 2J7CA 2BDQA 1Q6EA 4MWAB 4D8AA 3UG8A 4Z2KA 4A3RA 3VIIA 3V0SA 1Q6OA 4LS2A 3ZVIA 4UZUA 1E1CB 3CZLA 4C6MA 3MVTA 3WDPP 4K39A 2C0HA 3COTA 3G1RA 3WFLA 1HL2A 2G0WA 1UUQA 3PFRA 1S38A 1BYCA 1XQLA 2YBUA 3CZGA 1W1ZA 1F9CA 1XBZA 3S9ZA 1VR6A 4O1DA 3FJLA 4QBXA 2PDBA 1VFUA 3LBMA 3FV9A 4S38A 2B4GA 3DGBA 5CXPA 1TA3B 2REQB 2V3FA 5CPNA 3WDQA 1Z8AA 1GOIA 1FFQA 5MHBA 3NEHA 2QUNA 5FJUA 2INEA 4JNYA 3B0XA 4E2VA 1NP2A 4JEQA 1U33A 2FVLA 2GWNA 5LHFA 2HDJA 4GH3A 4PTDA 4S2BA 4AIOA 4U2ZA 2YW4A 1XLKA 2FJKA 4O4VA 3RLHA 2QMKA 3PG9A 4XTDA 4GK8A 1GYNA 1CNVA 4MJ2A 4ZMGA 1REQB 1UJQA 3R13A 5E0CA 3KE0A 1OFDA 2X7WA 1GVFA 2H8XA 3DI1A 1H3GA 3N6JA 2Z1KA 3D6NA 3MPGA 5FJOA 3MCOA 2QZRA 1XIHA 4G9PA 4S3JA 1KB3A 1MXSA 3VDHA 2D2HA 3BCJA 4GQ0A 1VEOA 1XCWA 2W5FA 4HPHA 1ITCA 3ABXA 3WLJA 5D03A 4URIA 5AVHA 1N55A 2V5KA 1IEVA 2EG7A 2DUZA 1PWMA 5BRBA 1FA2A 2I16A 4GYJA 4EANA 1M04A 4Q8VA 2NXGA 5M3WA 1F7BA 1FHUA 2V68A 4XSMA 3S1XA 1Y5XA 3WD4A 5HMSA 1TTJA 3PJXA 3CB8A 3G1XA 4QISA 1V6TA 1KQYA 1S39A 4J3TA 4YWSA 3P81A 1H49A 3VZXA 1J18A 2J66A 3TU9A 1K70A 4GVIA 3LHZA 2OSXA 1X98A 3HGJA 4IJBA 4X61A 3SR7A 2WSKA 3MMTA 3BG3A 4JR5A 2E67A 4JQ3A 4HIBA 1H7RA 4IMAA 1OK4A 2PDLA 1BRLB 3ANUA 4KF1A 3SBFA 1BVZA 2Q6ZA 1IXPA 2A1YA 3SCOA 2CLKA 4I8YA 2PTDA 3B0UX 1E6PA 4RZ5A 2FPVA 5IFTA 3EDEA 4HZ6A 5E09A 1W1IE 1TPH1 3BOXA 2HNEA 3CQ0A 3DC0A 3PG8A 2P50A 1OEPA 2VXNA 4AWUA 4GZIA 3MT1A 3PBVA 3PTQA 4MKSA 4L65A 2GGHA 4B3KA 2D0GA 1THFD 1KBLA 1EZWA 4IUGA 2QS8A 3TWAA 5I3DA 3QQ1A 4GI9A 1M01A 2WLYA 1EP1A 4LBRA 3DKLA 4DF0A 2YGYA 1UWAA 1XQKA 1MXDA 3KRSA 2NV1A 3BCFA 1PYFA 4TX6A 2DJLA 3WQCA 2FDSA 1NVMA 3QXBA 3GVVA 1WKDA 3W81A 3G1SA 3MJMA 3K1DA 3VNIA 5CAKA 1J2BA 2FYMA 3M4HA 3R12A 3K30A 1ME9A 4HU3A 4JTLA 3EB2A 1MNSA 3UD6A 3WEZA 1UUMA 3OO2A 3VOCA 1X6NA 5DCBA 2Y8KA 1CI1A 1IZKA 1GJPA 3AHXA 4QLLA 1AJZA 5LIWX 1WXZA 1CCWB 2ZXDA 4FNQA 5LIXX 3QSRA 1C90A 1UD6A 1JZ3A 4AQLA 3K1GA 4Z2GA 3M0HA 1R3RA 1B3ZA 3MWCA 5AC4A 1EXBA 3W26A 1R9ZA 5AYYA 1K8YA 3O15A 3GBEA 3BOFA 2BHYA 1YXDA 2HV5A 1XFCA 2CFFA 1EDTA 5I00A 1KBJA 1TSIA 2Y0FA 1E1CA 3PBGA 1NDVA 5G4HC 3UGRA 4U31A 1GOXA 1DJNA 2X1UA 1WP6A 3G1VA 1Y7VA 4QLKA 2C8NA 3NPUA 3GKAA 3GR4A 4GNVA 4X0NA 3O7UA 1X38A 2JEPA 1TWSA 2LLEA 3W27A 1UKPA 1YRRA 3G1HA 2VOTA 2D2GA 3RILA 2J8TA 8XIMA 3NM1A 2R14A 4FR1A 3GVGA 3P82A 3QLLA 2GZXA 2F8QA 3LU2A 1PZ3A 3AC0A 3LRKA 3WK3A 5HOSA 4KQNA 3SM0A 2Y88A 1KKOA 5KETA 1PX3A 2XFWA 4AWSA 2ASHA 3QMRA 1Q2SA 1E4MM 3SO7A 4M51A 3CAWA 4C6JA 1G5AA 2SFPA 1A5LC 2ZYFA 2GJNA 3O6YX 1BYBA 1XIEA 1FVPA 4FA3A 1QCWA 1LOSA 3GB6A 1N7KA 4CQ8A 3OYZA 1WCGA 3HPFA 2YDQA 3TP4A 3GU1A 4GI6A 1YW1A 3B8IA 4XAFA 1ZJHA 4JN8A 1SZRA 4AX7A 1DHPA 4KERA 2CKRA 4M3PA 4Q7NA 4PB3A 1MDLA 2PDJA 1XF0A 1ZFJA 3GAYA 4HPGA 3FGCA 4QDWA 1H7NA 3WQ4A 3N11A 1KLYA 3IEBA 3VK5A 4KFPA 3FFSA 2GQ3A 1CXHA 4LUJA 3QC3A 2ACRA 2XYLA 3WLLA 4ICMA 2V9DA 4LSBA 3OGSA 4R7OA 4K1WA 4NX5A 3W6YA 1HVQA 2IKGA 4DJEA 1PKMA 3BICA 1FWBC 1BKSA 4HGXA 5CKSA 3VKKA 4I5XA 3UNDA 2Q8XA 1ICPA 3C61A 1TWZA 3ITGA 3U7VA 3S6DA 4UTWA 4K8GA 2CPUA 5DCEA 4O16A 2XVPA 2CHRA 2A4AA 1XUUA 1EF3A 1XRTA 3DI0A 3CUZA 4X63A 5GNXA 5HMDA 1A5NC 1VBRA 5FL1A 2NWSA 3CMJA 3LS9A 3B9EA 1VFTA 2EKGA 2OT1A 1E15A 1FWCC 3GNPA 4BK9A 1AQMA 1TCMA 1GQNA 1TV2A 2PWVA 3R0UA 4UZSA 5DMLA 1VBUA 3T08A 1K77A 1CT5A 1EDQA 3NQGA 3FJ6A 5REQB 1MO0A 1XBXA 4F3HA 3W74A 3WQEA 5EMYA 4B9ZA 4W8BA 3VD3A 3GW3A 1NY1A 2WZEA 3LXBA 5TF0A 2X05A 3CEPA 1PZ1A 3URQA 1RZMA 2VZUA 1QO5A 3C3NA 2V3DA 3U2CA 3NO3A 1K9DA 4IT1A 1DJIA 4EXQA 2XFRA 1JDDA 3W1XA 2HVNA 5JH2A 3NZ1A 1KWKA 1W8SA 4MMWA 4NAFB 4ES4A 4ZQRA 2A79A 4FALA 2QCDB 1EBHA 4IPNB 3IRSA 1XIGA 3LLFA 1PKLA 1SJCA 1E4LA 3RLGA 4AU0A 3PK7A 1ZP3A 4YHGA 3BANA 3EWUA 3EKLA 4MNKA 3N9SA 3ITCA 1ME8A 2VOMA 4FIQA 2P5NA 4YIWA 4H8NA 1XYBA 4PMYA 2PRLA 3WQPA 2PRMA 2CNCA 3NVDA 1SSDA 5E1QA 5L6UA 4GJIA 3GO2A 1G0CA 4CKQA 3W1AA 1LQ2A 1TMQA 3A5FA 3B97A 3UCDA 5C9XA 2WZHA 3A9IA 4A8NA 3M5ZA 1VH7A 4FX6M 4CNSA 2WAGA 1E0TA 4ZXLA 1KGUA 3BQ6A 2A3BA 3E2VA 4P8UA 2DT1A 4F9JA 4CQAA 3QM3A 1VYRA 7PTDA 4UTJA 4EE9A 3HG3A 2HTMA 3EX3A 3TJLA 1PVNA 4GIRA 3G6LA 3A3WA 3RHGA 4LY4A 4ERGA 4AVOA 5DT7A 2HE5A 2V30A 4D6FA 3DFHA 1YPXA 7TIMA 6CGTA 5DRCA 1TPC1 4PL2A 5G2IA 4O1EA 3DG7A 3N25A 2P10A 4ERAA 2IKIA 1OFEA 5M03A 1CXIA 1H7OA 4B3LA 2GJLA 1XIFA 4YVXA 1RXOB 3WLIA 1DXIA 3IPWA 1LQ0A 3UWWA 3NXLA 4Q8MA 1C92A 2Z1VA 3ZVHB 4D6JA 2QUTA 3KCLA 2B81A 2JE8A 1JR1A 1IYXA 1GOOA 3LX9A 1SFSA 1TPFA 2AQOA 3TX9A 1TE1A 4NZJA 1JZ4A 3PJWA 2BXYA 2GYIA 2VI0A 4D1IA 1G7UA 5D2WA 2PZNA 3GW0A 1K7FA 2PGWA 4CD7A 3E2RA 1FOBA 4Y6GA 3DX5A 5I6SA 3AIWA 2OXNA 4PMVA 1UZ1A 4MFEA 3W38A 4MVAA 2WHKA 5A8QA 3LZ3A 1E0WA 4XO7A 3GHSA 3GS6A 3NR0A 4DHGA 3LGEA 4OT7A 4NI3A 2YX0A 3FVDA 1Q8AA 4UMBA 3WNMA 3CQKA 1ITXA 3N04A 3UCQA 4ONVA 2Z26A 3N2XA 5M2FX 5BU6A 3NQMA 5U7SA 2YL6A 1XXXA 4DELA 1XCXA 4WR3A 1IEXA 1Q13A 5M17A 4J40A 3KEHA 3SQLA 2FVKA 4CNTA 3KL0A 1JZ8A 4M24A 5JH1A 1EHNA 4Z2JA 3H6OA 4LB4A 1TR9A 4K2SA 4IMFA 2YYTA 4BA0A 3SRDA 4XKMA 1E4IA 3WLSA 3IVUA 1UPMB 4XUYA 3QV6A 3O3RA 4NJHA 1FH9A 3BSMA 1VPYA 2WXDM 3LOTA 1F76A 3W6MA 4CU6A 3VIFA 1TJPA 3CHDA 2E68A 4PUUA 3A4WA 4LAOA 4O57A 3C8FA 4W88A 3QTPA 2UZ9A 5A95A 2HQAA 1CB2A 3EPNA 3AIUA 3SCUA 2F61A 2KZHA 2B0MA 3U8GA 4TUFA 3GE7A 1HKMA 2H3BA 1Z41A 3FSTA 2VGBA 4LALA 1J8VA 4QM1A 4L1XA 1XJBA 2PDMA 3CWOX 3EOEA 4S3FA 3AHYA 1H4PA 2Z0IA 4H83A 2PZ0A 2I5QA 3THUA 1WDDA 1TV8A 2X40A 3VNYA 1OGGA 4W7VA 4JTJA 4Q7IA 3GK0A 1FP8A 1SR9A 1G94A 1TX2A 3NQCA 4FK9A 1LBMA 3OA5A 4BKNA 3AI0A 4HPNA 2BASA 4RZ6A 4O4WA 4C7FA 4GLEA 2HS8A 3HPSA 2E6AA 3W29A 4HJWA 5CZJA 3PS7A 3F1QA 2ZTKA 3G6MA 1C9DA 2YB1A 4JQ1A 2V2DA 2OWWA 4CD4A 3WEOA 1DJYA 2RFGA 4JTAA 3AUJA 4H7ZA 4Q8WA 1LP6A 1TPB1 1QNVA 3FXGA 4MWAC 1K9TA 3UPMA 1GOQA 2ZUVA 1OCBA 5C9WA 1GQJA 1V0MA 4EAYA 4EK7A 3ABOA 3CJPA 2YB4A 4O10A 3BURA 3VNJA 1MQQA 4FOJA 2J7EA 5XIAA 1L8NA 1JGIA 4NHVA 3T44A 4OZOA 4D6HA 1VBGA 5DY3A 4UB9A 4LJ3A 1QHZA 4FNPA 1PV8A 2J74A 3FAXA 2Z1WA 3OYXA 1W31A 4JGDA 4OBTA 3ONBA 4MDOA 3NQ2A 4ML9A 1JG9A 3BSGA 3TR2A 3TXZA 1JQXA 5ENLA 2MNRA 5A1AA 4Q4MA 1VRXA 1NDZA 1EBGA 6TAAA 1G9HA 1GOMA 4EKJA 3EOLA 4UTTC 2BGSA 3DENA 2NXIA 5AZ0A 1R9YA 5KMYA 3WUBA 2GL5A 4ZGYA 2ZTJA 1K3UA 1IEQA 3W85A 3M44A 2TMDA 3O63A 1O5XA 1IQ8A 3UA4A 1QVBA 2ABBA 5E9AA 1BXBA 3SN1A 5I3FA 1WDQA 2VWSA 1RALA 1MMFA 3KBJA 4AZBA 5A6TC 4V15A 3WD0A 1ZL1A 3GG8A 5BOFA 2B7QA 3CT7A 2WYSA 1JXKA 1GTEA 3VX0A 2J13A 4ALDA 2VWTA 3QV9A 1A5KC 3IVSA 4KCUA 1FH7A 2B7PA 3V35A 2DU2A 1BWVA 1BD0A 1RJRA 1AJ0A 3VTRA 3TQPA 4Y9OA 4M5PA 2QEZA 4M8UA 2EJAA 3OHIA 2VHLA 5KZEA 1I6NA 3G0XA 1S5MA 2WNZA 4OKDA 4F8XA 4Q8NA 2V5BA 1UQYA 3W22A 3VGDA 1C7TA 3WQ8A 3ARSA 3MCNA 3KHJA 4IP7A 4DI8A 1SW7A 1D3GA 1T8QA 3D3FA 2CZ5A 2CLEA 3IK4A 2WJDA 3F4DA 1XLCA 3R4IA 3L4YA 2BSLA 4HK6A 4FB7A 2E8YA 5IHSA 3W70A 2QJIA 3N18A 4B4FA 1OFBA 3FJ4A 4ACYA 2P0OA 3QPZA 1TCDA 3CMGA 4MDPA 5AKQA 1OZMA 2FMOA 3BL3A 3D3AA 3O07A 1ITUA 4DX3A 2XSXA 3PWAA 1DKWA 4I90A 1EX5A 1QHPA 1LCOA 3B8TA 1XUZA 1VYSX 1XCFA 3AFBA 4BEQA 3M6YA 4JD4A 4J3UA 4F0RA 2VZVA 3KOFA 3KZPA 5F2GA 1TV4A 1NQ6A 1YTDA 2CLMA 2WMIA 1WB0A 4LVGA 3N2CA 1BGGA 3EMZA 3H21A 1XIMA 4G8TA 1RA5A 1UA3A 3F4WA 3ES8A 2WZIA 2XTKA 3UVIA 1HKKA 4FF7A 1RLCL 1C3FA 3WBWA 3QGVA 4GJ1A 2J6XA 4ZB2A 2QV4A 1BPLB 4W84A 1KGWA 1S2UA 1TPVA 3CU2A 2BWGA 1Q66A 1MDRA 4WRHA 1ZUAX 2HS6A 4OE7A 3NOYA 4ATDA 4WDWA 3Q65A 5T9CE 3U5UA 5G1YA 2DSUA 1BGAA 2VGGA 5LGZA 1KRCC 4WSJA 3VX1A 2CW6A 4GE8A 4CQBA 3UR5A 2O4MA 3ZQ9A 3PPCA 2R1KA 2Z28A 2WKJA 1EZ2A 2BNJA 2TYSA 4M7TA 3MVIA 2D20A 3W01A 4H8UA 1PX8A 1SQ7A 4K1GA 2ZICA 1GEQA 1YKWA 5I7GA 3HTWA 2ICSA 5AVNA 3RO6A 5J5RA 3K13A 3M0KA 3N13A 1R0MA 1R85A 5C9RA 2OX4A 2ABAA 4DBSA 1RJPA 4PTNA 4HOXA 1A5UA 3W2MA 2C6QA 1I0BA 4GIYA 4HPXA 5EBAA 3LY0A 1OCQA 4REQA 4Q7BA 4WVXA 3F5KA 3N2BA 4AAJA 3C2YA 1H1ZA 3CHVA 1VZWA 5AC8A 2XM1A 4PZVA 4GQRA 1O68A 3MKVA 1SO6A 3M41A 1B5TA 2DDXA 3IUHA 4KWSA 3WJZA 3P3BA 4MNJA 3LRMA 2PBOA 4HCDA 1RD5A 3B0YA 2JALA 3RX4A 1TIMA 4GQBA 1KM3A 4Q8QA 1SZGA 1B3VA 1GJUA 3M0VA 2A3HA 4GIEA 5CJMA 3RN6A 1XPYA 2UWFA 3VC6A 3A22A 2EPNA 3TYAA 1GHRA 4WKFA 1FKXA 2YCKX 3TONA 2ZCGA 1JNDA 3W2UA 4O19A 2VFIA 1HF6A 3U4AA 5CGTA 2Y7DA 4FOKA 4DY1A 2EXOA 1X1OA 3A3XA 1J96A 2VZSA 3QZAA 3SY8A 3B4YA 5FOOA 1PB0A 3QZ6A 2ZQ0A 1U30A 3H12A 2G4FA 1F2JA 1QUMA 4AIEA 1A5AA 3ALGA 4MHBA 4WSKA 5MKGB 5A6BD 2DZPA 3KWSA 3V1PA 1GVYA 3S46A 2X30A 1DJXA 2PEVA 3V0UA 3VOHA 4BQ3A 3BXWA 3F03K 4LF2A 3SCRA 4MNLA 1NDWA 4NXSA 3TAKA 5GVJA 1QBAA 4I8DA 4HSHA 2E5BA 3ABSA 4MZ8A 4HQVA 3N2MA 3NFUA 2WKGA 4RUBA 1FBAA 2O92A 4IPLA 2BVDA 3FDKA 4DWSB 1Z7AA 4JQAA 2W66A 3LNMA 4I7UA 2Z27A 2R6OA 4K8EA 3UERA 4AHOA 4LANA 3ONCA 3CWNA 2Y24A 2X1TA 3EGJA 3N34A 4H9YA 4YYFA 4DJDD 4I3GA 2VDIA 1JQVA 5HQEA 1LYXA 2EF9A 3LV5A 3UJEA 1DTUA 4ICCX 5LZLA 3W7GA 2OVLA 3TN6A 2NZLA 3JW7A 1MZRA 4ZOCA 3KW3A 4ATLA 4CD5A 2PF8A 3MI2A 2BY3A 3UJ2A 4M7SA 4BI5A 3HB9A 1E73M 3FX4A 2OSWA 1EYWA 1QNPA 2WK2A 3M0ZA 4Y8EA 5E93A 2VQTA 3E5PA 3HGOA 1WX0A 4XSLA 3FW6A 4R7JA 4LT9A 6A3HA 3R89A 4JEJA 4PRRA 1FXPA 4WKHA 4ZCWA 2G5WA 4E8CA 2WSRA 3DBPA 1C8YA 2EGZA 3OGVA 2Y61A 5A94A 2WW5A 8RUCA 2PLKA 4C1NB 1UBSA 5AOUA 1B4KA 4FX8A 3JUGA 3ITTA 1ECQA 5AB3A 2NVAA 4Q8UA 4AVFA 1SFJA 4R85A 2ONEA 4DUWA 4PB5A 4HP5A 5LIUX 3WLHA 4C6QA 3B8VA 2VP8A 4LNCA 5A8MA 3P84A 4HNTA 4EPDC 4GY1A 3MSGA 1S5WA 1MEWA 3GIYA 2GJXB 1UP3A 4JIQA 1ONWA 2AAMA 3I7QA 2YCIX 3LBCA 3SW6A 3FCPA 4IL0A 4J3ZA 4H6QA 2C79A 3GU9A 1V08A 5CC6A 4AEOA 1E1EA 2F6UA 2CLLA 4HNOA 1DJQA 3BZGA 4H01A 1RP9A 2I1OA 3N19B 2WM0A 1JI2A 3STEA 3BZJA 2XZ7A 4LEQA 4O53A 3PAJA 5KINA 2BG5A 5IFPA 2FHBA 5A8GA 1KFBA 1J93A 2ZE3A 2YYUA 1B9BA 5HJYA 3S2JA 3MANA 1I0DA 4K6AA 3VCRA 4E3TA 2Y5EA 3N17A 2VFEA 2FZ9A 3T81A 5L9FA 2XSAA 1N82A 1XD1A 5FSDC 1R2RA 1TRIA 3GQYA 1IT7A 2B31A 3WQ5A 3UZYA 2J7HA 1JCNA 2HVOA 2XIOA 3SJNA 1QNOA 1ZSXA 2PE4A 3TA6A 3GTXA 4N6EA 2G37A 1KW1A 1WUFA 4XIMA 3BAKA 3WMLA 2FQIA 3UJFA 4HHPA 1DTNA 3GX9A 4GCAA 4CQCA 3B0VC 4C6BA 3RIKA 2Y85A 2A3AA 1LF1A 4Z1AA 8XIAA 4ECLA 4WJEA 4V27A 3STGA 3B3DA 3TYBA 3WLQA 1Z6KA 1XH1A 5CC7A 4WLCA 3SDOA 4QEHA 1XPGA 1UR1A 1TPUA 1GVIA 4U4MA 1XGZA 2ON3A 2X16A 5FJTA 2QGYA 2CWXA 5EY5A 4B92A 4ZL1A 1OG6A 3C2EA 3VGEA 4PEKA 4XTIA 3GNDA 4WGHA 5I3IA 2NX3A 3I7RA 4IXXA 1O5KA 1PS9A 4A6GA 1OQFA 1UQZA 4PRWA 3PY2A 1O5RA 2QF7A 1L6WA 1TFVA 1ICSA 2Y7FA 4A05A 1FUYA 1E6ZA 3PTKA 3FA4A 3PBYA 1CZ1A 1YE6A 4IIFA 4A8RA 1D3HA 4AZCB 2VURA 1CEOA 4P8VA 4IICA 1GORA 1J0JA 2VX5A 2E9MA 3GNXA 5BMWA 4D9PA 2WVSA 1W0MA 2QDDA 2GGEA 1YXYA 4LH8A 2CZDA 1W9VA 4YTRA 4XV0A 2PDFA 1K8ZA 2G3JA 1Y5WA 3PB2A 3T4WA 2CCRA 1BSLA 2NQJA 2DIEA 3L5MA 3OVRA 3H2MA 5A2AA 2YDAA 1K6AA 3HQNA 2XVGA 4I5UA 1R9XA 2ZZ4A 4WDTA 2QJHA 3K4WA 6ALDA 3GH4A 4IWWA 1YBQA 1KCXA 1R3YA 1S1PA 1OX4B 2AL1A 4UTLA 4GUJA 1B3OA 4US6A 1AZ2A 1OYBA 1KBBA 3II1A 4YXGA 4ZZ9A 3CAKA 1UD2A 5HR7A 3UG5A 3CHEA 5BWAA 2ZZ2A 3FS2A 3W7RA 2ZC8A 4AHQA 1M6JA 5HPOA 4W86A 2PTXA 2R1NA 1M41A 4PSRA 2GUBA 3I10A 3TFXA 1AQFA 3NURA 2OWXA 1R3QA 3UA3A 3TV8A 1W37A 4ZQCA 3REQA 5I5RA 5LSMA 4H19A 3W07A 4ZODA 3FSUA 3AIVA 1QT1A 5HNNA 3WQOA 4FLQA 5TIMA 3W7NA 1XLAA 3NQ7A 4UQCA 4WHBA 3WF4A 4C6DA 3R10A 3CL8A 2JGYA 2Y63A 1UOZA 4D6GA 4FZIA 3ABRA 3LYEA 5FF0A 1VCVA 2W6RA 1KM1A 3HPXA 3F4VA 3P0XA 1JZ6A 2R24A 4WUIA 1E9ZB 4L1GA 4WCJA 3M5YA 4IQLA 4WKAA 1Q6GA 3LD5A 4JFTA 3VZZA 1ADSA 4ROPA 4PMZA 2IPGA 4FSAA 1Z42A 1NOFA 5HPCA 5FF2A 2XISA 2FZMA 4O12A 3AXHA 3TE9A 4GIAA 4AW7A 5D9OA 1G6CA 4DJEC 1MUCA 2CIPA 1BTCA 3R6IA 1OK6A 1PIGA 1CB7B 5E6YA 3NZRA 4WF7A 1PJ9A 3A9BA 5HWNA 4H8HA 3T0TA 3DIPA 3B8SA 2PTZA 1Y8BA 2WVVB 1H41A 1ODUA 2OEJA 5LIYX 2IXVA 3FEQA 4OHQA 3TUUA 1N8FA 1MW1A 3HF3A 3TJ4A 2WC3A 5D38A 1ZBVA 2OKTA 1TVPA 5C2XA 1O6IA 1P1MA 3CM4A 4C90A 4BHYA 5C9UA 1TRDA 3WK1A 1QPRA 1HZYA 4RDZA 1SO3A 4RKAA 2YPIA 1JZ7A 3IJLA 2CXEA 1P0NA 2Z7GA 2C71A 3N1AA 5I06A 5PTDA 3G0UA 5D4YA 3S6OA 3OW1A 4HOZA 3CK5A 3UFYA 3A21A 4JKKA 3TYDA 3QY6A 3TMLA 3V5CA 1ONRA 3IJQA 2OMAA 4H9VA 4J5NA 4QG8A 2QCGA 1YDNA 4C1LA 3SRFA 6ENLA 1IE7C 4ZO9A 4I9AA 4HHMA 1MFVA 4LAKA 3BUVA 2A21A 2V5DA 4TO8A 1UYQA 2AGKA 4DNMA 3JR2A 3EWCA 1A5BA 1VFMA 3OQEA 1OVDA 3B9AA 1A5CA 3MUIA 5AC5A 4CVUA 1R7OA 4UFLA 4DUOA 2NX9A 2OX1A 3UG4A 1VENA 2GVGA 1DJZA 3LHYA 4E4UA 1M5WA 3QYQA 2CLFA 5DMMA 2P53A 5LA0A 1AL7A 2NVCA 4HBKA 3GKFA 4RK8A 3T7VA 4ZSUA 4LX4A 3U5YA 1WNOA 2ZUUA 4XBJA 4AXNA 2BGQA 4GC4A 3L0KA 1ISWA 1A0DA 2WANA 4AY1A 3L12A 1XLIA 4R53A 2ISVA 3G8EA 3BLDA 5B7YA 1Q2RA 1YLVA 1HKJA 1Q6RA 1O1HA 1Y5VA 4YU1A 3S9YA 1TWIA 1PBGA 3DZ1A 1VD6A 3JZUA 6PTDA 1PCWA 1I2OA 1QPOA 2PWUA 3GG0A 3FYPA 3VINA 1QBBA 3H8AA 2FJUB 2XG9A 4GA8A 3PBWA 4HK7A 4L7ZA 4R5EA 1SJBA 1AA1B 3RM4A 2CBVA 1LT8A 3ZFHA 4GNKB 4AD0A 3ZZ1A 1BG9A 3KCOA 4O15A 4I6VA 4LUIA 5FF4A 1JUKA 1DEDA 2FGZA 4XISA 1IGWA 1R5YA 2CBJA 3ITLA 4GD0A 2DGAA 3UCCA 4JPGA 3CUFA 4OQVA 1CGYA 2PGRA 2G3NA 2QCHA 1GPFA 4A3YA 4J7RA 5BROA 4GUFA 2GDUA 2PMQA 4CQ9A 1ZBCA 4TVCA 5F4SA 1HJWA 1OGSA 4GZ7A 1EQCA 2HK0A 2HNHA 3HURA 2FB3A 4M29A 5AHFA 1WKFA 1UWSA 4HA0A 3BAWA 1MEHA 1OFRA 2BTMA 2OKOA 5IDIA 5DXXA 3IJIA 2O9PA 3RJYA 1JPIA 1P0BA 3TJIA 5C7VA 3BGGA 3GM8A 2ALRA 4Z1YA 5FJPA 2PC8A 3TW9A 3G0SA 3TQ0A 1XYMA 4DPPA 1NM9A 3DFSA 4Y9AA 1B4EA 3APTA 3GXPA 1UP0A 1VHNA 4IGNA 2HBVA 1SMAA 4UR8A 2PP3A 3GYEA 2OQYA 4W7UA 1HNYA 2QUVA 8A3HA 3IV8A 2I17A 5H8MA 4Y90A 3U9IA 1CYGA 3OVQA 9XIAA 3W02A 4OTKA 3DUGA 3RMEA 3I6RA 3GVRA 4HJFA 3W1QA 2FIQA 1EJRC 4O18A 4GACA 1BF2A 4LRTA 2Z24A 3I3DA 3KDOA 4QG6A 2X0SA 3E0IA 5TBOA 2IQDA 2DZTA 2W92A 3VIJA 3GC4A 3JVAA 4MJZA 3LGDA 4NAEB 2J6VA 4LUSA 4V2XA 1TVLA 4PA8A 1X97A 4MWAE 3L66A 4L9ZA 4JL2A 2PUZA 4JHMA 1K8XA 1F07A 3L4WA 3DFQA 1BWKA 1P6WA 3MYPA 1Q6QA 3QGKC 3RUBL 4S39A 4Z1CA 2KX9A 4O11A 1SVDA 2VX7A 4UQDA 2RDXA 2POTA 5CZSA 4UUIA 5A6BA 3F4NA 2GK1A 1KFLA 4KESA 3MUY1 3CLWA 3F7JA 3VGGA 4IPIA 1M68A 2Y2WA 1G01A 3W7IA 3W3OA 7ENLA 1XYCA 1BF6A 4JNMA 1XLLA 3EEZA 4HKPA 3AXXA 4L80A 1ME7A 2PA6A 3NPXA 4TIMA 4B16A 5KEZA 1UUOA 2A6LA 4ZTYA 3SAZA 1T6MA 4R9XA 3GG7A 4O1BA 1RR2A 1ZTVA 4HMDA 2VGFA 1HT6A 3K2GA 1DIEA 4H7VA 1YEYA 3PANA 5CPOA 1XBYA 4GXWA 3MS8A 4ADSA 2XVNA 3N2TA 5A2BA 3HM7A 2QKFA 1P5BA 1WPCA 3AMCA 4F0LA 4MG4A 1E0XA 1SGJA 5T9BG 3XISA 1WBHA 3LUTA 2PFHA 3DKJA 4R3UA 3UZWA 4Z2HA 1IF2A 5C6MA 1JEZA 3O05A 1QATA 4M0XA 3U48A 3PBUA 3M7WA 2VT0A 4E4PA 1E6QM 4QJ1A 5C2GA 4UTTA 3C8NA 1KFCA 1KC7A 3TN4A 4JQ2A 3W1RA 3FAWA 1OY0A 4WXZA 4HCHA 4I9TA 5GNZA 3ZJ8A 4QITA 3WN6A 3LI0A 1VJZA 4PH6A 3VNLA 1FWNA 4D6CA 3WH6A 2FZNA 5AECA 2VEPA 4CU7A 2GK1B 2QW5A 2XVKA 3RDKA 1WZMA 4HYRA 1W3JA 3U2ZA 1ZAJA 3I4EA 3ALFA 3IJ9A 3V1HA 1OFOA 1C93A 3EDJA 3R94A 5AHLA 3AO0A 3CMFA 1GGOA 3W24A 3OLEA 4DYKA 1ZBWA 3OBKA 2ISWA 4Q6JA 4LNYA 4C1NA 3L65A 4UTIA 3WBXA 4B91A 1XLMA 3A64A 3W72A 2GVJA 5D2XA 3UNTA 4ZTXA 2QJNA 4UCGA 2YXOA 2AGTA 1TX0A 2PS2A 3EAUA 4W85A 3H2AA 4GXMA 2WJFA 1H61A 4DPQA 3KWXA 4QJ5B 3QHNA 2ZWYA 1MZHA 1A80A 3TVAA 3LCHA 4DJFC 1J0ZA 4PULA 1F6YA 4LEFA 1CXFA 2ISFA 4HB7A 3WUFA 5BXSA 3DFTA 4E8GA 1DQWA 4IISA 5D37A 4KEMA 1FWAC 3O6AA 3GR7A 1EC7A 1IT0A 2GGJA 2HZGA 4POCA 1UASA 1VKFA 2HE8A 2IKJA 3L5AA 3PNUA 2WB5A 1SM9A 1KWGA 4M1RA 1G4TA 3BLKA 4I7WA 1WXYA 4R34A 3WNOA 3UWVA 2Z7KA 3BO9A 2GLKA 3WQDA 2QDGA 3UVAA 4EPEC 3G77A 3IWPA 1MQPA 4L61A 4ZO8A 4P5UA 4GZEA 3BLPX 4HNVA 1V0KA 1R46A 5FJIA 3LRLA 2W3ZA 4MAVA 5I77A 5F2LA 2JIEA 5HMEA 5ECUA 4GINA 3ANVA 3PAOA 3IJ6A 3NSMA 3TCSA 2ZC1A 2ALDA 3CHCA 1EA9C 4UFJA 4FI4A 1HW6A 1JXJA 4LAZA 5JIPA 3S5OA 2E5DA 1PYMA 2O56A 2FFCA 3ITVA 5FJJA 5D30A 3F5LA 2OJPA 4YPJA 1S5VA 4O0QA 3MJYA 3EPMA 3C0JA 3VD7A 3PWGA 4DAFA 1D3CA 2VKZG 3BMXA 1NSJA 4DYJA 1B30A 3KBNA 3UWEA 4FXSA 5TD4A 4DM2A 3TC3A 3LPGA 1UWUA 2VDHA 3WH9A 1V6WA 4F9DA 3WKZA 2XFFA 2VTFA 5C54A 3IJ7A 1VPXA 3MP4A 4ZQPA 2WZMA 2HMCA 4X9YA 3VGHA 3B8UA 4QQ3A 3BW2A 1ENUA 3ZSSA 5F2MA 4D71A 2Z29A 3VZYA 1POKA 2OELA 2DZSA 4AVNA 3HMCA 2X41A 3PTDA 4Q4QA 2NQLA 1K03A 3BAIA 4QCEA 4QR6A 1VGAA 2EPKX 5HDRA 3CB3A 4OGZA 4ZE4A 3C0QA 4MF4A 3FOKA 1LDCA 3NPVA 1ISYA 3HBLA 3V75A 4OFCA 3L4ZA 1YPFA 3GRIA 3ID7A 2NSOA 5ECVA 2J7DA 2YFNA 2C13A 5F4XA 2O4QA 1KFKA 4IGSA 4H9MA 1TREA 3WJWA 3RGTA 2PU0A 1DVJA 4LVFA 4C91A 1AQHA 1AJ2A 2Z6JA 2VZOA 4AX6A 3CUGA 4MOZA 1BEUA 2YSWA 2FGBA 3P8JA 3W7KA 2V67A 3KP1A 1RJQA 2R8WA 3LLXA 2E40A 3F2CA 1A3HA 2BOEX 1FWDC 4JIRA 1NWRA 2RH9A 3DESA 2V3EA 3ARWA 4S3CA 4H2CA 1UKTA 3IGSA 3H2FA 1ZBKA 4GJJA 1FFRA 1RP8A 2PDUA 4UWMA 1F05A 3I65A 1K4HA 5JQ9A 2A7RA 5FAJA 5TNVA 3CYJA 1KM2A 3PZQA 4AIBA 1UHVA 3ZYZA 3M43A 4MFDA 1TB3A 2PCEA 4IQEA 3NM3A 4KETA 3MMDA 3AYTA 4NNCA 2ODOA 3JZEA 4XAGA 5H1WA 4CVWA 3VNKA 5K4XA 1V79A 1QNSA 3OLIA 1OF6A 4MNMA 2GSEA 3UYCA 1WDPA 3GUWA 4FO4A 3RYSA 3C5QA 4XUGA 3PJUA 5D04C 4LVDA 2AMXA 2DVTA 3T42A 3VM7A 5CLTA 3TOPA 4BZYA 2NQ5A 4PFMA 5GJPA 2DW6A 3VKBA 3S1GA 3F4CA 4Q22A 1XP3A 2DZAA 1LG1A 1X6LA 2O9RA 2V63A 1EIXA 2W27A 4P7RA 5A8OA 3KL5A 3YPIA 4C6EA 2VC9A 4PB4A 4NYYA 3AISA 4RJEA 2IS7A 1XYLA 1BFNA 1DQXA 4QXIA 1DBTA 4FEZA 4HTBA 3UZZA 1UP2A 1ESWA 4QEEA 3NVTA 4NJIA 1Z44A 1EEXA 2HPMA 1EJ7L 1TMLA 3L2IA 2QHAA 4ZB5A 1X96A 3NQ6A 3TKFA 3URAA 4X0VA 2A7PA 3NNTA 1IZCA 1RCQA 4Q4SA 4F0SA 1OT2A 3CC1A 3CIWA 3I6EA 1S2CA 4L5ZA 3W0KA 5KITA 5LXEA 2Z4GA 4NJJA 4ZENA 3L67A 4PUNA 4GYPC 4RDWA 1XINA 1W1VA 5LNSA 1PDYA 3MI6A 3SURA 4MYXA 2QLYA 5FF7A 4J3XA 3R25A 1H7PA 4F0KA 1YBQB 5XINA 2HK1A 4G2DA 5DELA 1AW1A 3U2EA 1NOUA 3NCOA 1M3UA 4BF9A 3B9DA 3OZPA 1I2PA 4YTUA 4CCCA 3GDKA 2ACQA 3MYOA 3T2OA 1RV8A 4C5YA 2G95A 1F6KA 1R3SA 4YCOA 3MQTA 3GD6A 2ZUMA 1AW2A 4Q8OA 1ADDA 2EPOA 4HHHA 4XIAA 1FDYA 1TWWA 1AW5A 3N6HA 4UMCA 4KEUA 3AS1A 2D2OA 2QAFA 2Q3RA 3GDTA 4RR4A 5DFAA 1CXEA 1P0KA 4PFHA 3SFWA 2J7BA 2YKKA 3STPA 3PBMA 3QLDA 2I5IA 1W3KA 1GJWA 1NDYA 3RR1A 1E72M 3SSJA 2EHHA 4AD1A 4ZB0A 3TAOA 1UR2A 1KD0A 1UZDA 1MRQA 1W1PA 5ABEA 3IV3A 2OOGA 4UXDA 3UETA 1AG1O 3WNKA 1HJQA 3AMLA 5CJNA 3GVQA 1M7XA 3KS6A 5K3VA 3GFZA 1OB0A 3F2BA 3UJRA 2E6YA 3ZLHA 3QR3A 3CT2A 3TYCA 1J0YA 3LNPA 3IUIA 1UJPA 3DEQA 2D3NA 4MZ1A 1JD9A 3IJ8A 1KGXA 1ZB5A 2BY2A 1UH2A 3SUUA 3SB0A 1PHWA 2NV9A 4YN5A 4PODA