3L0KA

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-acetyl-ump
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Uridine 5'-monophosphate synthase
total genus 101
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3l0kA00
4UFIA 3C2FA 3CEUA 5HUPA 2VELA 4E2DA 1KM1A 3DU0A 3UD6A 2Y85A 4QITA 1P4CA 2BX7A 5DLCA 3P61A 2GPTA 3NQDA 1SFLA 5LGZA 1QOQA 3W1NA 4CQAA 1K3UA 1IIGA 4O1BA 3S8HA 2AGKA 3MO7A 2GVGA 2ZRVA 3ZWSA 3EWWA 3TXZA 5EA9A 2W0UA 2V2HA 1JQVA 2DZUA 3FOKA 3DHDA 3HOJA 3SJ3A 3NAVA 4Q4KA 2JK2A 3S1XA 3G24A 4O52A 3JR2A 2X1UA 4GRSA 3GKAA 5EMUA 3C6CA 4NZJA 1WAUA 2EHHA 3N73A 2E77A 3S6DA 4UTTC 2WKJA 4FF7A 1ZFJA 2GVLA 3O07A 2CFFA 1R47A 3HG4A 1T0OA 3CIXA 4DQWA 3UWZA 2H3BA 1YDNA 4O50A 3QZEA 1ZENA 3TIMA 3L5LA 5K9DA 2R14A 4N6EA 1G4SA 3RLUA 4AWTA 1WOAA 2QCNA 5BNKA 3U6WA 1AG1O 1TV7A 4IMFA 4S1FA 3R12A 4A2RA 1DBTA 2QKFA 1DORA 5F2LA 5LHEA 4M19A 1T96A 2XN1A 1YYAA 1FQ0A 5A8GA 2ZZ7A 4H3DA 1TTQA 1UUOA 3UZ5A 4AHQA 1VHCA 4GUJA 2Y70A 5F2GA 1OX4B 3LHUA 3TMQA 2VENA 4X3ZA 4K39A 2JKEA 2WPBA 1FWWA 4WUIA 4EVZA 3LCFA 3TJXA 3MMTA 3UWVA 4I7WA 5J5DA 3W7PA 3H53A 4E2BA 4NNCA 5EPDA 4O1CA 3A9IA 3W22A 4JICA 1WXJA 4PC8A 1OFDA 2J9XA 3WK2A 3TSBA 3TC6A 4LNYA 1TCDA 1O4UA 3TK7A 1LBLA 2YCEA 1N8FA 1S5VA 4UTTA 4WJEA 4ZVJA 4CNNA 4OU1A 2OT1A 1LRNA 3NXFA 1TIMA 3C52A 2PCQA 4AHOA 3ABRA 5EYWA 3WFAA 1WBHA 1QCWA 2ZTKA 1W0MA 1FDJA 3G3MA 4L4MA 5D32A 3DFQA 4K8EA 3VNDA 2ZA2A 3GXPA 3SW6A 3ZR4A 4IPJA 4Z1CA 1M7PA 3PS7A 2Y89A 4QISA 3NDOA 1AK5A 1OFQA 2E6AA 4YXGA 4MUZA 2WSQA 1NEYA 4O14A 2NUXA 4UC5A 3VCRA 1YPIA 2ZZ2A 3LX9A 2OCZA 5AB3A 3SZ8A 3NPUA 4HT3A 4GWEA 1SZNA 1W31A 7TIMA 4G1KA 1H7OA 2WQPA 4NJGA 5TQLA 2PRHA 2C6QA 3NQGA 4JY9A 2GVJA 3W1LA 3KVLA 3L9CA 1KA9F 3HO8A 4ZL1A 1TPH1 1TTIA 5CKSA 3P80A 2HS8A 2FTPA 4K36A 5TIMA 1LLWA 3QC3A 1L6SA 1SO6A 3Q37A 5HQEA 1RD5A 1S5TA 3NQFA 1GWJA 2CLMA 5G2HA 1B4KA 3LHVA 1F74A 3FEMA 3L5AA 1B3OA 1TPDA 4OV9A 3LCXA 4AWSA 1GYNA 3G1HA 4ZQOA 1NF0A 4IQLA 3S9YA 5D30A 3HG5A 3KVJA 3N2MA 4HHPA 4KFPA 1JULA 5D03A 3QQ0A 4TR9A 1KFBA 4JX5A 5FEZA 3GDKA 4M5PA 4PTNA 1LYXA 3M5XA 5HJLA 1KTNA 2V2CA 3K30A 4ADUA 1U83A 2ABAA 4N9EA 2EGZA 4O11A 4N2YA 4UTWA 1XCFA 4O4WA 1RQEA 2YGYA 1PHWA 1OF6A 5G5IA 1TQXA 3SR7A 3PSVA 5DBUA 1QDSA 3O8AA 2ZBTA 3BLIA 4ORIA 1KV8A 4BI5A 1DVJA 3UWUA 1GPWA 3MHFA 4KWWA 2DZXA 5K2ZA 1VJIA 4HSOA 3EWYA 3UWYA 1UJPA 4JXCA 4R33A 5LHFA 3MBDA 1R30A 4N02A 4YCOA 4NZFA 4MLJA 4O1DA 5I3JA 1V5XA 2BWGA 3W7NA 1GVSA 3B03A 5CZTA 3QSRA 4MPQA 5F4SA 3W87A 2X1TA 3LCLA 3B8DA 3V1PA 3UXDA 3W6YA 3LRMA 3Q2DA 3PM6A 3DFTA 3NL2A 1FCUA 5I3FA 5IM51 1TREA 4RXFA 4WXYA 1OX5A 1YXDA 4S2BA 2J9ZA 4OV4A 2A7NA 3CB8A 3NQ8A 2GJNA 2E68A 2E6FA 1SUXA 3W76A 1TB3A 1QFEA 2FB3A 2A7RA 3L0KA 4XTDA 3B0VC 1WDWA 3LI1A 3H54A 3FFSA 4GE8A 3W7KA 4BK9A 4GJ1A 3W88A 4DXVA 3IIVA 1LROA 3GDMA 1FUYA 4I7VA 2Y7DA 2CLHA 1ML1A 3M47A 5LNUA 3IGUA 5LNVA 3TUUA 4CLMA 3TCEA 3W1TA 3G0SA 1QO5A 1XUZA 1SO3A 3W7JA 5E1QA 2B7QA 4RXGA 3QPZA 1LBFA 3DKLA 1KFCA 3SGUA 1J5TA 2Y63A 3CU2A 1I45A 3INPA 1F6KA 4TX9A 2ZRUA 3STEA 5CZ0A 3KHJA 5CPOA 1TMHA 1VS1A 2A5HA 4MVAA 2FB2A 1VC4A 1Y0EA 4Q33A 4O10A 4QNWA 3MBFA 4FNUA 3B05A 3F1QA 3O6DA 1BTMA 2F84A 2A6NA 5MHBA 1QMLA 3DFNA 3TQKA 4DELA 2RDWA 3Q58A 1X7FA 3ZS4A 1FCBA 3U2OA 3A5FA 2ZYFA 4U28A 4TMBA 4ZMGA 2DORA 3LCWA 1DKWA 2WOQA 1JJKA 1FDYA 1SFJA 1VCFA 1NVMA 2CLIA 4LV9A 2E5BA 2QR6A 4UMCA 3W75A 3NPXA 4UMBA 4OGZA 3MUXA 3C2EA 1G4PA 1KTCA 1H7PA 3V75A 3NZRA 5D2XA 4Y90A 4FX8A 1BKSA 5DN1A 4TO8A 3O05A 3BGGA 3W1XA 4WY0A 3LCHA 5BRBA 3IGSA 1LRQA 4O53A 4Z08A 4AH7A 3TDFA 4CNPA 3EWUA 2BLEA 5D37A 1EX5A 2KZHA 3MI3A 4CQ9A 1OX4A 3USBA 2YSWA 2C3ZA 4GUIA 5G1YA 4CCCA 1JVNA 3TU9A 1CI1A 1KFEA 3KOFA 3A24A 2DZVA 1S3HA 3HF3A 3I65A 3LRKA 5CG7A 2V2DA 1SSDA 3UPWA 4PFMA 3TROA 2NX3A 3EB2A 1EA0A 4RZ5A 1OFEA 4HIBA 4MYAA 1KTBA 5CSSA 2CLKA 2ABBA 1SW0A 3THAA 3QJAA 4LTSA 4R34A 1DV7A 1KFKA 4LVAA 3DBPA 3MI2A 5EKYA 3DKJA 2JBMA 1YDVA 1IXQA 1HO4A 1TO3A 4AWUA 2P0OA 4WY0B 2W79A 4NJIA 4WZHA 4MYXA 1FCVA 2A0NA 5F2MA 2TYSA 4CCEA 1DQXA 1JRBA 1JCMP 4AF0A 1O5KA 4A22A 1VRDA 3OG3A 1HO1A 4C1LA 1Q6LA 2X16A 2E5CA 3A23A 3WJWA 3LOTA 1VCVA 4OT7A 4JTKA 3L0NA 3RF9A 3HJZA 3BPWA 1AW1A 2C15A 1W5MA 2PRLA 2V81A 3WJYA 1KLYA 1KFJA 2YR1A 8TIMA 1A53A 3BW4A 4HNVA 4RKAA 4FNSA 2XFWA 1F7BA 3GNNA 5I3HA 3TAOA 1SPQA 1EPXA 3NG3A 4NNBA 3BARA 5FF4A 2NXHA 1YADA 3KFTA 1GEQA 2FFCA 1I2OA 5L6UA 4PL2A 5G4EA 4O12A 4QSHA 3NL3A 2EKCA 3QF0A 1XL9A 1SQ7A 2X2GA 1ICQA 5LSMA 3TAKA 3L68A 3S1VA 1VLIA 3YPIA 3P8IA 3A5VA 5HNRA 4FB7A 3F4NA 3NQ6A 2QEZA 1UUMA 4JIPA 4XKYB 2Y62A 4A29A 4O0KA 1ZNNA 3QM3A 3C2RA 3GKFA 2QAPA 4UTJA 5KTLA 1SO4A 3DHFA 1H7WA 4R7JA 1NFBA 3PB0A 5HWMA 5AHIA 3T4CA 4ZQMA 3BGJA 1U5JA 2TPSA 4LVGA 2ATSA 3TQ0A 4Z1DA 1TPFA 3EX2A 4QQ3A 3N2XA 3LDVA 1J2WA 3P8JA 2GOUA 2HMCA 3GXTA 3WK1A 3FA5A 3EWBX 3Q94A 2CLLA 4GC4A 3RNDA 1WV2A 1GG1A 3GXNA 1NAL1 5TBOA 2WO5A 3QH2A 5CSRA 2DP3A 5AC6A 4FXRA 4P2VA 5U4NA 3LERA 3OIXA 4O0ZA 2QJIA 3TV8A 1K7FA 2V0TA 1SR9A 4QIUA 2NX1A 4UCGA 2C1HA 1A5AA 4DPPA 1X8FA 3DGRA 2VFDA 1P5BA 2G5WA 2BXVA 4YCPA 5K4ZA 3M1ZA 1AMKA 2QJGA 3PBVA 1H60A 4UMAA 3NPVA 4UXDA 1OX6A 1GOXA 1SZGA 1W5NA 3ATYA 3UQNA 3W9ZA 4DPQA 5G1TA 4RZ6A 1HG3A 2X30A 2B7PA 1JUEA 1PCKA 2Q8LA 4WD0A 3G1SA 1JRCA 1O94A 1YTKA 3WJXA 2VFHA 4MKNA 1RPXA 4JTUA 2GQ9A 4XBKA 2BZNA 3OBKA 4I9AA 1H7RA 3CHVA 2YDAA 4UTLA 3C3NA 3OVPA 3G1FA 1R2TA 1FXPA 4O19A 2Z6JA 3UNDA 3SGZA 4IX2A 3RLVA 3KXQA 2PE4A 5HULA 5LGXA 2CZFA 5C6MA 2ZA3A 4JTJA 4K7YA 4JEQA 4FXSA 5IBXC 3P81A 1OHLA 3TKFA 1JCYA 1DQWA 3P62A 4ADSA 3IV3A 4AF0B 3G1DA 1JR1A 1O5XA 2C14A 1W3NA 3GAYA 5D33A 4RX0A 1TV5A 3M43A 3DXIA 4MJZA 3AJXA 1VH7A 5D02A 1LOSA 5I3GA 3SSJA 3C2VA 4IGHA 5C54A 1OFBA 2EF9A 2QCLA 3G18A 4PL1A 3PBUA 4IXHA 4UTUA 1R2RA 1LOQA 3GAKA 3IVTA 2E6DA 3SY5A 1I2QA 3CQ0A 1OYAA 1QOPA 4GBUA 4X22A 1LLZA 2E5DA 4LOCA 1L6WA 3MJYA 1KLZA 4E38A 4EIVA 4OBTA 1TTPA 1KV5A 4XTIA 4NQ1A 3QSTA 3PUOA 4DO5A 5HR6A 4FNPA 4Y9AA 3F4WA 4UR8A 1Q6RA 4D2JA 1BEUA 1ADOA 4MY8A 3QMSA 2G96A 1QPOA 1OFPA 3S1WA 2V9DA 5AYXA 1FBAA 2ZZ4A 3PUDA 4JX4A 1K8YA 2ISSA 3WK0A 3CTLA 3KRZA 4E0CA 3DFPA 1WQ5A 4RV8A 1XBZA 3EXTA 3CLMA 3W7IA 1PVNA 1TPEA 1DHPA 3WK3A 3JRKA 2B0MA 4OHQA 1X6UA 2P10A 2G97A 3GDRA 3W74A 1HL2A 3UY8A 4AEOA 4N9DA 1OK4A 5D2TA 3TFXA 4GNJA 1D3HA 2YFOA 3W7QA 1H7NA 3R89A 3HPZA 1ZHAA 3TQVA 3TSMA 3I6RA 5FEWA 4NXKA 3W7DA 2DJLA 1W56A 3HQ1A 1ME8A 2CW6A 3I7RA 3E02A 3QEZA 2V5LA 1YTEA 3NQVA 1Q6QA 1THFD 5DCEA 5FF3A 2XN0A 5FEPA 4Y96A 3PVFA 3SI9A 4K38A 3P5YA 2NWSA 2WV8A 3R5EA 5I3KA 3OHIA 4YL2A 2R8WA 1OK6A 1IIHA 4I7UA 3N9SA 4LVDA 1KM4A 4HKPA 4DEFA 1JCNA 3S0CA 2J88A 3TA6A 3NL5A 4XUGA 4N4PA 2RH9A 3T44A 4M6QA 4Z0JA 2P1FA 1OYBA 4MFEA 2JKPA 3E9AA 2QCMA 3NOEA 3G1YA 1F76A 4OQVA 3W7OA 3BW2A 4MIMA 2DU2A 5DCBA 1EIXA 5AHLA 5KSWA 2PC4A 3T55A 4MZ1A 4J9JA 2Y6ZA 4UFHA 3ELFA 1K8ZA 4GXMA 2HSAA 1G4TA 1ZALA 1YTDA 3KRUA 3M5VA 5BMXA 2Y61A 1E51A 1M7OA 3W2LA 1LCOA 3W83A 3R8RA 5CPNA 1GTHA 3W73A 2NZLA 1Q3NA 1A50A 1A5CA 3GVGA 3LXAA 3KRSA 1HFBA 3ATZA 6TIMA 3NZ1A 3W85A 3DENA 4NT0A 4JYDA 3IRDA 3G8RA 3P82A 4MOZA 5FEXA 1YXYA 5T26A 3PULA 2Q3OA 3O15A 5SWUA 1P0KA 3CWOX 3DH7A 4P61A 4JTIA 5DXYA 4IPIA 4ZZ9A 1TPC1 3PY2A 1GVQA 3NYZA 3L2IA 1XDMA 2XN2A 1FWNA 3FIGA 5AC7A 2YYUA 5DELA 5HWNA 5FF0A 2VFFA 3LI0A 3NQ2A 3E12A 1G7UA 2ZFAA 4Z0SA 1IXNA 2VEPA 5BW6A 3DFOA 1ME7A 3QQ1A 1EWDA 4ADTA 1XDLA 3PG9A 2QCEA 4JX6A 1M5WA 3OA3A 3PUEA 2I1OA 4NJKA 4WY0F 1K8XA 3I7QA 1W5OA 2A2IA 4UIOA 1H62A 5G4WA 3C4UA 4LY8A 3MP5A 5D2YA 3LLDA 4BWLA 3NQMA 4DBDA 1XBXA 4IXXA 3NQEA 2CLOA 2FLIA 3EXRA 3LXBA 1TV8A 2E09A 2A4AA 3OVQA 2FPYA 3L5MA 5DY3A 2Y88A 3M9YA 1H7XA 4XWUA 3BG9A 4JD4A 3NQ7A 4IMDA 1H51A 1OVDA 4KFOA 3A21A 1SW3A 3GZ3A 1V7YA 4ORMA 3W1PA 3UWWA 4CQ8A 5DBTA 3BLFA 5DY2A 3OEXA 4QJ1A 4XBSA 4LS2A 4H4IA 3ZFHA 3STCA 1HUVA 5KZMA 3GYEA 3L66A 5L9FA 3QW4B 1H63A 5FI8A 3UZJA 2W6RA 4O1AA 3G1XA 1W5QA 5BOOA 1VCGA 3GIYA 1H61A 2OJPA 1VQTA 3W2MA 5D04C 4ZQPA 3F03K 2QF7A 1OF8A 3MYOA 4HN4A 1W3IA 5K7JA 1CW2A 5D05A 4UTMA 3NGJA 1N7KA 3PC0A 3U8GA 2ALDA 2GJLA 2AQWA 1VZWA 1TSIA 1I4NA 2VEKA 2QUVA 3NM3A 3LGEA 1AW2A 4M7SA 2RFGA 2V8ZA 3LHYA 2PRMA 4JY8A 1G6CA 1KM3A 1TJRA 4JTFA 3LRLA 5EBUA 3S42A 3PB2A 3TW7A 1AL7A 1P0NA 2J6XA 2YYTA 4W9TA 3NQAA 5J5RA 4L4LA 2ZCGA 4M6PA 1WBJA 4O13A 1Q6OA 3CC1A 1YDOA 4GUHA 3VKJA 5H2ZA 1IGSA 4XQ6A 4LUJA 2OX1A 1L9WA 4FX7A 4X2RA 1MEHA 1B4EA 4H6KA 3T40A 2Z0IA 3QW3A 1MEIA 2RHGA 3S5YA 4HNTA 4N6FA 2E1DA 1KM2A 2FJKA 4LRSA 3ZWTA 1G67A 4TU1A 1LOLA 1OFAA 2I9EA 2C13A 5AYZA 2ZZ3A 1PHQA 1M6JA 4NVTA 1F5ZA 3W1QA 2YW3A 5F2IA 5LNSA 1LDCA 3PF3A 4DO4A 2FPTA 1PIIA 1QPQA 3M6YA 4UTKA 1J4EA 3TMLA 1MXSA 4BWLC 2R91A 1F73A 4BFAA 3BV4A 4O18A 1D9EA 4AAJA 3LHTA 2YX0A 5U7SA 3E0IA 3MP4A 2J9YA 2V82A 3QPYA 2Q8ZA 1JCXA 6ALDA 1ZAHA 5HR7A 3IVUA 2WSRA 1T8XA 1D3GA 1DJNA 3G1AA 3UPBA 3FKRA 4RJEA 1QR7A 4JTSA 3EWXA 1N55A 2ZRWA 4JYEA 3BO9A 3ABOA 2WNQA 2ZRXA 3IIPA 5K9XA 4RR4A 4JGDA 1FWTA 2QCHA 3G0XA 5FF7A 1EEPA 2TMDA 4R53A 1KBIA 1FXQA 4X9SA 1W54A 3EX4A 2A1YA 5H91A 5C2XA 4IMGA 5D38A 2R94A 4N4QA 3BG5A 4UNKA 5E93A 3S5ZA 2BSLA 5LNWA 3B0PA 2X1SA 4JTHA 4FEZA 1KM0A 2VEIA 1I2NA 4IMEA 2DZTA 3IIXA 2NXGA 1W3TA 1TYGA 3LTSA 2EPHA 4MFDA 3PBYA 3MP3A 4AMAA 5AHEA 4TIMA 4N9CA 1ICPA 4CNOA 1R46A 2ZRYA 3NNTA 1X1OA 4WOQA 2BTMA 1OG0A 1LM1A 3LBMA 1LRTA 3MHGA 5EL1A 4PODA 1UASA 1GT8A 3W72A 4C1KA 3FYPA 3ABSA 5AN7A 3P74A 4O4VA 4O16A 4IX0A 2FDSA 4Y8FA 1BWKA 1RV8A 3W2KA 1L6YA 3GDTA 2GQAA 1OJXA 3LBCA 4ONVA 1G69A 2CZEA 3HGJA 3JS3A 5IBXA 3UYCA 3N3MA 2OMAA 4EWND 1JCLA 2VC6A 1I2PA 4OE7A 3W7LA 5KINA 1QPNA 4N9BA 5G2IA 5CPLA 1NF7A 5FESA 4NNAA 2I14A 3DAQA 5EY5A 2Y7GA 1PV8A 1KFLA 2A7PA 1ALDA 1DJQA 1SZFA 3LHZA 3O06A 1GYLA 3RU6A 5LZLA 4XZ9A 4WX2A 4M6VA 2FIQA 1FDZA 3EEGA 1UBSA 3UWQA 4Z1AA 1BWLA 4LS0A 3W1RA 1AL8A 1FY6A 2TRSA 4YLWA 2H6RA 1ICSA 4NJHA 1A5SA 3P84A 3W84A 2AAMA 3EXSA 3W7HA 4UFLA 2Z6IA 4JIQA 4KFNA 4AVFA 2C19A 5CZJA 2Z2UA 4O28A 5AYYA 3L0GA 3P5ZA 5HUOA 1GVRA 3W2NA 3BVJA 3W7RA 3TH6A 1JUBA 4BI7A 1HTIA 3NO5A 1QO2A 4WXZA 1LP6A 3MI6A 4QNEA 2QCFA 4GUFA 1FWRA 1GTEA 1IF2A 1RZMA 4FNRA 4NXSA 2V30A 4FNTA 2DZSA 3PG8A 1SZEA 3VE9A 3PBWA 3M16A 2YZRA 3HIJA 1GVFA 2ZZ1A 3STGA 3B06A 1WX0A 3GK0A 4IOTA 4S2CA 4TMCA 3G3DA 1K7XA 5GVJA 1AW5A 1OABA 3M5ZA 1ZCOA 1JQXA 3T7VA 2WNNA 3QMRA 4HNUA 2NUYA 3THQA 1H50A 1SU5A 2CU0A 4O54A 1B9BA 4UTHA 3R2GA 1XI3A 2CZDA 2ATMA 3NL6A 4CCDA 1MEWA 3UY7A 1WYIA 3FLUA 5HWJA 1ONRA 4DF2A 3HMJG 1XKYA 3BG3A 4FNQA 1LTDA 1QNVA 3NVTA 3AO0A 3QYQA 4FIQA 2F7FA 4LS1A 2QCGA 1VYSX 1ZJIA 3C2OA 1TRIA 2NWRA 1EUAA 1QAPA 3T78A 2GQ8A 4LC6A 3HBLA 4K7VA 3CWNA 1DL3A 4XKYA 4BF9A 4BR1A 3QFEA 4PH6A 3C8FA 2H8ZA 3KX6A 4AHPA 1XUUA 1Z42A 3NM1A 2NLIA 2A6LA 1KM6A 2YW4A 4Q32A 1K03A 2ISVA 4ML9A 1KW1A 3EKZA 5LKYA 3W70A 2QAFA 3O63A 4O8RA 4ALDA 3IGXA 3LXCA 3FYOA 1TPB1 3PWAA 3MWAA 4AXKA 3S5OA 2QUUA 3GDLA 3A22A 4HPXA 1TRDA 1OYCA 1WA3A 3M7WA 2QCDB 1K7EA 3HGOA 4JN6A 4HSNA 4IWWA 1Z48A 3W23A 3LB0A 3LLFA 3SFKA 2Y7EA 5A5WA 3HGRA 4GUGA 3R13A 1EP1A 3EX1A 3O6YX 4UFJA 2A85A 2C18A 3NA8A 4JTEA 4HNNA 2QCCA 2A21A 1TQJA 3TJLA 5AOUA 3BLEA 4JDYA 3M44A 1YXCA 3FJLA 4A2SA 4UFMA 5HINA 4ZQRA 2ZDRA 4O15A 4A3UA 1VGAA 4LVFA 4UNLA 1Z44A 2C16A 4YWIA 3EWZA 4KKXA 4ZQNA 4JNMA 5KMYA 4WQ6A 3LV6A 5F4WA 1X1ZA 3M0ZA 1XBVA 2CLFA 2NXIA 3GB6A 4LC8A 1ZY9A 3N14A 3MYPA 4PCFA 3OVRA 3FS2A 4U4MA 2QDHA 4MY9A 3TXVA 4QAIA 1PS9A 3GR8A 1T99A 3MHUA 3HGSA 1EUNA 4UFKA 3PSWA 3IVSA 2OT0A 1VYRA 3P67A 1ME9A 1RR2A 5AHMA 4Y6GA 2TSYA 5CPMA 2LLEA 4UUIA 1OFRA 5F1VA 2NUWA 3L67A 4YMZA 4IMCA 2GUUA 3LCIA 4LRTA 1Q45A 3TFCA 2NX9A 2CWNA 1F2JA 3G1VA 4NJJA 1A5BA 5D2WA 4FIRA 2G95A 3HPSA 5AHNA 2B7OA 2Z1BA 4IJBA 5K3VA 2VEMA 3KAOA 2WNZA 3W7CA 4RCXA 2QJHA 2VOMA 3W7EA 3N9RA 1KBJA 3NEVA 3GR7A 3L21A 3NR0A 5ABTA 3VE7A 5D09A 2B4GA 2VFGA 5I3IA 1FCQA 1F05A 1ZAIA 4JR5A 4NX5A 3RMJA 3LM7A 2ZQ0A 4JYFA 1C9DA 1G4EA 2PURA 3FKKA 2ZZ5A 4FHAA 1I2RA 4FO4A 1C8VA 1TTJA 3HG2A 1QWGA 3PAJA 3WJSA 1YPFA 2X1RA 4EOUA 1O95A 3O1NA 3SIZA 1EP3A 1QPRA 4LT9A 3N34A 4NX0A 2YPIA 2C0AA 3HB9A 3FJ6A 4RZ4A 3W86A 2ZTJA 1F6PA 1P1XA 3GX9A 4JDBA 1VLWA 3IIZA 1XBYA 2NV1A 3CIWA 3I68A 4DBEA 2UV8G 3CPRA 3M41A 5HMSA 3TX9A 3W2UA 1GG0A 2FQIA 2QDGA 1CX9A 3TR2A 2CZ5A 1VPXA 1XXXA 3N19B 5C5YA 2WJZA 3CT7A 1MO0A 2ZZ6A 1EWEA 3W3OA 1H1YA 1KM5A 5CGQA 3CM4A 3ANYA 5KZDA 1PE1A 1H1ZA 2ZRZA 1NSJA 3P7YA 2CLEA 4HPJA 2IQTA 1MSSA 1TPUA 1JUKA 2H90A 2E6YA 4Z1BA 1RQHA 3C61A 4LV4A 4BI6A 4JTLA 4WOZA 2V5BA 3PR2A 4EF8A 3B04A 1GZGA 3LV5A 3W1AA 1W8SA 5F1UA 3KVMA 4PEKA 4UTIA 5E0KA 3W2JA 1R2SA 1W1ZA 4OWGA 2D73A 2HS6A 3MW7A 3CEPA 3S5NA 3EX6A 5FF2A 3H55A 2B7NA 1S5WA 2O7QA 5K4XA 1OFOA 4O57A 5DXXA 4QM1A 4MZYA 3O16A 3B4UA 1TJPA 4IUOA 2J27A 5G2WA 5AFDA 2H8XA 3G22A 3G8EA 3TW6A 3W7MA 5LNRA 4PA8A 3BW3A 1YLVA 1C29A 4NUWA 1UCWA 3B0UX 3O6CA 4GFSA 2YFNA 3HG3A 1ZAJA 1I8JA 1SSGA 4RLIA 1W5PA 1XFBA 1LORA 2RKXA 3C0JA 1SW7A 4MLRA 3LHWA 4FX6M 3W07A 3LTPA 4ICNA 3NQCA 3BK0A 4O17A 2DJXA 1IXPA 4A21A 5DCDA 3DZ1A 4ZQCA 2DZPA 3KVKA 4DO6A 5K9CA 3LTYA 4UR7A 3TNOA 4AB4A 1LZOA 5KZEA 3W1UA 3NPWA 3W71A 2O7SA 3C56A 1GQNA 3G0UA 4LU0A 2RDTA 1TPWA 2VKZG 4DF1A 4B5NA 1VHNA 3RK8A 3EX3A 1EB3A 1W37A 1B57A 5BMWA 3IIOA 3TSDA 2VFIA 2Q3RA 2ZA1A 3HPXA 2J24A 2VFEA 1LBMA 2HTMA 4LVBA 4MZ8A 3VFLA 2QCDA 4K37A 4JTTA 5CZSA 2FPVA 4LW7A 3I7SA 1SO5A 3ABQA 4EF9A 3S1UA 5C55A 5F4XA 4LUIA 3STFA 1VYPX 4MJMA 1DOSA 1UB3A 2JGQA 2NV2A 4KWVA 3DI0A 1PL9A 1MZHA 1FWSA 5D2VA 2RDUA 3E49A 3VI2A 4K8HA 2JKAA 2OZ0A 1G7VA 2H3DA 1RQBA 4K6AA 2Y7FA 1RVGA 2QUTA 2VXNA 4DF0A 1GVOA 3UXAA 3LCGA 2JGYA 4RK8A 3M5YA 1EP2A 1IXOA 3IEBA 1Z41A 2DZWA 1XM3A 3EKLA 1GJPA 1WOBA 1O60A 1XC4A 3SECA 3P60A 3DFSA 4NU7A 1FX6A 3D0CA 4LWWA 3RFAA 1PCWA 3GNDA 4POCA 3TC7A 4MY1A 4JS3A 2YXGA 3L65A 3W7GA 5AC8A 4UTWC 3E96A 5AHFA 1VR6A 3W1MA 3QMTA 1L2UA 1H5YA 5KITA 1K02A 2ISWA 2EAWA 3DI1A 4JTGA 1JCJA 1TPVA 3TE9A 2WSYA 4M7TA 3WJZA 3GLCA 3QRHA
chains in the Genus database with same CATH superfamily
4YHGA 3S46A 1OB0A 2PBOA 3DU0A 2Y85A 2ACRA 5DLCA 5LGZA 1QOQA 2QDEA 1IIGA 1GVIA 3ZWSA 5EA9A 2ACUA 2J47A 2V2HA 1WDPA 3FOKA 2OOGA 3EBVA 4MM1A 4RW3A 5ABGA 1IEXA 4XG1A 3D6NA 2X05A 2XG9A 5FSDC 4D6FA 1A5OC 3P2VA 2HNHA 2EHHA 3ALGA 4UTTC 2WKJA 3GTNA 3OYZA 4FI4A 4QHRA 4JTCA 4GYPC 4EPEC 5K9DA 2XWEA 1G4SA 7TAAA 3CAVA 1L8NA 3BXWA 4LCQA 3U6WA 1L2QA 4D6EA 4GQBA 1GYMA 1DBTA 3GG1A 1NY1A 1JDEA 5DT5A 2XN1A 2ZZ7A 3AWOA 3T0TA 4AD0A 4GUJA 5FAGA 2ZUTA 2F6XA 3BLKA 3I4KA 3MMTA 2ANUA 3H26A 2SFPA 1NWRA 4JFWA 1TWSA 3RYSA 2R9RA 1AMYA 5FJOA 1ISYA 3A9IA 3W22A 2NT0A 4J3UA 4JFVA 3BCFA 3RJXA 4GI8A 5BYWA 4Q4QA 4DRSA 3SUVA 4LNYA 2W4XA 2WQDA 4C7GA 2WJDA 1J0ZA 1KCLA 1LBLA 1S5VA 3WBWA 1K6WA 5D9MA 4ZVJA 1TR9A 4HTBA 3WEOA 4DX3A 1TIMA 2BFGA 5MF5A 4A3RA 2OKTA 2PCQA 4AHOA 3O6AA 3PTDA 1AH0A 4AUBA 4G5DA 5EYWA 3GW3A 1FDJA 1XLGA 3GG0A 2O4QA 5D32A 3N9KA 4K8EA 4KEVA 3MTWA 3GXPA 4HOXA 1M7PA 3PS7A 3AYRA 1AK5A 1OFQA 2E6AA 3UF9A 4YXGA 2WSQA 2NUXA 1GOMA 1E40A 1HP5A 2OCZA 2IKJA 1UR8A 2PDBA 3TOYA 3H2FA 4HT3A 1H7OA 3AROA 1XPYA 4NZ4A 4JY9A 2ACQA 4WEVX 2VDGA 3ME3A 3HO8A 4DWSA 3RM4A 1GW1A 2HS8A 4K36A 2ESCA 5TIMA 1LLWA 3QC3A 1SO6A 1DJZA 3CUHA 1ECQA 1RD5A 1S5TA 3NQFA 5G2HA 1B4KA 1F74A 4OV9A 3G1HA 1TUFA 3S9YA 5CJMA 3RLGA 3KVJA 1LUCB 5FEZA 3WLJA 3GUWA 3H23A 3POHA 4PTNA 4JL1A 2VC5A 3HFYA 3O2LA 4ATDA 1E56A 1TV2A 3I4EA 4O4WA 1IZCA 4LUSB 3QHNA 1E9YB 1JZ8A 3CQKA 4DM1A 4ORIA 2KX9A 4KRZA 1HJQA 2DZXA 4AC7C 3T09A 1KGUA 1OCJA 1VD6A 3EWYA 3DFYA 4NZ5A 1UJPA 4PZVA 2IKGA 1A0CA 3JZEA 3E0LA 1TJ1A 2CHNA 4ZE4A 1B3VA 5HJXA 3WLQA 4J40A 1YMYA 2PBGA 4MPQA 5BWAA 3MB9A 3ZMRA 2YXOA 3V1PA 4XVDA 2Z25A 3LRMA 3Q2DA 3PM6A 5IM51 4RXFA 7A3HA 4OV4A 5C7HA 3BTNA 1V6XA 3NQ8A 2GJNA 2E68A 5CBBA 1TB3A 2FB3A 3L0KA 3MKKA 1MW2A 3NZGA 3THDA 3H54A 2OEMA 4BK9A 3KM8A 3W88A 1LROA 3N2BA 1OZQA 3GDMA 1ML1A 3M47A 3TN5A 3U4FA 7CGTA 5LNUA 4BCEA 3TUUA 5HQLA 4CLMA 3W1TA 3AIWA 4RXGA 1LBFA 1TX2A 3SGUA 3BLPX 2XTKA 1QPKA 1XD1A 1X97A 1I45A 4TX9A 2ZRUA 4INFA 1GUVA 2WZTA 3WQDA 2G4FA 1EQPA 1FTXA 1VC4A 3C0LA 4XAPA 3DG3A 1KRBC 1MUWA 3MBFA 2YCLA 3O6DA 4DYEA 2F84A 4KESA 5MHBA 1FOBA 3TQKA 1W9PA 2Y8KA 4F0KA 1YEYA 4LX4A 3TVAA 4ZMGA 2DORA 3QY8A 1DKWA 5EMYA 1EC8A 1FH9A 1VP5A 2WSKA 2VL4A 4UMCA 2EPMX 4OGZA 2G50A 3C2EA 3BAJA 1KTCA 3K1GA 3DFHA 1IWBA 3DOPA 1RVKA 2XIIA 1DWHM 3O05A 3BGGA 1EL3A 3SFWA 4Z08A 2WMIA 4V1XA 1SFTA 4AH7A 1XG4A 1XIFA 1HKVA 4EX4A 4GINA 2KZHA 5KEZA 1E9LA 3FDKA 2DT3A 5I3DA 2BHUA 1WO2A 4Z2GA 4M0XA 1CI1A 1KFEA 3A24A 4XIMA 5EB8A 2W5FA 1HN1A 3HF3A 1RA0A 3M0VA 2OFJA 4CQBA 1SSDA 4E2VA 3IJQA 4ZODA 3VZZA 3EB2A 1C8YA 1OFEA 4HIBA 4XAYA 2Y8VA 3QJAA 4LTSA 3K46A 3DBPA 3VABA 1JDAA 4H00A 5EKYA 3DKJA 4IT1A 1YDVA 1B31A 3GW0A 1EDTA 4CCEA 2G41A 4RDZA 1JRBA 3N2OA 2GL5A 4UOZA 1VRDA 1Q6LA 1UD3A 1W9DM 3QY6A 3LOTA 1GOIA 3RF9A 1AW1A 5JBFA 3OW1A 1H0GA 1EF2A 3N4EA 2D22A 1A53A 4HNVA 4RKAA 4C1NB 1EPXA 3NG3A 1GQKA 3FY1A 2D3NA 4ML4A 2F2KA 2GGHA 2OEJA 1I2OA 1WKFA 5G4EA 4O12A 1AQMA 1XL9A 1FWJC 2DSZA 4FOJA 2VRQA 2X2GA 4QG6A 4DZAA 3L68A 3S1VA 1TVLA 2J7EA 4HB7A 1C3FA 2VX6A 2WJFA 3A4JA 2IPGA 1KXHA 3S6TA 3T42A 3TN6A 1UUMA 4JIPA 4YTRA 4J3TA 5E6ZA 1ZNNA 1QU4A 3SCVA 1AJ2A 5DRIA 3IJ9A 5DMLA 2WC4A 1WZMA 4R7JA 5AHIA 1DJHA 1R6WA 3TC3A 1V6YA 2ATSA 1R3WA 1VFOA 4Z1DA 3VMNA 4GO9A 4A8NA 3AICA 2FTYA 4ZTYA 2HMCA 3MVTA 2YBVA 3WK1A 1CWYA 2CLLA 3RNDA 3QR0A 1GG1A 3DDMA 1EYEA 3GXNA 1KKOA 3CASA 5AC6A 1LQAA 3PPGA 3V0TA 1RAKA 1CBGA 1E71M 3T2PA 1JDCA 2V0TA 2AMXA 4RNJA 4CEUC 1A3HA 4KF1A 2C71A 4LEFA 4NASA 4US5A 4M1RA 4UXDA 2PDCA 4RDYA 4GVIA 2P8CA 1SZGA 5AVNA 1W5NA 1N82A 1EBHA 4DBWA 2EPKX 3LENA 1GONA 2VZOA 3W9ZA 4DPQA 5G1TA 4DO7A 1HG3A 4GH3A 1JUEA 3K5XA 2FVMA 3G1SA 1JRCA 1YTKA 3WJXA 2VFHA 5FJPA 4JTUA 4GJIA 3ZSTA 3OBKA 4U10A 2PWEA 5I23A 1H7RA 3A6OA 4LB3A 4IQJA 1Q7ZA 4UTLA 2QIIA 3FXYA 3OVPA 3G1FA 1FXPA 4HA1A 4O19A 3CYVA 4MPKA 1YNPA 1VFFA 1YE6A 3ITVA 3KXQA 3SRDA 1JYWA 2GVEA 3V3WA 5HULA 2MUCA 4KEUA 5JH1A 1KGXA 3WD2A 2YL6A 3TTYA 5IBXC 4Q8QA 3P81A 4JQ3A 4Z42C 3CZKA 3TKFA 1JCYA 1DQWA 3P62A 4O8AA 4MWAE 3IV3A 3S47A 4ADSA 3G1DA 1JR1A 1RBLA 4L6OA 3K8LA 3AMKA 3LEPA 4P8XA 1HXJA 1K6AA 2X42A 1RLDA 3T0CA 4LUSA 2Y2WA 1HF6A 1OQFA 5I0DA 3VIPA 4DWSD 1WDDA 3SY5A 3KDNA 5CCZA 2VGIA 2J66A 2QVHA 1E1EA 4X22A 3H2NA 4DI8A 1QATA 4M29A 4E38A 4MB1A 5D8ZA 4EIVA 4GNKB 4NQ1A 4FNPA 1UC5A 4X2PA 4J7RA 3F4WA 1PB0A 4UR8A 1Q6RA 1Y7VA 1X1NA 2CETA 3WLRA 3LPOA 1FBAA 4JTQA 5D9PA 4WK9A 1XIIA 3UEQA 4L56A 5T9BG 3ARUA 3H12A 7XIMA 4E0CA 2WLYA 3JUGA 3EXTA 1RUSA 4JHOA 1W8GA 1RXOB 3QYSA 4MB4A 3WK3A 4OHQA 3AUJA 3W37A 3W28A 4H83A 3PTMA 2PF0A 5D2TA 3TFXA 1EXBA 3UG4A 3W7QA 1H7NA 3HPZA 3AISA 2ON3A 3TQVA 3TSMA 4B5UA 3T2OA 3LPFA 2YXXA 1DP0A 3HQ1A 2CW6A 4L1WA 3E02A 4F9DA 1M03A 3NQVA 1Q6QA 3SCOA 2JEPA 2XN0A 5EFDA 3SJNA 1TE1A 4PUDA 3OHIA 1EOMA 1OK6A 4LVDA 1KM4A 1JCNA 3WH5A 5A1AA 3TA6A 3VDGA 1BXCA 2O55A 2RH9A 1A4MA 4KMQA 4M6QA 2ZICA 1XCWA 4CCZA 2P1FA 2JKPA 3CZ8A 4P7QA 1P43A 3WELA 1WDSA 3NOEA 3MUY1 3OVGA 4WF7A 4OQVA 2DU2A 3FSTA 5DCBA 5AHLA 2PC4A 1NDYA 1XIJA 2PI6A 3M6DA 1QUMA 5EMJA 4E8CA 4MZ1A 5A6BD 3TYBA 2PGEA 1XYFA 5HBFA 3LPGA 4UWMA 3EA1A 4GXMA 5E9AA 4ERAA 2HSAA 1G4TA 1CXEA 4Q8MA 3LA4A 4UTFA 4PTVA 3M5VA 1WKEA 2QJJA 4EWJA 2CHOA 1ZTVA 1M7OA 1LCOA 2WBGA 4HU3A 4CQDA 3QKZA 3P0XA 1V6WA 2NZLA 1Q3NA 1GKPA 1RCXB 1CB7B 1GOKA 3RDKA 4X63A 5FAJA 3H4WA 1ZBWA 5IDIA 3VTRA 1ZLPA 1F9CA 4MOZA 3P82A 5HR6A 5SWUA 3O15A 1P0KA 4H8HA 1ZP4A 4P61A 3JZUA 3CO8A 5DXYA 2Z28A 3PY2A 1GVQA 1XDMA 3MPGA 5DELA 3TJ4A 5HWNA 3VOIA 2VFFA 3LI0A 3NQ2A 1XLDA 3WLKX 4ADTA 1XDLA 3B4YA 1W3KA 4LYKA 3OA3A 1VF8A 3MKVA 3I7QA 1PPIA 2VR5A 4UIOA 1H62A 3SRKA 3E74A 1SJCA 3MP5A 1JEZA 4B5TA 4F3HA 2FHCA 4V33A 3COTA 1HKJA 2FLIA 3LXBA 2E09A 1MFUA 4NYYA 1GEHA 4EPBC 1DJWA 1LQ0A 1H7XA 4HGXA 3UXLA 1UWIA 3CAKA 3MCNA 3AOFA 3I3DA 2DT1A 4Q8PA 3A21A 1T5AA 3VKDA 4YTTA 1V7YA 4ORMA 4KS0A 3CUZA 1YE4A 2PS2A 4KCTA 4LNCA 4XBSA 4LS2A 4YTQA 1EDGA 5KZMA 1KBLA 3BJFA 3GYEA 3L66A 5L9FA 3QW4B 3R10A 3UZJA 4YJ5A 3PFRA 1W5QA 2DPEA 2OZ3A 1VQTA 3VVGA 1OC5A 3ONCA 5EFFA 1JYVA 3MYOA 3WUEA 4YS1A 1W3IA 1XICA 5K7JA 2OSXA 5D8WA 3NGJA 4KPLA 1N7KA 3VM7A 3RCMA 2CESA 3GD6A 3VINA 5MKGA 2OB3A 4DI9A 1TJRA 5M5DA 2VJXA 5EBUA 3PB2A 3EZ4A 3UG8A 3H2AA 3WFZA 4M6PA 3NURA 4O13A 1Q6OA 4RE2A 1XW8A 4PUKA 3EPNA 1UKTA 4XO7A 2HBVA 3VKJA 5H2ZA 4XQ6A 3TN4A 5HJYA 3VZYA 4XISA 4GX8A 4H6QA 3SCUA 3OA5A 4LJ3A 2TODA 4L1XA 2FZ8A 1WZLA 4HU8A 4LAMA 1ZU8A 4WKAA 3I3BA 5G4HC 1ITQA 4D6HA 3ZM8A 4N6FA 3FAXA 3AS0A 4W4QA 5T9CE 3ZWTA 4TU1A 3OO2A 2I9EA 4FP1A 5AYZA 3E2RA 2FZ9A 1F5ZA 5JBDA 1VFSA 4DO4A 1QPQA 1IYXA 2NLYA 4CGTA 2X0YA 1K9TA 4F2BA 1X98A 1UWTA 2HPIA 2VEFA 3UJSA 1YDYA 3BV4A 1ZB5A 4O18A 4AAJA 2CKRA 2J9YA 2FKPA 2CXEA 4HJWA 2WSRA 3RO6A 1IT0A 4RJEA 3A3XA 4GY1A 3CQHA 3VNMA 1QR7A 4JTSA 3EWXA 4QDPA 3U48A 2WNQA 2UZ9A 2ZRXA 3IIPA 1F8MA 3KOXA 4K1GA 1FWTA 3G0XA 5FL1A 1X96A 1EEPA 1FXQA 1UR4A 3AALA 4MB5A 4GGBA 1RALA 1FWEC 4IPLA 3Q67A 4YPJA 2CLPA 5D38A 3HV8A 3CWHA 2R94A 1DXIA 2BSLA 3WLTA 5LNWA 4JTHA 5DEZA 1NH6A 1ODUA 3IIXA 3EMQA 3S2MA 1W3TA 1TYGA 3LTSA 2V3EA 2OYLA 1UOZA 4LBSA 2C8NA 1CGXA 3ENLA 2VC7A 3NNTA 4WOQA 4B90A 2XSXA 1CXLA 1HX0A 3ABSA 3EB4A 4IX0A 3R94A 4HN8A 4P7LA 5LA2A 1LWJA 4EACA 2CZVA 1OJXA 3LBCA 4F9JA 3S2CA 1QK0A 3SY1A 2VRKA 4F66A 1IWAA 4EWND 2G37A 3QTPA 4PTXA 1QPNA 1HQTA 3W25A 1NF7A 2IXUA 3DAQA 1ALDA 2QMKA 1UD4A 5IFPA 5GNZA 4XZ9A 4WX2A 3VIGA 3R1ZA 3AIQA 3IARA 3EEGA 3GFZA 1KBBA 1Y5WA 1PWLA 3UWQA 4ZCWA 1V8EA 3W1RA 1M9HA 1AL8A 1FY6A 4P8UA 3PP7A 2ISFA 3WQGA 3P84A 4X9YA 3RX3A 2AAMA 4QR6A 1X7IA 1E4MM 3W7HA 2YCKX 3QOMA 4UFLA 1GZ1A 1S39A 2Z6IA 2C19A 2Z2UA 2BOGX 3L0GA 3SO7A 4LSBA 4A3QA 2VURA 4M8UA 2RUSA 4LFYA 3BVJA 4CQCA 3WD1A 3NO5A 1LP6A 4GUFA 1IF2A 1RZMA 4AC1X 4HCDA 2DZSA 3VE9A 3S1GA 1OT1A 2YZRA 4GYPA 3STGA 3B06A 3TQPA 2XGBA 4IOTA 3V4BA 4LBRA 5GVJA 1AW5A 4KWOA 1F3TA 1ZCOA 3RM8A 2WNNA 2AAAA 2CU0A 2FYMA 1B9BA 4UTHA 3SDOA 3REQB 3MUIA 2WPGA 5C2CA 2QLYA 1WYIA 3VNJA 2PP3A 1ONRA 2BDQA 4K68A 2OZ8A 4DF2A 3M0MA 3HMJG 1XKYA 3AQUA 4RPQA 1QNVA 4R9OA 1ISZA 3AO0A 3QYQA 4ZO8A 4LS1A 4AXNA 1IEWA 1QAPA 2WB5A 3T78A 1HKIA 4K7VA 3UVIA 1W9VA 4P8WA 1D2KA 4XKYA 1W1A1 4PH6A 5HXMA 3IGHX 4PMNA 2H8ZA 1FFQA 1XUUA 4Q8TA 5HANA 1MRAA 3N4FA 1IHIA 3MSGA 2YW4A 1K03A 2OWCA 2ISVA 3DEQA 4Q8UA 1PIGA 3GTHA 5HDRA 3W6LA 2GGJA 3GZAA 4O8RA 3IGXA 1BQCA 1TPB1 4MWAB 2YLLA 3VAVA 3KE0A 2QUUA 3IRSA 3GDLA 2VWSA 4W86A 1US2A 1WA3A 5HNNA 4JN6A 4S3KA 4XSMA 3AHYA 3W23A 2Y7EA 2GWGA 3R13A 1XLLA 2C18A 5AOUA 3MV11 3NCOA 4CD5A 1PDZA 2PTDA 1J6OA 4UFMA 3VKKA 4ZQRA 4W5ZA 3FYYA 4KIEA 4O15A 4A3UA 1VGAA 4KGLA 2I56A 1A3XA 3SQSA 4YWIA 2PDKA 3AU6A 3W24A 3ICJA 3A3WA 3SIMA 4GFIA 2J7FA 4TVDA 1J01A 4PTDA 2AKZA 4LC8A 2W63A 2A3LA 1RA5A 1TWWA 3OVRA 3FS2A 1GCYA 2QDHA 4H1ZA 3WD0A 5A3HA 3R58A 4FXJA 4V1YA 1OM0A 4QAIA 3ZJ7A 5DT7A 1V77A 3HGSA 4I6KA 2JIWA 3IVSA 3OOQA 3P67A 2EG8A 3QGAC 2PFHA 2TSYA 1R38A 4XAFA 2LLEA 3GH4A 3ORWA 2NQHA 2GUUA 3ZT7A 3TFCA 2NX9A 3SCPA 4NJJA 1A5BA 5D2WA 2G95A 2OG9A 3HPSA 2Z1BA 4IJBA 3WYZA 5K3VA 3W7CA 1XF0A 3KBJA 3FGCB 3N9RA 3NR0A 1JDDA 4UB9A 5ABTA 2YZ5A 2B4GA 5EMKA 2W67A 1FCQA 1ZAIA 2ZX7A 3AIVA 1TMLA 3R8HA 3LG3A 2OQLA 2Y5EA 3T0DA 1FWCC 3HG2A 2PP1A 2C1IA 3HZ3A 4EOUA 4FOUA 4ZEPA 3VOJA 4LT9A 4NX0A 2YPIA 2C0AA 3HB9A 2XPKA 1JYXA 2ZTJA 1F6PA 1P1XA 4JDBA 2Z00A 1XS2A 2NV1A 3CIWA 4HMDA 3M41A 4IPPA 5IFTA 3V5FA 1AD4A 4ACZA 5I5RA 3TR2A 1VPXA 1XXXA 3MMWA 5C5YA 4ILSA 1MO0A 4D6GA 1E70M 2DQWA 3CM4A 3ANYA 5KZDA 1PE1A 2ZRZA 3FDGA 3HN3A 3IK2A 1VEMA 2ZWZA 4EKJA 3VGHA 3WNNA 3B0YA 3D3FA 1UKOA 4PCSA 4H04A 3W2JA 2D73A 2V67A 3H55A 1CDGA 3QV8A 1OFOA 3H2MA 3MDUA 2C0HA 4MZYA 1GHRA 3IUIA 4IUOA 5G2WA 5AFDA 3MT1A 4KRTA 5LNRA 3KRBA 4NUWA 3B0UX 3O6CA 3H7VA 3L4ZA 1XFBA 3BLOA 1SW7A 3LHWA 1PTDA 3EYPA 3BK0A 1GOOA 1TA3B 3GO2A 2V3GA 4FLQA 4C6PA 5B7ZA 2V6AA 1VFLA 2WCSA 3QBUA 4ZQCA 3NEHA 4AB4A 1LZOA 1M3UA 5KZEA 4ENLA 3C56A 1J93A 4H6EA 2BP1A 4FPSA 4XZNX 4KIRA 1VHNA 3EX3A 3UGRA 1W37A 4U5KA 2YDSA 1B57A 4YIWA 3IIOA 2VFIA 3N15A 2GOKA 4MNKA 1VBHA 5CZSA 2DVUA 5F4XA 4LUIA 2VQUA 2QQ6A 1VYPX 3I3EA 4DYKA 3WN6A 3NXLA 1M68A 2V5CA 1PL9A 1MZHA 1FWSA 1ONXA 5D2VA 1QW9A 3E49A 2GGGA 1OT2A 4K8HA 2INFA 1G7VA 3BQ5A 2Y7FA 3CV2A 1GVOA 1I1WA 3WQ6A 4RK8A 3ONBA 1EP2A 2WJEA 1IXOA 2HXTA 4HZ6A 3WNMA 1XM3A 4AZ7A 1WOBA 2VVSA 4CU6A 3D0CA 1IGWA 1PCWA 1XISA 4KBXA 1V6VA 5BRQA 3VM5A 4L9XA 1SFSA 3W7GA 1HW6A 4UTWC 5G1MA 1VR6A 3W1MA 2OKOA 4AG0A 1H11A 3VD3A 2VCBA 4KEMA 4JTGA 3ARTA 1TPVA 1O1HA 4J35A 2WSYA 4H9ZA 4JIEA 4M7TA 3GLCA 4LCSA 3QRHA 1JZ7A 3C2FA 3CEUA 5HUPA 4R7OA 2BX7A 2GPTA 3NQDA 6CGTA 3KL0A 3AS2A 3SURA 4Z17A 1K3UA 2VZTA 4O1BA 3MO7A 2GVGA 1L6GA 3DESA 5AC5A 3EWWA 3TXZA 1Q65A 1XYMA 3ZLFA 1QNQA 1JD9A 3NAVA 1BXBA 4MJ2A 2JK2A 4KEZA 5F7UA 1PKNA 2F38A 3S83A 1KD0A 1MZRA 4R88A 3GQYA 3JR2A 4AY7A 1V3JA 1H0IA 1OIMA 3MUCA 1BYDA 3LSBA 3N73A 2E77A 4FF7A 3O07A 1T0OA 1YNQA 4O50A 2PGFA 5I06A 1UUQA 3UJ2A 4S38A 1TVPA 5EMLA 3EGJA 3GHTA 1VBJA 1UR2A 3VZXA 4AWTA 1BPLB 5BNKA 1JFXA 2PC8A 4IMFA 1RP8A 5BU9A 1Z9AA 4G6CA 2QKFA 4PBFA 5F2LA 4N7QA 4ZB0A 3GVRA 1YYAA 1OGSA 3LZ3A 4H3DA 1TTQA 1UUOA 5ECUA 4V27A 2DW6A 3TMQA 2VENA 3RIKA 2E8YA 2JKEA 3GE7A 4DHGA 4WUIA 4EVZA 3B9AA 3LCFA 4HZMA 3TJXA 3KEHA 1CT5A 4NP7A 3GC5A 3W7PA 3SCQA 1DJIA 4N0RA 4BZYA 1IZKA 4NNCA 4FLRA 5EPDA 4C5ZA 3TWBA 4JICA 1OFDA 2J9XA 5CGMA 2VX4A 5I7GA 3WK2A 4J3ZA 3QFWA 1SR0A 2VD9A 3TSBA 4W88A 3TC6A 1CGVA 2WZMA 4IIDA 4GCXA 5BOEA 3QPEA 4UTTA 1UKQA 1S2CA 3ANUA 2DDXA 4CNNA 4GVHA 3C52A 3W81A 4P7RA 2OYKA 3N6JA 4W7VA 1ZJAA 5I24A 1HL9A 5FL0A 2ZA2A 4JTDA 3ZR4A 4Y7EA 4IPJA 2R1PA 4Z1CA 3MZNA 4DNMA 5E9XA 1UW9A 3NDOA 1X38A 4MUZA 3LQGA 4Q8OA 2YIHA 4UC5A 4REQA 3LX9A 4F0SA 3SZ8A 3SUUA 2QJMA 3B9EA 3OYXA 3N3TA 2E8ZA 3PTKA 3UJEA 4NJGA 2PRHA 2WMIB 3NQGA 5E0CA 2GVJA 3CL6A 4JQ4A 4F2UA 4ZL1A 1TTIA 1HIZA 3RXZA 3GNPA 3P80A 2XM2A 3LY0A 2Y1HA 1L6SA 3Q37A 5HQEA 1TUXA 3MZ2A 4W84A 1O5RA 4OKDA 1I60A 3LHVA 3FEMA 1B3OA 4AWSA 4OOUA 3VK5A 5D30A 2W62A 4KFPA 2X7WA 1JULA 3QQ0A 4TR9A 1J8VA 4JX5A 3P6LA 4I3GA 4M5PA 4F40A 1LYXA 3M5XA 2V2CA 1U83A 3FV9A 2ABAA 4N9EA 4ZTXA 1MW0A 2MNRA 5A8OA 2E40A 4DY1A 4K8GA 2R1KA 2PDHA 3SR7A 3PSVA 1QDSA 2WLZA 4PN2A 3VCCA 1KV8A 1MXGA 1DVJA 3UWUA 1GPWA 2PDPA 4QJ5B 1JPIA 4HSOA 1K1DA 3ZJ6A 4AZGA 1BSLA 1VJSA 1A4LA 3EDKA 1R30A 3VKBA 3CL8A 3W7NA 3W87A 2X1TA 3S2LA 1R3YA 2XDFA 4NL1A 3D3AA 3B8VA 3EMCA 5I3FA 1MYRA 1UIOA 4AD4A 1R3RA 2J79A 1UA7A 1UWUA 5A6KA 5LIWX 2J9ZA 4IF2A 4GXWA 2QUNA 1HKMA 1U5VA 4XTDA 2D0HA 4C60A 2WHJA 5C8BB 2HV5A 4G7EB 4B16A 1R86A 2VD8A 3WEMA 4DXXA 1AUSL 3W7KA 1HGWA 5CSYA 2Y7DA 3T81A 3IGUA 2Y5SA 2BMBA 1XRSA 3P14A 1JZ2A 4EANA 2PTYA 1S2UA 2B7QA 4HHMA 4PB5A 3URNA 4H9MA 3WDHA 5CC6A 4GQRA 4HK7A 1J5TA 2XWDA 3QY7A 4YWSA 2Y63A 5XIAA 2FHBA 3CU2A 2HK1A 3STEA 4TVUA 3KHJA 3RCNA 1QNPA 3G77A 1VS1A 2A5HA 5C7VA 2FB2A 4C6EA 1J0HA 5H8MA 4QNWA 1MI3A 3B05A 1FH7A 2A6NA 1ZSXA 1QMLA 3MKCA 5IHRA 3Q58A 1FCBA 3LBOA 3A5FA 1NWTA 4AFYA 4H19A 3WLNA 2FZDA 2WOQA 5DRCA 1UH4A 1VCFA 2CLIA 3IAPA 3QTGA 2YKKA 4HBKA 4UMBA 2VR4A 3S2JA 3L2LA 2Z24A 4Y90A 4GKTA 5TAOA 1R9YA 3LCHA 2FHFA 4X0NA 1RD6A 1PEZA 2G4JA 3TDFA 1OD8A 3VDAA 1F3EA 2BLEA 5I2UA 1EX5A 4CQ9A 5DQPA 2YSWA 2C3ZA 2VCCA 3MU7A 4CCCA 3H21A 3TU9A 3KOFA 5LXXA 2V38A 3AYVA 3R79A 4OECA 1F8IA 2DZVA 1S3HA 4UZSA 1XLBA 5CQ1A 4MDOA 3C5QA 4B3LA 2BNJA 4GVFA 3UPWA 4KQNA 1UYQA 1DYSA 2PUZA 1KRAC 4LUYA 4YHEA 5CSSA 4GJJA 3KWXA 1Q85A 1DV7A 4LVAA 3MI2A 3CZJA 2ZIDA 3Q65A 5M1TA 1HO4A 3ZT5A 1QBAA 3AYSA 3ZZ1A 1QASA 2Q01A 4WY0B 4AVNA 4MYXA 2X0HA 2V69A 1XIBA 4AF0A 4E2OA 3PZTA 4A22A 3AZRA 3SCNA 5TF0A 3N18A 2E5CA 4OBRA 3VU2A 3WJWA 5CLWA 1O68A 4IUGA 4OT7A 1PIFA 5HQMA 3F2DA 2C15A 4LXFA 2V81A 1TFVA 1KLYA 2WVVA 3EDFA 2J62A 2YR1A 2KAUC 1GJWA 5I3HA 2J7DA 1LL4A 1XWYA 4JPGA 4NNBA 3BARA 5FF4A 4PMOA 3ID7A 1O66A 1E6ZA 3BAWA 1GEQA 2WHMA 4PL2A 3OLIA 3NL3A 4G7EA 2J25A 4C6IA 1SQ7A 4YVPA 2H9AB 3RU8X 1DJYA 4KCVA 4AWEA 1W6TA 5LSMA 3PBGA 2EPLX 4NI8A 4CUCA 2ZKMX 3O9NA 5HNRA 3NQ6A 4GO8A 1US3A 1HJSA 4GK8A 2QT3A 3QLLA 3R11A 3OBAA 2Y62A 1BXNA 4O0KA 3SUWA 3GKFA 3PANA 2BGQA 2Z26A 4I5XA 2I9UA 2HVMA 1SO4A 3BLDA 3PB0A 4PCTA 3BGJA 3CV6A 2IW0A 2DUAA 3EDEA 2VWTA 3IPWA 4LEQA 3EX2A 4PMJA 4Q4OA 4BQ5A 3NQBA 5I09A 2GOUA 3GXTA 3FA5A 3EWBX 1WV2A 2D20A 1NAL1 3WQPA 3NO1A 4CNUA 4W93A 4QRNA 3UZZA 4JIIX 1MXDA 3AI0A 5C71A 3LERA 3TV8A 3VFCA 1TZ7A 4ZO6A 4KRUA 2NX1A 4QDMA 2C1HA 3ECQA 4DPPA 3DGRA 5A6AA 2VFDA 1P0DA 3M1ZA 1KCKA 2V63A 4D8LA 2VX5A 5CSUA 2DIKA 4UMAA 2Z1WA 2YB4A 4LF1A 5CPQA 2AOSA 4L5ZA 1GVEA 2WNWA 3UQNA 1XPGA 3G6LA 4RZ6A 2X30A 2Q8LA 3URAA 4XD4A 1TG7A 2I16A 1RPXA 1VFTA 4PMRA 4XBKA 1EXPA 4ICCX 1WDRA 3QHOA 3CHVA 5JMUA 2XIQA 3C3NA 1R2TA 2Z2AA 3LN3A 2Z6JA 3U57A 4B15A 2J74A 1XYLA 3RLVA 5C9UA 2CZFA 5LIUX 1V4YA 4XUYA 4F0MA 3CL7A 2Q71A 5HPCA 3USZA 2A3CA 2ZDSA 4LBUA 2HRWA 1LL7A 3GAYA 4RX0A 5E0FA 3M0KA 5XINA 5KETA 3AJXA 1VH7A 5D02A 5I3GA 4IGHA 3WH7A 1OFBA 2EF9A 1G1YA 1KO0A 2ZXQA 3G18A 4PL1A 2ZWYA 3PBUA 4IXHA 1T7LA 4UTUA 2EJAA 4QTGA 4JQ1A 3IVTA 4LAZA 1OZMA 3PZGA 6TAAA 4AU0A 1I2QA 1P7TA 3CQ0A 3IANA 1JZ5A 4GBUA 1LLZA 3OHMB 1L6WA 3MJYA 3BAXA 3V7PA 3SRHA 3ZVHA 4QJ3B 1KV5A 1BWVA 4DO5A 2WVUA 4HYWA 4MY8A 4RPPA 4L6DA 2ADAA 3S1WA 3CTTA 4H9XA 3PUDA 3KRZA 4GBDA 3R0KA 3RM9A 4IP7A 2NQZA 4RV8A 3UA4A 3BCDA 1J6PA 3M0YA 1XIHA 3CLMA 3OP2A 3W7IA 4WKHA 1K9FA 1C9WA 4GGHA 1EKOA 1TVNA 2P10A 2G97A 3GDRA 3RITA 1VPQA 1HL2A 4DJEC 3VILA 4N9DA 1OK4A 3OLEA 2YFOA 3R89A 3GRIA 3WD4A 4NXKA 1ISVA 1PAMA 1BD0A 2UY4A 3OGRA 3AS3A 2J7HA 2VZVA 1RY0A 3IJ6A 3CHEA 3F5KA 5CGTA 1XRFA 4IIGA 2PDFA 2WZHA 1FWIC 4Y96A 3SI9A 4K38A 1MNSA 3LGGA 2NWSA 3KBWA 3R5EA 5I3KA 2D2OA 2ZUUA 2R8WA 4I7UA 2BXZA 6PTDA 4B2DA 2J88A 1XSKA 4GXPA 4YYFA 2GK1A 4Y9PA 1YW1A 3S9IA 3PZOA 4N4PA 3T44A 3WUFA 2WANA 1BKHA 2UWFA 2NT1A 3VC5A 1OYBA 2CBUA 3BW2A 4G8TA 4MIMA 1AQ0A 1Y5XA 1FWBC 5KSWA 2INEA 2DZBA 1C8QA 1HJXA 4Q6JA 3WH6A 3EDJA 2A3AA 4NKCA 1E9IA 2YB1A 2RGLA 4AZHA 1ZALA 3WY1A 1YTDA 3KRUA 5BMXA 2Y61A 4U5IA 1E51A 1RCQA 1CGWA 4GI6A 1V0MA 3CO4A 5REQA 4AZCB 1ZPTA 2BHZA 3EOUA 4E6MA 3LXAA 3KRSA 1HFBA 4EAMA 2W91A 4B5WA 1VFMA 4H41A 2WKGA 3R0DA 5T26A 5FEXA 1YXYA 1XR2A 1US0A 3DH7A 1TPC1 1PKLA 1V3IA 1FWGC 3NYZA 3L2IA 4KERA 3FIGA 5AC7A 4GY0A 2CBJA 1YNYA 3U2EA 1X6NA 2ZFAA 4Z0SA 2REQA 1YKWA 1EX1A 1Q63A 1IXNA 3U7BA 5BW6A 4GYJA 3DFOA 1BTCA 2QCEA 3FAWA 4JX6A 1PJ9A 3BANA 4FALA 4NJKA 1K8XA 4J3VA 3OZMA 3C4UA 3CXOA 3BSHA 3NQMA 3NQEA 3LK6A 4GABA 3EXRA 4TVCA 3MWCA 4ZOEA 1UMYA 3L5MA 4EXAA 2Y88A 3RPMA 4XWUA 5FSEC 4HQVA 4JD4A 4UQAA 3TTSA 1PZ2A 1MUCA 1Y5VA 4KFOA 1SW3A 3GZ3A 3H7UA 5DY2A 3A4AA 4H4IA 3ZFHA 1UHVA 1XLMA 3STCA 4PUUA 3ES7A 5B7YA 2IS7A 3UR2A 4L64A 5LA0A 4D6CA 3G1XA 5BOOA 4H7CA 1H61A 1NDVA 3FA3A 1SZRA 1OF8A 2PDMA 3II1A 3GIPA 1W1VA 4JEJA 2X1IA 3WENA 4C7FA 5D05A 3PC0A 3U8GA 2ALDA 2AQWA 1VZWA 1TSIA 1J0YA 4GQGA 1AW2A 2RFGA 2V8ZA 3TNBA 4JY8A 5A2BA 2YDQA 1VRXA 4GIRA 4JTFA 4DBSA 4RZBA 3TZFA 1MW3A 3S42A 1P0NA 3N11A 4E4UA 2J6XA 5A6JA 3A13A 4F2TA 4W9TA 5J5RA 2E0PA 1WBJA 3P93A 4HK6A 4MKVA 3UESA 3TWAA 1Q7QA 2G0WA 2W9MA 4RL3A 2QV4A 5D9OA 1JPKA 2OX1A 5IDZA 1GGOA 1KXQA 2VVNA 4X2RA 4XD3A 2PWUA 1EJTC 1NFPA 1MEHA 3M7SA 1V3MA 3T40A 1BFNA 3W27A 4RUBA 3WH9A 2WSPA 1B54A 2RHGA 4PULA 4QQUA 2OXNA 1JAEA 4LRSA 3KBMA 1OFAA 2Y24A 3KS6A 2C13A 2QDDA 2RDXA 2ZZ3A 1M6JA 4XAGA 3BURA 3SGGA 5BCAA 2QHAA 3NJ3A 3TMLA 4X0VA 5HATA 4FMVA 2HQAA 3WQOA 4B5VA 1D9EA 3BMVA 5U7SA 3MP4A 3GY1A 4WVXA 3WQ5A 1N8IA 1H2JA 4BEQA 5J04A 6ALDA 3SEPA 1UPPA 3V0UA 1Q6DA 3GG8A 3DC0A 2ZRWA 3BO9A 3ABOA 3M0IA 3UWEA 5K9XA 1JAKA 5BXTA 3ITOA 4R53A 2TMDA 1QBBA 4DAIA 1XIDA 4J28A 1XIGA 5I6SA 3EX4A 2GJXA 5H91A 3SM0A 2PMQA 2XIOA 2PAJA 4N4QA 4U3AA 2PDNA 3B0PA 4JKKA 3KCJA 2DZTA 3UVAA 2PTXA 2J4GA 3DIPA 2OVLA 2OTDA 1NDZA 4N9CA 1EJRC 2BTMA 1OG0A 3LBMA 2CKSA 5EL1A 4DBUA 2VC9A 2XVKA 4O4VA 4O16A 2FDSA 4Y8FA 1IT7A 1BWKA 2C91A 3PNZA 3RHGA 1R3VA 1NELA 2E67A 3FHQA 4QX4A 1G69A 2CZEA 1ZS2A 3HGJA 3ITCA 4P7OA 3UYCA 2WK2A 2VC6A 5E70A 1I2PA 3W7LA 4N9BA 1D8WA 3N04A 5REQB 4NNAA 4FSAA 1O7AA 4AZCA 1Q6CA 2Y7GA 1KFLA 1PV8A 5H8UA 4AZ6A 1AQHA 2XHYA 4QG9A 3GU1A 4PFHA 4W8BA 1NDWA 1J5SA 1UBSA 4AY8A 2MANA 4LS0A 1BAGA 4YLWA 2H6RA 4WCJA 5C9ZA 4NJHA 3EXSA 4GVGA 4YVXA 2FMOA 5CZJA 3B9DA 4O28A 3WNOA 4DJDA 2P5NA 5CC3A 3W7RA 1Q7MA 4XAZA 1JUBA 4JOMA 4BI7A 3D47A 3OGSA 3M0LA 3TYEA 1DIOA 5A6BA 4QNEA 1FWRA 1GTEA 1A80A 3ITYA 4FNRA 4BQ2A 1FKXA 2FDMA 1SZEA 1VAHA 2HWGA 3E2SA 3M16A 3WLPA 3SBFA 2ZZ1A 4JQAA 5FA5A 4S2CA 9RUBA 2GDVA 5BXRA 1R9XA 2XM1A 5A6TC 4HNLA 1B3XA 4B92A 1Q66A 3L2MA 4CN1A 3T7VA 3SADA 2FVLA 1UD8A 4EK7A 3QMRA 3THQA 4B3KA 2CYGA 2GLKA 1QNSA 2XVGA 3R2GA 2CZDA 1BRLA 1QI5A 4CCDA 1YQ2A 1MEWA 5HOSA 1LL6A 4B9YA 3FLUA 2PB1A 1TWIA 4TV6A 1KKRA 1XJBA 3SCTA 4D6DA 3NVTA 1XIEA 2QCGA 1XQLA 2NWRA 4HSHA 2HE8A 2D69A 1DL3A 4G9PA 2PDUA 3H2EA 3ISIX 2FZBA 3C8FA 1ITUA 4AHPA 2NLIA 1E6XM 1OEPA 1KM6A 4JN7A 1KW1A 5LKYA 1GW9A 2XJ7A 1E6SM 3WMCA 1W3LA 5EBAA 4QGCA 3MC5A 3LXCA 4M80A 3D5HA 4AXKA 1H3GA 2F9RA 3KLLA 3OGVA 4IMAA 5I78A 3KBSA 3SAZA 1TRDA 2QCDB 4Z2KA 2ZE3A 2HVOA 4D6IA 1MQQA 2P3EA 2JFEX 4HSNA 3HJEA 1Z48A 4GPNA 4AIOA 3LLFA 5GJMA 5A2AA 1FKWA 3HGRA 4WDXA 1OGGA 2XIMA 3WL0A 2YOCA 2VTFA 4NRRA 1UMLA 4DJFD 2BOFX 1CGYA 4JDYA 1QHZA 4MB3A 1K8CA 1YXCA 4GHRA 2UBPC 3PBMA 3WMLA 3ZQ9A 3AMGA 3UXKA 3TN3A 4M3PA 2E9MA 4XZHA 2DH2A 2P50A 1J11A 2UY2A 3LV6A 3MMUA 3IJ7A 3M0ZA 2NXIA 3GB6A 1ZY9A 3FVDA 4HMEA 3N14A 3MYPA 1HKWA 1IEQA 4MY9A 2AL2A 5H8PA 1E3XA 3A9BA 1PS9A 1EUNA 3O7UA 2BOEX 4Q7NA 3PSWA 2OT0A 1VYRA 4U33A 2PODA 1UP3A 4BA0A 2D2JA 2PLKA 2FJUB 1POJA 4HNOA 3WLIA 3L67A 4DZIA 2VGBA 3G1VA 3DG7A 2W27A 1J0JA 4RW5A 3VIHA 1VJZA 4GIEA 2VEMA 4CN6A 3KAOA 3UG5A 4RCXA 2QJHA 3W7EA 2PF8A 1HZYA 5LA1A 1GKRA 1EYWA 2YL5A 4UQDA 3ZVIA 5I3IA 1LUCA 4US5D 4AIUA 4HCLA 3WZ0E 4PSRA 4IISA 1MVYA 4DWSB 4TX8A 1C9DA 4JYFA 2PURA 3FKKA 2ZZ5A 3ZT6A 5C9XA 3RR4A 4FO4A 2RJHA 1C8VA 3A47A 3GHUA 2EBNA 5CG0A 1HGYA 3O1NA 3ERPA 3IUDA 3N34A 2E28A 3FJ6A 4WLCA 2VMFA 1UR1A 3GX9A 3AXMA 3S2NA 4DLMA 3KCOA 4GZ7A 4AD3A 3CPRA 4RV3A 1IEIA 3AIBA 3ITTA 2QDGA 3UERA 3N19B 1TWZA 1E9ZB 2PU0A 2WJZA 4PRWA 3NYDA 1H1YA 2H9AA 5CGQA 4PMZA 1GOQA 1AH4A 3GU9A 3P7YA 1PX8A 4W85A 1CECA 4LYRA 2XZ9A 2H90A 2E6YA 4BI6A 2V5BA 1H1NA 4DZ5A 2WCGA 5CBJA 2HJPA 1XINA 1WXZA 4UTIA 1R3TA 1W1ZA 3CIVA 4UOJA 2HS6A 3MW7A 9CGTA 5FCZA 3S5NA 3PZUA 2PDJA 2WAGA 4OJYA 5I79A 1O5QA 2IUZA 1B9ZA 4EPKA 2WXDM 4IG2B 4D9PA 3O16A 3B4UA 1TJPA 4QS6A 5CPSA 3AXKA 3W7MA 3BW3A 4F79A 5I77A 3B0XA 4GFSA 2YFNA 3HG3A 1IQ8A 2GJXB 4G56A 1I8JA 2DGAA 4RLIA 2RKXA 3C0JA 2INZA 4E8GA 4C6NA 3HTWA 3LS9A 4KWUA 3KZPA 1X6LA 4ICNA 3TYZA 3CZEA 3TA9A 3CZGA 5DCDA 2PWVA 2DZPA 3EOSA 3UU0A 4IQEA 2NW0A 3W1UA 1TR1A 2O7SA 4YYCA 4FOKA 4IIEA 1GQNA 1NIUA 1TPWA 1BVZA 2O4MA 3RK8A 4GZIA 1V6UA 3IJDA 3VC6A 4NZ3A 5BMWA 4B4FA 1J9YA 3TSDA 2Q3RA 2ZA1A 2J24A 3ARZA 2HTMA 1W1IE 2DY3A 3KTSA 4MZ8A 2QCDA 4K37A 2FPVA 3I7SA 4FLOA 3S1UA 1WZAA 1S2TA 1KQZA 4AYGA 2BHYA 3CLWA 3E2QA 2GQ3A 2NV2A 4KWVA 3WCZA 3CGTA 1M01A 2PDIA 4X61A 2CITA 2CBIA 1TJ2A 2WYSA 5I02A 2OZ0A 1RQBA 3K1DA 3MS8A 2QUTA 3VGGA 1BYBA 1FWAC 3BCJA 3V1HA 3LCGA 4ZO7A 3IEBA 3EEZA 1XC4A 3DFSA 5EU9A 4NU7A 1AA1B 1F3XA 3RFAA 2AGTA 2G3MA 5M3WA 2WCAA 3GNDA 1ONWA 4GG9A 3WBXA 1E0XA 4POCA 4DYJA 2CIPA 1TE6A 5I07A 2ZUMA 3L65A 3U0HA 5AC8A 4D71A 3E96A 5AHFA 2BGNE 4OVXA 4HCHA 3MO4A 2O9TA 4ASTA 3TZNA 3F2BA 3WQWA 5BXPA 2Q8XA 2OO0A 4TX6A 1TX0A 1XX1A 4HU0A 3HQOA 3JW7A 4C6QA 2VELA 4WSKA 1KM1A 3N4AA 3UD6A 2V68A 1E3ZA 4QITA 1MMFA 1P4CA 1R5YA 2Z1KA 1UROA 3DYMA 3P61A 3QGVA 4C90A 1SFLA 4JL2A 2O56A 5JIPA 4TV5A 5DO8A 3W1NA 2GJPA 4CQAA 3IACA 1I0BA 3S8HA 2AGKA 4HPGA 1R3SA 4Q4RA 4AY1A 2W0UA 1XLKA 2DZUA 4GISA 1NWUA 3DHDA 3HOJA 1TKKA 2G3NA 3SJ3A 1BRLB 1UR0A 3CK5A 1CXIA 3AHZA 1PX4A 2FFIA 4O52A 3MUZ1 2X1UA 4GRSA 3UXIA 4WRHA 3GKAA 3KBNA 3PZVA 3C6CA 3N12A 4NZJA 3APYA 1B1YA 5IOBA 1RBAA 3S6DA 1ZFJA 3W02A 1R47A 3CIXA 4DQWA 1ZJHA 3QZEA 3QR1A 2IXVA 1ZENA 4QAWA 8XIAA 3ZJKA 4Z2JA 3GFYA 1ZQ5A 4D72A 4AYSA 4JN8A 4B91A 1WOAA 1IR2A 2NVAA 4HTYA 1M53A 1AG1O 1TV7A 3MMDA 3AZSA 1J96A 3APGA 4S1FA 3R12A 4A2RA 1E72M 1W1PA 5LHEA 4Y8EA 1T96A 1DE6A 3GTXA 1FQ0A 1AJZA 2GUYA 3PTQA 3UZ5A 2OQHA 4AHQA 1VHCA 4MHBA 4CD4A 4IL2A 2Y70A 3TW9A 1Z6KA 3WF1A 4K39A 3L4VA 1FWWA 4TXEA 2J8TA 4LUTA 3UWVA 1EZ2A 5TD4A 3H53A 4E2BA 4CU7A 5A6LA 2ODOA 3BAIA 1GJUA 1QVBA 3OODA 1XLAA 2D0FA 4AX6A 1TMQA 3I10A 1TCDA 3TK7A 1UPMB 3F5JA 2IPJA 3MANA 1N8FA 4HZ7A 3EOOA 4PBGA 4WJEA 4PMYA 4OU1A 1LRNA 3N13A 3NXFA 2VOTA 3SRFA 1KCXA 1WBHA 1QCWA 4D8AA 2ZTKA 5ENLA 1W0MA 1E43A 3DFQA 3VNDA 1C92A 4BQ4A 4C6BA 2JEQA 2Y89A 4AVOA 1EHAA 1YX1A 1TELA 1Q2SA 4O14A 2PWGA 3PJWA 3AUOA 1YPIA 2ZZ2A 5GPRA 5E5CA 3NPUA 2IQ0A 4J5NA 4JNYA 3FHAA 4LCRA 2WQPA 1ODZA 4PB3A 3BAYA 5TQLA 2PU1A 2G3IA 1H49A 3FJNA 3KVLA 3L9CA 4Q4SA 4I6VA 4KT2A 3VKCA 1PZ1A 1TPH1 4U2ZA 1GPFA 3IJ8A 3VGBA 1PX3A 1J0KA 2VI0A 4ZFCA 3UZXA 1GWJA 2CLMA 2YA1A 3BAKA 3L5AA 4XB3A 1TPDA 4ZQOA 1GYNA 4IQLA 2J6VA 2A79A 8A3HA 4E3VA 1AFSA 3B3DA 3LUTA 3N2MA 4HHPA 5D03A 1IR1A 1KFBA 3GDKA 5HJLA 4ADUA 1KTNA 1HT6A 2ZE0A 6XIMA 1AVAA 4O11A 4N2YA 3ZXWA 3W6MA 2BVTA 2DIEA 4B5XA 4CN4A 1OF6A 1M1BA 3KZSA 5DBUA 1C91A 3O8AA 3BLIA 4AZ5A 1QW7A 1XSIA 3CT2A 4BI5A 1I6NA 1RJRA 4KWWA 1VJIA 5BWFA 1G5AA 3QV7A 4R33A 5LHFA 3PJTA 3KOYA 1S2VA 4ZB2A 4YCOA 4NZFA 4O1DA 5I3JA 4MUPA 2BWGA 4DUOA 1GVSA 3B03A 1S2AA 5F4SA 4LPCA 1CB2A 5M2FX 1UZ1A 2OZTA 3RRAA 3UXDA 2XYLA 4JFUA 5BU6A 3WMSA 3NL2A 4PMVA 4IG2A 5FACA 3PHAA 3T4WA 4K3ZA 1EA9C 2OO6A 3CAWA 3AXIA 1YXDA 3HURA 4S2BA 4LF2A 2A7NA 3OBEA 2E6FA 1SUXA 3W76A 2A7RA 3OQ8A 2GSHA 9XIMA 2RJGA 3B0VC 4RNHA 3T08A 3MDWA 1DWIM 3FFSA 4GE8A 1VBRA 4S3AA 2V5KA 4PUEA 1V51A 2GDUA 3GNOA 1RHCA 5LNVA 4I9TA 5D9NA 3TCEA 5E1QA 5EMMA 1G94A 3QPZA 1UWQA 1XP3A 1E4IA 2NQLA 3GIQA 2DFAA 2ZC1A 2B81A 5CPOA 1TMHA 4Y9MA 4QE1A 2EKGA 4GIYA 1JL8A 4MVAA 3GUGA 3WG6A 3OTRA 1Y0EA 1ENUA 3N17A 4PBEA 4Q33A 1YIXA 3F2CA 1P6WA 4FNUA 3F1QA 3THCA 1FWFC 2VDHA 5DMMA 2R24A 4Q8NA 2RDWA 2PPGA 1K77A 2BB0A 3U2OA 2ZYFA 4U28A 4TMBA 3E3HA 3R6IA 1FDYA 1SFJA 1D7KA 3QV9A 2QR6A 5CBIA 3W75A 1RH9A 3MUXA 2BVWA 4EPDC 3NZRA 2E4TA 2OELA 3NOYA 3T0AA 4PGLA 3W1XA 4WY0A 5BRBA 3IGSA 1LRQA 5HK4A 3UR5A 2D0GA 1ECEA 4CNPA 2VGFA 5ABEA 3CV7A 5G1YA 1JVNA 7ODCA 3E6EA 3HV9A 4C6LA 2FVKA 1REQA 1IZJA 1Q2RA 2POTA 4BY3A 1R85A 1SGJA 4WSJA 5CG7A 3WL1A 2I17A 2QULA 2DSVA 3WF3A 4GC3A 2NX3A 1EA0A 4J3XA 4RZ5A 3M0HA 4FR1A 1E15A 3LU2A 4MYAA 1KTBA 4IFKB 2CLKA 2ABBA 4R34A 2JE8A 1KFKA 2GWNA 2Z1SA 4H6RA 4WDUA 1IXQA 1F3WA 1TO3A 2IKIA 2P0OA 3GXIA 2W79A 4M56A 4S3GA 1W9BM 1FCVA 1XFCA 2TYSA 1PTAA 3S4TA 3CHDA 1O5KA 3I6TA 3M46A 4I5RA 3OG3A 3XIMA 4C1LA 4M81A 3GWQA 4YTUA 3MJMA 1J2BA 2NVDA 3A23A 3DN5A 6REQA 4JTKA 3GSMA 3L0NA 1RSCA 1DQUA 3ARVA 1GQLA 3HJZA 2CPUA 2PRLA 3WJYA 1WAWA 1KFJA 3NTYA 8TIMA 3BW4A 2IKHA 1UD5A 4WJ8A 4DJDD 5MKGB 3GNNA 3TAOA 1E5NA 4ACZB 3CH9A 2NXHA 5GNXA 2PD5A 1JZ6A 4GYFA 1XYZA 3GBEA 2FFCA 1I1XA 2HVNA 1M7JA 1UWSA 5LIKX 1WKYA 2HROA 4PMQA 5BXSA 9XIAA 5RUBA 3OLDA 3KWSA 4PTWA 1DIDA 3OU8A 4B4HA 3AJ7A 3TAKA 2R82A 3ZO9A 2GSJA 1JI2A 3LMZA 1TWDA 1OC6A 3GYCA 5DFAA 2C1GA 5AZ1A 1L8PA 4H9UA 4QFUA 2QAPA 4UTJA 4A8RA 1YBQB 3CMFA 2Z7KA 1ZL1A 3DECA 2BY2A 3DHFA 1H7WA 2ZUSA 4LGXA 1NFBA 3T4CA 4ZQMA 3LD5A 1U5JA 4LVGA 3TQ0A 3ZIZA 2PA6A 5PTDA 3P8JA 2XSAA 2VO5A 1HJWA 3UR8A 3Q94A 1XLJA 3PZNA 1XYCA 2DT0A 2W92A 3CPGA 5AVHA 3QH2A 2DP3A 3OIXA 4O0ZA 2QJIA 1LG1A 1TA3A 4ATWA 1SR9A 3KCLA 1ZGDA 4UCGA 2J78A 3BUVA 4I9MA 1X8FA 2X40A 2G5WA 2BXVA 4YCPA 5K4ZA 4KCWA 1AMKA 3KL3A 3U5UA 1S38A 2QJGA 1E0VA 1L6FA 1IV8A 7REQA 1H60A 4Y9OA 4QROA 3NPVA 1H4PA 3WD3A 5ECVA 3F5LA 4MTVA 2B7PA 1OC7A 1PCKA 4WD0A 1B5TA 1CLVA 2PWDA 5B80A 1VEPA 4J3WA 3S6OA 2GQ9A 1V03A 2F2HA 3DYPA 4RNIA 3WQEA 4Q22A 3SGZA 5LGXA 2DV0A 3RUBL 1XV8A 5AC4A 3PUGA 4Q6XA 1EJWC 4FXSA 1B30A 4GNVA 2WM0A 1O5XA 3WSUA 4LAOA 1V7AA 1EH9A 2C14A 1E1FA 4ZSUA 5D33A 3M43A 4MJZA 3ZR6A 3SSJA 2V3FA 3C2VA 3SQMA 2QCLA 3FW6A 4IP5A 4IM4A 1R2RA 3NSMA 1GKQA 5BOFA 5JIWA 1E4NA 1DEDA 1QOPA 4D8ZA 4HVXA 4CU8A 1JNDA 2E5DA 1F4HA 1TCMA 3K4DA 1BGAA 1LQ2A 2Z2BA 3JU2A 1NP2A 3UCCA 3WF2A 1KCZA 5JQ9A 1XYBA 4OBTA 1TTPA 2PDWA 3WBYA 3QSTA 1JCTA 4D2JA 1QPOA 1OFPA 4I9JA 3V36A 3U5YA 5AYXA 4JX4A 2ZZ4A 2ISSA 4HK5A 2GJRA 3GTIA 2WZIA 5A8PA 2Y8UA 1WQ5A 4PUNA 1XBZA 2VT0A 1TPEA 1DHPA 1EJSC 1BSIA 3PZQA 4D6JA 3KP1A 3UBPC 1X6UA 2ZADA 1YBQA 4RDWA 3W26A 2Q09A 4GNJA 1D3HA 2OLAA 5FJUA 1ZHAA 5FEWA 3W7DA 1ME8A 1V79A 3K2GA 3UW6A 1OD0A 3GG7A 1THFD 3G5EA 1FFRA 3PVFA 4FZIA 2WVSA 3P5YA 2WV8A 1EGZA 2CCRA 1IIHA 1QOXA 4HKPA 4MAZA 1V6TA 3AMCA 1WB0A 1KB3A 3T8LA 3BICA 3BSMA 2OR2A 4XUGA 4S3CA 4Z0JA 3CJPA 4MFEA 3E9AA 4PUJA 2QV5A 2QCMA 2QGHA 3G1YA 3BOFA 1NJJA 3W7OA 2DIJA 5A6SA 4E4PA 1EIXA 3L4TA 5A95A 4L80A 1UKSA 3EPMA 3T55A 1W9XA 1KXVA 4J9JA 1I9CB 2Y6ZA 4P8VA 5CZKA 4UFHA 1K8ZA 3A64A 4QE4A 4S23A 1KXTA 4R85A 5IXEA 3W83A 3KBVA 3W73A 2RAGA 1A50A 3GVGA 4ZA0A 2F6KA 3ATZA 3NZ1A 1P6BA 2CWXA 1CZ1A 3IRDA 5FJTA 2PGWA 3PULA 2J8FA 3VYLA 4QG8A 4JTIA 3H6OA 4IPIA 3QOKA 1EBGA 3ARRA 4ES4A 2XN2A 1FWNA 3DBNA 2R1NA 1R7AA 3IWPA 3VD5A 3AC0A 3E12A 1XLHA 3B9NA 4C7DA 2VEPA 3PZ9A 3QQ1A 3TYUA