3L12A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (yp_165505.1) from silicibacter pomeroyi dss-3 at 1.60 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
297
Chain Sequence
GFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGVRALEFDVVMTADGVPVVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGLDGRTVYGRRFPDQAFLTGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARAEMVAAVLADVRRYRMEPRTVMHSFDWALLGECRRQAPDLPTSYLSQLPEGPDYDRMTESLPQAVASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDIRRMATTGVDGIVTDYPGRTQRILIDMGLSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (YP_165505.1) from Silicibacter pomeroyi DSS-3 at 1.60 A resolution
rcsb
source organism Silicibacter pomeroyi
molecule tags Hydrolase
molecule keywords Putative Glycerophosphoryl diester phosphodiesterase
total genus 100
structure length 297
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3l12A00
2OTDA 3QR0A 6PTDA 4F2TA 3NO3A 4QJ4B 1DJGA 1O1ZA 2PLCA 1YDYA 4GNKB 1GYMA 1QASA 4OECA 2FJUB 3EA2A 3OHMB 4I90A 4I9JA 1QATA 4I9MA 5T91A 4S3GA 4QJ5B 1DJIA 2OR2A 3L12A 3QVQA 2ISDA 7PTDA 4R7OA 1PTGA 4PTDA 3H4WA 4RW5A 3V16A 3V1HA 3H4XA 3QR1A 5PTDA 4I9TA 2F9RA 1DJYA 4I8YA 1XX1A 4QJ3B 1T8QA 2OOGA 1DJWA 2PTDA 4RV3A 4RW3A 5T9BG 3RLGA 1DJXA 1V8EA 1DJZA 1PTDA 5T9CE 3V18A 3EA3A 3CH0A 1ZCCA 4F2UA 1DJHA 3KS6A 2PZ0A 3KS5A 1T6MA 3PTDA 4Q6XA 2P76A 2ZKMX 3RLHA 1VD6A 2O55A 3MZ2A 1AODA 3I10A 4F2BA 3EA1A
chains in the Genus database with same CATH superfamily
3UWZA 1W9BM 4DXVA 4GI8A 5CPTA 1WXJA 1LBFA 3QHNA 1W9VA 2CXGA 2FHFA 2WZIA 3UBPC 1QI4A 4KFPA 1DIEA 3GK0A 4UR9A 1ZP4A 3PHAA 5CGQA 3S1VA 3H54A 3POCA 4B5WA 3UYCA 3VMPA 4PTMA 1IWAA 3PWIA 3UJ2A 1V3MA 4Q8NA 4FP1A 3TMQA 2E8ZA 1QHZA 2J6XA 4PTVA 3ICJA 1H1YA 3HJZA 4LEQA 4NX0A 1XJBA 3R94A 4ZOBA 2C6QA 4DNMA 4DWSC 5C55A 1Z69A 2PE4A 3G1DA 3OA5A 1FX6A 3QGAC 1RXOB 1WDWA 4YWSA 2TODA 1JUBA 4PUDA 2I57A 4GACA 4U5KA 1J6PA 2CZEA 2I16A 3CIXA 3KOZA 3FY1A 1KGXA 1XIHA 3QZEA 1DTNA 1VEMA 3WBXA 2G96A 3WLRA 4AZHA 3T09A 1LG2A 3KZSA 2YIHA 3ONBA 4AF0B 4C6CA 2ZXAA 4UZUA 1J11A 2P1FA 3A3WA 5HATA 1SFLA 5HXMA 4GKTA 1KBIA 3WSUA 3ZJ8A 2ON3A 4LALA 1R3RA 1ESWA 4MZ1A 4Y9MA 3NA8A 4MY8A 5JXQA 1WZMA 3TEVA 3GNRA 2RJGA 3MMDA 3HV8A 3I6RA 3CUZA 2X0SA 1KRMA 2YBUA 1U30A 3W7IA 5TNVA 2W9MA 4LQ1A 4TMBA 4D9PA 4NAFA 4F2UA 4INFA 1AW2A 5CG7A 4UB9A 1BVNP 2YCLB 1VCFA 3SQSA 1HO1A 2HE5A 3E0VA 3QPZA 1JXJA 4GH1A 5HWJA 5CLWA 5AHNA 3SSZA 3WZ0E 4B91A 5TIMA 5DFAA 1VPQA 2EKCA 1BVWA 4JIQA 5KTLA 2JF7A 4HU0A 4FX6M 1UR4A 3RX4A 3L2IA 1X38A 4GK8A 4RCXA 5J5DA 3MDUA 4H3DA 2V2DA 1W0MA 5A1AA 1ICSA 1YTEA 2J25A 3IRSA 2E3ZA 3ZR5A 3VX0A 1KBKA 3M7SA 5EMKA 5LNSA 3QM3A 2QJMA 3UJFA 4JAWA 5D38A 1L2UA 4X63A 4MZYA 2REQB 4AZ5A 3A9IA 2VGBA 2YR1A 1VF8A 4C6BA 2J8FA 3NXLA 5AYBA 4FNSA 5TQLA 2ZA1A 3UJRA 2W63A 4S3JA 1F5ZA 2V5DA 2GGEA 1NQ6A 2ASHA 1JZ3A 1UR9A 2R24A 4EACA 1RP8A 2E6YA 1LG1A 3MS8A 5JUVA 4H8NA 5G1YA 1OGBA 4HPGA 3MB9A 1SJCA 3UR8A 3N29A 2ZE0A 5EL1A 1HJXA 3S42A 4KRTA 3OVGA 1J0ZA 2NW0A 4XZMX 1GW9A 5HULA 2BP1A 4NHVA 1EPVA 2PGWA 5FAGA 1DEDA 1FWSA 3SN4A 3GXTA 3EX6A 3LPPA 2OWCA 2AOSA 3WLPA 3SURA 1GVIA 2NT0A 5LNWA 4WSJA 1T41A 1KXTA 4QJ5B 4L7ZA 1IGWA 3SCOA 5ABTA 3EXSA 1R47A 4WOZA 3ARYA 4O28A 2PWGA 2Y6ZA 4X61A 4XTDA 1PTAA 2QF8A 3MI3A 1MEIA 3W1QA 1TPB1 2PDMA 3DIPA 2Q3OA 4D6GA 2CLPA 4GG9A 1QNPA 4YYFA 1JCNA 4AYGA 2C15A 3FAXA 3T6CA 4WDXA 1K70A 1QPNA 1P6CA 1DTUA 2GJNA 5I23A 2V3FA 3FYPA 4MWAC 3AS2A 1YDOA 3HGRA 4L4PA 1VRDA 2G50A 2YB1A 4KIRA 5HWNA 1QPRA 2WKGA 4MJ4A 4QHRA 5CZKA 5I03A 4JKMA 5FSEC 2GFTA 4HU8A 1PSCA 3BW4A 1TWSA 3K8MA 5F2GA 2W4XA 3PNUA 3OW1A 4JHOA 4GFSA 1IWPA 1W9PA 4M6VA 3IGXA 5CCZA 1X8FA 1ZGDA 3TYEA 3UPWA 5BXSA 3ABXA 3WUFA 4O10A 3HM7A 1CGXA 3EKLA 1EKOA 3IIZA 5H6HA 1NQKA 2GWNA 3RIKA 1KFJA 5LIXX 2F6UA 3USBA 4CLMA 4QCEA 3AHZA 3Q67A 4LJ3A 1EBGA 3VKDA 2NQ9A 3LB0A 1BGGA 1JD7A 3QV8A 5BOFA 4LOCA 4MKVA 4DELA 4K8EA 3ONCA 2QJNA 2BVDA 4HTYA 4LUTA 3W7LA 2H6RA 3TW7A 4AD5A 2YGYA 3LZ5A 1UBSA 1V3KA 3LERA 3AQUA 2HJPA 1W5OA 4IT1A 4XD6A 4A35A 4L65A 2DIKA 1AD4A 3ERPA 3NZGA 3O9NA 1EO7A 2R91A 2TYSA 1UKTA 4MAZA 4B16A 3VD5A 1ZJIA 4DZIA 1ITCA 1EGMA 2TPSA 4FIQA 1HVXA 1H7WA 2C71A 2GQ9A 5F4WA 4Q8MA 3MYOA 2VOMA 1IHIA 1N8WA 1GUVA 3SY8A 1YX1A 4XBSA 4AHQA 3VK5A 2WKLA 4KIEA 3H2EA 4QJ3B 5D9PA 3RLGA 1FHUA 2C1GA 2R94A 1ZNNA 3HPSA 1Q3NA 4IH3A 4IJRA 2DP3A 6PTDA 1LQ2A 3DAQA 1UC4A 2GVJA 4IQEA 4CQBA 4JBRA 1LM1A 1OGGA 3F2BA 3L65A 3UR2A 1VFUA 3R10A 4O1DA 3TCSA 3PTMA 1RSCA 3OVPA 3IJLA 5AHIA 4OBSA 4O1FA 5AYZA 1RBOB 1MUWA 4DXKA 2F2KA 4ACZA 5JIWA 4H4IA 1R7AA 1HW6A 3VMOA 2J7DA 3SRKA 3HZ3A 4GZJA 1NARA 4Z1CA 4F66A 3DI1A 3VM5A 1E15A 5BWFA 4KCVA 2VYOA 1X98A 1GVQA 4Z0JA 1W1IE 4H9YA 4RUBA 4KWOA 3OGRA 4OWGA 3CJPA 3PZNA 1O4UA 1XH2A 1WUFA 1FCQA 2GJXB 4Y6GA 3BLKA 3BVJA 4EKJA 4OBTA 3AMKA 1E9IA 1A5OC 1VKFA 2OKTA 1DXIA 1GVEA 5BXTA 3N4AA 3GWQA 3VNIA 1SZNA 1ZAIA 1TVPA 2WJFA 4QAIA 4IJBA 3EOSA 2IUZA 1G1YA 3TJLA 3ES7A 3C2RA 3GYCA 1E70M 1VJIA 5FJPA 2QZRA 1ZFJA 1LOSA 2GK1B 2GSEA 1NEYA 2PDGA 4C91A 3M0IA 2HBVA 4UQDA 4JHMA 5DT5A 4HHPA 4AZCB 1E9YB 2RHGA 1FDJA 4LS0A 2DSUA 1IEVA 3N17A 4HSNA 4E4PA 1XW8A 1QOPA 5I3JA 5E6ZA 2YL8A 3OG3A 3ABSA 2OZ3A 2BWGA 4TX9A 3MSGA 4PUJA 3W02A 3VIOA 4UQAA 4KWSA 3SBFA 1GYMA 2BTMA 4GYPA 3U6WA 4MYXA 4Z2JA 1ODUA 1WDSA 2VFEA 4JIHA 1KM2A 4FNUA 3IV3A 1ZTVA 5HAOA 4J28A 4QEHA 4EWJA 3IACA 2XIOA 3KL5A 1E1CB 4Q7BA 1W1VA 3W85A 4NUWA 3MHUA 3IUDA 4QQ3A 4HBKA 3BL3A 3PANA 4F9JA 1XYBA 2R14A 2QUTA 1OCJA 1XQLA 3ITYA 4MKSA 5A8PA 2EF9A 5IM51 3A21A 2Y24A 2RGLA 2RGMA 3A4WA 2DPEA 3F5KA 3VILA 3GTFA 1YE4A 3W88A 4PEKA 3HF3A 1RHCA 1DXEA 4BI6A 3UXKA 3QBUA 3P8JA 3K4DA 4ZO7A 4AY1A 5KZEA 1OX5A 4CNSA 4LW7A 1DHKA 1MW1A 5T9BG 2WVVB 5D30A 5BU6A 4D8LA 1VBHA 5FL1A 4PN2A 1JGIA 3AYVA 3JZEA 5DMNA 3VABA 3QQWA 2ZA2A 5JQ9A 4S3CA 4EXBA 1YDVA 3LLDA 7PTDA 2X8RA 3LMZA 3NYDA 1H5VA 1O66A 1JCJA 2V5LA 2WSQA 2ZRVA 1MSSA 4EF8A 3PJUA 2C91A 3E74A 1CLVA 3NQDA 2AL1A 4RNHA 4RV3A 1R8LA 4JTIA 3S6OA 4KGJA 1SZEA 2W92A 3SY1A 3WF4A 4LAKA 4R7JA 3R0UA 2FZ8A 3EX4A 4LEFA 3W7DA 4BK9A 3QGVA 3T2OA 3PNZA 2V0TA 2OQLA 1TJRA 2QUUA 3HPZA 2IMRA 4ICMA 2OFJA 4IXXA 3WIJA 3EDEA 5C5YA 3STFA 1JI1A 4O1EA 4ORMA 4GGBA 1QWKA 2J62A 1Q4NX 3UA4A 1EIXA 2PDJA 2GJLA 3WJZA 3C61A 4U3CA 1WAUA 2BHUA 1W3JA 1HL8A 3B4UA 4WGXA 1UH2A 1V08A 4BHYA 5BROA 3AI0A 3J7HA 1XDJA 2XIMA 1Z7AA 3L4XA 4ZB0A 3A13A 4D6JA 4BS0A 3TSMA 4KW2A 1CCWB 4D6CA 4DJEC 3TAKA 2C18A 3AS1A 1OG6A 4G8TA 1W37A 3G3DA 2BG5A 3G6LA 1PL9A 3BWWA 1GEHA 4L80A 4YCOA 4GZEA 2FIQA 3BLEA 5AHFA 2PU1A 1M68A 4DJED 2EPOA 2Z0IA 1E6QM 3CUHA 4AD1A 2ZXDA 4HU3A 2OPJA 3CQIA 3VKAA 1H62A 3BUVA 2F61A 2VZOA 2A3HA 2Z4GA 3BZGA 3TVAA 2OEKA 4US6A 3WLLA 2ZX8A 3UZXA 1DJWA 3WN6A 1UQZA 3BTNA 3A5FA 4XZWA 1UR1A 2WC7A 5FL0A 3W7RA 3RR1A 4LAMA 3B8UA 4AZGA 2CHOA 3QC3A 1SO4A 4LH8A 3CO4A 4F0HA 1XISA 2WWDA 1J8VA 2PSNA 3ARPA 2C13A 3CZGA 3Q65A 4S23A 1QNRA 1Q2SA 4C1NA 4B5SA 5FJOA 2QCLA 1AH0A 2JKEA 5D2XA 1BAGA 3OYXA 1VHCA 2O7SA 4JYDA 1R3TA 1EA9C 2E8YA 1IXPA 4O52A 1BG4A 3WNMA 3BE7A 3KVLA 2GWGA 4CN4A 2ZRZA 1TMQA 2VZVA 3TFXA 3KHJA 2WSYA 4BF5A 4Y9PA 2DUAA 1M6JA 4QDPA 1S2VA 2H3DA 3LA4A 2PLMA 4Q4MA 3JUGA 2IPJA 4DZ5A 4M19A 1ZL1A 4O1AA 1E4MM 3GDBA 4QS6A 3W2LA 5JVLA 2ZZ7A 1BF6A 3BGJA 3V4BA 2DU2A 1XG4A 2A21A 1L2QA 2AQWA 1PWMA 1QR7A 3N9RA 2J78A 1XYZA 4MDPA 5I5RA 1XUUA 4IMEA 1XLCA 2HE8A 1QNQA 4QG6A 1I2NA 4MUZA 4LV9A 1VS1A 2FPVA 3MT1A 2RDUA 3TTEA 4L9ZA 3ARSA 3W76A 4HB7A 4MPKA 2QV4A 3LS9A 3WDIA 3TUUA 3WMSA 3GU9A 4LTSA 4CD6A 3AYSA 5FAJA 1G5AA 4QXIA 4AEOA 1O5QA 4ROPA 4H83A 5FJJA 4HK7A 1K03A 4UNIA 3M9YA 2EXOA 4LVGA 1KCLA 1GG1A 2VEPA 5BOEA 2V5CA 3QMTA 3SIZA 1XCXA 1XGDA 3EOEA 1DWFM 3QLLA 5EFDA 1GKQA 3NVTA 5GNZA 4TIMA 1QI2A 4UBPC 3VIMA 1SVDA 2A7NA 3OB8A 4DEFA 2FHBA 2J79A 3S5SA 1Y5VA 2H8ZA 4IFRA 5A8OA 2I5QA 3NVDA 2D20A 2I17A 1OVDA 3IEBA 3E3HA 4P2VA 1GWJA 5T91A 6TAAA 4CD4A 4JQ2A 3TP4A 3UG5A 2QMKA 1HJWA 1TTQA 3AUOA 1ODZA 2JIWA 5A2CA 1CXFA 2F84A 1BLIA 5BNKA 3W2NA 2WYSA 1S2AA 1UD4A 4XKMA 4JFWA 4PFMA 1JCTA 2FZDA 4HCDA 4OUEA 5CSSA 3UGRA 4FF5A 2W6RA 3IWPA 1XIBA 4DAIA 1OGSA 4C5YA 2BB0A 3B8IA 4OIFA 5TBOA 4AIBA 1SJBA 3OP2A 1U5VA 2I1OA 4E0CA 3LPGA 2H8XA 1CPUA 3U0HA 3MA8A 3WH5A 2REQA 3RUBL 1UQYA 2H3BA 3TYAA 4Q4OA 3CL6A 1KRAC 1XWYA 1TTPA 3TQPA 4ATWA 2EJAA 3SCQA 1EEPA 3ZSTA 5LZLA 2V5JA 3PTKA 1K7XA 5EYWA 4JL2A 4RDVA 1W17A 3QHMA 3LQLA 2AL2B 1QHPA 4F9DA 3A4XA 1Y65A 2FVMA 1UWRA 4UXDA 3WF2A 3N2XA 4DBDA 1QI5A 4ZTYA 2J24A 4O16A 3M5VA 4D6EA 1FDZA 2VZUA 4M3PA 2VEIA 3DU0A 3CTLA 1TMLA 3U9IA 2A7PA 4S3GA 2Z1KA 1JL8A 2O9OA 2YCLA 2J9XA 2J74A 1KLYA 2YCEA 3AIVA 5CAKA 3QR1A 3R8GA 4FXFA 4LAOA 3NZ1A 3URBA 5T9CE 2WVVA 3W7EA 1M7OA 1E3XA 4W87A 3IRDA 2VC6A 4ZVJA 1AZ2A 4I9AA 5U4NA 1DJGA 1D9EA 2VGIA 1NWUA 2PDWA 2DT0A 4F4RA 4FAMA 3F4VA 3DFYA 1F76A 5L9FA 1TTJA 1NVMA 4AWSA 2YCKX 2OO6A 4D1JA 3AJXA 2WPGA 5JH2A 2W62A 3SCNA 1RY0A 1BEUA 2ZZ5A 1GNXA 3E0WA 1E9LA 1SZRA 2PFHA 5H1WA 3CASA 3TC3A 1HX0A 4ASTA 1PJ9A 2NLIA 3TLQA 4NL1A 2R1KA 4GKLA 4IMDA 5U7SA 3EZ4A 1S46A 2OT0A 5AC8A 4HTBA 5F7UA 3RK8A 3K13A 2WANA 3LXCA 3YPIA 2GYIA 1TPVA 3CH9A 5I02A 2Z2BA 2OMAA 2CZFA 4A2SA 1PIGA 1A5KC 4C60A 3TTYA 1UC5A 3UWQA 4UTTA 3EKGA 3R1ZA 4WY0A 2DIEA 1WCGA 1GHSA 4LYRA 2G97A 3VTRA 1A3WA 3Q37A 2NX3A 4UMCA 2PDYA 3W7PA 5HNRA 3REQB 4DI9A 3QV9A 2QIIA 1C3FA 3VOGA 1HKIA 2EG7A 4HHHA 4O17A 1EXBA 3V36A 3DC0A 2VZTA 4IMCA 1ZENA 1NDYA 2GVLA 4AIEA 1KWKA 3CL7A 4M5PA 4DYJA 2G3NA 2CETA 4PE8A 1JUKA 3N19B 1JJKA 2OX1A 1IZCA 3MUCA 4JDYA 4AY7A 5GNYA 4FXRA 2XTKA 3L4VA 2PD5A 2OWWA 2P3ZA 3GX9A 4IL0A 4GYKA 1GQNA 4U28A 3W84A 4FEZA 2PP0A 1RBAA 1EYWA 2Q6ZA 4DBUA 2X7WA 1EJVC 1IIGA 4XKYB 2NQHA 4TXEA 3BLDA 3EA2A 3F5JA 1Q7MA 1UWSA 3IPWA 3WD3A 4HT3A 4D2JA 2HEJA 3DG7A 4PBEA 2D2JA 5EA9A 4UTWA 1ZPTA 5DQPA 3TWBA 4FK9A 5JIPA 1NDWA 4MF4A 3GG0A 4U4MA 1SR9A 3DYMA 1FKXA 5REQA 2VHLA 1PV8A 5C9UA 1T5AA 4F3HA 2QCDB 4PCPA 2Y88A 1MNSA 1VP5A 5G4WA 4C6FA 3ISIX 3KRZA 5A8MA 2CLFA 3WMLA 3NZPA 1FWRA 4B2DD 2IQTA 1XD1A 3N18A 1M41A 1FHVA 2OYKA 4F8XA 2YW4A 3NYZA 5AB3A 4Z2HA 4GUIA 2XSAA 1A4MA 5AZ0A 4ERAA 2PP1A 1ISXA 2HCVA 3U3HA 1R3VA 4HZ8A 3MP4A 4EP8C 2PDIA 2ZVRA 1JZ8A 2G3IA 1ZQ5A 3PZ9A 1UROA 3G3MA 3S6TA 3DYOA 1JQXA 4MNMA 1MQPA 2J7FA 2RFGA 3AUJA 2QPUA 3GHUA 2X05A 3GG1A 3LY0A 2DZXA 3PWGA 4KFNA 3TTQA 1CGYA 2RJHA 1BWLA 4GIAA 3CQ0A 3ZT6A 1KM1A 4S39A 1LOLA 1WB0A 1YBQB 4BQ5A 4AD0A 2X41A 1B9BA 3V35A 2ZRYA 4LVFA 2QCFA 3UF9A 4HZMA 2AMGA 4DO4A 4CQCA 4DJDD 1I0DA 2Z1VA 1E51A 1K8YA 4V1XA 2GQAA 3WK2A 1KM4A 5CH9A 2AAMA 3ATZA 1B4EA 4IP5A 4ZQNA 4MWAB 1KKOA 1TPDA 5CC7A 5LIUX 2IKHA 1R0MA 5G2WA 1CXKA 2A0NA 3LLFA 1OFBA 2XDFA 3WNKA 4LRTA 3KX6A 5E0FA 3NO1A 5T8GA 4JOMA 2DVUA 3IARA 4ZMGA 9XIAA 5E70A 3RAOA 2YBTA 1KGWA 3GFXA 3PAJA 2W0UA 3I4EA 3VD7A 1HGYA 4YJ5A 4JIIX 1TJ1A 2EPNA 2ATSA 1YXCA 1B1YA 3S1GA 4PSRA 1JXKA 1JPKA 2F9RA 5MKGB 1NOFA 3H55A 9XIMA 2NVAA 5LA1A 1L6SA 3WF1A 1VC4A 3N12A 1OZMA 3E2SA 5JBDA 6CGTA 3GR7A 3BAJA 3A24A 1CW2A 3E1F1 1E3ZA 3SJ3A 1DQUA 3MUAA 4Y90A 3A3HA 4HPJA 3PTQA 1PYMA 4JTCA 3HGOA 3UZYA 5HNTA 4GNJA 4QROA 4GI6A 4JCLA 1Q6RA 4A3RA 4MMWA 2YOCA 3NPXA 3GNOA 3NURA 3APGA 2QCMA 3EOOA 1GCYA 2PB1A 2CLOA 5FEZA 3LBOA 4HP5A 2FB2A 2Y1HA 3I6TA 4AVFA 5M2FX 5GNXA 1IF2A 1EJRC 4GINA 4JL1A 3W75A 2HXTA 2XFWA 4DF1A 2D2GA 2O9PA 1J0HA 3WLMA 4WSKA 4YMZA 5EU9A 3RM4A 2CWNA 4KEZA 3WCZA 3NQMA 3PWAA 2QR6A 3RR4A 4OZOA 2F38A 4CCEA 3TSBA 5PTDA 1OB0A 1HFBA 1OY0A 2W61A 4FXSA 4L1XA 3VOHA 4F0MA 1LL4A 3TW9A 2LLEA 2FFIA 1G7VA 4JXCA 3HMCA 4HJWA 3CC1A 3L0GA 1YKWA 1V51A 4L4OA 4RR4A 2PTXA 1R9XA 3W71A 2BOEX 4O50A 3WLKX 4DB7A 5HPOA 1PDZA 5JMUA 1JG9A 3C2YA 4ZO8A 2PU0A 3PTDA 4ZO9A 2OLHA 1T0OA 1Z3NA 1E4IA 4C6IA 1DXFA 3NQCA 3CEPA 3KOXA 1K77A 4A3UA 4ES4A 2V67A 4AC7C 1JF5A 3AHVA 1H63A 1OWQA 3C52A 4ZE5A 3UVAA 5HDRA 3DFHA 1ADSA 5AVHA 3BW3A 1DWJM 1QCWA 1QHOA 5FF2A 3HG5A 4WY0B 4HSOA 3MSYA 1I60A 2ZUWA 1VENA 3GLCA 2WXDM 3GY1A 1HJSA 2OEJA 1TYGA 1SFJA 3PPGA 1G4EA 3ARQA 3H22A 3VGGA 3QPYA 3T0BA 2Z1XA 4EWND 2POZA 1UUOA 1LOQA 4M56A 4D72A 4F2BA 2BXZA 1MW2A 4OQVA 1VJZA 2AMXA 2I9EA 5E5CA 2I5IA 4WCJA 3B8VA 4JX5A 3WEZA 4QGCA 4TVDA 4OFCA 1V6TA 2WZHA 4WIWA 3SADA 2VJXA 2XZ9A 3XIMA 1ME7A 3PZVA 4WRHA 1UA3A 4WDTA 2GVGA 3WNOA 1W1TA 1UP0A 4OGZA 5FJTA 5I06A 3W81A 4QISA 4V1YA 8TIMA 1Z9AA 2OZ8A 4UTHA 2YSWA 2NUWA 3C3NA 3PJXA 3GC5A 3ITVA 1KFKA 3H2OA 3FSTA 3KCLA 3AOFA 2PWDA 1K4HA 4GIYA 1XV8A 3CH0A 2IS7A 1GOQA 1QPOA 2ZXQA 1LLOA 5DCEA 5EMLA 5JU6A 4QBXA 1BYDA 1U1JA 3ARRA 5CPSA 3TK7A 2AL2A 2E6AA 2Z2AA 3WFAA 3GUGA 3I68A 3A5VA 1ML1A 3SCUA 3UWEA 3KBNA 1ICPA 1KFWA 3KRBA 1TWIA 1XG3A 4PUEA 1LRTA 2QGHA 5DLCA 4FOJA 1JCMP 3BZJA 3QVQA 3AHXA 1SW0A 1NFGA 3R6IA 3AZRA 3SB0A 2NX1A 4HOZA 2Y7EA 4POCA 2VENA 2OSWA 2YDQA 3IAQA 1RJQA 1RJRA 4H8VA 3UXIA 4FOUA 1R9ZA 1CB7B 1ZBVA 1AW5A 4UTFA 3BICA 3UG3A 2V63A 4G1NA 4PTXA 1Q13A 1MEWA 3WBWA 2XUCA 4HU4A 1RLCL 1Q65A 3OZYA 1POJA 5CBIA 5LXEA 4S2BA 4HOXA 4FNPA 4MY9A 1JCXA 3W1AA 1ADOA 1AQHA 1OC6A 5CZ0A 3WQ5A 3S6DA 3NWRA 3STEA 3I4KA 1S38A 3C6CA 1VYPX 1M04A 3MO4A 5E0KA 3BCFA 2R1PA 1W3HA 3CUFA 5HNUA 3PBWA 1KB3A 1MEHA 1V0LA 3V1PA 5A8QA 2DVTA 1UP2A 3HPAA 1TZZA 3A6OA 4Z1YA 1HIZA 1XGZA 2D1ZA 3CT2A 4BI5A 5I7GA 1H09A 1VPYA 2E1DA 2DZVA 2OKOA 3K2GA 3RJYA 4JFVA 4PTWA 4N6FA 3K4WA 4WHBA 1K1DA 2Z27A 4GNKB 3NDOA 1YW1A 1LUCA 1E40A 3RO8A 4GIEA 4PFHA 2XVGA 1A0CA 1ZBWA 1RD5A 1WOAA 3U8GA 1REQB 4G7EA 4Y8EA 3T40A 1TJ2A 3HQPA 4PULA 4HNTA 3T07A 2Y63A 3UVIA 1WZAA 1AW1A 1KBJA 4QTGA 2EPHA 1LL7A 3QFWA 2VC7A 4O15A 2J47A 1JNDA 3B9EA 3ARWA 1AQFA 2Q09A 1G94A 3AIRA 3S5YA 3TYBA 1V7YA 3KBVA 3MI6A 2PDPA 3G1YA 3MUIA 2I9UA 4FMVA 4MWAD 5AC6A 1YDNA 3PJWA 2G41A 3BV4A 3MBFA 5AC5A 4Z1DA 3IIXA 2V8ZA 1VAHA 1I2QA 2GVYA 3AWNA 3OPSA 4I7UA 4HA1A 3V16A 3COTA 1FFQA 4Q8PA 1C9WA 3VE9A 2HPIA 4PMDA 1XIEA 4W8AA 4E2OA 1EX5A 3S9IA 1SFSA 5ECUA 1SM9A 2FGZA 4AW7A 5FSDC 3BH4A 3DI0A 7XIMA 5FF3A 3MCOA 4XD3A 1GQJA 3LSCA 4K2SA 4YHGA 3THDA 1FP8A 2OQHA 3L0KA 3V0UA 2AQOA 1ZCCA 2IKGA 2OLAA 2GDUA 3LI1A 1QVBA 3FYYA 4LY4A 4ZCWA 5KSWA 3SRHA 3VZZA 1K9TA 3GDMA 2PWHA 4FZIA 2PRMA 1WZKA 1JDAA 3V1HA 2A3LA 3W37A 4JQ1A 2QCEA 2J75A 4LS1A 4MWAE 3NL6A 4DLFA 3DHPA 3GYEA 2E67A 4GO8A 5HWMA 1TV3A 3RX2A 3GAYA 1F7BA 3THQA 3HFTA 1JDCA 1E1FA 4W7UA 3UFYA 4NY2A 1QK2A 1UIPA 2A79A 3PFMA 1KXVA 3SECA 3CMFA 1TWZA 1FWWA 3LTYA 1DOSA 2G37A 1YYAA 1KCKA 1GHRA 4LYQA 2IXVA 3WDQA 1BG9A 2D3LA 4CD5A 2CCRA 5IHRA 4Q32A 1S5WA 1Q6LA 3EDFA 3SUUA 4K6AA 1J79A 2R82A 4K68A 3WD1A 2OSYA 4ILSA 3PSWA 3AWOA 2NQ5A 4ZQPA 1OBAA 3ANVA 2A3AA 1Q6EA 6TIMA 2X1IA 3W29A 1P0BA 1Z89A 5LGZA 5GQBA 1ADDA 1XYFA 5A8NA 3WK0A 5A3HA 3NQVA 3DXIA 1S5VA 4N42A 1NJJA 1W1B1 4ZTXA 1ISVA 2PP3A 2Q8XA 3P62A 3ZMRA 4C7DA 5J04A 1O5XA 3ZT5A 4ZQCA 4D6FA 3OG2A 2BGQA 1XLGA 3GZAA 3B97A 5CZJA 3PBMA 2BHYA 2XVNA 3GU1A 2HBXA 4R33A 2BX7A 3AXHA 4DIAA 1R6WA 2VX7A 4LF2A 1AJ0A 4Z2GA 4YTTA 2JGQA 4DWDA 1XYAA 1EJUC 4EIVA 2A3EA 2RAGA 1KCZA 1EFZA 3BG5A 3K1GA 4UWMA 1PS9A 4K39A 3S2CA 5E0CA 3DHDA 3AXMA 4QR6A 1P7TA 4GE8A 3NQ6A 4LY8A 5I3GA 3E5BA 1F73A 1XD0A 2YXXA 3UPBA 4KPLA 3DGBA 4GCAA 1E72M 4AZBA 2FDMA 3M0JA 1XCWA 4LCSA 3VDHA 2UWFA 4O0QA 3H7UA 3WQPA 4LUIA 3VGFA 3BGAA 3L5LA 2PRHA 4F40A 1B90A 3MV01 3II1A 2ZZ1A 2RH9A 3FJLA 4C5ZA 5AYIA 4DO6A 2ACSA 3L4UA 1TWDA 5F2IA 2WCGA 4C65A 3QOKA 3OBAA 5D4YA 4JCMA 5HUPA 3R79A 1UR2A 3BLLA 3PBGA 2CKSA 3DFSA 1KR0A 3KAOA 1Q5MA 1KKRA 2EG6A 2H9AA 2ZADA 2BXYA 1QWGA 3B05A 3NL2A 3W25A 1T8XA 3URAA 4LBUA 4PB4A 1VFFA 1GZ1A 4ADTA 1F9CA 4N7QA 4M24A 2WJEA 1JFXA 1UD6A 2E28A 3HURA 2QUNA 3BAKA 2PUZA 1X39A 4ZEPA 4IUOA 1J12A 1WXZA 3DKLA 3WQDA 4C6OA 4E6MA 1ALDA 1Z8AA 1R86A 3GH7A 1E1CA 1WBJA 3STGA 4HGXA 4I5UA 4HMNA 2WWCA 3WKZA 4QIUA 1RALA 1NTHA 2WOQA 4IFOA 5CGMA 2QDGA 4P7NA 1PX4A 4GXWA 1H11A 4JNZA 5DT7A 2IPGA 3NOEA 4HPHA 3ATYA 7CGTA 2Y89A 5D04C 3L5AA 4JIRA 3P82A 3NO5A 4UQ9A 4XSMA 4L4LA 1NWRA 5D2TA 5A8GA 4XUGA 4WD0A 1X6NA 4WKFA 1ECQA 2D23A 4J3TA 4MJMA 4KETA 4TUFA 3XISA 1A5LC 1HP4A 3K4AA 1KCXA 3U2EA 1RCQA 5A2BA 4H9MA 1ZLPA 3AIBA 2V3EA 3WL1A 2DEPA 3CYVA 1D8CA 1HKVA 2DY3A 2VEGA 4OV9A 3EPNA 4RXFA 4QLJA 4MUPA 4P7LA 1DIDA 1VFMA 3DESA 4MSSA 1IT7A 3UZJA 3WQEA 1BWVA 3VOFA 1K7FA 2PDQA 1A5CA 3KTSA 4YLWA 4F0KA 3W74A 3G1AA 2VI0A 4X22A 4JYEA 5CG0A 2X0HA 4MLRA 2PGFA 4D8ZA 3GHSA 1EQPA 3DKJA 3E96A 4YTQA 1PB0A 4JTUA 4GI9A 3N9SA 1HTIA 3CUIA 5A6SA 3EYPA 3CWOX 4ZQRA 2VCCA 1XBVA 1JFHA 1U5HA 2C14A 4HPXA 1OADA 3G6MA 3UR5A 1K7EA 3TYUA 3Q45A 3E0LA 3RJXA 4DRSA 2VD8A 4HMEA 1H1ZA 4KH2A 1KR1A 2IXUA 4GH3A 1SMAA 4YCPA 2Y5EA 5HMDA 1HKJA 2PBOA 4XX6A 1XXXA 5LHFA 2E6DA 3ZO9A 3IANA 4P7RA 2NV2A 3FYOA 4FR1A 3TOYA 1FWHC 3OGSA 1Y0EA 1E0TA 1RLDA 3ZFHA 3EXRA 2V3DA 3S1WA 4UTUA 1Q66A 1F2JA 3VDAA 4IIFA 3T81A 1BF2A 4UNKA 2IKJA 3TIMA 4V33A 4L6HA 2ZKMX 4CEUC 4XBKA 3EPMA 3S9YA 2NQZA 1PZ0A 1I1XA 1ZS2A 3QQ0A 1R3WA 4GJIA 3PZUA 3VIFA 1H60A 1KFCA 1C90A 1PTGA 4PTDA 3P84A 1EX1A 1RQEA 2OGYA 3IAPA 5KETA 1MXSA 4YYCA 3GXPA 4QNWA 5AOUA 3WH8A 3AZTA 3B3DA 3C2EA 2A6NA 1O6IA 1GVOA 2E25A 3EMCA 3WDPP 2C3ZA 4O8AA 3MCMA 5GJNA 2O92A 3C2FA 4V28A 1NFPA 3SR7A 1XSJA 4O0ZA 2XN2A 3ARVA 2WMKA 2ZC1A 2F2HA 1UZ1A 2Z1SA 3BAXA 1XLFA 2ZX6A 1LF1A 3L21A 4RDYA 3U2CA 1S1RA 4IQDA 4DJFC 4M1RA 1TVNA 1B3YA 1GOXA 1LQAA 3WUEA 1RH9A 3UXLA 3VKBA 5HUOA 4FPSA 4AXNA 4L4MA 3W28A 1TPUA 2NWRA 2VRQA 2A5HA 2X0YA 2FYMA 1P1XA 2UY4A 3MMTA 4X9YA 4FOKA 1IXQA 4JDBA 1C8XA 4H6RA 3IS4A 4F0SA 1JDDA 4LUYA 4LAZA 4IIHA 1Q2RA 2VVNA 4YVVA 3M41A 2BLEA 2WZMA 2Q3RA 2VX4A 3G77A 4UCGA 4FIRA 3H7VA 4JFSA 4S3KA 4F48A 1UD2A 2PGEA 3FDKA 1HJQA 2HNHA 1V8EA 4S3BA 3DOPA 3T0TA 2JKPA 3BMWA 1VCGA 3FVMA 5BXPA 3QPEA 4DM2A 3G0SA 1PKNA 1WE5A 5A6BA 3V7PA 1BYCA 4O1BA 1IR2A 1QPKA 1Y5XA 2ISDA 2ZTJA 3CZ8A 3IJ7A 1EYEA 3DGRA 5ABFB 4U5IA 2YZRA 3T08A 1WDDA 4XIMA 4LU0A 2PEVA 4KERA 4B5XA 3C2VA 3CUJA 1PX8A 1MQRA 1XL9A 4B4HA 2WMIB 8CGTA 6XIMA 2WLYA 4A05A 1EL3A 2VELA 5I78A 3GXNA 1G69A 1O60A 3MHGA 1X6LA 3RLHA 3FHAA 1X1NA 4O12A 4XTIA 3GDRA 4HJFA 1ITXA 4ATLA 1RCXB 3GFZA 3GNDA 5D2WA 4UIOA 3W3OA 3TC7A 1EC9A 2J8TA 2QQ6A 4LX4A 3DYPA 4PUWA 3BJTA 2J7GA 1EUAA 5D9NA 1O5KA 2GUBA 3G8RA 3N04A 4DUOA 3LZ3A 1S1PA 3W27A 2FGLA 4YIWA 3BO9A 3NUKA 2J7EA 3E0FA 4S38A 4XO7A 1DJQA 3NQGA 4C6QA 3WYZA 2B31A 1NY1A 3LEPA 1V3JA 3D0CA 2DW6A 4H9XA 2WMHA 1FWNA 3TXVA 1HNYA 2NUXA 4QG9A 2G3MA 4O0KA 5AY7A 3V0TA 5CPLA 3SRDA 4UR7A 2UY3A 2G4JA 5FF0A 5BMXA 2TRSA 2G8ZA 1YIXA 3LHUA 4O11A 1SFTA 1OK4A 3AO0A 1V93A 3CZLA 1XC6A 5TAOA 4KWWA 1F6YA 2D24A 5DMLA 2B7NA 2XGZA 1JIBA 4JTGA 1GONA 1N82A 3VINA 2Y2WA 5A6KA 3TTOA 4KGLA 2XSXA 1FRBA 1DJNA 4WEVX 3NM3A 1DJZA 2BSLA 2JF6A 1AODA 3PSVA 4GPNA 2DZSA 4QRNA 4ZGYA 1L6GA 3U5YA 4K37A 1LUCB 1SSGA 3C0QA 3W73A 5BMWA 3QYQA 1E9ZB 3FK4A 3H24A 2VWSA 4MB4A 3ITOA 4GUGA 5FEXA 3W26A 4NNBA 3WLOA 4DF2A 3FIGA 4JTSA 3SN1A 4AG0A 5XINA 4PMZA 1VHNA 4NAEB 1FQ0A 4N4PA 4PMJA 1XR2A 3UNTA 1UKOA 1TJPA 1YNQA 1EWEA 3QW3A 3W07A 1LORA 2E09A 3QC0A 4CNNA 1G01A 1DJXA 4DHGA 4AF0A 3MBDA 1BYBA 3S1XA 4WXYA 1XBXA 1LJYA 3TTSA 5E9AA 3PF3A 2IPFA 3G1XA 1UZDA 3AXIA 3RFAA 3PFRA 1J0YA 3F4WA 2DZAA 3CZEA 2ABBA 3FJ4A 3ABQA 1HF6A 2CZ5A 3QKEA 2CLMA 2YCJA 3TJXA 1XYLA 4PMYA 4C6JA 1A5SA 4E8GA 1EPXA 1SW7A 3W1PA 3ZWTA 4C6LA 2PC4A 2E9BA 2WM0A 4XAPA 4QE1A 1E6RA 3QMRA 3BPWA 5E6YA 2F8QA 2JE8A 4A29A 5HANA 3DBPA 3EX1A 3QW4B 1WQ5A 2ZOXA 1XLHA 4ZSTA 3RPMA 3BLFA 1EIBA 3VM7A 1FA2A 4ICNA 3TAOA 2OELA 4G56A 4US5A 4BA0A 5A6JA 2Y70A 1MZRA 4LUSB 3EBVA 3B0XA 2ZQ0A 1MYRA 4DWSA 1I4NA 3BLIA 3ZZ1A 4TU1A 2I14A 4M7TA 5K9XA 1X1OA 4NJIA 1QATA 1E4LA 3W0KA 5C7VA 2VDIA 1B3OA 5JBFA 5K4ZA 1D8WA 2F6KA 5CPQA 3HV9A 1E6SM 1CNVA 1E73M 2NXHA 5CBJA 3OQ8A 3R11A 4QLLA 1B5TA 1QFEA 3AMCA 3UY7A 3ZVHB 3ZJ6A 3MZ2A 2GSJA 5I3HA 2C7FA 4NSBA 3P14A 3PZTA 3N13A 3TC6A 3NGJA 1M1BA 4RZ6A 3VKCA 3U7VA 2ZC8A 3WF3A 2QHAA 3DX5A 4QDWA 2CBJA 4GUFA 4NQ1A 4DUWA 4U2ZA 3WH9A 3NQ7A 1DWHM 3AZSA 3W1TA 2J77A 4U31A 3SQMA 5K4XA 5EFFA 3U48A 5AC4A 4CU7A 2Y8VA 4JQ4A 2G4FA 3VYLA 3HQ1A 3SAZA 2ANUA 4QS5A 4YTSA 1X7FA 2AQVA 2BBFA 4A6GA 3CQJA 2DUZA 3GC4A 1XIGA 3STPA 3AAMA 1CEOA 2OOGA 2BV9A 3ITCA 1F8IA 1IEIA 3LCIA 4L5ZA 4N9BA 4HMDA 1C9DA 4WZHA 5C9RA 1FDYA 3C8NA 1UWQA 2I5GA 2L5HA 2QEZA 4GZ7A 2RDXA 2OWXA 2Q8ZA 4D8AA 2WJDA 3H2FA 1BVZA 3OTRA 4EVZA 3N6QA 1EO5A 4AVOA 3EWZA 2YFNA 3OVQA 5B7ZA 2V30A 1S2UA 3R0DA 5G2HA 5KINA 1TWWA 3GG7A 4I5RA 4UMAA 2P50A 1ISWA 5AYXA 4FA3A 2HNEA 5G1TA 3FCPA 3BXWA 5DRCA 3AHTA 4ZXLA 3SY5A 1Z41A 2FTYA 3R0KA 4LVDA 3P67A 3IJ6A 5C2XA 1NP2A 1R85A 3WFLA 4P7QA 4IPPA 1TR9A 3GKFA 2MNRA 3HQNA 4O4WA 5DANA 3MP3A 2X09A 1OD0A 1JYNA 4C7GA 1R30A 5AFDA 1JAEA 2PDLA 3NOYA 3ZXWA 1XLJA 5I07A 2CLKA 4DPQA 2CFFA 3LX9A 1VYSX 1GGOA 3URQA 1SUXA 2PZNA 1JPMA 2QUVA 2NSXA 2GK1A 1MZHA 3ORWA 1PTDA 3WEMA 3MUZ1 3ZS4A 1E71M 2DT3A 3W2MA 5G5IA 4AD3A 4W7WA 1YE6A 3UG4A 3PZQA 3DDMA 4GVHA 1DV7A 1EGVA 3LYEA 2PTYA 3WH7A 1EC8A 4NRRA 5CGTA 4HMCA 2J66A 5BRBA 3S47A 3W7CA 3SIMA 4GBDA 3S3GA 1FHLA 5K2ZA 2WNZA 4WDUA 4H7CA 4Y9AA 1IV8A 4JTJA 3ENLA 1WO2A 4Y9OA 2XZ7A 4PC8A 1UP3A 1OHLA 2PTDA 4ICCX 3M0KA 4UOJA 3LNMA 2DORA 4JKKA 1ZP3A 4XSLA 3O15A 2NSOA 4O14A 1XCFA 2BOFX 2YFOA 1I6NA 1QK0A 1F6PA 3FLUA 1P0KA 4GMEA 4GBUA 4YHEA 4YVXA 3WJWA 4PCSA 1UCWA 1XI3A 3M6YA 3UA3A 3W9ZA 1SPQA 3PBYA 3WMBA 1JI2A 3GHTA 4R88A 1RPKA 1TTIA 1QI3A 3A3XA 3SW6A 1W9UA 3O05A 4DUXA 4J27A 4WDWA 1IQ8A 4LV4A 1IXNA 1UZHA 4M6UA 3W70A 4BKNA 1MUCA 1H5YA 4CQ8A 1Q7QA 2QULA 4H6EA 1TQJA 1XUZA 3WMCA 3IV8A 4DJDA 3G8EA 1ISZA 4WJ8A 2GGIA 1XFCA 4R5EA 2XM2A 2FH8A 3K5XA 1LWJA 1ICQA 5EMYA 3QV7A 3AIWA 1SGJA 1AFSA 1ZB5A 2GDQA 2OYLA 4TR9A 2AKZA 3XINA 1V6YA 2PWEA 2OTDA 5G1MA 3KTXA 3ES8A 3S46A 4DJEA 4ZOAA 1ME9A 3KLLA 3RPDA 3F4CA 3R58A 2CZVA 3TE9A 4EF9A 3ITXA 2VGFA 4NZ5A 4Q22A 3N6HA 4ZENA 3PK7A 2ZVIA 2YPIA 3OO2A 6ALDA 4MNJA 1ONRA 3EPOA 3MDWA 1SZGA 3PZMA 1NM9A 1F3WA 4OE7A 5D8WA 1AZ1A 2VFGA 1JYXA 4X60A 3JVAA 1AJZA 3NCOA 8A3HA 3ZLFA 1OINA 3OIXA 2AGKA 2ISVA 1KW1A 1HL9A 1SZFA 4RNJA 2ZX5A 2OU4A 1GJPA 2HTMA 1DVJA 3VD4A 1S3TC 3FFSA 4G6CA 2Y8UA 3LHWA 3VIPA 3MUXA 4A8RA 2QW5A 3ARXA 3UCQA 3L4WA 5D8ZA 3GIPA 1QOQA 4WXZA 3W7HA 1P0EA 3LXBA 3DFNA 2VT0A 1BWKA 5EY5A 3LDVA 1FWBC 3VGDA 5CC5A 5HR6A 3O6CA 1DQWA 2CWXA 3NG3A 1YPFA 3GB6A 4LSBA 2DSKA 3WX7A 3GTXA 4BEUA 2INFA 2EPKX 2W79A 1JDFA 1N7KA 2J6VA 3M64A 5ECVA 5A69A 2B0MA 1DJIA 3SUTA 3TW6A 1LZOA 3TCEA 1GOOA 4P8VA 1QNOA 4RW5A 3V5FA 1YADA 4B5NA 2HMCA 1KM0A 4O57A 2WMFA 3BQ5A 4ZOEA 3ZSSA 4YXGA 1LTDA 1QRQA 1QASA 3SGZA 4BQ2A 2E4TA 4QSHA 2GQ3A 1A5BA 3AIUA 2P0IA 5AZ1A 1V0KA 3PPFA 2FZ9A 3NNTA 2XYLA 5LNUA 3AALA 3KW3A 4HN8A 1CLXA 3PB2A 3IVUA 3KE0A 3MZNA 3M43A 3QY8A 1XBZA 4B4FA 3UWUA 1V0MA 4ZB2A 3KCOA 2VKZG 2J4GA 3EWDA 2C19A 4JTEA 3E2VA 4OVXA 3Q2DA 4FLSA 2XM1A 3SCVA 1SMDA 4AISA 4X2RA 3GTNA 3V5CA 2HXUA 4KS0A 3A4AA 1JPHA 3MKVA 3WQVA 1QBBA 1DPMA 3HG3A 1Q6QA 1C29A 3IJIA 1RVKA 4GCXA 1MUMA 2GUUA 3E2QA 3NPVA 5DBUA 3UERA 1S3HA 3TN3A 4CNTA 1RAKA 5CC3A 2HV5A 4JTHA 2DZPA 3ITGA 1L6YA 3GXIA 4Q4SA 1YEYA 5DCDA 4F79A 3H7RA 3IJQA 1AG1O 2YLAA 1CGWA 3GC2A 4A22A 1K02A 1VBGA 3FGCA 3C0SA 3RMEA 2RKXA 2CW6A 2O55A 3CEUA 1O1ZA 2J7CA 1HQTA 1L0PA 4GGHA 3FSUA 2X16A 2VR5A 1EJXC 4AU0A 1FCVA 4J35A 2EPLX 1F3XA 5F2LA 4AH7A 4FX8A 1I2RA 3BSHA 3CT7A 1DORA 1BKHA 3RCYA 1TX0A 2WJZA 1M5WA 2XIBA 1DL3A 1EGZA 2A3BA 1V02E 4N9DA 5CC6A 2E40A 2Z28A 2ZRXA 5A6LA 2OB3A 2QUMA 1F4AA 2YJQA 3G24A 3KTCA 3W1XA 1EOKA 2YB4A 2BHZA 2OODA 3O1NA 4LUJA 4GQRA 4AX7A 4IQJA 4UTKA 3CU2A 1EP2A 2VRKA 3OJGA 5E93A 4GZIA 1VLIA 4GX9A 2VFIA 1WA3A 1WOBA 5CSUA 3WBYA 1UPMB 3KOYA 4GVFA 2V68A 5MKGA 1LWIA 3KM8A 4L9XA 1AVAA 3VD3A 4JX6A 1PVNA 3N25A 4BJHA 3GH4A 1DQXA 3NEHA 4J3VA 4WJXA 4YWIA 1X96A 1QBAA 3EX3A 3M0XA 2P76A 3WLNA 3TA6A 3CGTA 1R2TA 4PA8A 2PTZA 4AIUA 1E6ZA 3VOIA 4ZXOA 2F6XA 1XSIA 5LSMA 4Q8OA 3H12A 1M7PA 3WQCA 4D71A 3GU2A 7TAAA 3EB2A 3B9AA 3CL8A 1U22A 1FWJC 2V38A 4E3TA 4RNFA 4JY8A 3W7KA 1EDQA 2X1RA 3CLWA 3TJ4A 4JQ3A 4O18A 3QEZA 3LMYA 3O16A 3ABOA 3GXDA 4CU8A 2VR4A 3MJMA 2V5KA 1BGAA 2QKFA 2BY1A 2FMNA 1XS2A 4PL1A 3HTWA 2ATMA 1PBGA 5E9XA 3DUGA 3MWCA 4XV0A 4H9VA 1PX3A 5F1VA 3SRFA 2QVHA 2ICSA 3PBVA 2FHCA 3L4ZA 2HVOA 3NQFA 4PB5A 3L66A 6REQA 1XM3A 2PS2A 2GVEA 3BOLA 1D3GA 3TH6A 3LCFA 2E5DA 4BWLA 1H1NA 4GQGA 4US5D 4WKAA 4JGDA 1JZ5A 4HCHA 2VVSA 3LQGA 3QH2A 1X8CA 1R2SA 3E38A 1GOWA 4J7RA 4I6VA 1AQ0A 3BW2A 1GK8A 1O95A 3BCDA 1UKSA 5HQMA 2OG9A 5I24A 1DJYA 1UUQA 4FNQA 3GG8A 3UT0A 3VNKA 4KBXA 3N6JA 5HJLA 3M07A 4XD5A 5FIPA 5MHBA 3LV5A 1K6WA 3NO3A 4LFYA 4XWUA 4BR1A 3BG9A 1KM6A 3EX2A 4ERIA 3FOKA 3SJNA 4LT9A 2ZDRA 3CV2A 2Z7GA 2O9TA 3CB3A 3ELFA 1GTEA 4LF1A 2EPMX 3EDDA 3TYDA 4G7FA 4HHLA 1VRXA 4MHBA 4XZIA 3QLDA 3HA1A 3QY6A 4JEJA 3KVKA 3KBJA 1YPIA 2V6AA 3T7VA 1QPQA 1W3TA 5DO8A 5M17A 2VQTA 3LRKA 5D33A 5BRPA 4PMRA 2CNCA 3NDZA 1QMLA 4B90A 4RXGA 1UH3A 4W9TA 3D47A 1FVPA 1AA1B 5CJNA 3WNPA 4W85A 3S83A 4B5UA 4NZCA 4HNOA 5CKSA 4IHCA 3NGFA 4C1KA 3W24A 1RPXA 2Q02A 3BSGA 3P81A 1XBYA 3A22A 2E7FA 2X1UA 3PN8A 1M03A 1US2A 7A3HA 5HBFA 3T05A 2VNCA 2HQAA 1ZRQA 1R38A 1GKPA 3I7QA 3BOXA 3EXTA 4JN6A 1XDLA 1OCBA 2G95A 4MTVA 1YXYA 2OT1A 5DELA 3B40A 2ZA3A 3ITLA 1BQCA 1Z32X 2VX6A 5AN7A 4GY7A 3WJYA 1FXPA 4AVNA 5XIMA 4WQ6A 3T78A 2Q8LA 3TQ0A 1OABA 4A3QA 4CEXC 3KOFA 3RNDA 4E4FA 3EDJA 3O63A 3W4RA 2VRJA 4Q8VA 5M3WA 1IGSA 1L6WA 2RUSA 4U33A 1FFRA 5I2UA 3QJAA 1KTNA 3G5EA 4E8CA 3OZPA 4R53A 3BGGA 3WNNA 4J1OA 2WVUA 2X1TA 4UFLA 1RJPA 2BOGX 3RCNA 1I75A 3D5HA 2X1SA 1FWAC 4MB3A 3KWSA 3WK3A 2DZBA 3H2CA 1HUVA 3B4YA 1I2PA 1T40A 1W1ZA 5GJMA 2ZUTA 2Z7KA 2HZGA 4UFKA 4QEEA 4AAJA 2BVYA 2BY2A 3JW7A 3APTA 2WVTA 4AHOA 1FHDA 3IVTA 3CMJA 4YTUA 5LGXA 2WSKA 3LV6A 5LNVA 1EHNA 2XINA 5I6SA 5HQLA 4HCLA 3EEZA 4JQAA 1W8GA 4NXSA 2ZTKA 3RHGA 4AX6A 3OOQA 2VDGA 5HNNA 1XLEA 3M7WA 3F7JA 5LNRA 5KZDA 4GX8A 3IIOA 1PKYA 3TONA 3VDGA 3RG6A 2YL6A 3T8QA 4RX0A 3I3DA 3W1MA 4AEFA 4BF7A 5JH1A 3MCNA 1XRSA 2EJ1A 4DBEA 5DCBA 2J7HA 4NJGA 2DDXA 3UNDA 1ZHAA 4ZZ9A 1VH7A 4NJKA 3DFOA 2XIJA 4YU1A 4KEUA 1TV5A 3T55A 5EBUA 4M81A 4ORIA 4UQCA 4UOZA 3CMGA 3M0MA 2HVMA 3QGKC 3IIPA 5AHMA 3Q94A 2FPYA 4PYSA 3UWVA 1J5TA 3AJ7A 1KFEA 1UWTA 1QXLA 2PZ0A 4JFUA 1EF3A 4U3AA 4E3VA 1XKYA 5C70A 4LGXA 3WQ4A 2VURA 3LHTA 5A2AA 4OECA 2E5CA 2ZBTA 3CAWA 3PUGA 2Z6JA 3EAUA 4ENLA 3NJ3A 4LRSA 3GVVA 5A6TC 1J10A 1Q6DA 2O9RA 3UY8A 3RF9A 4KCUA 1NWSA 1WV2A 4JFTA 1JGMA 4L9YA 4YN5A 4JHZA 2WV8A 2D0FA 4IIGA 3IGUA 3QY7A 1BRLB 3W7GA 1XLAA 1EZ2A 1AQMA 4XZBA 2NV1A 4IMGA 1S5NA 3UPMA 2ACUA 1EUNA 4Q6JA 5CAHA 4GWEA 4P61A 3VFCA 1JPDX 4MG4A 2HPMA 5DY2A 3EOLA 3LPOA 1WX0A 3T2QA 4JNMA 1CTNA 4TV6A 3MANA 1OM0A 1P48A 2CHNA 3HFYA 1TJ0A 4NZ3A 4LCQA 1HGWA 4LVAA 2DZTA 1QO2A 2CBIA 3WF0A 3UU0A 3NQ2A 2BDQA 1FWEC 4IF2A 3OYZA 1YXDA 4UTIA 4AZCA 1TIWA 2YW3A 3WQ6A 5DN1A 3B0YA 3RX3A 4RPQA 5EGRA 2VFDA 2YKKA 1MMFA 1XIJA 4M8UA 4C7FA 4BWLC 5EMUA 4MY1A 1TZ9A 2X2YA 1WYIA 2WAGA 3G0UA 5EKYA 4TO8A 4QFUA 4ZFCA 4C6EA 2EGZA 1EF2A 1VFLA 4DJFA 2Z26A 4WK9A 3SUSA 4WLCA 5H2ZA 2C0HA 1UMYA 4U10A 1TV4A 4ZSUA 3LXAA 2FPTA 2GSHA 4KRZA 3K1DA 4Y8FA 4AZ7A 2GUYA 3AMLA 3VIKA 1UD8A 3VO0A 1CXHA 3MW7A 2P8BA 2P10A 1P6BA 2MUCA 3WY1A 1W1PA 4RL3A 4LAUA 4Y7EA 3TROA 3RRAA 3OVRA 2NVDA 5M5DA 1KD0A 3W2UA 1CXIA 2VD9A 4PCNA 4ACYA 4TVUA 3W1RA 2OLSA 3PG9A 3IUHA 1IEWA 3N4EA 3M5ZA 2F7FA 4MKNA 3NDYA 2VC9A 2IQ0A 3PS7A 4H9ZA 3WJXA 3FA5A 1WKEA 3I6EA 1A50A 1K9EA 3NL5A 4S3DA 1QW8A 3RM8A 8XIAA 3MJYA 4IGHA 3SCSA 4EX4A 1JNEA 4JTAA 2CYGA 2C1IA 1UG6A 2ZIDA 1EC7A 3GFYA 4I7VA 1T8QA 4A4AA 4EXAA 4FS9A 4MAVA 4HNVA 3WELA 4PSPA 4XVEA 5A6BD 4IPNB 3P0WA 1VR6A 2O56A 1IIHA 5C8BB 1EDGA 3CBWA 3CUGA 4J2PA 1GPFA 2QJJA 2WLZA 4W5UA 3BQ6A 3VNZA 1U1UA 1DE5A 4B92A 3KWXA 1TV2A 1Q4WA 2TMDA 2WCSA 1KBBA 4KEVA 3HO8A 3T8LA 2YBVA 3BARA 1SSDA 3PY2A 1GVFA 3DG6A 2J88A 1OX4B 4CN1A 3TMLA 4CNUA 2PDUA 2XN1A 1Z44A 4DPPA 1TUXA 3NQEA 5K9CA 3LLXA 5C9XA 5A5WA 4LANA 3R89A 2Z2UA 1FY6A 4FALA 1WDQA 4NJHA 3HN3A 5C9ZA 2DSZA 3QSTA 2WNWA 1LROA 3LPFA 1W31A 1CDGA 4ADUA 3GNXA 1R2RA 1M9HA 1ZJAA 1RQBA 4FX7A 1TV7A 4V15A 4K7VA 1M3UA 2BFGA 3VVGA 5LXXA 1XIMA 2Y85A 4O19A 4RLIA 3G22A 4FF7A 4AFYA 1OCNA 2J7BA 4GY0A 1SO6A 3SGGA 1QW9A 3CLMA 3CV7A 1UR3M 4DI8A 3IGSA 1OFQA 3GNPA 4DYKA 2YA2A 3WLTA 1C92A 4OHQA 3UESA 5FJRA 2D3NA 1FH8A 3RLVA 4JS3A 3O2LA 1BTMA 1VFSA 3BJFA 1F05A 3H2NA 1QTWA 2CLLA 2Q01A 4R27A 3R4IA 3AYRA 5HMFA 2DVXA 8XIMA 1EJ7L 1HKMA 1DIKA 4TTGA 1F3TA 3CQKA 5A94A 5G2IA 3RXZA 1AMKA 4IG2B 4P8UA 1V5XA 4PGLA 4Q8UA 1PIIA 2EBNA 1B54A 3MWAA 4QE4A 3TX9A 1C8VA 5AYYA 5IDZA 1T99A 1JPIA 2XH4A 4J5NA 1E55A 4H9TA 3O0FA 4UQEA 1W8SA 3KRUA 3TDFA 1IYXA 2POTA 1Q8AA 2OGJA 1FXQA 4P8WA 2CERA 1WDPA 1JVNA 4UC5A 1UWUA 2E68A 1XIDA 4OJYA 6A3HA 1V77A 1VPXA 2R8WA 3N2MA 2A3CA 2ZUSA 3NPUA 4IWWA 4R3UA 2XGBA 3RCMA 1ZJHA 4NZ1A 4EXQA 1XQKA 3M0HA 1KM5A 4KF1A 4DJFD 3F2CA 3S0CA 1H2JA 4PMXA 1XRFA 1G0CA 3CK5A 4PRTA 3C0JA 4HA0A 2GGGA 3AFBA 2YDSA 1NIUA 5CPOA 4MZ8A 4IIDA 3O6DA 3EA3A 4UUIA 4Q4QA 4UTWC 1TVLA 1ZALA 2ZZ6A 5D9MA 3ZLHA 9RUBA 1DWGM 3ANYA 2DH3A 2E0PA 1V6WA 4NAEA 5AC7A 3PZGA 1NFBA 3QYSA 2QDDA 1A5MC 1UR8A 4I5XA 1XYMA 1ELSA 4KRUA 4S3AA 3OHIA 4IM4A 5EBAA 1TPFA 3EA1A 1ZBKA 4Z1AA 4CU6A 1CGVA 1FH9A 1R7OA 3SM0A 1G4PA 4D1IA 3M6DA 5CJMA 3WENA 5D02A 9CGTA 1FCUA 1DIOA 3LCXA 1S2WA 3LM3A 4MIMA 3LBCA 2RDWA 2V3GA 2MANA 3SUVA 3MVIA 4R9XA 1TFVA 2W91A 4JTLA 1LP6A 1R46A 3KHDA 5LKYA 4IJCA 2V9DA 3UJEA 2P53A 3JZUA 2PI6A 3V0SA 3F4DA 1KC7A 2Y0FA 4NVTA 3FEMA 4G5DA 3FGCB 5LYRA 4LBRA 3TOPA 3RM9A 4V2XA 1M53A 3TR9A 4MLJA 2FTPA 5IHSA 1I1WA 2X42A 2GJXA 3HBLA 3C0LA 4JKLA 5H8PA 2PTWA 3UJSA 1K8CA 4EANA 3L4YA 2HK0A 2G3JA 2V69A 4QG8A 3PULA 4O4VA 3FEQA 4AMAA 1XLDA 1EA0A 5SWUA 2JIEA 4OTKA 4E5TA 4ZL1A 3REQA 3BAWA 5I3FA 2VR2A 4PODA 3ZVIA 3ZJ7A 5CPNA 3T1GA 5D32A 2WVSA 3EGJA 3OZOA 4GIRA 4CD7A 2O4MA 1UD5A 4N9CA 4I7WA 3LHVA 2X7VA 5H8UA 1UZ4A 2XGIA 4JTFA 3TLLA 4NF7A 2ALRA 3W7QA 1TUFA 3IK2A 4PUKA 3KP0A 3BG3A 1Y5WA 3N73A 2UBPC 4NG3A 2YDAA 3EMQA 2WQDA 1TE6A 1J6OA 1GVRA 3FN9A 3TWAA 4A2RA 3N2BA 2OSXA 2QIWA 3GVQA 3EWBX 2PLJA 3N34A 3FXGA 2BS9A 2ZUMA 1P0DA 5M03A 4ALDA 4LC8A 2QPSA 2DV0A 1SO3A 3FKRA 3P7YA 4GA8A 1SJDA 4Q6XA 1CECA 3ZWSA 1A3XA 4XB3A 1V3HA 5AHLA 1THFD 1J2BA 3ECQA 3NQ8A 4BQ3A 1SJAA 2PDFA 2CEQA 3VUSA 3I3EA 4N4QA 1O1HA 4RPPA 3QHOA 1JQVA 3CB8A 4W8BA 2CLEA 3VIGA 3VIJA 3S9ZA 1ZUAX 3KOWA 1AMYA 1Z6KA 3QR0A 2CZDA 4MNLA 1LBMA 3H26A 3AHYA 3PBUA 2P8CA 4M29A 1LRNA 1W56A 4LNYA 4QAWA 1V7AA 1E0WA 3VI2A 4RDZA 4H6KA 4XAFA 2B7OA 1OK6A 3W7JA 3QN3A 3KS5A 1KNWA 3UZWA 2WC4A 1RD6A 1A49A 4PR4A 3EOUA 1NDVA 3M0LA 2O4QA 3SQLA 1P0NA 3CHVA 1KTBA 2JK2A 2VUYA 5TF0A 3CHDA 1XIFA 4GHRA 4Z0SA 3TV8A 3E12A 3H2MA 3KDNA 3S2JA 3VFLA 4H8HA 1PZ1A 2OX4A 3W7MA 1A80A 4IPJA 4IXHA 1CBGA 3FVDA 1VIZA 5I3IA 3CQHA 1IEXA 3VD9A 1SW3A 5HA7A 3M16A 2YL5A 3FHQA 4GOAA 2VZSA 3CAQA 1BSIA 2NQJA 2QCCA 1NP0A 2DIJA 1C93A 4AWTA 5FCZA 3K30A 1G4TA 3KVJA 1E5NA 4ONVA 3CO8A 1BFNA 4CVUA 3VOCA 1E1EA 5HJYA 4M1BA 2DT1A 3BLOA 1QDSA 1ITQA 4HZ6A 4GISA 1KLZA 3KBWA 4N0RA 5I3DA 3LN3A 4NZFA 2V81A 4M7SA 4JN7A 2V2HA 5HJXA 5CJ5A 4ERGA 1CB2A 3M5XA 4K3ZA 1O7AA 1R3SA 2X2GA 1J5SA 3O6AA 5FKYA 1V6UA 2VMFA 1WKYA 1I2OA 4PL2A 3OLIA 3GRIA 1TRDA 3NZQA 3ZIZA 1F6KA 5KZMA 3E49A 4CQDA 2VXNA 3NSMA 2KZHA 1TMHA 3OZMA 3MSRA 2A2IA 4PUNA 3AROA 3GTHA 2JALA 4E2DA 3SDOA 3BK0A 2EAWA 1P5BA 1TR1A 3O8AA 4NT0A 3KP1A 1MQQA 4LPCA 1PYFA 3AICA 3MYPA 2WSPA 1HKKA 1XKJA 5CSRA 2HISA 3LRMA 3UWWA 3BDKA 4O1CA 1J0JA 4Z2IA 3SCWA 1PHWA 3IJ9A 3DEQA 3L23A 4DAFA 3EB3A 3B8WA 2WHJA 3GQYA 2OJPA 3LGGA 3C3UA 3B0PA 1W91A 2ZFAA 4H7VA 1XLLA 3C4UA 4R9OA 3AXKA 3M1ZA 1Q6GA 1A4LA 3N2OA 1CGUA 3M46A 1YQ2A 4K1GA 1ME8A 5REQB 3EDKA 3O3RA 3HG4A 2ABAA 4FO4A 4I8DA 3PJTA 4M6QA 2HROA 2YX0A 3DC8A 1XF0A 3IVSA 4PCFA 3W72A 2BVTA 4EK7A 1UD3A 2PCEA 2ZE3A 3H6OA 2SFPA 3B9OA 3BMVA 4R34A 3PUEA 1S2TA 3NIYA 2PMQA 1N2VA 3NTYA 1W5PA 2VDHA 3FW6A 3DHFA 1A5AA 3VZYA 4XKYA 3QTPA 3R2GA 3HJEA 4UZSA 3TSDA 1UOZA 3KUMA 1V0NA 4FSAA 3F5LA 4EAYA 3W1LA 3QTGA 4IFKA 1O94A 2CC0A 4WSHA 3UCCA 4MB5A 2WO5A 4XZLX 1N8IA 1J0IA 3GTIA 4O13A 2WKJA 3P3BA 3FX4A 5D37A 4HQVA 5FEPA 1XICA 4W89A 4B5TA 4IGNA 3L9CA 1BRLA 2KAUC 4IMAA 5FJUA 3CV6A 4W5ZA 2PDNA 3U2ZA 2A7RA 2PWVA 4DJDC 1OIMA 2ZXBA 4KWVA 1C91A 1R5YA 3UWYA 4B9ZA 1JZ7A 1GG0A 1TE1A 2C8NA 3CWNA 2I7GA 4PUMA 1VBRA 2D69A 4XVDA 4IIEA 4B3LA 5LIWX 3PM6A 4QSFA 4QCFA 4XIAA 3I7RA 1R3QA 1KFBA 1CXEA 2R1LA 3R12A 1KWGA 4XAZA 1NAL1 3N9KA 3WBEA 4X9SA 1US3A 3RYSA 2PC8A 4QE5A 1OQFA 4R7OA 2JFEX 5G4HC 4ZBCA 1UBPC 2W67A 2R9RA 4E2BA 4CQ9A 2XVPA 3W82A 4BQ4A 3H21A 3VA8A 2NVCA 2PLCA 3VNYA 4QNEA 2QCGA 5LHEA 1XRTA 1MDLA 3G18A 1LL6A 4RV8A 4AZIA 4LB3A 4S3EA 2H9AB 3LTPA 1E43A 4AZ6A 4XK2A 3E9AA 3PR2A 3STCA 4JICA 2PA6A 1U2YA 1B4KA 4NNCA 4DNHA 2E9MA 1Q63A 2IQDA 3MU7A 5I77A 3T44A 4DUVA 5LA0A 1EWDA 1LWHA 3LCHA 4DN1A 1X7IA 4F0LA 3FJNA 3O07A 3W6YA 2ZDSA 2R1NA 2NLYA 5I09A 3GR4A 3O6YX 1LBLA 1OC5A 2PWUA 3SZ8A 5BU9A 1PWLA 1FUYA 4JZ5A 3IJ8A 3LK6A 1H49A 2ZRUA 4IISA 2D22A 1W1YA 3QZ6A 4PTNA 4C6DA 1E6NA 1HN1A 4IL2A 4HK5A 3W6MA 3VIIA 4RW3A 3OLEA 1GJWA 4F2TA 2PF8A 3MP5A 1H7XA 2INEA 3P61A 3T0CA 1OC7A 1KV5A 4ATDA 2QGYA 4CKQA 1HVQA 2Y7GA 3ZM8A 4L6DA 2RDTA 1TA3A 4PMUA 3VOJA 4CUCA 1F4HA 2BZNA 1ECEA 4UTMA 3R43A 3CIWA 2GZXA 1OJXA 3UW6A 1AJ2A 3U4AA 3G1VA 1EZWA 3WD0A 5F4XA 2B7PA 2Y7FA 2WBGA 3VCRA 4GC3A 1KQZA 4O54A 4RJEA 1BXCA 1V6XA 3OU8A 2Z00A 3L7RA 2ZX9A 5ENLA 4JD4A 3W7OA 1PEZA 4HOWA 1J9YA 4IPIA 2ZUNA 2FZBA 3E2RA 1MDRA 2Y8KA 3UD6A 5IDIA 4N9EA 2FKPA 1H7OA 1OT2A 3S2LA 5LIYX 1UJPA 3BLPX 1XH0A 1XH1A 2BVWA 5J5RA 1PHQA 2DH2A 3RGTA 3CS2A 1A3HA 4L56A 3GE7A 1X1ZA 1OF8A 4D6HA 2ZWYA 4AUBA 1FH7A 3UGVA 4DYEA 1KTCA 1W5NA 2PWFA 3UQNA 3NM1A 4JNYA 3W7NA 4DX3A 4CCZA 2CU0A 1QOXA 1HL2A 4CCDA 1XRVA 1B57A 5I79A 1P1MA 3VGEA 4RE2A 5F4SA 2QXWA 5A6AA 1PKMA 5HR7A 1JUEA 3DCPA 1PZ2A 1UR0A 3LBMA 4LYKA 5RUBA 2W66A 2ZUUA 4RE4A 4PRWA 2OZTA 3WUBA 4HSHA 2WPBA 1JRCA 3UR7A 1H4PA 7REQA 1G9HA 2J9ZA 1WBHA 2D2OA 4WJEA 4JTTA 2WNNA 3LG3A 2TAAA 1PIFA 3AS3A 1OYAA 1P43A 4IMFA 1KQYA 1RR2A 3AU6A 4MPQA 1EBHA 4O53A 3F2DA 1D7KA 1FWCC 4H04A 3KL3A 3V3WA 2ACRA 3NSNA 4FLQA 4NI8A 4B15A 4WF7A 1MVYA 3TYZA 3G1HA 3T42A 3WL0A 1PE1A 2PLKA 4GY1A 3W86A 3GIYA 3AXXA 4QM1A 1FCBA 1CENA 1G4SA 3THAA 3H53A 1O68A 5AHEA 1E4NA 4Q8WA 3UG8A 4KT2A 2QLYA 3OIHA 3DERA 4IP7A 1TKKA 1M01A 2PF0A 3L12A 4MDOA 1X6UA 2D73A 1MO0A 4AD2A 1GT8A 4XAGA 3QR3A 2IW0A 4KFOA 3KS6A 1LDCA 4P5UA 1V3LA 3ZQ9A 5HOSA 1J93A 1I0BA 2Z1BA 2PGRA 2CPUA 4WGHA 1TQXA 3EB4A 2J27A 3GNNA 1W2VA 1HP5A 3QFEA 3G0XA 1R3YA 3TN5A 2C0AA 2DW7A 3H4XA 2YZ5A 3GZ3A 3VX1A 3EWYA 4GFIA 3O0KA 1CI1A 3EMZA 1PCWA 2VOTA 3WK1A 1UW9A 3LCGA 1GZGA 1FWDC 4G7EB 1TZ7A 1PZ3A 2WCAA 2J8GA 3MSDA 2OO0A 2P88A 4FLOA 3AU2A 2OZ0A 4X0NA 3THCA 3TYCA 2QJHA 1XX1A 3L68A 4Q33A 3GW0A 1GQLA 4E2VA 3KVMA 2VGGA 3M0ZA 4GJ1A 4A3YA 3FDGA 3W1NA 2VP8A 2X40A 3SCTA 5FF4A 2GL5A 3BAYA 4HNCA 1QT1A 3GBDA 2WMIA 4CCCA 1J2WA 1OFEA 3KBSA 1FOBA 1QJWA 2ISFA 2QV5A 1W9DM 5LA2A 2HDJA 4JPGA 1WPCA 2VCAA 1RA5A 3OBEA 1TRIA 1DWIM 4BEQA 1J01A 3ZR4A 3HGSA 4C6PA 3D3FA 4L1GA 3LOTA 2UV8G 4AC1X 3GDTA 4JTRA 3L4TA 4PBGA 1YPXA 3GHRA 4HK6A 1E6XM 1Z48A 3A64A 2XHYA 2VC5A 3GW3A 1GOMA 3CYJA 1MXDA 3W53A 3VNLA 3OQEA 4J3WA 1D7FA 3RITA 4URIA 1EXPA 4EAMA 4ML9A 2E6FA 1GVSA 1NF0A 3A23A 2ONEA 4OBRA 1X97A 2VEKA 2DSVA 1JF6A 2OOFA 3LUTA 3MUY1 5AECA 4GVGA 5HPCA 4YS1A 3QF0A 1ZCOA 4ZODA 3IIVA 4XQ6A 1G67A 4B3KA 3TNOA 1IE7C 3GVGA 4H41A 1Q7ZA 4JX4A 1HXJA 1JYWA 1XDMA 3LENA 3P8IA 3THUA 3WO8A 3T9PA 1EJTC 1VEOA 1V6VA 3P60A 4E8DA 4JR5A 4DO5A 1BQGA 2QYGA 4ZE4A 1V79A 4H1ZA 4KCWA 2WHKA 1JD9A 4PCTA 2FJKA 1JAKA 1MRAA 1ZAHA 2QS8A 4IQLA 2PDBA 3GO2A 1BHGA 3LNPA 4TTUA 1EDTA 5I3KA 4UFMA 3TKFA 1UUMA 4AB4A 5MF5A 2DZWA 3B03A 3NQBA 4DF0A 1RK5A 4NYUA 5LIKX 3W6LA 1EEXA 3SCPA 3LGDA 3UCDA 4GYFA 1GOKA 4D6DA 4LUSA 1KFLA 2ZZ3A 1OFRA 1C8YA 1O5RA 5H91A 4HZ7A 1GQIA 1NF7A 3VU2A 1XSKA 1B3WA 2VFHA 3AMGA 4XZ9A 1CXLA 4HVXA 4HIBA 4I6KA 3VKKA 1J0KA 5CEWA 5K3VA 4MNKA 1HG3A 5D9OA 4GXPA 4MFEA 1L9WA 3M44A 1BXBA 2XN0A 5GVJA 1VBUA 1TIMA 2DFAA 2XG9A 1JULA 3ALFA 3DZ1A 1TCDA 2V2CA 3W2KA 1A5NC 3VE7A 3GS6A 1ENUA 4GJJA 2Y62A 4MGGA 1TELA 5DF0A 1QUMA 4XD4A 5CZSA 3VC5A 3W1UA 3HU7A 1EB3A 1W3NA 5HK4A 3RMJA 3HMJG 5EMJA 5IFTA 3LTSA 4HA3A 4XG1A 4OOZA 1RA0A 3WG6A 1I45A 2YDRA 1TG7A 4XAYA 4IGMA 3QKZA 4KWUA 2CIPA 3BV7A 2VQUA 3NL3A 2YA1A 2HWGA 3SO7A 4OU1A 1MRQA 1WP6A 3OHMB 1GKRA 1OSEA 1PKLA 3LRLA 1DWAM 5C0QA 1GORA 3TJIA 3LCWA 4M6PA 4UR8A 1QI0A 3MKKA 2EQDA 4JYFA 5FEWA 3MKCA 4UCFA 5F2MA 2G3FA 3EWXA 4OV4A 1JEZA 4NKCA 1WAWA 2KX9A 3SUWA 4IX2A 1ZY9A 1ONEA 3WDRA 3GVWA 3H4GA 2O7QA 3FA4A 4J40A 3W01A 1IT8A 5CBBA 1UOKA 2B7QA 4J3SA 1W32A 4AYSA 1P6WA 4Q8TA 2EO7A 4CNOA 3APYA 3VNDA 3EWUA 4AMCA 4REQA 1J18A 1S5MA 5I0DA 1K3UA 1UWIA 2WMJA 4QX4A 2GJRA 1T96A 4BI7A 5DMMA 2ISSA 3P0XA 3S8HA 4W86A 4ZO6A 1VIWA 3CAKA 4JY9A 5FA5A 4PEEA 2JEQA 3KBMA 4A3HA 3CPRA 3SSJA 1VD6A 3FJ6A 1VGAA 2XSBA 2XVLA 4ZQOA 3WJSA 3JS3A 4EE9A 1AL7A 4JEQA 1B3ZA 3CHEA 3GXMA 4NIRA 3PC0A 2UY2A 5E09A 4UNLA 4O8RA 5EMMA 1MWOA 2CHRA 2H90A 3QXBA 1UKPA 3SFWA 2QT3A 4H2HA 3BAIA 4MFDA 3NAVA 1RP9A 1Q8JA 2BY0A 1F8MA 5TD4A 3W23A 3INPA 3N4FA 4PBFA 4ACZB 3GD6A 3HGJA 2C79A 3P93A 5D2VA 4MJZA 1JRBA 3VNMA 3ZR6A 2QVNA 1V02A 5DBTA 4JTDA 2WBKA 3UEQA 3S5OA 3CPGA 1B31A 4HYRA 4IUGA 3ZT7A 1J96A 1TB3A 3TR2A 2WHMA 1OFPA 5M1TA 4MADA 2G5WA 3CZJA 5CSYA 4I9TA 1LT8A 1JZ2A 1XLMA 2HS6A 2XVKA 4W4QA 4HKPA 1H0IA 1NWTA 4CN6A 4JIPA 1BPLB 2TSYA 4RE3A 5C2CA 6REQB 1QO5A 3GVRA 1FBAA 2YCIX 4DZAA 3PVFA 4TMCA 3GAKA 5C9WA 4HN4A 1H50A 1YNPA 4DXXA 5IBXA 1VEPA 4BY3A 4DVOA 1ISYA 5FACA 2GQ8A 2FH6A 2NXIA 2W27A 2D0GA 3WEOA 1YDYA 4I9JA 4I9MA 3GXFA 4UQBA 4XZHA 3LI0A 3KEHA 1KXQA 1JCLA 3ZJKA 2WM1A 1TSIA 3TN6A 5A95A 3N3TA 5GPRA 3GDLA 2VEMA 4LYPA 4YVPA 2XH0A 3I10A 5ABEA 2Y5SA 3MO7A 3AMDA 3OBKA 3SCRA 4I90A 4CQAA 3BMXA 4A8IA 2VO5A 4QQUA 2Z6IA 1OFOA 2ZZ4A 2EG8A 4PMQA 4CVWA 4DWSD 6XIAA 1BSLA 1ZBCA 3USZA 3E0IA 1JZ6A 4GI4A 3PP7A 3GDKA 5ABGA 4DLMA 1F74A 2HRWA 1B30A 3JU2A 4YPJA 5CQ1A 1IXOA 2C1HA 4BCEA 3C86A 3SI9A 4N6EA 3D3AA 1BKSA 4K38A 1UPPA 1XP3A 1DE6A 4IX0A 3TQVA 1ZZMA 4C90A 4UTJA 1HJUA 4RZ5A 2WSRA 3N14A 3RLUA 1LYXA 2PPGA 4Y96A 2VX5A 1OD8A 4R7WA 5BCAA 3WLIA 2WMGA 3DECA 1XLIA 2XPKA 5XIAA 3R7MA 4AHPA 2GDVA 4L6OA 4GLEA 3DFTA 1ZAJA 5H8MA 3MMWA 3RPTA 3TU9A 3DN5A 3DFPA 4LNCA 2B4GA 3GR8A 4HA4A 3B9NA 4IPLA 4J3UA 1L6FA 2BGNE 2XU2A 4CD8A 3GH5A 2CBUA 4X0VA 1GQKA 4A8NA 4DY1A 4ZB5A 1OFAA 7ODCA 2FZMA 1VZWA 1SU5A 4HHMA 1YMYA 2DJLA 4DBWA 3HB9A 1D3CA 3PUDA 1UYQA 1YTKA 4GYPC 3TZFA 5IFPA 2BNJA 3B8TA 1IZKA 3ZOAA 1F07A 1CGTA 4AIOA 2Z1WA 1K4GA 4L64A 5FI8A 3FAWA 4HYVA 4H2CA 4MJ2A 3WLSA 1TV8A 2UY5A 1RBLA 3VGBA 4UMBA 2E77A 1US0A 1B0IA 3K8KA 3PZOA 4ZA0A 1Q45A 4LBSA 4UTLA 3A12A 3TNBA 1H41A 3TA9A 1BXNA 5ABHA 2WZTA 2DT2A 2XFYA 4PMNA 1DP0A 2ISWA 2BODX 5B80A 1AUSL 5C54A 1AK5A 2Y7DA 4ROQA 3KFTA 1QNSA 2CLHA 1W3LA 4S2CA 1TCMA 1VB9A 4PUUA 5D03A 3W38A 2W5FA 2E5BA 5HINA 1XINA 4Q4KA 2NUYA 2ALDA 5F1UA 3R25A 5C6MA 2OYMA 4H01A 4TQTA 4W84A 1S39A 1C8QA 2QNEA 2VM8A 1G6CA 3LD5A 3WLHA 4QITA 1FWTA 3FXYA 4W88A 1D3HA 3WQOA 3CZKA 1KXHA 1GW1A 4Q4RA 2PDHA 3VDCA 5CXPA 2CKRA 4FLRA 3DHUA 1DKWA 2XIQA 1XLBA 1BD0A 5D2YA 2ZCGA 4Z42C 2IPWA 2YXGA 4CNPA 1GYNA 3PB0A 4FNTA 1F3EA 3MHFA 1XLKA 3F03K 4M80A 5CLTA 3O7UA 1RQHA 3P6LA 4KQNA 3L2MA 1NSJA 2NWSA 2ZRWA 1GVYA 2HVNA 7ENLA 4M0XA 4AXKA 1UKQA 2XWEA 4Q8QA 2Y4SA 3U4FA 4DO7A 3MVTA 2NT1A 1I8JA 4XISA 4Q7IA 5EB8A 3H70A 5IOBA 1E6PA 3ALGA 2CITA 3K46A 2GLKA 4NAFB 4UOQA 1ONXA 4J9JA 4QLKA 2R1MA 4WKHA 4K7YA 1Q6CA 2HS8A 1PXGA 1LCOA 3M4HA 2E9LA 1EJWC 7TIMA 5DXYA 1EOMA 1XPGA 2VWTA 2VTFA 3FS2A 4AEEA 3ZYZA 2JQXA 4J3ZA 2ZUVA 2IKIA 1E0XA 2XISA 1OF6A 4IZGA 1KBLA 1WKDA 3QQ1A 1SR0A 3ARUA 3NEVA 4TX8A 1UB3A 4R85A 4H6QA 1PO9A 3WQ8A 4NZ4A 1V4YA 4HNNA 2Y61A 4RK8A 3B9DA 2QCNA 3RN6A 4BZYA 4A21A 1K6AA 3RU8X 4FHAA 4S3FA 3WD2A 1WNOA 1H51A 4KMQA 4PH6A 1VFHA 1Y7VA 3U2OA 4HNLA 2OCZA 3Q4DA 3CHFA 1W6TA 2JGYA 3LCLA 2EEXA 3JRKA 1H3GA 2XFFA 8RUCA 3WQGA 3PPCA 4I8YA 1WDRA 3SEPA 2QAPA 1G7UA 3MPGA 1QW7A 4W93A 1W3KA 1S2CA 3G2GA 2WB5A 1U33A 3VPLA 3ANUA 2J9YA 4NRSA 3K8LA 5KEZA 1FTXA 4GYJA 2WC3A 4K36A 4Z1BA 2YLLA 1LLZA 3N15A 2CXEA 4M51A 2ADAA 2WZEA 4PMOA 2D0HA 3URNA 3VC6A 1ITUA 3UZZA 5IBXC 3OGVA 3AC0A 1JDEA 3W83A 2FQIA 2QMJA 4GUJA 5AKQA 3I65A 1R9YA 3E02A 1JR1A 2ZYFA 4Z2LA 1OYCA 1UASA 2FTWA 1W1A1 2VL4A 1N55A 5G4EA 2VFFA 2Z29A 4S1FA 3GKAA 3B8SA 3H4WA 5E1QA 1UWAA 2PDKA 3TXZA 3FV9A 1KRBC 1AH3A 2BMBA 2YA0A 3AIEA 3S1UA 4IFKB 2DZUA 2AKMA 1GPWA 1S5TA 4H9UA 4B3ZA 3OLDA 3BOFA 2ODOA 3R8HA 4Z2KA 2PBGA 4LCRA 4PMVA 4G1KA 2JKAA 3L0NA 2Z24A 3S4TA 2PURA 2P3EA 4H7ZA 4B9YA 1Q6OA 1TPC1 3NSXA 1Q85A 4IP4A 4OKDA 2Y5JA 2GOKA 3E6EA 1YHTA 1O12A 3RU6A 4GNVA 1HO4A 4H8UA 4Q7NA 1RZMA 4Y2WA 3CM4A 3A4JA 3CPUA 2OXNA 3LU2A 1I9CB 4GC4A 3LSBA 2FGBA 3VUPA 1U1HA 1XIIA 4EPKA 1U5JA 5CPMA 1VLWA 3Q58A 5BXRA 4PZVA 1OT1A 3PAOA 1JYVA 1POKA 5KMYA 1SQ7A 2CLIA 1DJHA 4GO9A 3TQKA 2E1WA 3FNDA 4WY0F 4HD5A 1HT6A 2R6OA 4NJJA 3WNLA 3AYTA 4B5VA 1TX2A 3VIHA 1EJSC 3NR0A 2ZZ2A 1OZQA 1QAPA 2JBMA 4IOTA 4K1WA 4JN8A 1E0UA 4MYAA 3U57A 3VKJA 2ACQA 2A4AA 1A0DA 1OYBA 4C1LA 2J13A 5AVNA 1A53A 1AD1A 4LB4A 3M0VA 1RY8A 3GM8A 2BXVA 2BY3A 3KRSA 3NFUA 1NELA 3L5MA 2BGSA 5BOOA 4WX2A 1KM3A 1L8PA 5ABFA 5I00A 3QZAA 1NH6A 1E0VA 1UIOA 1EP1A 2QCHA 4IGSA 3C5QA 2O0TA 3D6NA 3C2OA 1ZJBA 3T2PA 1LT7A 4HPNA 3VAVA 1W5QA 2YXOA 1CYGA 2ZICA 4QJ1A 3CUXA 5L6UA 3QRHA 1DBTA 3KLKA 1MFVA 1OG0A 5BW6A 4CGTA 3QMSA 1LQ0A 1ONWA 3CXOA 4ZR8A 3AS0A 5HMSA 3ABRA 3WBAA 2QJIA 3N2TA 4NASA 1W5MA 3IUIA 2D2HA 3AIQA 5DXXA 2QDEA 4I3GA 3CV1A 1TPH1 4XUYA 2QF7A 3SFKA 4NXKA 1GOIA 4Z17A 2PAJA 4DQWA 4W8LA 1KGUA 4AWUA 4LWWA 4P8XA 1W3IA 1IWBA 1KV8A 4W7VA 2JEPA 1CX9A 1XFBA 3NZRA 2FZNA 2WK2A 1ZSXA 3F1QA 4WVXA 2HK1A 3ZLGA 1UJQA 3VNJA 4Y9NA 3MY9A 3ZVHA 3FA3A 2A1YA 1NOWA 2ZWZA 2W3ZA 1CWYA 4WOQA 2XWDA 4REQB 2OQYA 1CIUA 1WXYA 3A47A 2DQXA 1H7NA 3U7BA