3L12A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (yp_165505.1) from silicibacter pomeroyi dss-3 at 1.60 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
297
Chain Sequence
GFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGVRALEFDVVMTADGVPVVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGLDGRTVYGRRFPDQAFLTGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARAEMVAAVLADVRRYRMEPRTVMHSFDWALLGECRRQAPDLPTSYLSQLPEGPDYDRMTESLPQAVASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDIRRMATTGVDGIVTDYPGRTQRILIDMGLSWT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (YP_165505.1) from Silicibacter pomeroyi DSS-3 at 1.60 A resolution
rcsb
source organism Silicibacter pomeroyi
molecule tags Hydrolase
total genus 100
structure length 297
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3l12A00
1DJZA 1XX1A 5T91A 2F9RA 2OTDA 1QASA 3RLHA 1PTGA 3KS5A 1VD6A 3OHMB 3MZ2A 1YDYA 1PTDA 5T9BG 4QJ4B 2FJUB 1DJXA 2PZ0A 4QJ5B 4QJ3B 3QR1A 4RW3A 3NO3A 3KS6A 5T9CE 1QATA 2OOGA 2OR2A 1DJYA 4RV3A 4F2TA 3EA1A 1DJHA 4F2UA 1T6MA 3H4WA 5PTDA 1DJWA 4GNKB 3CH0A 4Q6XA 3L12A 2PLCA 2ZKMX 4OECA 4I9MA 1GYMA 2PTDA 3H4XA 2ISDA 4RW5A 4PTDA 4R7OA 3QVQA 4I8YA 1AODA 3RLGA 3V16A 2P76A 3QR0A 1DJIA 3V18A 3PTDA 1DJGA 3EA2A 4I9JA 3EA3A 7PTDA 1O1ZA 4S3GA 3I10A 6PTDA 4I90A 1ZCCA 1T8QA 4F2BA 1V8EA 3V1HA 2O55A 4I9TA
chains in the Genus database with same CATH superfamily
4GISA 1XYFA 4IGHA 4NZ5A 4FF7A 4HCLA 5AKQA 2QGHA 5HQLA 1UKPA 5K9DA 4IFKA 2PDPA 2Q09A 5AC7A 3WG6A 4DPQA 4IG2A 1JPMA 3BDKA 3M9YA 5F1VA 4YYFA 3ZS4A 4FPSA 1KC7A 2WHMA 1SZGA 3DYPA 2FVMA 5L6UA 4FALA 4H19A 2HVMA 1YKWA 4UR9A 1EDQA 1XJBA 3H4WA 3FX4A 3F5LA 1JCXA 4PH6A 3VKCA 2YDAA 4H9UA 3BK0A 1AD1A 3L12A 4HBKA 1R8LA 4GUHA 2XH2A 4JTRA 1B1YA 4C6NA 1F61A 1YPFA 3HG5A 2YXOA 3GHUA 4C91A 1WUEA 4K36A 4I5UA 3CZGA 2CXGA 4DYEA 4R27A 1H1YA 1IEQA 3G1VA 4O10A 3GW0A 2A7PA 1XKJA 4WR3A 4QISA 3R0KA 3PBMA 5FCZA 2DH2A 2E6DA 3GHSA 3XISA 1KLYA 3DYMA 4RR4A 4B2DA 1CENA 2X41A 5JVLA 4NQ1A 4W7WA 3VE9A 2AMGA 3NG3A 1ME7A 3W27A 1KBKA 1R3RA 1QI3A 3GYEA 1S2CA 3HA1A 3A9BA 2RDWA 1OG6A 2QT3A 1DWFM 1XLDA 4GXPA 2F9RA 1H41A 4PUJA 2CIPA 3SCQA 3QN3A 3O6AA 1K4GA 1I1XA 1US0A 2ZICA 4M24A 2OEMA 3QY6A 2BOGX 1R3QA 1BYDA 1OB0A 2Y85A 1QMLA 2VQUA 3VFCA 4F2TA 2H3DA 5A6JA 1Q6RA 2E1WA 3B40A 2ZA3A 3S2CA 1O4UA 4LYQA 3NDZA 4O19A 2P10A 2WSYA 3TXZA 3T0BA 2E28A 1WZKA 4RZ6A 2YZ5A 4HPGA 4PL1A 4G1NA 3OB8A 4U10A 4U5KA 4UQDA 5CG0A 2A21A 1E6NA 5D4YA 1MDRA 3H4XA 4G5DA 4MUPA 4PUKA 5KSWA 3K8KA 1S1PA 4ZO6A 4GYJA 2ZVIA 2ZUMA 4WDUA 4FP1A 4UQAA 4PBGA 3WJXA 2G96A 3MCOA 3BXWA 3ANYA 4UNKA 2D2OA 3DAQA 3COTA 3QOKA 3AMCA 5U4NA 4LX4A 2J66A 3PHAA 4OUIA 5CPOA 4ZMGA 4Q7BA 1JZ5A 1NY1A 1W32A 1BRLA 3UZWA 4AZ7A 2DZUA 5H2ZA 5EBUA 3WLLA 1Y0EA 2ZWZA 3TYBA 1SVDA 3E0WA 5FJOA 1XBZA 3KCLA 4AX6A 1IT7A 4Z1AA 2VL4A 2A2IA 2EG6A 4GBDA 4L56A 4LS1A 3R0DA 3B0PA 5ENLA 3SCNA 4M7SA 2PODA 3UU0A 3AHZA 4C6OA 1EO5A 2F84A 3TYCA 1B2YA 3GXMA 4PUEA 1KFBA 1OFRA 1L6GA 1JDEA 3MCNA 1IE7C 3AIBA 3SADA 3MP5A 4PMXA 5I79A 4POCA 3Q58A 4GPNA 3EX1A 4HZ8A 4EIVA 4CD5A 3R79A 3GU9A 3H4GA 5AZ0A 2C18A 1XDMA 2A79A 4RUBA 4H2CA 3DFYA 3AMGA 4UFJA 1QRQA 3R8GA 3VKDA 3AYRA 2RHGA 3D3FA 3CEPA 3W2UA 3EX4A 1FWEC 1QPQA 3A23A 3LCFA 1WV2A 4DWSB 4MKNA 2J8FA 3MMUA 1OC7A 4XK2A 2AL2A 4S2BA 3EMCA 1Q5MA 1UA7A 1NVMA 3K4DA 2OLHA 2XZ7A 2J74A 3MKCA 3SBFA 4ZSUA 4IQDA 2VVSA 3UWZA 1WUFA 4O17A 5I3IA 3B8VA 3OLIA 3MW7A 3AQUA 3THDA 4NSBA 1J10A 1BKSA 3W1AA 4U3CA 5CZTA 5IHSA 3LBOA 1JZ3A 2BSLA 3E2VA 1XH0A 1V77A 1S2VA 1W56A 1A3HA 1MVYA 3WCZA 3BE7A 1VYSX 1NF0A 3CZ8A 1TYGA 1KD0A 3TQ0A 2GGIA 4XUYA 3OHMB 2V5JA 1ADSA 2HE8A 3DI0A 3T0AA 3R8HA 3N34A 3WLKX 5XIAA 1GTHA 2I56A 1H7XA 4GOAA 3KFTA 3GG0A 1B3VA 3LHWA 3CZKA 4F0MA 1ITQA 2WOQA 3PBVA 3OHIA 4TV5A 1TPWA 4A4AA 3DDMA 1ZY9A 1TWZA 3N6HA 1PBGA 1EHAA 3BWWA 1IV8A 4QCFA 1J0IA 3FYYA 1QBBA 3DU0A 1GEQA 3F2CA 5I07A 3BGGA 4QQ3A 3WDHA 4MLRA 1WYIA 1KBIA 4H7VA 3W87A 1YX1A 1TZ7A 3L5MA 2YBUA 2BHZA 1MUMA 1JAKA 1O1HA 3NQCA 3DBPA 3WUFA 1DJIA 3T8QA 1T96A 3ITGA 1Z3NA 1CXLA 2ZRZA 3L66A 1O1ZA 5REQA 4C1NA 3SCUA 5EMJA 3DUGA 3FJ6A 2VM8A 3G1DA 1C8VA 2V6AA 3VNJA 3L4VA 3A3WA 1IT0A 4ONVA 1IXPA 1CYGA 2PC4A 1VCVA 1C8YA 1FWGC 1FWIC 4LBUA 2PD5A 1U5HA 2I5QA 3WNPA 1T40A 1GKQA 4HKPA 1SZFA 1GNXA 4L6HA 1WO2A 3S1UA 1JULA 4FXJA 2WK2A 4NNAA 4B5VA 2ZX8A 1R3SA 5D9PA 1K9FA 3EDKA 1VHCA 1J96A 2VEKA 4KWOA 1ZJIA 2FTWA 2HPIA 3H53A 2V38A 4H01A 2TPSA 3ARVA 3RCYA 3ITLA 4JFTA 3LPFA 5I02A 3CHEA 1UD2A 2RGMA 3THCA 4FEZA 5BROA 3URAA 3R94A 4B3KA 1V0NA 2ABBA 4AD0A 1PYMA 1MW1A 3BJFA 4HP5A 4XZ9A 3MO4A 4QS5A 3RHGA 1EX5A 3QMTA 3RPDA 3B4YA 4NASA 5DT5A 3CBWA 2XWDA 1E4IA 3M47A 4RPPA 3NSXA 2YA2A 4N0RA 1QFEA 4LXFA 4ACYA 4REQA 4WXYA 3NL3A 2R9RA 1AVAA 4D6FA 3ZYZA 1A3XA 2KX9A 2IXUA 5CSYA 4C6IA 5A6LA 3W37A 2WLZA 3A4JA 5DO8A 1XYMA 4WCJA 3HQNA 2C19A 4J3XA 2YLLA 4IP4A 4Z1DA 2HK0A 3SRKA 2P53A 5FL0A 1S2UA 1FQ0A 3GTIA 1JVNA 1H2JA 3ZSTA 2Y8KA 2GOUA 4A3RA 2P1FA 4NAFA 3EZ4A 3EGJA 2I1OA 4AIEA 4GY0A 2Y61A 4NILA 5LNSA 1J4EA 4XISA 2QV5A 3ICJA 4PE8A 3TAKA 1W1YA 3FLUA 4UOQA 3LRKA 3GZAA 3TC3A 3R12A 3DERA 3QR1A 4ZFMA 1HW6A 3P7YA 3G1RA 4Q8NA 3P84A 5D32A 4BI6A 5BXTA 3MI6A 2GK1B 1K9DA 1XUZA 3P80A 4K8EA 4YCPA 4JIIX 2XH0A 2E09A 4JEJA 3GM8A 2WQDA 4NJJA 4MJZA 4A3YA 4BEQA 4KRZA 3FSTA 5DXXA 3VOHA 2PLCA 1B3OA 2OLSA 4A8IA 3TWAA 4LF1A 1RV8A 4MYXA 3B0UX 3CO4A 3DN5A 3Q4DA 2GQ9A 1UP2A 4H41A 1GUVA 1V7AA 7REQB 3R1ZA 1PAMA 4LAUA 2FB2A 4Z42C 3B04A 3V5OA 4D8LA 4PMUA 2QJMA 3HV8A 4HNNA 3BAYA 2FZDA 3GHTA 4D1JA 1VEMA 4UTKA 3R43A 2VXNA 2WXDM 2OG9A 4JIRA 1OCBA 3MSDA 1XPGA 2QJIA 4LQ1A 1J0YA 1AW5A 3CZEA 3TA6A 1K02A 1QOQA 2W3ZA 4BA0A 1XG4A 4UMAA 4ZFCA 3TE9A 3URNA 3SQLA 2OOFA 1Z8AA 3AZTA 3WH8A 4ZZ9A 2OSWA 1PTDA 1GHSA 4LY8A 5T9BG 4OVXA 5GJNA 2ZE3A 3R6IA 4CNOA 3ITVA 5K7JA 1UD4A 2V63A 2RDXA 4CN4A 4QJ5B 4JDBA 4MWAB 3G22A 3CQKA 1J11A 3N12A 3W7MA 1JEZA 1Q7QA 1LF1A 4DF2A 2WVUA 4QTGA 2OPJA 2OELA 2HQAA 4MB4A 2CBUA 3RU6A 2ACUA 2X16A 3EEGA 1A5BA 2YBTA 1PVNA 5GQBA 1H11A 3B4UA 4A8LA 2J27A 3OQ8A 2BG5A 5LIUX 4H9MA 4C6LA 2Q3OA 2YCLA 2B7PA 3RJXA 4TOQA 2CW6A 3CPRA 2PDQA 3MQTA 4LV4A 4AWSA 1R46A 2G3FA 2YDRA 2VFFA 2L5HA 4AZGA 1Q6OA 4I8YA 4MKVA 3ZIZA 2CNCA 4GINA 5KZEA 2EGZA 1L6FA 1VLWA 5H8MA 4MDOA 3EX6A 1EDGA 1QHOA 2VEFA 4FZIA 1PXGA 1DXEA 5C0QA 1A49A 3GSMA 2C1GA 4HNVA 1QVBA 1M5WA 3NVTA 1F05A 4BF5A 3AFBA 2WM1A 3VA8A 4C6CA 2Y5EA 3N13A 4EPDC 3L21A 3ATYA 2PRMA 3TA9A 3NZQA 5JIPA 2F2HA 1SMDA 2EPLX 1CLXA 2YA1A 2WMIB 2QUTA 3OVRA 4AU0A 4TX8A 4UQBA 4MOZA 4GGBA 1FWJC 4JOMA 3WJZA 4ZR8A 4GCXA 5CPTA 3LCWA 4N9DA 2YGYA 4KCTA 1NWRA 1KQYA 5HJXA 1V08A 4RDZA 3L0NA 5DLCA 4DO4A 4YPJA 5HMFA 1PL9A 1KM2A 3W1UA 5LIWX 3LTYA 3TDFA 2D2JA 2B7NA 5I3GA 3M41A 5I7GA 3QJAA 2PD9A 1JFHA 3PY2A 4Q6XA 4NF7A 3M44A 1E9IA 1K1DA 4NHVA 8TIMA 3Q37A 1F9CA 1UD6A 5HXMA 4IL2A 3HTWA 3OODA 1FUYA 1FWWA 2DSZA 1ZJAA 1R9ZA 1X39A 2INZA 4EPEC 1QCWA 2XDFA 4EXQA 3HM7A 1P7TB 2ZXQA 1QI0A 3IAPA 3ZZ1A 1LBFA 3N17A 5HNRA 1F2JA 3DXIA 3SDOA 1K8CA 1OT2A 3NURA 4BHYA 4RL3A 3MHUA 3BQ6A 1OZMA 4MNJA 1OZQA 3BUVA 5AB3A 3N73A 3LTPA 4HHHA 3VIMA 1A0CA 4UFKA 5ABEA 1YDYA 1QNRA 1I1WA 1P6WA 1I2PA 3P82A 1XV8A 1UWQA 4QJ3B 1A5OC 1P6CA 3WQ4A 1MQQA 1NDYA 2D23A 3RK8A 1UOKA 3KL0A 1JL8A 1DIEA 1FFQA 1MNZA 1OD8A 3W73A 3LQLA 2J7EA 4F0HA 1DJNA 2PLKA 2WJDA 4PR4A 5IBXA 5L9FA 3RR1A 3CH0A 2R1NA 4M8UA 4LUJA 4M6UA 1XFCA 4O4WA 1ZP4A 1FP9A 4JICA 3TV8A 5FESA 3CB8A 1E1CB 2C13A 2VFEA 3LCIA 3QFEA 1S5MA 1AG1O 3QV8A 3VE7A 3V16A 1FP8A 5GNYA 4N02A 1N8IA 1U83A 3E2SA 1EQCA 1U22A 1XD0A 1AMYA 3BW2A 1QOXA 4MDPA 3CV7A 2WYSA 3T2QA 1YW1A 4DJDA 3TNOA 3S5SA 1LBMA 1DWJM 2Q8ZA 1L8PA 2W67A 1AJZA 1IR1A 3W75A 3V5CA 1US3A 4WY0A 4HD5A 2YDSA 1B31A 1ELSA 4GFIA 4HSHA 1MMFA 5I06A 2WCGA 3KDNA 5CSUA 7TAAA 2YYUA 1FY6A 4UMBA 3CUJA 4ZQPA 1TR9A 1N7KA 1WDDA 3WN6A 3CH9A 4R33A 4JKMA 3E5PA 5JH2A 2BTMA 4O28A 1W3HA 2FGLA 1HJSA 2XSBA 3MKKA 3OOQA 3QW3A 3V0SA 4AVFA 4IXHA 1RSCA 5C71A 1D3GA 1JDDA 3IJ8A 4UXDA 4I9AA 3MU7A 4UB9A 1IF2A 1D2KA 4QRNA 2UV8G 4QSFA 1NTHA 1QO5A 2QCEA 5HMDA 1HP5A 4L1GA 4JS3A 2WHJA 1HX0A 3CMGA 3GH5A 2J7DA 3A6OA 3WJWA 3UCQA 1ONWA 4I90A 4MPQA 1CEOA 4HNCA 3G18A 1Y7VA 2VD8A 4JIHA 1HZYA 1FH8A 2NW0A 4GQ0A 1X1OA 2ZRUA 3A9IA 3VABA 2NQJA 4LPCA 3II1A 4GYKA 1B57A 5I3FA 4U31A 4ZQNA 2CWNA 3CMFA 1VS1A 1FOBA 1HKIA 4GJJA 1GTEA 3NQ7A 3G0UA 4O16A 3HU7A 4LF2A 3T0TA 4AD5A 3VIKA 1Q3NA 4FR6A 3TTQA 4HZ6A 1PKLA 1Y5XA 1E40A 1H0GA 2WKJA 3ZSSA 3ZWSA 2XGIA 4O14A 3VOIA 3IJQA 2AOSA 2DP3A 5XINA 4O0KA 3WH7A 1H4PA 1BLIA 4QITA 4WJ8A 3QQWA 1YQ2A 1V6WA 2CXEA 3LBCA 3OVQA 4I5XA 1UCWA 4CQAA 2KZHA 4H04A 3PG8A 1XLEA 1D7FA 2V3FA 4GVIA 3VINA 2CU0A 3BLOA 5F2LA 2EJAA 4AY1A 1C93A 4P8VA 1OFQA 4PMVA 3FIGA 3E0VA 4C1KA 3SUTA 4MHBA 1RHCA 2FB3A 4N6FA 3NAVA 3LCXA 2Z28A 3G1YA 1W0MA 3M0IA 3QQ0A 3W6YA 2VR5A 9CGTA 4KS0A 4Y9MA 3PJUA 5F4WA 3AMKA 1T8QA 1UH3A 5EPDA 1UR8A 2HBXA 2J7HA 3UVAA 4S3BA 4Y9PA 3H7VA 5HWJA 4C6FA 2IPWA 1SPQA 2VC7A 1F6KA 4HCDA 3K1GA 4H00A 6REQB 3QRHA 1PKYA 4QG8A 4GIYA 4EOUA 5DBTA 3W53A 1ME8A 1R2TA 3ZT5A 3GR7A 1E6QM 5XIMA 3P60A 2D0FA 4A3QA 3BZJA 3NCOA 3G1FA 1K8XA 4W8LA 3GNRA 4GH1A 3ABXA 3QMSA 1UKTA 4LUTA 3TIMA 1SR9A 1UYQA 2XVNA 3KCOA 1TIMA 5A8PA 4DZHA 2WSRA 2ZX7A 2J88A 4IPPA 1HT6A 1V3MA 3MYOA 3MUXA 5A6TC 3AYVA 4CVUA 3FCPA 4CUCA 2QPXA 4BFAA 1AFSA 2VOMA 3G3MA 2YL9A 1QI5A 1SFSA 3EDFA 3I3BA 4AZIA 3N2BA 2QUMA 4DELA 3RDKA 5DCDA 1RBLA 3U9IA 3W83A 4S38A 3KW3A 2AQOA 4A3UA 2VO5A 1M03A 1MRAA 3UR7A 3HFTA 1DXIA 3S47A 2F6UA 3FEMA 2BFGA 3G2GA 3AZSA 4CU8A 4AX7A 1A5AA 5E0CA 1PS9A 3P81A 1EJXC 3SECA 1YDOA 1YHTA 3CL7A 1DIKA 3AXKA 4CLMA 4TU1A 1J6PA 3WQEA 3UXIA 2WSKA 4HGXA 3RO6A 1A47A 3M7WA 2CESA 5C2GA 4D2JA 3N4AA 1TB3A 2YLAA 3WENA 1L2UA 4LNCA 4L64A 2X30A 5C9UA 2VUNA 1XRTA 2HJPA 5AVNA 2CBJA 3NOEA 3KVKA 4ZOCA 1TSIA 2XIQA 3BQ5A 2FVKA 3IRDA 4WD0A 5BRQA 4R85A 4F66A 4RV3A 3W2MA 3ZT6A 1VBRA 1F3WA 1CGUA 2ZDSA 3O1NA 3W1RA 3NIYA 2QIIA 1UG6A 4CN6A 3L4UA 1TPC1 3UZ5A 3VD3A 4S2CA 2H8XA 2H9AA 3ISIX 1OC6A 3WKZA 4NRSA 3LBMA 4XKMA 1M7OA 1K9TA 3UVIA 1UJQA 4TIMA 4IQLA 4O1BA 3PZUA 5FJPA 5FJRA 1QPNA 3PUGA 3NA8A 3VIFA 4NL1A 1DP0A 4ZQCA 2BWGA 3BLLA 4IUGA 3Q45A 4KEMA 5C9ZA 5HPOA 3PULA 3G24A 5JBEA 3UF9A 3PTQA 3JS3A 5GNZA 4C6DA 2QVHA 2RDUA 1OF6A 3LGGA 2YL6A 4MADA 3QC3A 4J3SA 4UQCA 3E74A 2JKPA 2Z1XA 3LNPA 4OZOA 3W7KA 1QDSA 2W66A 4NJIA 2CERA 1QAPA 4LAZA 1BVWA 2OQYA 1WCGA 1J5TA 3W38A 2J8GA 1B4KA 5T9CE 2P3ZA 5H8UA 4C90A 3W3OA 5A6SA 4B15A 1Z9AA 1T6MA 4E4PA 3ELFA 4FIQA 4BQ2A 3IJLA 1GOIA 4J7RA 4TX9A 5KITA 3SY8A 1QHZA 5HATA 3KRUA 1WAUA 3BSHA 2DZBA 3R10A 2EPMX 2D3NA 3W7GA 2V5CA 1W9DM 2QMJA 3ALGA 3L4YA 3N6QA 3GTNA 4S3AA 3VOJA 1PEZA 3K8LA 1ONEA 4P7OA 3IJ9A 2FZNA 5FOOA 1G4SA 2NSXA 3KEHA 3KLKA 3KWXA 3ABSA 1Z42A 3LCHA 3LEPA 5KTLA 4Z1BA 3SM0A 1KFLA 7PTDA 3CK5A 1VJZA 2O4QA 3SURA 4C7FA 4ALDA 4BWLA 4XQ6A 4XAGA 1DEDA 4QLLA 1HN1A 4GQRA 1WP6A 2OQHA 2NX1A 1P0EA 5DBUA 3TONA 1R9YA 2PCQA 3WH5A 2BB0A 4MWAE 1MZHA 3L0GA 2J9XA 4D6CA 2PZNA 2VC6A 1GOWA 4PUWA 3S2MA 2BVTA 4H8UA 3RLHA 4PEKA 1H5VA 5JU6A 4PTXA 3DECA 4FLRA 1HKMA 3A5VA 3SIZA 5CLTA 2Z29A 1B3XA 1LOSA 4X9SA 3QYQA 1KLZA 2C16A 3WF0A 4DWDA 2CPUA 3SN0A 4GMEA 3T7VA 1G69A 4ZQOA 1UH2A 1S1RA 4MFDA 1JZ2A 1KM0A 3EKLA 1CPUA 4ES4A 5CPSA 3GTFA 1OF8A 4ORMA 4LANA 3ORWA 4HNOA 1S5WA 3FSUA 3VIIA 2VWSA 3N2CA 2CKSA 2XFYA 3WUBA 3M0ZA 1XLCA 1D8WA 1WB0A 2QS8A 4CCZA 4M51A 3DH7A 3WF4A 4GXMA 3AUJA 3I7RA 3VMPA 2EF9A 4B9ZA 2R1KA 3N2OA 3LMYA 4JX4A 3DCPA 1Z48A 4DF0A 3RXZA 2QZRA 1R9XA 5G1YA 2VT0A 3QHNA 3VVGA 3OYZA 1XI3A 2F38A 4PMOA 2DSWA 3AROA 1SFTA 1XBVA 2J9ZA 1SQ7A 3S6TA 4J4KA 1XFBA 2C8NA 4KWSA 1X97A 1J8VA 2DT0A 4QDMA 3NVDA 5B7YA 1SR0A 3N11A 1EP3A 4FK9A 4M7TA 3WK2A 1LWJA 2V5DA 2O9PA 1RALA 3W02A 3C6CA 2DVXA 2GOKA 2Y7FA 4Z2IA 3HPZA 4KH2A 3C2OA 1QNPA 4XIAA 4L65A 3ZJ6A 4F0LA 4F9DA 2HVOA 3R2GA 5IBXC 4W5UA 2MNRA 5BMXA 2OOGA 4PCSA 1DHPA 4S23A 3MA8A 1NOFA 4HTYA 5F1UA 1O94A 4UR8A 5B7ZA 4B90A 1JNEA 3CAVA 4GIAA 4H7ZA 3E0FA 4XAYA 3N04A 2CLFA 3IVUA 4LYPA 5CGTA 3TOYA 2D2GA 4PBFA 1KWKA 4A22A 1MFVA 2DY3A 3EDJA 2FHBA 4OGZA 4QM1A 1XBXA 4BQ3A 5SWUA 2QJHA 4LVBA 4C60A 4DJDC 1Q6FA 1NWUA 1T8XA 1S2TA 1AJ2A 2YB4A 5I3HA 4H2HA 3AOFA 3BGAA 2I16A 1JF5A 2RKXA 5F2MA 1IZCA 4P8XA 4CCDA 4L9ZA 1MEIA 3EB3A 4MNKA 4PRTA 1V93A 1IQ8A 1TUXA 2CZEA 3EOUA 1AK5A 2OGYA 2A1YA 2PWGA 3M6DA 1GWJA 3EDEA 2V67A 3MPGA 2XG9A 1S2WA 3GXTA 3AYSA 2VJXA 4NU7A 2PDKA 1Q6CA 2BASA 2XH7A 1NOWA 1UZHA 1DQWA 3WLRA 4FX6M 1DIOA 4URIA 5E93A 2X0YA 4OIFA 3LX9A 1K6AA 1Y8BA 2O9OA 1EWDA 3FA4A 1D8CA 3NEHA 4TR9A 4HMCA 1UR1A 3AS1A 4MZ8A 1GPFA 3IIVA 3ZLFA 3LV5A 5HULA 5ABFB 1UUMA 4DBDA 3UPWA 2CLMA 4ZQRA 4DAFA 3O05A 1KNWA 1FWFC 3LHUA 3T42A 4PC8A 3WUGA 1M7JA 2XVPA 5M1TA 1VGAA 4TMBA 1QBAA 5TNVA 1NWSA 4XZBA 3NQ2A 1TV3A 2X1SA 2BP1A 4O8AA 1NH6A 3UNDA 1XG3A 4Q4OA 3CXOA 5E70A 3EOEA 1Q13A 3VDGA 3WNMA 5TD4A 3BOXA 1H63A 4CNUA 3VCRA 2O9RA 4LC8A 2GK1A 3KBNA 3TOPA 5HNNA 4W7UA 3WQ8A 1KQZA 2EKCA 1V0KA 4GWEA 2W61A 5AC4A 3LCGA 1UROA 4DY1A 2NV9A 3WIJA 3G3DA 1TV2A 1IEWA 3S4TA 2BGNE 1DWAM 1Y5WA 5JQ9A 4XSLA 2IUZA 1BRLB 4AVNA 3CMJA 4JHMA 4L4PA 1I0DA 4IUOA 3MSGA 1R7AA 3HJZA 4WVXA 2XGBA 1HUVA 1OC5A 5G5IA 2IPGA 1UZ1A 3RCNA 3A64A 2ZUTA 4JEQA 3SJ3A 1CXFA 3I4EA 1EJUC 2BY1A 5TAOA 5FF3A 3KTSA 3TN5A 4PEEA 4OU1A 5ECUA 4AW7A 5I09A 3HQ1A 1UBPC 2G50A 1K8ZA 3S9YA 1W9UA 2NV1A 1WXJA 2NQHA 1P6BA 1HJQA 1SO5A 1RJRA 3SCSA 1HF6A 2QJNA 1RUSA 4YYCA 5D33A 4CEUC 4LT9A 3S42A 3SZ8A 5A6BA 5D02A 2XPKA 2HPMA 1JD9A 4H8VA 1Q6EA 1EPVA 2PF8A 3ARUA 2CZVA 4CCEA 1GYLA 3VCCA 3R7MA 5BW6A 4PTVA 2D22A 1TWWA 1FH7A 3QKEA 2WVSA 1OYAA 2E5BA 3CQHA 2AL2B 3H26A 5DQPA 3UXKA 1POKA 1SM9A 4KEUA 4PMJA 3LXBA 2F7FA 5AYIA 1LL7A 4XBKA 3GW3A 3VUPA 4UTMA 4MAVA 3W81A 4L5ZA 3WLSA 6ENLA 3W2JA 1E70M 3U6WA 1F76A 1EPXA 4AXKA 1LLZA 2VENA 2GVJA 2X1RA 2E6YA 3M0KA 4JL2A 3MANA 3GVRA 4HMDA 1FHVA 4AZHA 2VTFA 3VC5A 1R38A 3R8RA 2VKZG 2YX0A 1B9ZA 4ECLA 4E5TA 5HWNA 1XP3A 1I2RA 3AC0A 5H6HA 1OADA 3OIHA 1BF2A 1CECA 3GFXA 4DIAA 4G56A 2YOCA 4I5RA 5TF0A 3G1XA 4G7FA 3FFSA 3IIOA 1G7VA 2F6KA 4ZB2A 4UC5A 2DZAA 1BSLA 2OLAA 1NF7A 2GSJA 4CN1A 2PDCA 3BPWA 1MQPA 4Z1CA 4MVAA 1NEYA 1F8MA 1G0CA 4H8HA 5BMWA 3AMLA 4GO8A 3UJFA 1IIGA 5LIXX 5BWAA 1S5VA 1V7YA 3LPGA 4PMZA 3U3HA 2JFEX 3OYXA 4HA3A 2VUYA 4EWND 1GT8A 3WEOA 2WNNA 3K13A 1AZ2A 4GKLA 2DUXA 3B8UA 2IKIA 1KM6A 2J25A 1XW8A 4OBTA 3R5EA 3WDJA 5CC6A 4C1NB 3ZO9A 2F8QA 2WC7A 4UTUA 1ONXA 1Q6DA 3KHJA 3WNOA 1D3CA 2XH4A 1EBHA 1H50A 1PB0A 4J3UA 2OEJA 1S38A 3TEVA 2BY0A 1PX4A 3NWRA 4MZYA 2CYGA 3W9ZA 3U4FA 4Y9OA 1W3LA 2ZA2A 4ZVJA 2D2HA 1TJPA 4GK8A 1KB3A 2V3EA 1EX1A 3VO0A 3LHYA 4B92A 2QCDB 4I6VA 3LZ3A 3VK5A 4F3HA 3CZLA 5LXXA 4DYKA 4NZ1A 5A8QA 4R9OA 4U3AA 2ZRWA 4UTTA 3M6YA 5E9AA 3IEBA 3GWQA 3DESA 2ZTJA 4YL2A 1OABA 4BQ4A 4US6A 5I77A 3EPMA 2DH3A 4LFYA 3VKJA 4HJFA 3W74A 1EEPA 1JFXA 4K39A 3STCA 4Q4MA 3KDOA 4PCNA 5C70A 2DJXA 2YXXA 1WDRA 2WW5A 3GUWA 1L6YA 1FKWA 3N6JA 4CD7A 1K03A 1UOZA 3QM3A 3QPEA 1KXQA 3L2IA 4GACA 3TW7A 1E4LA 4LOCA 3PR2A 2XIMA 1SO3A 1L0PA 2WMFA 4N9CA 1E5JA 1OGGA 2ZDRA 3W1PA 1W5OA 1SGJA 4GE8A 2IXVA 5D30A 5AHEA 2X05A 1G4EA 3L0KA 3SR7A 3WBEA 4QDWA 2FHCA 3IWPA 4HCHA 2BMBA 1A5LC 2OYKA 4HHLA 3O9NA 1TX2A 4NAFB 3ERPA 2PZ0A 4IIDA 3H2AA 3ITTA 1C92A 1A4LA 2IKHA 4CQBA 1QJWA 2B4GA 3NL2A 3NQBA 1FKXA 3U2CA 4ERAA 3SUUA 1W1VA 5IFTA 1HXJA 2AGTA 3A4AA 3IARA 5HUOA 1G94A 5EL1A 4BI7A 1TRIA 3OLDA 3KLLA 4WKFA 4KRTA 1AJ0A 5A8OA 1YADA 3WBAA 4S3DA 5K3VA 4PUDA 3BSMA 3O0FA 1DIDA 4LSBA 3L2MA 3BMVA 1Q7MA 3LTSA 2NXIA 3BG3A 4ERIA 3EPOA 3C0JA 5CSRA 4PSPA 4MB1A 3I6RA 4GGHA 2XSXA 4UOZA 3URQA 4IP5A 3WK0A 4ZCWA 1J2WA 1OK6A 2PP3A 2Y7DA 4BWLC 4LRSA 1OFOA 4M29A 3BO9A 2ZC8A 2Z0IA 1EGMA 4DN1A 5BRBA 3GZ3A 4UFLA 3O7UA 4DJFA 4K7VA 4JQ2A 4B3ZA 1XD1A 4W8BA 4KFNA 4DJDD 4NNBA 4ADTA 5D2VA 1ZENA 3LPOA 1V6VA 4EX4A 1QT1A 4U2YA 1FXPA 3FHAA 3VNZA 3CIVA 4PMRA 1JZ4A 4PCFA 1E55A 3MZ2A 3BG9A 1I45A 3UXDA 2VFGA 1W31A 2DT3A 3WQDA 1VYPX 3PBWA 3UY7A 1YNPA 2UY2A 1L8NA 4Z2GA 1YPIA 4AMAA 5H8PA 2G3IA 3DFHA 3EAUA 3WEZA 5J5RA 4DUWA 2ZRXA 2NUXA 5LA0A 4KESA 1IHIA 4NJHA 3GFYA 5I78A 2W63A 2OZTA 1ZAJA 3N9KA 3U2OA 2DIEA 3GUGA 2VWTA 2Y70A 4WUIA 4WOZA 4OECA 3WLPA 4R3UA 5JMUA 2OX4A 1RA0A 4JTEA 4O0ZA 4JTUA 4PTDA 1BHGA 2O7QA 3SCOA 1GVSA 1JCTA 3W6LA 3N4EA 4KIEA 3VOCA 1R3TA 4ATDA 3GH7A 1JDFA 1I2OA 4M5PA 3O16A 3BW3A 2BY2A 5HQMA 3OEXA 1ZS2A 2PPGA 2Z7GA 3WH6A 2IKJA 2OX1A 4MYAA 2VDHA 3TZFA 1H1ZA 1A80A 4BF7A 5T26A 1B9BA 1UHVA 3FEQA 3DHFA 1DORA 3RGTA 3A4XA 1Y65A 4E4UA 3NDOA 5F2IA 2W0UA 2QJJA 5A1AA 1XLHA 4H3DA 1TTJA 5DMYA 1GK8A 4JTSA 4MTVA 1M04A 3BLFA 5FAJA 1UASA 1OX6A 2PP1A 3PWIA 4HVXA 3W07A 4CD8A 1V3JA 3URBA 4PRWA 5AY7A 2ZOXA 4IX0A 3MBFA 4JTIA 3OPSA 1KM4A 2PCEA 2E77A 3Q67A 3VGHA 2I9UA 1VIZA 5A2BA 3D3AA 4HK5A 1JGMA 4GNKB 4WGHA 3UWUA 4XD5A 1YXDA 3DIPA 4L6DA 4AQLA 2E5DA 1RD5A 4C5ZA 1WKFA 1IEXA 4AEEA 1NDZA 1K9EA 2ZZ5A 1E5NA 4I9MA 2PTDA 4NUWA 2FGZA 3QGAC 4DI8A 5FF2A 3HGOA 3REQB 1PZ2A 1UJPA 1ZPTA 3TN6A 3G6LA 2GFTA 3B8WA 4M0XA 5I3JA 3IRSA 3T0CA 1LRNA 1XC4A 2ZTKA 3LCLA 2QQ6A 1TV7A 1ALDA 1Q2RA 3P6LA 3RLUA 1XLFA 2C15A 3PPHA 4LH8A 2PU1A 2ZUVA 4AC1X 1QW7A 3TTOA 3AO0A 1Q8JA 3CM4A 1MEWA 3MWAA 4JHOA 4H9YA 1BSIA 2Y88A 3DHDA 3NQDA 4DO5A 4B5WA 1AH0A 3BMXA 5C9XA 4RDVA 4HYRA 3IUHA 2ISSA 1AW2A 3N2MA 3EWWA 1XS2A 3L9CA 1QTWA 2A3AA 2VYOA 3SI9A 1FWAC 2PDIA 3UWWA 2EPHA 4RZBA 4PMYA 2VP8A 4JX6A 4NVTA 1HG3A 3P0XA 3AS3A 4ZOEA 5AYYA 3RM4A 1TMQA 3LXAA 2I17A 1W91A 3W84A 4D6EA 3SY1A 4Q4RA 1C7SA 1F5ZA 1W9BM 3GD6A 4LB4A 1EJ7L 3CB3A 3EOLA 3H70A 3MJMA 4IM4A 2PB1A 3NO5A 3W7NA 2Z1BA 4OKDA 3KE0A 3AS0A 4N42A 3C52A 3TN4A 3THQA 3TU9A 5C54A 1JCMP 4HJWA 2DORA 4GI6A 3E2RA 3GE7A 3OBKA 2P0IA 2WVTA 1NSJA 2VFDA 3QTGA 1XYCA 5FIPA 1S2AA 3HB9A 2YCKX 1BGGA 3KUMA 4YCOA 2JBMA 1KTNA 3FNDA 4QIUA 3NGJA 1F3EA 3VU2A 1BKHA 1RD6A 2ZUSA 1EQPA 3H2CA 4LBRA 1QW9A 5I24A 3LS9A 2RUSA 1NDVA 1XLMA 3GNPA 4L80A 5C5YA 2Q8XA 4M82A 2PP0A 3ZFHA 4JN7A 5D2XA 3WQWA 1TRDA 2HVNA 4W7VA 1X98A 1OEPA 4MFEA 4A29A 3T9PA 1TTIA 1A4MA 1GQKA 5JH1A 2WJEA 2H8ZA 3F4NA 1R87A 2EEXA 2TRSA 4N6EA 2X1IA 1E9LA 4GC4A 5BXRA 1UWSA 2FIQA 3DGRA 5KETA 4AIUA 2V5LA 4HA0A 3NEVA 3BLPX 1PHWA 1FBAA 1DWGM 3QPZA 1EEXA 4M6PA 2CLIA 3SB0A 3GYCA 3WQCA 3ZR4A 1UWRA 4ZQMA 2Z4GA 1WOBA 1CDGA 2FH6A 2BY3A 1CLKA 4WY0F 5AZ1A 3KZPA 1ODZA 2FDMA 3P0WA 4JCLA 4EXBA 1K70A 2WNWA 1XYLA 5C9WA 4GIEA 1E0WA 1GJUA 4H7CA 3V18A 1KRMA 4WHBA 1DXFA 3PC0A 3KRZA 2PEVA 2JF7A 3HN3A 3UCDA 3GG8A 4NI3A 2G0WA 1GG0A 5D2YA 5F2GA 4UQEA 1YE4A 4FNQA 3IIXA 5DEZA 4XAFA 1XIGA 2QF7A 2YXGA 4YNGA 1V6UA 4XWUA 1QNVA 2PAJA 3BAJA 3KOYA 3VKKA 4DZAA 1SYTA 1BGAA 1DWHM 4GUFA 5D38A 2R82A 3PAJA 4UNIA 4UTHA 1VKFA 3N19B 4IMFA 2H6RA 4U4MA 4FXRA 3UZJA 4X3ZA 1FXQA 4QP0A 3C0SA 1U30A 2AMXA 1ZTVA 2O92A 3PFRA 3PSVA 4Q22A 4XD6A 1ZALA 4IMGA 4K37A 3OGRA 3A3HA 5E0FA 3QTPA 4H9VA 3FA3A 4ADUA 1DJYA 3UJ2A 1EXBA 1NOUA 2UZ9A 3MV01 4UTFA 3NZ1A 3FVDA 4ICCX 2JGQA 7CGTA 3KVJA 2VEMA 3MDWA 1XHGA 1W8SA 1DBTA 1GW9A 4RV8A 4YMZA 3GKAA 1GYMA 4Q8OA 1S3TC 2WNQA 5DCEA 3R4IA 2ISDA 2G95A 1B3WA 2R1LA 3B0YA 4DPPA 1Z32X 1WBHA 1IT8A 4PN2A 2AL1A 4K8GA 4LUSB 3VGDA 2BZNA 2HXTA 3MO7A 1ICQA 1W2VA 1WDSA 3GDMA 1KV8A 2JQXA 3TFXA 3ZQ9A 4M1BA 2SFPA 3VGEA 4O15A 2WZEA 3NL6A 3OGVA 3V35A 3A22A 4G6CA 4ZSTA 3EX2A 1LRTA 3LI1A 4C6QA 3LSCA 1V02E 1EFZA 3QXBA 5K2ZA 1GVQA 2PC8A 2JEQA 4JFVA 2BVYA 4JTHA 1KCXA 4DWSD 4NT0A 4JTCA 1E73M 1Q6QA 2G8ZA 2R94A 4YTTA 3VD4A 1N2VA 1GJWA 4Y90A 1E56A 3WY1A 2ZE0A 5J8LA 1A5KC 1H60A 3H23A 1R85A 3KBMA 1MUWA 3EKZA 4QG6A 4AZ5A 1SMAA 5A8GA 4AC7C 4OBRA 2E5CA 3EWYA 4UTTC 4KBXA 5BYWA 1RJQA 4JZ5A 4LNYA 5A6MA 3UZXA 1DQUA 2R6OA 2VEGA 3EWZA 4GIRA 2CITA 4RPQA 1EO7A 1DTNA 2CLEA 3LRLA 3H22A 1XQLA 4IPLA 4PUUA 3MYPA 4JHZA 3MC5A 2J47A 2B7QA 1UD3A 1REQB 5JUVA 4JGDA 4M1RA 4HYWA 4LU0A 1I0BA 1H0IA 4OE7A 3A13A 2A85A 3RUBL 7XIMA 2WMKA 3CQIA 3DOPA 3BW4A 3S1WA 1ISXA 3W7DA 3CS2A 4JCMA 4P7QA 5C7HA 3RLVA 4C7GA 3BLDA 2ZZ2A 3NGFA 3OBAA 3LRMA 1OVDA 4L61A 1SJDA 4FHAA 3G0SA 1QPOA 4JX5A 2V5KA 3UWQA 2X8RA 1IEVA 5EFDA 3K30A 1ZUAX 4MPKA 1NELA 4YU1A 2NV2A 3H2FA 3A3XA 2ACQA 4QSHA 2Q02A 4W93A 4JAWA 5I03A 2DDXA 1UD8A 3WQPA 3GC5A 3W6MA 4JIEA 3RPTA 1M01A 4G7EB 1U5VA 3W70A 3EA1A 1IGSA 4HU0A 1H7WA 4Y7EA 3MB9A 4EPKA 3RITA 2ALRA 5HDRA 4F0SA 4FOUA 1SW3A 4EPBC 3V5FA 3CWHA 1VRDA 3T0DA 3WQOA 3CV1A 5F4SA 1J0ZA 3CPGA 1K7XA 3WF2A 3CIWA 4B5NA 3V1PA 3B0VC 4TVCA 1B3YA 2HTMA 3D6NA 3TJXA 2XVKA 4WOQA 4O57A 1QPKA 2PURA 3XINA 3BLIA 4LBSA 2HV5A 1YDVA 1U1UA 1XM3A 4DJFC 3OO2A 3DX5A 2GQAA 5C8BB 5TIMA 3TUUA 2J8TA 4DM1A 1KKOA 2HS6A 2J77A 4AWEA 6ALDA 6PTDA 2H9AB 5K4XA 1Q45A 3WDRA 1HL8A 4IGSA 3KOZA 4ZGYA 2ZX6A 3MMDA 4MUZA 2QR6A 5ABFA 5LYRA 2YJQA 3ITXA 1EKOA 4DLMA 4H9ZA 4W87A 1HJVA 4UBPC 1ZL1A 4ERGA 4LW7A 4Q7IA 1XX1A 1CW2A 1VHNA 3MUAA 2WPBA 2E9BA 1TPH1 4JTAA 4UFIA 1VCFA 4D72A 5TBOA 2OKOA 3HG2A 4C6JA 3CWNA 4XIMA 4GC3A 3UFYA 1QPRA 4CNSA 4TMCA 4H4IA 3Q94A 2XINA 3W7QA 3CPUA 3KP0A 4LUYA 3C2VA 5K9CA 1GZGA 3T2OA 4PB3A 2EPNA 1R6WA 3PBYA 3FJ4A 1RP8A 1EBGA 1R86A 1HIZA 1XPYA 4HZMA 3EB2A 2Z26A 1NARA 5D03A 1ZZMA 4EK7A 2RFGA 5M3WA 1Z41A 2BGSA 3PPGA 1ENUA 2JEPA 1LQAA 2ZUWA 1EOMA 3D0CA 3GNDA 1V3HA 2UY3A 1ML1A 1P0KA 1W3JA 2JF6A 1WDQA 2FFIA 2HWGA 1E1EA 1EIBA 1R30A 2C0AA 3SRHA 2I9EA 5FACA 1LTDA 3CAQA 4MJ2A 3AWNA 4O4VA 2QF8A 3S5NA 2HCVA 4CD6A 4H8NA 1FWSA 1O12A 2Y62A 2HNHA 3V7PA 4EF8A 1XRSA 1F3TA 4CNNA 5FJUA 2QPUA 3GXNA 1PPIA 1Z69A 4NJGA 4XZIA 3E02A 2YKKA 4AMCA 2NLIA 1NIUA 1HGWA 1OFDA 4U2ZA 2VR4A 3C5QA 4F9JA 2CC0A 3YPIA 2Y5JA 3KVLA 3BJTA 3OLGA 3WLTA 2BLEA 2GJNA 1CWYA 2OJPA 2A3EA 3DKJA 1ADDA 3B9OA 2VFIA 3EEZA 3KHDA 5D8WA 1LZOA 4FLQA 3JZUA 1YIXA 2JIEA 1X6UA 3D47A 4E0CA 3K5XA 1BTCA 4BCEA 2FVLA 1HO4A 1TCMA 4AHPA 4E8CA 3KL5A 3M0LA 1JZ8A 1MSSA 4LEFA 3W7EA 5BOEA 2XIOA 5BCAA 2PWVA 5C7VA 2X7WA 1HKKA 4AYSA 4OWGA 3TROA 3VIHA 5EFFA 1KO0A 3LERA 4MWAD 4WRHA 1V02A 3RX2A 2Z25A 2CHOA 4IGNA 4Y9AA 3T07A 1XIIA 3OZYA 3PBUA 1TWIA 3SSZA 2QAFA 4O54A 3FAWA 4PMDA 3PUEA 1XINA 1VPXA 1D3HA 5EMKA 1W5QA 2J6VA 4EKJA 3P93A 3UJEA 2JKEA 1KR0A 4FX8A 1GQNA 1OFBA 4NRRA 4ZE5A 1UPPA 4BR1A 3BH4A 2NQ9A 4W89A 2C3ZA 4CCCA 1EYWA 8XIAA 2FJKA 1SZEA 3TMLA 1M1BA 4OT7A 4A6GA 2E1DA 1DJHA 2WKLA 3BV7A 3WMSA 1HFBA 1LLWA 1RCXB 3UA4A 3WX7A 4J9JA 3RN6A 5DMNA 2XN1A 4C65A 4DAIA 1TCDA 2OWCA 2ZZ3A 3G1AA 5BU9A 2DIKA 4AD4A 1G4TA 3STEA 3CHDA 3S1XA 3SUWA 3UQNA 4UTIA 3NXLA 4MMWA 1UR2A 4LAOA 5FJJA 4C6KA 4XZNX 4PODA 5AC6A 1A5MC 4L7ZA 1O66A 3QKZA 3E96A 4QCEA 3S83A 4Q8QA 1SUXA 4WQ6A 1QK2A 2ZX5A 3CL6A 3ARRA 2OYMA 4F0RA 3CZJA 8A3HA 1AZ1A 3W7CA 3B9NA 3RF9A 2QCDA 1RLCL 3HQPA 4K7YA 1P43A 1XYZA 4MM1A 1DE5A 1PCWA 1RLDA 2A3BA 3HFYA 1TTPA 3UESA 2VX7A 2DVTA 2PDJA 3HMCA 4KMQA 5HNUA 2PDYA 1BVZA 1E9ZB 3GX9A 4JFWA 1GVOA 3KRBA 4WSHA 3RR4A 1VCGA 3FXGA 4HK7A 1EHNA 4TXEA 2GUYA 3O63A 2F61A 3PANA 2PWEA 1X8CA 3N3TA 1J0JA 2OWXA 3GK0A 4J2PA 5AHFA 4DLFA 2J75A 2G3NA 3O6CA 2G41A 4LVGA 4GJ1A 4X61A 3IS4A 4TV6A 3VCNA 1XQKA 4L1XA 4H1ZA 2ANUA 3PZQA 3AIEA 1H09A 3F03K 1Y5VA 3H2NA 2X0SA 3LD5A 4Q4KA 1PHQA 2D0GA 4RE3A 1UZ4A 1RXOB 3N15A 3CWOX 3W7HA 2EG7A 3AZRA 6TAAA 4Z1YA 1CCWB 1HJWA 4X2PA 3ENLA 3C0QA 3FJLA 4P7LA 1J93A 4QAWA 4Z2LA 1YTEA 3PM6A 2PDNA 4IF2A 2XFRA 1W9XA 3HURA 3LG3A 3GVWA 1FRBA 1OFPA 5DMMA 1W2PA 2XM2A 2A6NA 3KXQA 1UR9A 4K68A 2CBVA 3DYOA 5A95A 1TPDA 5DXYA 4D9PA 5LIYX 3CV2A 3A5FA 3ITCA 2VCBA 3F2BA 4FXSA 3KS5A 2YFOA 3CQ0A 1VF8A 2ZZ1A 4QS6A 2ZZ4A 3VILA 5A94A 4YWSA 4Y9NA 1WZAA 3WQGA 3CQJA 2ATSA 2H3BA 3T08A 5EMLA 1NM9A 1XKYA 3U2EA 1AA1B 1E51A 2Y7GA 5E6YA 1POJA 2BVWA 3OW1A 3AALA 4D8AA 2R8WA 3C61A 3ID7A 5M17A 1U1HA 3NQFA 4D6HA 5G4EA 4NX5A 4DXKA 4J40A 4S1FA 2EXOA 2X40A 3W2NA 3QHOA 3QZEA 3ARQA 5G4HC 3M16A 4U5IA 2Z00A 1JPHA 2OVLA 4OOZA 4KEZA 1EJWC 3VGGA 7ODCA 3MSRA 3O8AA 4DB7A 1ISYA 4GABA 1ZP3A 1J18A 1G7UA 4N9EA 4A8NA 4JFSA 3OG3A 2NWRA 3I6TA 3GAKA 2IKGA 5DF0A 4HPJA 4DJFD 3VDAA 4LTSA 3RIKA 2PU0A 4W88A 3DC8A 3G0XA 1YTKA 1KFWA 7TIMA 2H90A 5EMUA 4V2XA 2ACRA 1FWBC 4ZO9A 2CLKA 1RCQA 3IGUA 4AXNA 1JCLA 4LCRA 1QUMA 3KAOA 3S2NA 4G2DA 2V3DA 3WELA 2BHYA 3PZMA 1W3IA 1YTDA 1EA9C 3GU1A 4J3WA 4B16A 1JYNA 2QHAA 4GQBA 4DRSA 3U7VA 1GVRA 5LGZA 1EF3A 3MUZ1 2ZUNA 4NAEB 3TCSA 5EYWA 1ICPA 3PNUA 3I68A 3ME3A 2DJLA 2VHLA 3I7SA 4S39A 3PK7A 4JN6A 1OSEA 3GC2A 2WKGA 1GQLA 3KP1A 1SJCA 1BD0A 1R5YA 4XZMX 4RKAA 4GVFA 1KRBC 4TUFA 3INPA 5AFDA 4PUMA 4Y6GA 3BURA 3EKGA 1TE1A 1W5MA 4Q8WA 3SQSA 3NZRA 3VXGA 5CQ1A 3L5AA 2AAMA 4HMNA 4O1DA 2OYLA 2EPKX 2QVNA 4I8DA 3IACA 1OX4A 2ESCA 2DV0A 4JNMA 1Q2SA 3WBWA 3PUOA 3QV6A 3KVMA 1XCFA 1EYEA 3A4WA 3ONCA 3N9SA 1ICSA 1JJKA 3FXYA 1KBLA 4XKYB 4YWIA 3REQA 1E3XA 1IWPA 4QJ4B 2IS7A 3PTMA 4LVFA 4UUIA 4N4QA 4JY8A 4IP7A 3G6MA 1EA0A 1W1ZA 3VNKA 1FCBA 1UIPA 1XF0A 1AQFA 1Z44A 1WPCA 3OTRA 2I7GA 4UZUA 2P8CA 5D09A 1ZRQA 1XLBA 3U5YA 5D9NA 2PBOA 4OTKA 1LG1A 1W8GA 4QFUA 4E38A 1S5TA 1MQRA 3F4DA 3SIMA 2GVGA 2GDVA 4GZIA 2YDQA 2V69A 3GKFA 3GY1A 2FYMA 4AYGA 4LS0A 3AWOA 4I9JA 1ODUA 5HR6A 1QU4A 3WBXA 1JUEA 1TV4A 4FO4A 3GB6A 4PA8A 2OKTA 3PAOA 3VIGA 1UA3A 3NSNA 1SJBA 3B05A 2O9TA 4YHGA 1VJIA 1CB2A 3KCJA 3UYIA 3DFOA 3ABZA 5IHRA 2XN0A 3K8MA 4GVGA 4UZSA 4UCFA 1X6LA 1I2NA 1KXTA 4ZTYA 1C3FA 4YTQA 3ES8A 1RQHA 2Z1WA 2Y8UA 1PTGA 4Q8PA 4UQ9A 3WLHA 3BICA 2INFA 1VLIA 3TYDA 5D2TA 1TQXA 3NZGA 3F4WA 3CHCA 1RJPA 5CXPA 2Z2UA 3EWXA 2PS2A 1O5KA 3BV4A 1TFVA 2PTYA 3QEZA 2IQ0A 4RNFA 5GNXA 3FDKA 3H24A 3GXDA 4FNPA 2DEPA 3CHVA 4GKTA 3IIZA 4AISA 2A7RA 4W4QA 2QCLA 5CSSA 1PZ1A 4RNJA 1DOSA 4BF9A 4WGXA 4JTGA 4X2RA 3G8RA 3SN4A 4ICMA 1D7KA 4JD4A 1BG4A 5HBFA 2WZMA 5A69A 3QV7A 2GGGA 1BXCA 2GUBA 3AXMA 3W88A 3QHMA 2I57A 5AC5A 3W72A 1YNQA 1F73A 3WNKA 2XUCA 3JR2A 1EC7A 3GLCA 1BPLB 5HR7A 3T1GA 4C1LA 4FS9A 4UR7A 5I0DA 1B0IA 3AIRA 1XCWA 1XLGA 4HOZA 3M7SA 2WSPA 1UC5A 3UJRA 2GVYA 3I65A 2P3EA 3IJDA 3PWAA 4XBSA 3VM5A 4CQDA 1UWTA 4S3KA 3IVTA 4JKLA 3WLMA 1PX8A 3FVMA 4HTBA 3R89A 1EP1A 2A4AA 1DQXA 1F4AA 4L6OA 1CTNA 3HQOA 3HV9A 2XVLA 4PCPA 1E3ZA 5DFAA 3P8IA 1QOPA 4WLCA 2OZ8A 1IYXA 3FGCA 1HKVA 4XAPA 3M0YA 3H2OA 1Q6GA 1AW1A 3U57A 5AN7A 3W82A 4I6KA 1JR1A 1XSIA 3UG3A 1QATA 4RXGA 5I3KA 3GXIA 2X1UA 3CAKA 4YVPA 3FKKA 3NR0A 4JXCA 1JAEA 2EO7A 4UFHA 2V2CA 4KEVA 2DSUA 1K77A 2Z2BA 3P2VA 3RMJA 3FKRA 3IGXA 3KZSA 2B31A 4DBUA 2J7FA 1XBYA 3ANUA 2YFNA 3UZZA 2GQ8A 4JTKA 5I00A 5GJPA 3CASA 3EXRA 3KOWA 4XSMA 1J0KA 1CXIA 1OFEA 3UG5A 3CUGA 1XXXA 5LZLA 1KWGA 1GONA 4J2MA 4DBEA 2D73A 4DNMA 1V8EA 2VX4A 2ZXAA 1XIHA 2PWDA 3ANVA 1XICA 3SQMA 4H9XA 3WL0A 1BEUA 3CT2A 1A5CA 2PFHA 4WX2A 3CO8A 1SO4A 1OG0A 2XHYA 1IZJA 4OV9A 4RCXA 4ZBCA 4MSSA 3ARSA 3U0HA 2PDUA 5EY5A 3A24A 4LUSA 1TKKA 1E0UA 1PWMA 3M5VA 1OY0A 1JGIA 3SUVA 3ZVIA 1JZ7A 1UWUA 2E7FA 3ARWA 2J78A 2V5BA 1VFHA 1L6WA 4HHMA 3GR4A 2TYSA 3WLNA 2BXYA 3P61A 4AF0A 2PDMA 4AB4A 3NZPA 4ZXOA 1GVYA 1W3TA 2E4TA 1K7EA 1KW1A 2WQPA 1IZKA 2X2YA 1OINA 4WJXA 1QXLA 3C8FA 3CTTA 1MEHA 3T05A 3QMRA 3ZOAA 3S9IA 3OG2A 1DJGA 1TJRA 1BTMA 4GZ7A 3G1HA 2YPIA 2C7FA 3SSJA 1ONRA 3WFAA 2BXVA 2YIHA 4XTIA 4JQ4A 2FZBA 2FZ9A 5M5DA 2C1HA 4RE2A 1ITXA 2WO5A 3LQGA 3TSDA 3U8GA 4IIBA 5CPLA 5G2HA 4HN8A 1B30A 3T44A 1WE5A 1YMYA 2A6LA 5FF7A 2J4GA 1LOLA 4ADSA 2W91A 1HJUA 2PWFA 5CPQA 1QASA 2X09A 1REQA 2GGJA 4AAJA 2G3MA 5AHLA 2CLHA 1DPMA 2PLJA 3E0LA 4ZB5A 1OFAA 3L23A 5LHEA 4O1CA 2RGLA 5ABGA 3AHTA 3VZXA 1V0LA 2CLOA 3TX9A 1HKJA 3SCWA 2P50A 3I4KA 4GD0A 4ACZB 2Z6IA 1CIUA 2ZRYA 2O7SA 3PF3A 2W4XA 3QY8A 1N8FA 1Q6LA 4JL1A 1I75A 4GJIA 1OT1A 5CKSA 1RZMA 4EVZA 4QE4A 2BHUA 3AXIA 2IQTA 3VFLA 3C0LA 1TPB1 2REQA 3FYOA 1PE1A 1MZRA 1QR7A 2Z6JA 3IV3A 1UB3A 2ZWYA 5AVHA 3OP2A 1G67A 3W00A 1SFJA 3PTDA 1FCVA 3GIQA 4RK8A 2QAPA 3BSGA 4JNYA 1R3YA 3BAXA 4G7EA 5U7SA 2IW0A 3LLDA 1KRAC 1SSDA 1Q4WA 3UR5A 1ZAIA 3ZT7A 1GPWA 1V03A 1NWTA 4AH7A 1H7RA 4RNHA 2ZRVA 2YCIX 3NM3A 2UWFA 1XIJA 1JZ6A 4E3TA 4AZCB 3C86A 2PUZA 3C2YA 2BODX 1HQTA 4AIBA 1MW3A 1IXQA 3GRIA 3FOKA 4Q8VA 3SO7A 4GUJA 1A5UA 1FDZA 2V9DA 4ML9A 4XVEA 1E72M 5T8GA 3GU2A 1L6SA 1VFMA 1KTCA 4PRRA 5IDIA 2FGBA 2WCSA 4LEQA 2GVEA 2Y2WA 1NAL1 2CHNA 1GHRA 4PL2A 2XFWA 1H7PA 2Z27A 4DI9A 4RXFA 7A3HA 2PMQA 2GLKA 1G01A 2OB3A 3DKLA 2VQTA 5FEWA 2CKRA 3W71A 4IX2A 3WJYA 3HG3A 1IGWA 3GR8A 5A8NA 1EH9A 3P5ZA 2BS9A 3W7PA 1ZBCA 5FF0A 2WZHA 3HGJA 4BI5A 1PX3A 3P8JA 2NQLA 1Z7AA 1JYWA 2NQ5A 1TJ0A 4B2DD 4LB3A 3BOLA 2ALDA 3VAVA 1M7XA 4AG0A 3UP8A 2J7CA 1TV8A 4TO8A 1TPFA 1GORA 4AZ6A 3PBGA 4GA8A 5J5DA 4F4RA 2A0NA 2ONEA 3LOTA 4S3GA 1EC8A 3GDBA 3TW6A 4PMQA 1LQ2A 1QNQA 2MUCA 3AAMA 1PIGA 4PULA 3VMOA 2E67A 1TUFA 1ZCOA 4LYKA 2C14A 3GIYA 2J62A 2E68A 5CJNA 2Q3RA 1CT5A 4C6MA 2O55A 4DVOA 2OZ3A 3DI1A 3U4AA 1YPXA 4JYEA 5IRPA 1ZJHA 3WF1A 4HNLA 4QJ1A 3CAWA 1VQTA 4IMDA 4IPNB 2OSYA 3S46A 1HO1A 1D9EA 4MB5A 4A8RA 3M43A 1A50A 3M1ZA 4W9TA 3D46A 4WXZA 4ML4A 4J3ZA 4Q4QA 1EZWA 1WZMA 2E0PA 3WFZA 3SCRA 3TC7A 1RK5A 1A0DA 4ZL1A 4KWWA 4KCVA 3BVJA 3ZJ8A 1XL9A 1WBJA 3QBUA 5FJTA 2HE5A 4S3CA 3SW6A 4CKQA 3F4CA 5DY3A 4FR1A 4O1FA 1V6TA 2OGJA 1WX0A 1FVPA 1XIDA 3NO1A 3WDIA 3QW4B 2GYIA 1EUAA 4HHPA 1CGYA 1T99A 3SY5A 1J9YA 1KBBA 4DXVA 3OZMA 2A3LA 2ATMA 2PTXA 3WJSA 5CPNA 1A5NC 1O95A 1KFJA 4E2DA 7ENLA 1UPMB 2ZIDA 1CXHA 3IANA 1GW1A 3FN9A 2WCAA 5KEZA 4UTJA 3JZEA 3EWDA 2FDSA 3QR3A 3K2GA 3N18A 3SFWA 3B0XA 1PDZA 2WJZA 2BV9A 2PTWA 3POCA 3M46A 1TMHA 1LG2A 2QJGA 2XJ7A 2X0HA 2HROA 1GKRA 1XRFA 3SRFA 2D20A 4YLWA 4JYDA 1TE6A 1L9WA 2OU4A 2ZVRA 1FWHC 4P61A 1UZDA 4AUBA 3NQ6A 4H9TA 3MHGA 2QLYA 4PYSA 3ITYA 1FHLA 1UMLA 1UR0A 4OJYA 1VBUA 2RJGA 2OFJA 2PRHA 3VKAA 2QCCA 6TIMA 5CC3A 1W1IE 3AIQA 3DFSA 2NVAA 3FHQA 1XISA 5LNRA 4HZ7A 1H7NA 1FHUA 3LUTA 3TSMA 4FB7A 4QG9A 3FK4A 4GUGA 2DPEA 4HMEA 4S3EA 5C6MA 1KA9F 3LGDA 4YTRA 1MO0A 3KBSA 4B5TA 4XX6A 3S1GA 4AEFA 2FHFA 1J2BA 4F40A 1G5AA 5GJMA 3ARTA 4RW5A 3BL3A 3C3NA 4IT1A 4R7OA 1EIXA 4Z2JA 4MKSA 3E0IA 4HN4A 1U2YA 2C6QA 3VTRA 4B3LA 4P5UA 4XD4A 4GI9A 3QV9A 4HNUA 1JDAA 2ZA1A 3MP4A 1PTAA 1XIEA 3B8DA 1LWIA 3CV6A 1E9YB 3S2JA 3ABRA 2GJLA 5G1TA 4EAMA 3QYSA 3S0CA 1JRBA 4IHCA 1ZHAA 5LHFA 1TQJA 1KKRA 1W9PA 3V4BA 3S5YA 1XYAA 3EBVA 4IJRA 1O5XA 3AICA 4QXIA 1CGXA 1OYBA 2I5GA 3JU2A 3WQFA 5CZSA 3R58A 4V33A 3QY7A 5HK4A 2FFCA 4HU4A 5LXEA 2GDUA 4JFUA 4MB3A 3WD0A 3BLEA 1TX0A 1RH9A 1F6PA 3FYPA 4L9XA 4EWJA 4UMCA 4IOTA 1EL3A 2B81A 1VZWA 2WPGA 2DZXA 1WA3A 3P67A 2EBNA 1DL3A 4UTWA 5FA5A 1UIOA 2FTYA 3T2PA 4XZWA 3SCPA 5BXPA 4IH3A 2OT1A 3B8TA 3CTLA 3G1SA 5C2XA 1FWTA 1DKWA 3VNMA 3PJWA 4S3JA 1XCXA 1PIIA 4X0VA 4ZO8A 2G37A 3AIUA 2WWCA 2HEJA 1XSKA 1KR1A 2QUNA 2PSNA 4HU3A 1UBSA 1NQKA 3H21A 1FH9A 1AD4A 4W5ZA 1H5YA 3LU2A 4K3ZA 1JDCA 1BF6A 1Q66A 4GVHA 2OODA 4TQTA 5I3DA 4HNTA 1X1NA 3LK6A 1EC9A 4GYPA 4D6DA 3M07A 4DO7A 1F3XA 2NVDA 3CIXA 1ZGDA 4GX8A 1WQ5A 5IXEA 4MY1A 5BNKA 4V1YA 1LQ0A 5EU9A 3TTEA 4NIRA 4GY1A 5FF4A 3NM1A 4B5UA 4IIGA 2AGKA 4V28A 3TCEA 3LY0A 1GKPA 2V8ZA 1JUKA 2E25A 2XYLA 1E6RA 4LWWA 1MNSA 2GWNA 3N4FA 1ZSXA 3USBA 4GLEA 1R7OA 4NXSA 3IGHX 5BOOA 1F6YA 1ISZA 2X7VA 3SGUA 5A3HA 3FJNA 3LYEA 4QLKA 2DFAA 2OEKA 2Y8VA 1U5JA 4J3VA 5KMYA 4NYUA 3RRAA 2JK2A 5CZKA 3AXXA 2HBVA 3CC1A 1FWCC 2VNCA 4NZJA 3PJXA 1TJ1A 4JYFA 4I7VA 1OM0A 3W1LA 3RO8A 1M65A 3AHXA 1JF6A 3RG6A 4MF4A 1W9VA 4YTUA 3W22A 1P0NA 3HMJG 4NJKA 2VX6A 1NFBA 1ISWA 3T81A 4GZEA 2AQVA 3A12A 2UBPC 3NNTA 1UQZA 2CHRA 4KWUA 1RCOB 5FEPA 2R1PA 1TV5A 3MUY1 1QNSA 4E2VA 1JI2A 1SZRA 2VZTA 3AXHA 1WKYA 4DZ5A 3CU2A 5HOSA 1RQBA 1VFSA 4LRTA 1LORA 2CEQA 3UGVA 1H1NA 4H6RA 3MDUA 1HGYA 2W62A 1GOKA 4O8RA 1T0OA 3VNIA 1JPKA 3BOFA 3CGTA 1BG9A 3GDTA 3W7JA 1X96A 3LDVA 3B3DA 4QE5A 1B54A 4X9YA 3OA3A 3JVAA 3SEPA 2YB1A 3GC4A 1E0TA 3G8EA 1PCKA 1Q7ZA 2FKPA 3ARZA 3O07A 3UCCA 2VFHA 5HJYA 4NYYA 3QOMA 1FDJA 5FKYA 5GVJA 3UW6A 2BXZA 2QNEA 2Q6ZA 3OBEA 3DGBA 4CQ8A 3NPWA 1C9WA 5FAGA 5AYBA 4BS0A 2VGGA 3RCMA 4ZE4A 4M19A 4PFMA 1KTBA 1GG1A 2BX7A 2Z24A 1HKWA 4P8WA 3ABOA 1H62A 3HF3A 3LLFA 3W7LA 1OIFA 3WF3A 4LV9A 5CAHA 1VP5A 1OCJA 1KFKA 3P74A 1XUUA 3NQVA 3ZLHA 1JD7A 3VKBA 1Z6KA 4IL0A 2PWUA 1G1YA 1ITUA 3B03A 2VX5A 3LM7A 2NUYA 2ISWA 3GQYA 1OBAA 3EDDA 1WAWA 4IISA 5CJ5A 3MHFA 2VGFA 5CH9A 3SJNA 3EYPA 3UG4A 2W79A 4KW2A 4CVWA 1DYSA 3QF0A 3W7IA 4NZCA 3WK3A 4JDYA 4C5YA 3H7UA 4NZFA 5ABHA 1GVIA 3APGA 3WMCA 1W5NA 3ZVHA 1PO9A 1IR2A 4WK9A 4US5A 1X38A 1FX6A 3WDPP 4NAEA 4H83A 1V3LA 2E8YA 3K1DA 2PGFA 3RAOA 1VFOA 2YR1A 3PUDA 1MUCA 1LDCA 3M0JA 3D5HA 1YDNA 1KGXA 3HGRA 3OZPA 1Q8AA 4ORIA 1P1MA 5CBBA 1AL8A 1YBQB 2CCRA 2ZX9A 3GNOA 3BTNA 3FDGA 4EF9A 4C7DA 5EKYA 3EB4A 4OV4A 6XIMA 1TMLA 4LS2A 4CGTA 2OR2A 2IPJA 4IJCA 3MMTA 1FWDC 4G8TA 1BWVA 3ZR5A 4IQEA 4U33A 5AYZA 2VGBA 3MJYA 3L68A 3HBLA 3PB2A 3RMEA 3PPCA 1TO3A 1R0MA 1UWIA 4DNHA 3CJPA 2HSAA 4AD1A 3NQMA 4XKYA 4ZOBA 1PSCA 1HJXA 1TZ9A 1ZJBA 5H91A 2LLEA 3B9DA 1KXHA 4CD4A 4KQNA 3L4ZA 1P0DA 5K4ZA 4HIBA 4X60A 3TJLA 3U48A 3KBVA 3DG6A 1TPEA 1KGUA 4F8XA 3UGRA 2YL5A 3UNTA 5KZMA 4W8AA 1OX5A 4HOXA 3GDKA 4N7QA 4UWMA 3VI2A 1LOQA 2WJFA 1K7FA 3VX1A 3VD9A 1W1B1 3E12A 1MW0A 4OFCA 1VFTA 4WKAA 3W2KA 1VD6A 1JNDA 4XO7A 2VR2A 1THFD 2NVCA 3HPSA 1X7IA 2VEPA 1EGVA 1RAKA 4NY2A 1L2QA 3W1XA 1UP3A 1OGSA 4JQAA 1O60A 3H12A 3F4VA 3PSWA 1QI2A 2DUAA 2G5WA 3C56A 2Y63A 1XIFA 1JG9A 2RDTA 4F2UA 3PVFA 5PTDA 1CGWA 3P14A 4WDWA 2RAGA 1EJVC 2DZSA 2XIBA 4XZLX 2O0TA 2J9YA 4GQGA 4Z2KA 5LA2A 1W5PA 3TYZA 1F7BA 2Z1VA 3JUGA 1RA5A 4KWVA 1TA3B 3ZJ7A 5E6ZA 3M5XA 1M6JA 3PP7A 1AODA 2WM0A 3STFA 1KCLA 1TTQA 3FV9A 3SCVA 3CUZA 1JQVA 2V3GA 2D1ZA 8CGTA 2CWXA 4ZB0A 4KT2A 3AU2A 4D8ZA 2ZUUA 5CBIA 5JBFA 2O56A 2VZVA 2HNEA 3ALFA 5HMEA 4CQCA 5M03A 3KX6A 1BXNA 3WLOA 1JIBA 3GXFA 3A47A 1GOXA 5HANA 2ZXBA 1GQJA 3WZ0E 3DFNA 4DJEA 3EPNA 2TAAA 1GVEA 3L7RA 1VBHA 1E43A 3L2LA 4C6EA 3ZM8A 3MMWA 3AISA 2QCNA 1AL7A 4UIOA 4HOWA 3VMNA 5A2AA 2FJUB 4CNTA 5LSMA 3I7QA 4MGGA 4C6BA 1YNYA 3L5LA 5K9XA 4W85A 4DZIA 4H6QA 4LUIA 2FPYA 3VYLA 2NXHA 3M0HA 2PWHA 4IMAA 3T8LA 3N3MA 1NJJA 1NP0A 4HPNA 2WMJA 3HJEA 4F79A 4FNRA 4QHRA 3CUFA 8RUCA 1KM3A 4JPGA 4P7NA 4J27A 1XSJA 2FLIA 2CZFA 3GBEA 3IUIA 3TR2A 4RE4A 1TELA 2AQWA 1TIWA 2GL5A 1R47A 1LYXA 1DHKA 2ZQ0A 4U28A 2VEIA 1I4NA 5FI8A 1B3ZA 2QULA 2GJXB 4TTUA 1CB7B 1WKDA 3GVVA 1FHDA 3MV11 3UR2A 1LBLA 1NDWA 1E4NA 3I3DA 3WFLA 2PDXA 1JXJA 1E0VA 4AEOA 1XC6A 2E3ZA 4MG4A 4GH3A 3DFTA 2F6XA 1V6YA 5DRIA 3UYCA 4FOJA 2P5NA 3EXSA 3PS7A 4I9TA 4Q7NA 5FEZA 4ROPA 1A0EA 4D6IA 5T91A 3UWEA 4O13A 4TX6A 2G3JA 1DJQA 2PDLA 1OIMA 1PZ3A 4FLOA 3WMLA 1RVKA 3M0MA 3ES7A 2IQDA 3MVTA 2ZCGA 5CEWA 1DJXA 1EDTA 1CXEA 1BWLA 3UJSA 4RJEA 4X22A 3ARYA 1VYRA 3W24A 5HJLA 1F8IA 3E6EA 3LHZA 5MF5A 3M5ZA 3LPPA 2D24A 1AQHA 4LGXA 1U1JA 4BY3A 2VZUA 1AH3A 4DF1A 1GJPA 4K1GA 2CBIA 1PKNA 4IPIA 1NQ6A 4KPLA 4WIWA 1YLVA 4V27A 4IGMA 3KWSA 4KIRA 3MP3A 3IAQA 3AMDA 2PLMA 1Q85A 5GPRA 2POTA 2Z7KA 1RBAA 4MJMA 2E6FA 4FXFA 2VI0A 2WHLA 2R91A 3EMQA 3QR0A 4C6PA 5MHBA 2E9MA 3SFKA 5HINA 2E8ZA 3VUSA 1JUBA 3ARPA 4N4PA 1C8QA 1MW2A 3NXFA 1K6WA 4DBSA 1UKQA 4KF1A 4FNTA 4UTLA 2EHHA 3K4AA 4L9YA 4NI8A 4QQUA 2D69A 1WXZA 4HPHA 2GWGA 1SU5A 1CZ1A 3N29A 2D3LA 3CUXA 4JNZA 3UWVA 2DT2A 5AHMA 4P2VA 4XO6A 3AI0A 1MXSA 2DGAA 1WOAA 1TVPA 3EWUA 5DMLA 2ON3A 4B5SA 3OVPA 3DFQA 3MUIA 1XGZA 1R3VA 2A3HA 3W1NA 4ZOAA 1OX4B 5D8ZA 1QO2A 3BZGA 3AJXA 2WAGA 1JCJA 4H6EA 3LA4A 3VGFA 1BAGA 4PMNA 3L4WA 5F4XA 4UTWC 4QGCA 3N1AA 4GHRA 3IJIA 1DE6A 1RPXA 1TG7A 3F2DA 3NL5A 2UY5A 3FW6A 2QGYA 4MZ1A 2PE4A 1XRVA 2ZADA 2NZLA 2QKFA 5D9OA 3RX3A 1NFPA 1XLLA 4Q32A 3HPFA 3FA5A 4GUIA 2PGEA 3W1MA 1VEPA 5FEXA 1F74A 3WNLA 3MWCA 1V51A 1A3WA 1ECEA 3OZOA 1ZQ5A 3SGGA 4GYPC 4M80A 2B0MA 4D71A 3OGSA 4JQ1A 3BJSA 1XDJA 3DHPA 3KTCA 1V0MA 1VBGA 4X0NA 3RYSA 3ARXA 5A8MA 3M0VA 1U33A 3OLEA 2VCCA 5CJMA 4ZA0A 3F5KA 2Y89A 3S3GA 3ONBA 3TMQA 5HWMA 3UETA 1FCUA 4ACZA 4PGLA 2ZC1A 1M68A 1GQIA 2QDGA 3POHA 1R3WA 1KXVA 3V75A 1LJYA 3ECQA 1JXKA 2DSVA 3TW9A 1PIFA 3ZR6A 4EE9A 3U2ZA 2QUVA 3GNNA 6A3HA 3B97A 3DFPA 2QCFA 1AQ0A 1VAHA 3R0UA 3SCTA 3ZLGA 5LNUA 3WNNA 3WLQA 2QEZA 3LB0A 3W76A 3S6DA 2Y0FA 1HP4A 4J3TA 5FSEC 3VPLA 2JKAA 1RBOB 4Q8UA 4PTNA 2V0TA 2VURA 1YXYA 5MKGB 5D04C 1S46A 3QH2A 1K8YA 1E6SM 4R7WA 1H61A 3E38A 4L4LA 3LZ5A 2DQWA 3AUOA 3K4WA 4J1OA 1PYFA 2ZXDA 5CAKA 2VRKA 5LGXA 3H8AA 3HPAA 3EXTA 3NPVA 2W6RA 2C71A 3SAZA 4IWWA 4AZCA 5J04A 1AH4A 1VPYA 3GNXA 4P8UA 4G9PA 2JE8A 3ITOA 2PI6A 2YW4A 3USZA 4OUEA 5AC8A 2PDWA 1H7OA 2PRLA 5I5RA 3CNYA 1EJSC 4GNJA 3UPMA 2QCMA 1NFGA 5FD0A 3PZGA 3NQ8A 3N2XA 2OO0A 3S5OA 3M4HA 2IMRA 1W1PA 3WD3A 1EF2A 1XLKA 2ODOA 5HUPA 1P5BA 2DT1A 3GAYA 2C0HA 3KOXA 4JR5A 2ZZ6A 3RFAA 3STGA 2XIIA 2Y5SA 3B9EA 1E6PA 4UOJA 2QCGA 3SUSA 1VFUA 3W26A 3G5EA 3VIPA 2QDHA 1LT7A 3CYJA 3HO8A 3TYEA 2VZSA 3PB0A 3GHRA 1UUQA 1HL2A 1X6NA 3TYAA 3CLMA 1G9HA 3ABQA 2EAWA 5C9RA 3B8SA 5EMMA 5G2IA 2GJPA 3DZ1A 2PDHA 3T09A 5M2FX 1WDWA 2PDFA 3EWBX 1J5SA 4FF5A 4DWSA 3E5BA 2VZOA 1HVXA 4N9BA 1LUCB 1LCOA 4KERA 2XFFA 3FGCB 2WB5A 4HA4A 2HDJA 2J6XA 4R53A 4BK9A 1T5AA 2WVVB 4JTJA 3NYDA 1PV8A 1K3UA 4PTWA 5CZ0A 1IWAA 2F2KA 4N2YA 2HISA 3UZYA 4J28A 1CGVA 1S5NA 3PTKA 1UWAA 3B06A 4DX3A 1E15A 2X2GA 4PCTA 2QXWA 4A05A 4V1XA 2PDBA 4DHGA 2OWWA 3IUDA 3TYUA 2FPVA 4QEHA 2NX9A 3TR9A 1GVFA 2QYGA 1YYAA 4WEVX 2DQXA 1KM1A 1MWOA 2DUZA 2XISA 4AHOA 3BMWA 3C2EA 1J6OA 2Y24A 4G1KA 4DUVA 2XSAA 2JALA 4O18A 2PTZA 4A3HA 3TKFA 3O15A 4LVAA 5G1MA 3RM9A 2WSQA 1QI4A 3VOFA 1N82A 5FSDC 4HQVA 3P62A 4IICA 2HK1A 4GI4A 1JQXA 1J79A 4AZBA 3PZVA 3AU6A 2BOEX 3NO3A 1GZJA 5D9MA 3HPXA 3RX4A 3LMZA 3KRSA 1ZBVA 1CGTA 4ZXLA 4KFPA 1V3IA 3MSYA 2O4MA 1C7TA 4CNPA 4Y8EA 1DJWA 5HNTA 1E1FA 3QQ1A 1FDYA 4ICNA 4NP7A 2GZXA 3K46A 1CLVA 2W5FA 5E0KA 2Q71A 3TQKA 1V4YA 3VNDA 4QNWA 3N9RA 1E4MM 4IFKB 4XBJA 4IG2B 3W01A 3BC9A 1PDYA 1C8XA 4Q3MA 4AF0B 3EA2A 2NX3A 3PZOA 2YL8A 3GXPA 3PPFA 4R34A 1E0XA 1YXCA 1E6ZA 4BEUA 1W3NA 4BKNA 2YCJA 3UA3A 1UR4A 1ESWA 5D05A 4ZEPA 3H54A 3STPA 4O0QA 4L4OA 3ZMRA 5B80A 2NT0A 1ME9A 2CZDA 3GO2A 3LXCA 3TFCA 3I6EA 2OT0A 2WANA 4DUXA 3DHUA 2WV8A 3SN1A 3UBPC 4P7RA 3VNYA 4QEEA 4QAIA 1IXOA 3UT0A 3EX3A 4GYFA 3WLJA 3RU8X 3QC0A 3KBWA 5EB8A 3LLXA 3WD4A 4MIMA 3F5JA 4AY8A 2J7BA 1CNVA 4L4MA 3UY8A 2QUUA 5E9XA 3TK7A 5CGQA 4NZ4A 1J01A 2E40A 3BLKA 1I9CB 5BWFA 3FAXA 4IJBA 3LENA 4JIPA 1XLIA 1OYCA 1EP2A 1FWRA 2A5HA 1LL6A 1VR6A 3VOGA 3BCDA 3NTYA 1OCQA 4HYVA 3WL1A 2W92A 3IVSA 4WKHA 2WBGA 4X63A 5BXSA 1W1TA 1TVNA 3PZTA 2P76A 3QZAA 1BXBA 1SW0A 3WEMA 1XDLA 2WWDA 4MY8A 1UKOA 4LCSA 3CYVA 3HIJA 4JIQA 4ILSA 4R88A 3F7JA 3O3RA 4JTLA 2REQB 1WZLA 4B4FA 4ZODA 1ZB5A 4PBEA 3T4CA 2VGIA 4DJEC 3RILA 6CGTA 1OQFA 1BYBA 4FLSA 2WHKA 2DW7A 4CQ9A 3WYZA 3PZ9A 6XIAA 2FPTA 2OTDA 3T40A 5AOUA 1WXYA 3QZ6A 4WDXA 1OHLA 2DZPA 2GGHA 2GUUA 2BGQA 1TPUA 1RY0A 4DM2A 4DEFA 4QROA 2G4FA 1EB3A 4NKCA 3KS6A 1WDPA 3H6OA 3DG3A 3EMZA 4GI8A 2VC9A 3SGZA 4DXXA 3L4TA 2FQIA 1ITCA 1OWQA 4YXGA 3TP4A 4Q8TA 7REQA 4CU6A 4IMCA 3MI3A 3B9AA 2W27A 2PGRA 4TVDA 2B7OA 1VC4A 3V0TA 1C91A 4D6JA 1RK6A 1LRQA 3E2QA 2BBFA 1LL4A 3O06A 3RPMA 2VELA 2HZGA 3MVIA 4IIFA 3WO8A 5I23A 3WMBA 3VIJA 4YVXA 1ZLPA 2EG8A 4QNEA 1GOMA 3UPBA 1MFUA 1C29A 1E6XM 3UD6A 2WBKA 2IPFA 3V3WA 1UP0A 2QV4A 1M3UA 1YEYA 2DSKA 4Q4PA 4IMEA 1KRCC 3TQPA 3OA5A 5HMSA 2PA6A 1OCNA 3LNMA 2ISFA 4EP8C 4UFMA 1O68A 3DBNA 4PSRA 5E1QA 1XGDA 2V82A 3TH6A 3IJ6A 1NP2A 1QK0A 3HOJA 4Z2HA 1X1ZA 4MWAA 4ATLA 1DJZA 3QSTA 4KCWA 2XGZA 1JPIA 3MI2A 3OJGA 1HL9A 1EXPA 3S6OA 3LSBA 1RP9A 3C3UA 4INFA 9XIAA 3MTWA 1S3HA 3AIWA 1XWYA 2J7GA 5ABTA 3MKVA 1ZNNA 2GPTA 4FIRA 2OXNA 3IV8A 3VDHA 2FMNA 4RW3A 2XWEA 2FMOA 4AWUA 4EANA 3M5YA 3HG4A 3E9AA 4JTFA 4DBWA 4WDTA 4M81A 4Q4SA 2XVGA 1VEOA 1GOOA 2VVNA 1EWEA 3E3HA 1HTIA 4IQJA 4XB3A 3R25A 4O50A 2CLPA 4M6VA 4XV0A 3SRDA 4PFHA 3ZXWA 3N2TA 2ZYFA 2QW5A 4ZENA 2C79A 4NG3A 3CEUA 5FL1A 3NYZA 1JCYA 3BGJA 3WLIA 3W28A 3JW7A 2NWSA 5CZJA 1F4HA 2Y6ZA 3C8NA 1SO6A 3GFZA 3QSRA 5DN1A 3MUCA 1YRRA 1WKEA 3C2FA 2EQDA 2WZIA 1ZBKA 3UEQA 1VENA 4GX9A 2WMIA 3W25A 2EPOA 5E5CA 4GBUA 2DZTA 3T78A 3VD7A 4Z0JA 1V79A 3H7RA 3V1HA 2I14A 5CGMA 3UXAA 2MANA 2OCZA 2Y1HA 3AJ7A 1XLAA 2V2DA 1Q63A 1O6IA 1UQYA 3GVGA 2NUWA 3VD5A 4ASTA 4GFSA 2QPSA 3Q2DA 2V2HA 3UXLA 2HS8A 4HSOA 2VCAA 2NSOA 1VFLA 3KM8A 2Q01A 1JRCA 2Y7EA 3XIMA 5G2WA 1M41A 5REQB 5IDZA 3NDYA 1W3KA 2Y4SA 4R7JA 4J35A 2VRJA 1N8WA 2BNJA 2TSYA 1XH1A 1ZU8A 2HRWA 4UCGA 4A35A 1AUSL 2DW6A 2GDQA 2QDDA 4JTQA 3RNDA 1P0BA 5A6BD 4JTTA 3RM8A 1DTUA 3WD2A 2Z1KA 5A6KA 5DX7A 3GH4A 1FWNA 4K2SA 1P7TA 1TPVA 3RJYA 2XN2A 1VB9A 2OMAA 4EACA 2J24A 3H55A 1YBQA 3QPYA 1S39A 2EJ1A 3QFWA 5FJIA 5A6AA 4W86A 3TJIA 2YW3A 4RE0A 3BAKA 4FSAA 5A2CA 4PUNA 5EGRA 2DZVA 2NQZA 1UC4A 3VNLA 3WDQA 1ZCCA 2NT1A 3TNBA 1VJSA 1W54A 3U7BA 3APTA 1FTXA 4ZO7A 4K6AA 4DO6A 1TWSA 5AHNA 4US5D 2KAUC 5E09A 2WZTA 4IZGA 3PJTA 2GJRA 4FAMA 1O7AA 3GG1A 3MS8A 1HVQA 2ACSA 1PJ9A 3NUKA 2P88A 5HA7A 4REQB 2AKMA 1BFNA 2E6AA 4A2RA 2DU2A 3M64A 1FFRA 4GXWA 2DIJA 3FS2A 1UR3M 3TC6A 1SZNA 3NOYA 4XTDA 4GZJA 1PWLA 1MXDA 3WQVA 3W4RA 2CZ5A 2VD9A 3WQ6A 1E1CA 4RNIA 1OK4A 1QWGA 4TVUA 3VM7A 4O11A 3Q65A 5CG7A 3C4UA 3AS2A 5LIKX 3GIPA 1XIMA 1V6XA 2I5IA 2QIWA 4R9XA 3S8HA 3ZJKA 4MLJA 1KCZA 4KGJA 2XZ9A 1P48A 3PWGA 3OU8A 4XG1A 1G4PA 5KZ6A 2YA0A 1KBJA 1SSGA 3R11A 4FNUA 1TZZA 2ICSA 4JQ3A 3L4XA 2FH8A 4Y96A 3IPWA 1US2A 2GQ3A 3GVQA 1C9DA 1X8FA 1QNOA 1B5TA 1H3GA 4D1IA 3W7OA 4KGLA 1SW7A 4AWTA 3TLLA 4Q33A 1NU5A 1HNYA 4JTDA 4Y8FA 3E49A 3OQEA 1VH7A 2ZFAA 3G77A 4GCAA 3UG8A 2J13A 3KBJA 3N14A 2UY4A 4JKKA 2JGYA 1TA3A 5TQLA 4WF7A 5KINA 3THUA 4QE1A 4DWSC 1XIBA 1KM5A 1MXGA 1PZ0A 4S3FA 2CETA 1IXNA 2HXUA 3CUHA 4GNVA 3LHTA 2WMGA 2OQLA 1OJXA 3TZNA 4AVOA 3PZNA 2YZRA 3IK4A 1KV5A 3IJ7A 4B91A 4O1EA 3QGKC 1OGBA 3QLLA 2RH9A 4KCUA 5AYXA 3T6CA 3W2LA 2RJHA 4PB4A 5C2CA 3UWYA 4AY7A 1UD5A 4E3VA 3TQVA 1QWKA 3WSUA 1DV7A 1RVGA 4HB7A 1UMYA 3H2MA 3HGSA 3PG9A 5ECVA 3S2LA 2FZMA 1YE6A 4B4HA 3QGVA 5CCZA 2XTKA 4TTGA 1BQCA 5JBDA 4HK6A 4I3GA 4QR6A 4EXAA