3L12A

Crystal structure of putative glycerophosphoryl diester phosphodiesterase (yp_165505.1) from silicibacter pomeroyi dss-3 at 1.60 a resolution
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
297
Chain Sequence
b'GFSQLEGLRGHPSVVRVIGHRGARGVMPENTLEGFAFTLAAGVRALEFDVVMTADGVPVVTHNHHLANAMTRDGQGHWLTGAERQVAEMTYAEIRALDVGGLDGRTVYGRRFPDQAFLTGIHVPRLGELLDLCAGYGDQAPYLLLELKSDPALMHDHAARAEMVAAVLADVRRYRMEPRTVMHSFDWALLGECRRQAPDLPTSYLSQLPEGPDYDRMTESLPQAVASAGGQLWCPYFLDVTPELVAEAHDLGLIVLTWTVNEPEDIRRMATTGVDGIVTDYPGRTQRILIDMGLSWT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative Glycerophosphoryl diester phosphodiesterase
publication title Crystal structure of Putative glycerophosphoryl diester phosphodiesterase (YP_165505.1) from Silicibacter pomeroyi DSS-3 at 1.60 A resolution
rcsb
source organism Silicibacter pomeroyi
molecule tags Hydrolase
total genus 100
structure length 297
sequence length 310
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03009 GDPD Glycerophosphoryl diester phosphodiesterase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.190 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphatidylinositol (PI) phosphodiesterase 3l12A00
4RW5A 3NO3A 4QJ3B 1DJWA 1AODA 1YDYA 4F2UA 3KS6A 1ZCCA 4GNKB 1DJIA 1PTDA 3RLGA 2ISDA 3KS5A 1XX1A 2PTDA 2O55A 3CH0A 4I9JA 4RW3A 1V8EA 3RLHA 1T6MA 3EA3A 3EA2A 1T8QA 1PTGA 1QASA 4I9TA 3I10A 3QR0A 5PTDA 4R7OA 1DJXA 2OOGA 1QATA 3H4WA 4Q6XA 3V1HA 4I90A 5T91A 3H4XA 1VD6A 4I9MA 3EA1A 6PTDA 2PLCA 7PTDA 4S3GA 1O1ZA 2F9RA 1DJZA 4OECA 3OHMB 4PTDA 1GYMA 4F2TA 2OTDA 3QVQA 4RV3A 2PZ0A 3MZ2A 3QR1A 2FJUB 5T9BG 1DJYA 3PTDA 2OR2A 4I8YA 4QJ4B 3V16A 1DJHA 4QJ5B 2ZKMX 4F2BA 3V18A 1DJGA 5T9CE 2P76A 3L12A
chains in the Genus database with same CATH superfamily
1PZ1A 5F2GA 4QLJA 3FYYA 1UR1A 1UR8A 3TN4A 2HVMA 4PUKA 4ALDA 3WMLA 3WLSA 3K8LA 3ABSA 4EANA 1LWJA 3FA5A 3VIGA 1UKPA 4AX7A 3BWWA 4IQJA 2C1IA 2WNNA 4ECLA 3EEGA 4D72A 1W1VA 1SM9A 3HV8A 3W01A 3TA9A 2BP1A 5D2XA 2RAGA 4AY8A 1BD0A 2OEKA 4HU3A 1WAUA 3ZJ8A 1YLVA 2DDXA 2VENA 3MP4A 4AWSA 4DM1A 4KEMA 3TQ0A 1W3KA 2PDCA 1W2PA 2P8BA 3HA1A 1Z48A 1SO5A 3KRZA 2O9RA 1JPKA 1EJSC 2NT0A 3N25A 2V69A 3WMCA 3SRKA 1PZ3A 1TA3A 1PPIA 3QBUA 1V0LA 1KNWA 2AQWA 1JUKA 4DJEA 5I03A 4DF2A 3UXKA 5D32A 4BR1A 7TAAA 4N4PA 4W88A 1K03A 4K36A 4HNLA 4IXHA 3M16A 2OODA 2GUBA 3QZEA 3WEMA 5FD0A 2RDUA 2HISA 2QIWA 3RMJA 3EX1A 4HPGA 4DELA 1SFJA 2D0GA 4DXVA 4G8TA 3TROA 1OFPA 4E2BA 3UY8A 3KBNA 3EPNA 2V5DA 4AD5A 4DBSA 3FSUA 3RM9A 1XGZA 5FA5A 2BOEX 2WO5A 5C55A 1YTKA 2O4MA 4PH6A 3SIZA 1MQPA 2ZRUA 4ZSUA 2YFOA 3BGAA 3I7QA 1J0HA 4YPJA 1OT1A 3IS4A 4RUBA 3JU2A 2X09A 4NX0A 3T7VA 1CGYA 2BVWA 1PDZA 3JRKA 3IRSA 1G7VA 2DT2A 3E1F1 2PLKA 1GZ1A 2DVTA 1QRQA 3HIJA 2C71A 2QVNA 3P84A 1HZYA 5KEZA 1A5AA 2VEIA 1MFVA 4KCUA 4K68A 1MQQA 3MHGA 1YYAA 3GH7A 5I02A 5CPMA 4GGHA 2QMKA 3DENA 4FSAA 1RALA 4HPHA 1WBJA 4BI5A 3H2FA 3TJ4A 3QMRA 4U5IA 4NSBA 1Q6OA 3U48A 4MB1A 4NF7A 4ILSA 4V28A 2JEQA 2NX1A 1ZSXA 1FHLA 1LRQA 4PCTA 7REQA 4GFSA 2VNCA 3CMJA 4Q8NA 1SO4A 1P0EA 2OWXA 1CT5A 1M6JA 1R3VA 2BOFX 3AYRA 4JD4A 4C1KA 2ZZ6A 5H8PA 2CLOA 3UETA 1UA3A 1OZQA 3Q94A 1IQ8A 3H26A 1H09A 3CMGA 3BO9A 3NL2A 4U3CA 1W0MA 3PC0A 3N2BA 1R8LA 4IHCA 2WC4A 5HNNA 2EPLX 3ZWTA 1WV2A 3AICA 3NYZA 2WJDA 3E0WA 1O6IA 1JPDX 2WZHA 4AHQA 3KFTA 4IFOA 3KDNA 2UBPC 3A4AA 5A6TC 3AO0A 3WL1A 3BE7A 5LA1A 3IJDA 5ABFA 3RJXA 4FA3A 3MSYA 2PD9A 1HKWA 3ZYZA 5D8ZA 5BYWA 4I9TA 3ZT5A 1V79A 2WMHA 2X8RA 3U5YA 1XPGA 4JTHA 3P81A 3LN3A 4GZ7A 1KWGA 4JYEA 4B5NA 4AMAA 4J7RA 3FYPA 4FNTA 1SMDA 5AC8A 3GU9A 1VB9A 3MMUA 5AZ0A 2PWHA 1V03A 1F61A 2OSYA 2V2DA 4IUOA 1WO2A 5LNSA 5I23A 4OOZA 1Q6QA 2PRMA 4LCQA 2V63A 1DBTA 2NVDA 3F4NA 3GO2A 1TE6A 1GKQA 2F38A 4KEZA 1S1PA 4FIQA 1TJ1A 1AW5A 2J7FA 2X41A 5IM51 4MZ1A 4NX5A 4HA0A 3VDGA 3VIKA 5JIWA 3DFTA 1V7AA 3BW2A 3HFYA 5DXYA 1OWQA 4QAWA 3W37A 4JHZA 1IEIA 2DZUA 1J96A 5CGMA 1HGYA 8A3HA 2CXGA 2C1HA 3O07A 1XR2A 1LQ2A 1VJIA 4UNIA 3LMYA 5HNUA 5DBUA 3NZ1A 1RVKA 1FDYA 2ZX9A 1HJUA 2GQ3A 3D0CA 2D22A 5CC5A 2CBUA 4P7NA 1P1MA 1VD6A 1KBKA 3G8RA 4GKTA 1FKXA 4FO4A 1V4YA 2ZX8A 3DC8A 4IGHA 3KTSA 3NSXA 3ARXA 2DQXA 2G0WA 4DJDA 2CESA 2EAWA 4D8ZA 2WQPA 3WEOA 5AVNA 4GJ1A 3VPLA 1TB3A 3S1UA 4DPQA 1E0VA 4PA8A 4YWIA 4B5SA 3K13A 3M0JA 2QT3A 4I8YA 3HBLA 5G5IA 4HHMA 3AS3A 1EF3A 2FTPA 4YYCA 3BAKA 4D6FA 5EFDA 1KFEA 1W32A 3KBJA 3KTXA 5C70A 3EB2A 1OIFA 3MKCA 3O1NA 3DIPA 1YBQA 5LKYA 3RLUA 2NV2A 1PKLA 2ZWZA 2PDFA 3O3RA 5FJTA 2ADAA 3MYOA 4AX6A 4R85A 2D1ZA 3PZQA 2VZOA 3CAKA 3UJSA 2PDKA 1CGUA 1XC4A 1DWHM 5LHEA 3JVAA 3N13A 3QYSA 4N2YA 3AMLA 2W0UA 1DJXA 1XIJA 1QMLA 2C15A 3RLVA 5JBEA 3VDAA 3K30A 3QMSA 2B7NA 3T4CA 3P0XA 5HQMA 2YXGA 3B97A 2E09A 3WSUA 5EL1A 3UXLA 2FQIA 4F3HA 5E0FA 2OQYA 3WH8A 4AXNA 1S2VA 2CYGA 3BCJA 5LYRA 4MVAA 3IANA 1PYFA 2E9MA 1AQFA 2E77A 1EQCA 1XS2A 3EWYA 3GR4A 3P6LA 2OTDA 2H3BA 2Z4GA 2QF7A 3QGAC 4Y9PA 1T99A 3MI6A 3URBA 3B8WA 2I7GA 4DZHA 2G95A 2D24A 4ZCWA 1J5SA 2Y7FA 2YCKX 2XVNA 1US2A 1FX6A 3DFQA 4JTUA 3TSBA 2PCQA 2NQZA 3W76A 1JYVA 1JGIA 4MFDA 3HGJA 3N04A 1IWPA 2XIIA 4WHBA 3H55A 3FKKA 2ZC1A 1SFSA 3WQGA 1FCUA 2VFHA 4Z08A 5FKYA 3P61A 3VO0A 2XH2A 3IJ9A 2PEVA 4Q4MA 3K4DA 3HQNA 2OYMA 5DCDA 3TVAA 4C6PA 4XISA 1YNQA 2VFFA 1QASA 2HROA 3AIEA 5DN1A 2P1FA 1B9BA 2G8ZA 3CYJA 1HF6A 3HPAA 5D9MA 3SECA 3TLLA 4J3TA 1Q5MA 1BKHA 1Y8BA 2QDEA 3E9AA 2W5FA 3N2TA 4W7WA 4C6MA 1E71M 2FFIA 1J0JA 2CNCA 1I1XA 1YRRA 1UKTA 3TXZA 3AIQA 4NI3A 3EKGA 3VZZA 2GDVA 4UQCA 2CLFA 3CLMA 4QROA 2X0YA 5HXMA 2PDNA 2WVSA 2XIQA 3T55A 3FAWA 4F9JA 1S2AA 3CT7A 3HGOA 3KOZA 3WBEA 4AIUA 1YADA 3NQFA 2NUXA 3TE9A 4H9XA 3CIWA 1S3TC 3R8GA 1RSCA 4ZO8A 2AOSA 3WNKA 4OU1A 3BK0A 1TV2A 4K8GA 2OX1A 1ZJIA 4MOZA 3NDYA 2VRJA 1K9FA 3WNPA 1EDTA 3NAVA 3GDKA 1PX8A 1AVAA 4M19A 3FHAA 5E9AA 1BEUA 3UR2A 4NAEB 1VKFA 2NWSA 3BQ6A 3Q45A 4QRNA 4H19A 1XLIA 5FL0A 4QE1A 3NO5A 4ZGYA 4I5XA 2WHLA 4B16A 1KKRA 1W1IE 4JFTA 3B8DA 3VNMA 3G8EA 4V1XA 2VRQA 5JXQA 1GVYA 1V7YA 1TCMA 4IG2A 1V08A 4UC5A 1IGSA 3FGCA 3SCTA 3VIFA 3A5VA 1YKWA 2J74A 3BV4A 1G69A 4S38A 3N3TA 2PTYA 3R5EA 4LANA 3TWAA 1H11A 3PSWA 4C6DA 4B5XA 2PTWA 2D69A 9CGTA 3BARA 3WQCA 1I4NA 5AYXA 4CU7A 4HPNA 3CHDA 3UJFA 3TJLA 1F73A 2OCZA 1ZHAA 3GXPA 5HOSA 1A5CA 3PBMA 4IF2A 1CXEA 4FNSA 4LSBA 1T8XA 2J6VA 4A2RA 2I14A 4D6HA 1Z3NA 1OYAA 3PZGA 2J8FA 1CW2A 1DWIM 3NPVA 2WMJA 4YYFA 2ON3A 4NQ1A 2PDWA 2Z1VA 4UBPC 2X0HA 1TG7A 5I3KA 4AZGA 2JIEA 3SUUA 3VC6A 4HGXA 1TVLA 2HS6A 1HJSA 2WCSA 4MUPA 2P0IA 5BOEA 4E5TA 2I1OA 1O68A 1YTEA 3VOFA 3T0AA 1VHNA 1EJXC 3SY1A 4I6VA 2X2GA 2PBOA 2NWRA 1OQFA 3W26A 3HURA 3EA2A 1Q6LA 3LLFA 3QC0A 2YZRA 5TAOA 1P4CA 4HZ7A 2YBUA 3FN9A 3R0UA 1E6PA 4UFIA 1T96A 1JDCA 3RCNA 4GY1A 2GUYA 4J1OA 3V1PA 1GOKA 3L2MA 2VC7A 4H41A 4A8RA 1LWIA 1W9UA 3RIKA 3O63A 4AQLA 4ERAA 5DO8A 3SSJA 1VFHA 3AJ7A 1BRLB 1ZENA 5E6ZA 5D2TA 3ZT6A 2YL8A 2XGBA 5K9CA 3GC2A 1NFPA 2KZHA 1TV5A 2XVLA 1BXNA 3CEUA 1AZ2A 1RQHA 3BCDA 1UKSA 2PLJA 4LS0A 5HMSA 1XLCA 3MKKA 5AECA 4ICCX 1OJXA 4H2CA 1OCQA 2Z1KA 3BMXA 2E25A 4E4PA 2NQ9A 3M1ZA 5HNRA 1S2WA 1JPIA 3E3HA 4EAMA 3VKBA 5MHBA 4AEOA 4RPPA 3G6LA 4JZ5A 4DBUA 2WAGA 5HQLA 3WD4A 4LJ3A 1JCYA 1NARA 1OFDA 2Y8UA 1L8NA 1H62A 3KL5A 2PTDA 2BGQA 1BVWA 1H7XA 4C60A 2PLMA 4RNIA 3CZGA 3PPHA 1E0UA 1I0BA 4S3EA 1KRMA 3DG3A 4DXXA 2ZX6A 3TN6A 1XLDA 2OZ8A 1O12A 1PWLA 1JYWA 4Y7EA 3EDKA 3V1HA 3TC7A 2HPMA 4LV9A 4PCFA 3FFSA 3MANA 2O7SA 1DE6A 5FF3A 2VKZG 5FJUA 2DP3A 1O1ZA 3VAVA 4DO4A 5CPNA 4LAMA 2AL2B 3W1NA 4JQAA 5I7GA 4JHOA 4AIOA 2F2HA 4AEFA 2E6FA 5EKYA 4XSMA 1QNOA 1XL9A 3SEPA 5CBIA 4UTWC 1QNVA 1A5LC 3PBYA 4LTSA 5T9BG 3EX6A 2ZYFA 3P93A 4DYKA 3W3OA 1AJ2A 4MIMA 1P1XA 2CLEA 5HJXA 1QPRA 1ODZA 3H8AA 5BW6A 3ES7A 3T9PA 5FACA 3VGDA 5HWMA 1OYBA 4WSKA 3GG1A 4PSRA 4H2HA 5C2CA 3BLIA 4H8UA 3VM7A 5AC7A 1UCWA 1PKNA 2O4QA 4HK7A 4AY1A 2YYUA 1EGMA 5ABHA 4JFWA 2WPBA 4OOUA 4KWUA 2ISWA 4YVVA 1KB3A 5JQ9A 3WN6A 1MFUA 4H8HA 4RW3A 3STFA 1DIOA 3W83A 5PTDA 3PWIA 2PWGA 1PV8A 1VHCA 1JYXA 6ENLA 3TFXA 2CLMA 5T91A 1PJ9A 4JN6A 2TPSA 1OIMA 4F48A 1U5VA 4LUJA 3SFKA 4ZSTA 1SZFA 1VC4A 5HMFA 3W1XA 4QNWA 4DRSA 3QEZA 1OINA 2OGYA 4OBRA 4A05A 4BZYA 1UH3A 4PBFA 1EBHA 2PPGA 2XN1A 3OG3A 3S6DA 4S3AA 2ZUUA 3RRXA 4GFIA 1OX6A 2BLEA 1U1UA 2V3EA 1ISYA 4WF7A 4K8HA 2IPWA 1JCNA 4IJBA 2EO7A 1QHPA 4LAOA 2ESCA 3W1PA 1BTCA 4ZMGA 2PGRA 1UUOA 1XYMA 3EOEA 4Z17A 4LRTA 3C4UA 4PCNA 3R13A 2L5HA 4WX2A 5I09A 1J10A 1X7FA 4FR6A 4Y9AA 1TKKA 1GWJA 4WDWA 3NQGA 4QLKA 2C6QA 1S5MA 3SB0A 2YJQA 4KWVA 2YLAA 1GOMA 4WJXA 3ITOA 3WDJA 3LBMA 5J5RA 4GBUA 3W6MA 4EXBA 4C7DA 1Q7QA 2WNQA 3AHYA 1T8QA 2HXTA 4ZB2A 4AD4A 3NZRA 1I2NA 5AC6A 4LVFA 1ONWA 4Q6XA 2EG7A 3KCLA 1CIUA 1NTHA 1SZRA 1KBLA 3GAKA 4EAYA 3FCPA 1J18A 1IZCA 1L2UA 1U1JA 4M80A 1LBFA 3PPGA 3G18A 3IUIA 4FMVA 2JKAA 1J8VA 3GKAA 3HG2A 4KF1A 5I3FA 4N4QA 3VNJA 2XSBA 4C7FA 4K1WA 3OIHA 1SZGA 1SU5A 1BLIA 1NEYA 1GQIA 1B3OA 3A4XA 1D7KA 1ZBVA 3PTDA 3B8UA 3SN4A 4J2MA 4QJ5B 3MMTA 2WMIB 4PYSA 1KQZA 3LBOA 3TSDA 2INEA 2OOFA 3ZMRA 1UP0A 2QCCA 1F4HA 4FS9A 2D3NA 1OZMA 1CI1A 6XIMA 4XZLX 4Q4QA 4H6QA 3CZJA 4Q4KA 4AXKA 1WUEA 1OVDA 4UMCA 3N12A 1DJNA 3AU2A 1QK2A 3U4AA 3VX0A 4NL1A 1DEDA 3S8HA 1J2WA 1V8EA 3AZTA 1RJQA 3VNKA 4OTKA 3QSTA 4GMEA 3L67A 4K37A 3KBMA 1F8MA 4OFCA 3PN8A 1W9VA 4Y9MA 3W85A 2Z0IA 3LXCA 2VC5A 3WLPA 2ACQA 3PULA 3U8GA 2R1PA 3RHGA 1SUXA 3KHDA 4OBSA 1QXLA 1VR6A 1JCXA 3LYEA 3KL0A 1I0DA 4HTBA 5JUVA 3R0KA 1PO9A 1DWJM 2O92A 2V3GA 3W72A 4AZ7A 1FWGC 5FJPA 1H41A 1R6WA 1FH9A 2PZ0A 2QEZA 2PF8A 3NDZA 2JALA 4X0NA 4H9VA 4DQWA 2I9UA 5AHIA 5D9NA 1MUCA 1WOAA 4Y8FA 4XD3A 1J12A 5A8NA 1Z69A 4P8UA 2GWGA 2ISVA 1EGVA 1UR9A 3QM3A 3B9DA 1EJRC 3KVLA 1PXGA 4ACZA 4BFAA 3WF4A 2BS9A 1TPVA 1E6XM 4JS3A 1J0IA 3N2OA 4IQEA 1KXVA 1JNEA 3F4VA 2VQTA 4EPKA 3NQ2A 1IIHA 1XRFA 4E8DA 3GHSA 3EGJA 4CQAA 1CEOA 2EPOA 4I7WA 2ZUVA 4ICMA 2YOCA 4WDTA 5EA9A 1HIZA 2DZPA 3UW6A 3MSRA 3IV8A 1XW8A 1J01A 4V1YA 2YA1A 2VD9A 3P8JA 2X2YA 3I3EA 3ANVA 3NVTA 3N3MA 4CN6A 1A47A 4EE9A 4EXAA 3ENLA 4CN1A 5H1WA 3CUZA 3TCEA 2OEMA 4JNMA 2WYSA 2AQVA 3ARRA 1E9LA 4M6VA 4JHMA 1P48A 1TWWA 2KX9A 1UD4A 3A22A 2PDIA 4P7RA 4DY1A 5C9UA 4BF5A 4RV3A 4D6GA 3WH6A 3LGEA 5JBDA 4UWMA 1QFEA 5DXXA 2IUZA 5IOBA 3E12A 2DH3A 5D4YA 4W8AA 5FAGA 2PDXA 4FPSA 5A94A 3APGA 5F4XA 2IXUA 1IF2A 4Y9OA 4XZWA 4ATLA 3BVJA 3A4WA 1NU5A 2QCHA 1PUDA 3TTOA 1PCKA 4PMJA 1IE7C 1XLBA 1E43A 3W6LA 1RK5A 1XKJA 2WJFA 3WJWA 3ABOA 3EPOA 4IQDA 2ISDA 3VIIA 1KM5A 2OZTA 2Q8LA 1VPYA 4IIFA 4PTVA 4IUGA 3EWXA 2B0MA 2B7QA 3SUWA 4R33A 3E0LA 2F6UA 1MYRA 2ZUSA 2I5GA 1QI0A 3WD3A 1Q13A 2Z29A 4DAIA 1KA9F 3B0UX 1XIDA 3PBWA 3PZUA 2Z2BA 3ISIX 3VNZA 1NDYA 4IGNA 4YS1A 1DP0A 3W88A 3HM7A 4OHQA 1KXTA 3VCCA 1KM3A 3LXAA 1RR2A 3CZKA 5FOOA 4L56A 3RPMA 1ZQ5A 4HPJA 3GYEA 3O2LA 1BG4A 3OBEA 4HKPA 3W7OA 5DRCA 3WLIA 1R0MA 1H5VA 4FLOA 2PWEA 4O52A 4A21A 1MSSA 4WXZA 5K4XA 3WQ5A 3ARVA 4LCSA 1T7LA 2OLAA 4GYPC 1E1CB 1A4MA 3W02A 1E0XA 3FA3A 2WW5A 4O50A 4V15A 3KBSA 1IEVA 4A3HA 3TAKA 4CQ8A 4XG1A 1PKMA 7A3HA 3KRSA 3EBVA 3WCZA 3PAOA 3FJ4A 3RR1A 2PAJA 2GGEA 3FLUA 3H2OA 3WUGA 1XYZA 1VGAA 4GYKA 2VCBA 2PDYA 4GXWA 3DHFA 3KP1A 1V0KA 3GC4A 2PP1A 2YPIA 3NOEA 4IH3A 3PFMA 2AKZA 1TVPA 1W1B1 4AWUA 3R89A 3L2LA 2Z1WA 3OVQA 5M03A 3GVVA 1TPB1 4IFRA 1ZZMA 1EOMA 5G1YA 2V8ZA 1HKKA 4LWWA 3WQPA 1I1WA 1IZKA 2FYMA 3TKFA 4Q4OA 3PZVA 4KRZA 3WFLA 2GSHA 1V02E 1GVEA 1IYXA 1UW9A 4A8NA 2CZVA 4I9MA 3M6YA 3MTWA 3TLQA 2O9TA 3LA4A 4GY0A 2P10A 5E1QA 4V27A 1MRQA 2CZ5A 4HU4A 2VR2A 3HPSA 5RUBA 1LRTA 4ZQRA 4UTWA 3UJEA 3L4WA 1XHGA 3VCNA 1V3LA 2FHBA 1VFMA 5GJMA 3PZOA 3RPTA 3RILA 1LF1A 4Z2GA 1V93A 2JK2A 1MI3A 1QT1A 4IISA 1KV8A 2VZTA 1LRNA 2RDXA 2EG6A 1CXKA 3QRHA 3EWUA 5JH2A 3H2NA 3L5AA 3KOXA 2DPEA 3TAOA 3WZ0E 3R6IA 5CBBA 2A3EA 4KFOA 1A4LA 4DUVA 2XIOA 4O16A 4LVBA 1UG6A 4H6RA 2R1KA 3IGUA 1JCMP 2BVYA 4S39A 2QZRA 1HFBA 1UUMA 1IZJA 2V30A 2Y0FA 4ZEPA 1KBBA 4QX4A 3BSMA 4PSPA 2EF9A 4QS5A 4UQAA 3LI1A 1TPWA 1XYBA 1XLLA 3QPZA 4Q8OA 4RL3A 2C18A 1F4AA 2R24A 3BLPX 2Y63A 4FNQA 1WDPA 1KRBC 1XLAA 5EMYA 2OT1A 1B9ZA 1CXFA 3DKJA 4KIEA 1M7PA 1UYQA 1KW1A 3ZS4A 4Q8WA 4LUTA 2NX9A 4I5RA 3IPWA 3IUHA 3OLGA 3L9CA 2ZADA 2HPIA 1WYIA 3CBWA 4UFMA 5A3HA 3MW7A 5E0CA 4L1GA 2QJJA 1E9YB 1ZS2A 4RDYA 4GLEA 1RP8A 3CH9A 1C9DA 1AK5A 4IFKB 2REQB 3RUBL 2QCDB 5A6BD 4X9YA 3DFNA 1LL6A 5LNUA 4DM2A 4ZFCA 2PDPA 3WF3A 4DWDA 1SFLA 1DJGA 2C3ZA 3NO3A 4QISA 4GOAA 5LGZA 2A3BA 3UXDA 3ITTA 4GXMA 3WQEA 2H8ZA 1VFOA 4W4QA 4GNJA 6CGTA 3W1AA 1JCLA 4UB9A 1MW3A 3VYLA 2W3ZA 1XSJA 2XH7A 4ZE4A 3MUXA 3W29A 3POHA 3W7QA 1W1YA 2QUNA 5F2LA 2IKIA 3EOUA 5DX7A 1THFD 5CPTA 4BHYA 2R1NA 1W1A1 1UASA 4JTFA 3WDQA 1BSLA 9XIMA 1P0BA 2NV9A 4GI6A 4GO8A 4QM1A 3D47A 3SRDA 3ITGA 4X61A 3C2OA 2CCRA 2POTA 3BAIA 2X42A 2NT1A 4M1BA 4FXSA 1LBLA 3H7UA 3VD5A 2HRWA 2AL1A 3AS1A 1P0NA 4TTGA 3RN6A 2QXWA 1V0NA 1M65A 2NQLA 2ZVIA 2J8TA 1DYSA 3W2JA 3DFPA 3QTGA 3DUGA 3D3AA 2PP0A 1CZ1A 1L2QA 3WD0A 5G4HC 3MZ2A 4WQ6A 3WQWA 4MB4A 3OLDA 4US5A 2FDSA 3C0QA 3G6MA 4JCLA 4TOQA 2C8NA 1ONRA 4F2BA 2F61A 4ZE5A 1L0PA 4OUEA 4TVDA 5FL1A 3LPPA 1H4PA 1E1CA 2A1YA 4GGBA 4QDWA 3MQTA 4C6JA 3QPEA 1G4PA 3BDKA 1QOXA 1B3XA 3WJYA 1TIWA 4RDWA 4O4WA 3RLGA 1YMYA 2Y5EA 4NRRA 1KV5A 2EQDA 5DBTA 5K9XA 1AG1O 4H4IA 3BSGA 3ITVA 3MA8A 1S5WA 2ZZ1A 3CQHA 1EQPA 4B9ZA 3SURA 4FNUA 1GQKA 4FZIA 2QW5A 1I45A 3LPFA 5AOUA 1B4EA 3FW6A 2VX4A 5D03A 1W5MA 3C8NA 8RUCA 1Q3NA 3DFOA 1TWSA 1FWTA 4GVHA 4IMEA 4L9YA 3H23A 2G37A 1XBYA 1J11A 1LL7A 3EDDA 2QUTA 2F8QA 3ELFA 3L4YA 1TJPA 4CNNA 1EIBA 5EGRA 3PPFA 3LY0A 1LYXA 1J4EA 4JTSA 2R94A 1VP5A 4FXJA 3HN3A 5F7UA 3L2IA 3LNMA 1F3XA 2HBXA 1PWMA 1TQJA 4ZOEA 1E1FA 3MMDA 3LGDA 1G1YA 4A4AA 3QZ6A 3TU9A 2TAAA 1WQ5A 1TJ0A 2ZDRA 3RRAA 3SW6A 1FWCC 1R3SA 3CL8A 3LDVA 2QYGA 1EO7A 2P76A 2DUAA 2ODOA 1EP3A 4ZL1A 1GQNA 3P74A 4QG6A 3GVQA 3WBAA 4PFMA 3M0MA 3PB0A 4LALA 3O6YX 3BXWA 3SFWA 1YPIA 1RQBA 1TYGA 3BANA 3VMOA 3V35A 1EIXA 2J78A 1E9ZB 2OZ0A 4HA4A 3LENA 1U22A 2E40A 5AC4A 4RR4A 2QDHA 2RFGA 2IW0A 4FLSA 3POCA 4NZ4A 1VH7A 1N8WA 3SN1A 3WBWA 1OFBA 3EZ4A 4UCGA 4B92A 3CUFA 5HPCA 3U2OA 3W7DA 2QUVA 3GG7A 4UMAA 3AWOA 4KESA 3GFXA 4G7EB 4JTQA 1V0MA 4XIAA 1ZP4A 3GBEA 1QI2A 1Q2SA 1VRXA 2DORA 5D2YA 1E72M 3E5PA 1RY0A 5CEWA 4D9PA 4MTVA 2RKXA 4ZENA 4UNKA 2WSYA 2NQHA 1JRCA 4INFA 2W6RA 4UFJA 1QPOA 3B05A 3K1DA 5I06A 4HNCA 3QMTA 1VYSX 2XGZA 2V5LA 4WY0A 4F0RA 5GJNA 3IJQA 3II1A 1EX1A 2XZ9A 4ADSA 4QAIA 3BLLA 3CS2A 1BG9A 1L6YA 5CZ0A 1W8SA 1RVGA 2AMGA 4OV9A 1TR1A 1DQUA 1HVXA 3BW4A 3MB9A 3ALFA 4JQ2A 3LCFA 3VU2A 1OGBA 4O28A 5A8GA 1C3FA 4H9TA 5B80A 1DJQA 2CWNA 3ANUA 4O12A 3CPUA 3NIYA 4WSJA 3DYOA 2OO6A 1XC6A 4JIHA 5EBAA 1MEIA 3GXTA 3TZNA 4F0SA 3ABZA 1LQAA 1L8PA 2D2GA 1W91A 1JZ5A 1GQLA 3THCA 1F74A 2HE8A 2X7WA 3NM3A 1XISA 3LRLA 4EPDC 1XRVA 3D3FA 1DHKA 3L7RA 2WHKA 4AU0A 1CCWB 1MNZA 3VGHA 1AJ0A 2HNEA 2VDGA 3SO7A 4MJMA 3OOQA 4NIRA 3L0NA 3N2MA 4NJJA 2A7NA 4DZ5A 2YFNA 5CSRA 3VA8A 1BYCA 3SI9A 1X1OA 4UTJA 4XVDA 4H00A 5K9DA 1XYLA 1XWYA 4LF1A 1ZCOA 4GI9A 2V3FA 2VTFA 1R38A 3W53A 1JFHA 3GR7A 1WUFA 3UZZA 2YIHA 3SUSA 4L80A 3B8TA 2ZZ7A 4HZ6A 4OJYA 2OG9A 2MANA 1KFBA 4UOJA 4XK2A 3S5YA 2NXIA 2PD5A 2I17A 1G67A 3H7RA 2XHYA 1OX4A 2FH6A 1JZ2A 3HV9A 2VJXA 3PG8A 3SADA 3WF2A 3NSNA 2XN2A 1W9DM 2H9AA 5CLTA 1Y5VA 4CVUA 2J9XA 2VQUA 1JZ6A 5TD4A 2Y85A 1Q7MA 3NQ8A 1VFLA 4G1KA 5CJ5A 4TXEA 3CGTA 4HHHA 1S38A 4HMDA 1OFOA 1W3NA 2IQTA 5BOOA 1O5QA 2YKKA 1KRAC 3VIMA 5A6JA 3UBPC 5GNZA 3NM1A 1P7TB 5KSWA 1JPHA 3CZEA 1IWAA 3WK2A 4N9DA 3GHRA 3GNXA 4QR6A 1PB0A 5D9PA 2O56A 2IKGA 3UEQA 5CPSA 3OQ8A 2HDJA 3L68A 1TWIA 5EMMA 1AODA 4L6DA 1WZKA 2CPUA 3HG3A 3IVUA 3MU7A 4U2YA 3RX4A 3AMCA 4TO8A 4XAZA 5CG7A 3W9ZA 1D3GA 3P8IA 4XSLA 3QFEA 2BBFA 3WLJA 3PUDA 5FF2A 3SCSA 3CASA 5FJRA 3W28A 3V4BA 2V5CA 1U1HA 3SZ8A 1YDVA 3WLMA 4QHRA 1R3QA 3I10A 4IWWA 3ZIZA 3GB6A 1QBAA 2YCLA 3EMCA 3OB8A 4C5YA 5G1MA 4O4VA 3ABXA 3DFHA 4PZVA 1G0CA 4R88A 4U3AA 4TX8A 5I6SA 4PMRA 2OO0A 3UT0A 2FHFA 3M64A 3WQ6A 3VX1A 1MW0A 1J9YA 3CV2A 2R14A 2ZA2A 4W5ZA 2X05A 1IEXA 1X6NA 3M0ZA 1EXPA 2R1LA 2VRKA 3F4DA 1BF6A 1VYPX 4QP0A 4GI4A 1XDMA 3GDRA 1PSCA 3CAQA 4W9TA 1XGEA 1TUFA 4E2DA 1W1TA 2FZBA 1F6PA 4YTUA 3CQJA 3M46A 1EYWA 5AHNA 2ZOXA 2DQWA 1WP6A 2VOTA 4UTUA 2XTKA 4RCXA 3RYSA 1QDSA 3KEHA 3GU1A 1R9ZA 1WXYA 1VBGA 5CKSA 4U31A 1K9EA 3P62A 2PDBA 1SPQA 3DFYA 4RE4A 3KS5A 1EEPA 1XIGA 1QU4A 3NVDA 2PDQA 4NZCA 2QCMA 4EACA 3PWGA 2DSVA 2BY3A 3N9SA 4FI4A 1FHVA 2G96A 5CJNA 2OVLA 2FPTA 1DIKA 3A9IA 4FK9A 2WCGA 1VRDA 2QAPA 3OA5A 3A13A 3FVDA 5A8QA 1I6NA 3O0KA 3G1AA 4NILA 3VFLA 4A3RA 3OEXA 1R9XA 4QEHA 3HPFA 4PODA 3KXQA 2XSXA 3VE7A 4EVZA 3T8QA 4W8BA 3FK4A 3U4FA 3HQ1A 2HJPA 5LXXA 2D0HA 3QY8A 1Q45A 5F4SA 3R10A 5HPOA 4JFVA 2V81A 4J3UA 3ZVHA 2Y5JA 3LQGA 3TW6A 3GVWA 3KBWA 3LMZA 1VPXA 3ZJ6A 2DEPA 5CC3A 4FNPA 1OEPA 1WOBA 3M41A 1RQEA 1TQXA 1XIMA 1VFUA 5BXSA 2Q09A 1H0IA 3LU2A 2J7EA 2JKPA 5G2WA 2DGAA 1QO5A 3RAOA 1HXJA 2HVOA 1IXOA 2VFGA 1GW1A 3ES8A 1EDQA 4QJ4B 1G7UA 3G22A 1CYGA 2WCAA 3BW3A 2JF6A 4HNUA 5C71A 4DWSB 5KMYA 4JL2A 3L5LA 4DO7A 1H7WA 1XPYA 1J6OA 3ARZA 1DTUA 4DUXA 4Q8QA 3W2UA 1XV8A 4N9EA 3E2VA 4TUFA 5D09A 5D2WA 3H21A 1KFJA 3W4RA 4BEQA 3EX3A 1QWGA 3DI1A 4DBEA 1V5XA 3VKDA 5GQBA 3VZYA 1ONXA 3W07A 3PZMA 4MWAD 4IMGA 4NJHA 1UIPA 1RXOB 1LT8A 2XPKA 3TV8A 1B3WA 3LSBA 3QV6A 2C1GA 5A6BA 3SUVA 3TYEA 2RJHA 1PKYA 5CPQA 2FHCA 3QLDA 1XBVA 3CUJA 4LUIA 3CZ8A 3S0CA 3N6HA 1JIBA 3OBKA 1NQ6A 3WLRA 1MEHA 1GEHA 1AH4A 3IAPA 1TTIA 3P80A 3DC0A 3QV9A 1HG3A 3M43A 1QI3A 1DJZA 4OECA 3ZSSA 4YWSA 1KM6A 1EPXA 1LCOA 4X22A 2QDGA 1GZJA 4CCZA 1H63A 4EX4A 4KT2A 4C6KA 4NXKA 3W23A 1QPQA 2DT1A 4G56A 1K4HA 1XCFA 3UQNA 4Q8UA 2UY5A 3EMQA 1X1NA 2DIEA 1S5TA 4NZFA 1ICPA 3A5FA 1R7OA 3M7SA 3THQA 1P7TA 3UPBA 4GZEA 3M6DA 3VTRA 3ARUA 4GIRA 4JNZA 4L64A 4NJGA 3TIMA 1E4NA 2ZE0A 1HJXA 2OZ3A 2NV1A 3WMSA 3C2FA 1KTCA 4QE4A 5A5WA 4RKAA 4LYPA 3OVRA 1M1BA 4B2DD 1US0A 2OGJA 4JTIA 1K7FA 5TIMA 4Y90A 1CGTA 2ZA1A 2DIJA 1TA3B 5A8MA 1H7PA 2J9ZA 3N6QA 1VJSA 4QTGA 2VVSA 2OOGA 3GY1A 1TR9A 1EB3A 2VL4A 3HMCA 3BGJA 4L5ZA 5A6AA 4ZQMA 3H53A 4LB4A 3R0DA 3WQ8A 2VHLA 2V68A 3ZO9A 2PGEA 4DJDC 2F6XA 3W27A 3U6WA 4FOKA 1CXLA 1BXBA 3ZJKA 1JZ3A 4Z42C 1EOKA 4MADA 1R86A 3TC6A 3WQFA 4PTMA 1VBJA 4AISA 3GM8A 1ME8A 3B8SA 4B5VA 3KOWA 2G41A 2XWEA 2XJ7A 1CGVA 3O8AA 2E0PA 3TCSA 3LZ5A 4F2TA 1OF6A 3IUDA 1BGGA 2E6AA 2MNRA 3WQ4A 3PS7A 3N9RA 1PIGA 4RZBA 4CUCA 1JQVA 2FGBA 5HBFA 4EOUA 1JXKA 4KETA 5I0DA 2R82A 1UJQA 5BRPA 1JCJA 1W5QA 4GINA 5LIUX 3AMGA 3VK5A 2POZA 4C1NA 3S6TA 4LUSA 4EK7A 3LGGA 5M17A 1F6YA 3KAOA 1SW3A 3EOSA 4JY9A 4M1RA 4Z0SA 3TYZA 3FS2A 5FF7A 4JTJA 2ZXBA 1JPMA 4I9JA 4MNLA 1H1ZA 3ZR4A 3APYA 2OMAA 4Q7NA 1TJ2A 3QHMA 2NXGA 4NAFB 3UFYA 1HKMA 3EAUA 4GO9A 3VNYA 3GLCA 1FFRA 4DBWA 1XLGA 1Q4WA 2GK1A 3GFZA 4D1IA 1XLJA 4NP7A 1M03A 4FLQA 1DORA 1FOBA 4UUIA 1Q8JA 5BU9A 4XAYA 5C54A 2DZAA 1G4TA 3WK3A 3TWBA 4I7UA 1T5AA 4H8VA 1XDJA 1V3HA 4RNHA 3CB3A 1ZBKA 2NSXA 3TYUA 1OGGA 1W37A 4HZ8A 1ZY9A 1KM0A 4LU0A 3UYIA 4AY7A 4JEQA 2E4TA 4XUYA 4XZ9A 1KFCA 5FEPA 3KE0A 3STPA 1BF2A 3WH7A 1K77A 4IJRA 3N1AA 3NR0A 2F84A 3S2MA 5EMJA 5FI8A 5IRPA 4RXFA 4O17A 3VD7A 4MY1A 4D8LA 4MZ8A 1PBGA 4S3BA 2WXDM 4DJFD 4BY3A 4KFNA 3CB8A 4R9OA 1H60A 2FPYA 3W7IA 4GKLA 1UR0A 1B3YA 2VEPA 2ZFAA 1A3WA 5CLWA 4HNVA 5A1AA 4JTGA 7CGTA 3WNNA 2J8GA 2Z28A 3LQLA 2QUMA 1GUVA 1UPMB 4XUGA 2UY2A 4P61A 5HR7A 4YHEA 5EU9A 4XBSA 3AUOA 4HN8A 4M7SA 4MLJA 1Q6GA 5HA7A 4B5UA 3ARWA 3ZZ1A 2VVNA 4XZIA 4HQVA 4WGHA 1FVPA 5D33A 4PEKA 5DQPA 3LZ3A 1W56A 2RGLA 2BGSA 5CC6A 3TQPA 4J9JA 4XO7A 2QCFA 1B31A 4XZHA 1F3EA 1LLOA 3PUGA 1Q4NX 1QNRA 4XD6A 3WL0A 2X1SA 4RNFA 3MVTA 1SW0A 1P5BA 4JIRA 4L7ZA 4KRTA 3EYPA 3OW1A 5ECUA 3TJIA 3T0CA 4JAWA 4ZQCA 1KCZA 4IMAA 3WUEA 3HB9A 1GONA 4UTFA 2VXNA 5B7YA 4QQ3A 1OC7A 3N19B 1QJWA 3K46A 3V3WA 1U30A 1KM4A 4PFHA 3S2CA 4JIPA 8CGTA 1NWTA 4OQVA 3RXZA 5JBFA 1S5VA 2XIBA 3S46A 1YNYA 4AZBA 9RUBA 2V0TA 1LTDA 2FIQA 1UWRA 1WCGA 5G2IA 4W86A 2D73A 3KCJA 4OVXA 2QF8A 4HN4A 4O0KA 2O55A 1UP3A 5XIMA 4ZTYA 1Q6EA 1EPVA 3H2EA 3KZSA 3WLQA 1RD5A 5A6KA 1EF2A 2I5IA 4MNJA 1IT0A 5CXPA 1PL9A 4LS1A 1MXDA 3GNOA 4UOZA 2EPHA 4Q32A 4LNYA 2HZGA 3GQYA 3OLIA 3GG8A 4GVFA 2QHAA 1U5HA 3OQEA 1H0GA 2BG5A 1E1EA 5GVJA 1H49A 1QVBA 3W7MA 2PRHA 3LHUA 1EUAA 1YBQB 3OTRA 4QJ1A 2QQ6A 3AS2A 2DZWA 4QCEA 2FZ9A 3WD2A 2YB4A 4ATDA 3OHIA 1POKA 3LCIA 2OPJA 4C6FA 4R7WA 1SJCA 1SSGA 1U5JA 2FJUB 4AH7A 1DQWA 1BHGA 4JDYA 4NG3A 3HQOA 4PRRA 3TOPA 1V6XA 1R3YA 4A2SA 1ZALA 4ERGA 3N73A 4OWGA 3T78A 1VAHA 1R2RA 2ZZ2A 4RXGA 3JUGA 5J8LA 3CQKA 2VM8A 4MB5A 2WMGA 1JYNA 2G3JA 2V2CA 4HSHA 4XX6A 4QNEA 2PFHA 3IK2A 2YXXA 3RITA 4YTQA 1QK0A 5D38A 4KMQA 4BEUA 3WQDA 3W2KA 4QG9A 2IPGA 2VUNA 1UWIA 5HANA 4DZAA 2CKSA 2J75A 5CGQA 1WKDA 3THUA 3I6TA 3IARA 1J5TA 3IJLA 1QATA 3K4WA 3KW3A 4NAFA 3GZAA 3UU0A 4HNTA 1KBJA 3S2JA 5D9OA 1EZ2A 2CLPA 4CNTA 2CC0A 4WJ8A 3UVIA 5DMYA 4BQ2A 1ML1A 1R3WA 1M5WA 4QDPA 1ZAHA 3AIBA 4WKAA 3AROA 1MXSA 1F05A 1YE6A 8XIAA 4LBRA 5L9FA 2D23A 2HV5A 3GHTA 3IK4A 3UG5A 4CCCA 3URNA 3G1HA 3WKZA 3NZPA 4O1AA 3WDIA 3N17A 3QV7A 2IXVA 3PZNA 1DVJA 4AZ5A 1TPDA 1FHDA 3SAZA 2QGHA 1X39A 3EEZA 3W82A 1RUSA 2O9PA 1S46A 3N6JA 3K1GA 1ITXA 4J5NA 5CAKA 1GJUA 4DWSD 3MO7A 3WK1A 2FB3A 3OZMA 2DSWA 3AHVA 3AYTA 3LHTA 1LROA 2GQAA 1S39A 4L1XA 3W7HA 4G6CA 3VC5A 1FXQA 3QH2A 4JY8A 5MF5A 1M68A 3DCPA 2E68A 4DI8A 3S5OA 4XD4A 2WVVB 1UKOA 4YJ5A 4CQ9A 3E2SA 4W87A 1OFAA 1BGAA 2PDHA 2C7FA 2XU2A 1H51A 2X1TA 2EBNA 4Z2KA 1GEQA 1XG3A 1MWOA 2CU0A 3TZFA 5DMNA 4R9XA 4CQBA 4EWND 1ZB5A 3NL6A 2FVKA 2A21A 2EKGA 1IT8A 4AB4A 1XXXA 5I79A 2QPUA 4RE2A 3ZSTA 4AWTA 2YA2A 2NLYA 1MXGA 3GUGA 3TW7A 2VUYA 1TX2A 4MMWA 7ENLA 1DWFM 3LX9A 2WWDA 1ESWA 5HMDA 3VIOA 3O16A 1GQJA 3S3GA 2G50A 1XDLA 2V67A 3EB4A 1D3HA 1LP6A 3HZ3A 1RPXA 4B4HA 5C9ZA 4NNCA 5LIKX 2AKMA 3FJ6A 2ZRXA 3GIYA 3CK5A 1RCQA 4JN8A 1TV4A 4DF1A 3WUBA 1SZNA 3UR5A 1EHAA 1FQ0A 1I9CB 2OEJA 4IG2B 3MWAA 3FGCB 2XIJA 3WLNA 4WLCA 1NFBA 4A29A 2OSWA 3U2ZA 3UGVA 3LSCA 4JQ3A 5LIXX 1WDWA 3ANYA 2VEFA 2C91A 3WK0A 4AG0A 2R91A 3OODA 4NYUA 4DJED 1PTGA 1UH4A 2PGFA 1XM3A 1LOLA 3SM0A 3SR7A 3RG6A 3NSMA 3PAJA 1JULA 2YBTA 4AC1X 3G24A 2O9OA 1R2TA 4PTXA 3D46A 3VOHA 7PTDA 4FF5A 4C6LA 1WA3A 2FGZA 1VCGA 3RR4A 3L4UA 4XWUA 3ICJA 2JIWA 3SCOA 3LLDA 3P60A 1W5PA 3UERA 4IP5A 1TV7A 5M3WA 4HNOA 3PM6A 2OU4A 2D2JA 5IBXC 3K5XA 3IIZA 1KLZA 3BAWA 1QBBA 5CCZA 2FZDA 2DZVA 1JD9A 3W7RA 4HHLA 3EXSA 5AN7A 3B8IA 4L1WA 1FWRA 1Q6CA 3B0PA 3GK0A 2YL6A 4AFYA 3CT2A 3UPWA 5CZTA 1DL3A 3MV01 4ZOAA 4C7GA 4FP1A 5AYYA 1UWTA 1YW1A 3N9KA 4PTNA 1H7OA 1VENA 1MVYA 1KFWA 4WD0A 3UWEA 2GJRA 1GNXA 2YL9A 4ZQNA 1ADDA 2J77A 1QW7A 1IV8A 2HBVA 3U9IA 3EOOA 1XIIA 2BZNA 3MUAA 1B3ZA 3CXOA 2BY1A 4XKMA 4K1GA 3NEVA 1GTHA 3INPA 1NIUA 4Q3MA 4AD1A 5HR6A 1O1HA 3LCLA 2EJAA 5MKGB 1AD4A 2HWGA 4LAZA 2XIMA 3SY5A 4CNPA 3C0SA 1MDRA 4DPPA 1VEPA 1Q66A 2G4JA 3ONBA 1REQA 2ATMA 4JOMA 4KGJA 4JKMA 1Q65A 3RCMA 2CW6A 1RBLA 1UJPA 3ZJ7A 3LLXA 3C6CA 2V82A 3AIUA 4RX0A 2ZBTA 1SVDA 2OXNA 2WKJA 1QR7A 3EX4A 2A79A 3WX7A 2UY4A 1F07A 1YHTA 4AZIA 2GGHA 1F76A 2PI6A 4PULA 2FFCA 2VMFA 4MLRA 2FVMA 4JIEA 3THDA 4O1FA 2QCNA 4HU0A 1E51A 4QJ3B 1E40A 4H9UA 4F66A 4UCFA 1ZCCA 1LOSA 4UFHA 3ZLHA 3CQIA 4MSSA 1NWUA 1ICQA 5A8OA 2FPVA 4PMDA 3VI2A 2DZXA 2HE5A 2PU1A 2INZA 3LCWA 3QOKA 4MZYA 2GJNA 2GOKA 5BXPA 2G3NA 4FF7A 2OYLA 4AD2A 3W7JA 3TEVA 3VD4A 1S1RA 1B5TA 2PTZA 5KZEA 2WVVA 2XN0A 4IPPA 1YDNA 5TBOA 4XBKA 3IGSA 1OSEA 1U2YA 4L65A 2OQLA 5AHLA 5K4ZA 4PUJA 3W2NA 1WKEA 2A5HA 3I6EA 4ML9A 1UP2A 5JH1A 2GZXA 3S83A 1EEXA 3ME3A 1XYFA 4KWWA 2Y1HA 1R9YA 3UWZA 2VOMA 4S23A 4H01A 3KWXA 1W9BM 1AD1A 1W31A 2ZZ4A 3LM7A 3O6AA 3GWQA 3CHVA 1OFRA 4JX6A 1HUVA 1GHRA 3AYSA 1RH9A 3QVQA 1K8ZA 3FIGA 3ZT7A 4MKSA 1CLKA 4A8IA 5A6MA 4BJHA 3MUZ1 4QG8A 2JBMA 4GUFA 5AFDA 2P53A 4D6EA 4I7VA 4C6CA 4AZ6A 1Y7VA 2RHGA 4P8VA 3VKKA 2CHRA 2DT3A 4ZA0A 1E56A 3JS3A 2BWGA 4GUGA 3I68A 1ISXA 5LIWX 1A0DA 1NQKA 1AH3A 1E6NA 1K4GA 1NM9A 2E1WA 2HSAA 4HT3A 3USBA 4IPIA 4AIBA 4E4UA 3QGVA 5F2IA 1VLWA 1XX1A 1K6WA 2NQJA 4DLFA 3WMBA 3GAYA 3SQMA 1XLFA 4W7UA 4F40A 2XYLA 1R85A 1GOQA 4HOWA 3QPYA 5GPRA 5DEZA 3TONA 4Y8EA 2YYTA 2E3ZA 4AF0B 2ONEA 3K4AA 1R47A 2H6RA 1S2TA 2NQ5A 1LBMA 4EF8A 2NZLA 3KDOA 2VGFA 4HCLA 3UJ2A 3C3NA 1XH2A 2GLKA 3S9ZA 4UNLA 1KKOA 2PDUA 2ZX5A 2J66A 1A5KC 4GHRA 4GWEA 1YQ2A 3JZEA 2ZTJA 3SCVA 3GXMA 4YTRA 1GYNA 4GQ0A 3HTWA 4LYRA 3MCNA 1H1YA 4Q22A 4GJJA 1RD6A 1Z8AA 1H50A 3PPCA 1UHVA 1WDSA 3TN5A 3WNOA 4H6KA 3RDKA 4LT9A 1QCWA 1OC5A 3WBXA 3NNTA 3F5JA 3BMVA 3GC5A 4O8AA 1GVSA 4ZB5A 1JDAA 3ZFHA 2BTMA 1RLDA 3ALGA 4ZOBA 3U57A 1ZFJA 4C6BA 1OYCA 1E3XA 1UMYA 3MDWA 2CKRA 3VD3A 1E15A 4J2PA 5G4EA 4X2PA 1V6YA 4AVOA 3QOMA 1PHWA 4AD0A 1AL7A 1M04A 3E0VA 1BWKA 4HCHA 2YCIX 3A24A 5EB8A 5LNRA 4MUZA 3UZWA 1KWKA 1FA2A 1OK6A 3ARQA 1CENA 4PUUA 3MUCA 1US3A 4UFKA 1UC4A 1D2KA 3WO8A 4CN4A 4JIQA 4O18A 5MKGA 3VUSA 3M47A 3ZOAA 1BKSA 3FAXA 4M24A 1X8FA 3B8VA 1D8CA 2XH4A 1E5NA 1W3JA 2IS7A 1KM2A 1E4IA 2YZ5A 4JN7A 3IV3A 4UTIA 5H8MA 2AQOA 1MUMA 3TFCA 1UZ4A 2Q71A 1MRAA 1V51A 5CC7A 4HA3A 4MYAA 3WENA 3VCRA 3AXHA 4X63A 3TMQA 3B9NA 4CD7A 2NUWA 1TPFA 3S9YA 1E3ZA 3G1VA 2RDWA 4RW5A 2QPXA 3EXRA 4OT7A 3IIOA 4M3PA 1CWYA 1EH9A 3T6CA 4R53A 2ZVRA 4JCMA 2J24A 4GVIA 4MM1A 3AHTA 1PTDA 3BLKA 1N82A 3CTLA 4EWJA 3SGGA 1W1ZA 1V6WA 1G4SA 4AWEA 4LBSA 2Y61A 3B9AA 3CPRA 2JF7A 4PR4A 5M2FX 4PMQA 2CETA 4UTKA 3CZLA 1XYAA 1Y5WA 1EA9C 4RE3A 1R30A 4MJ2A 1SR0A 1ME7A 3TTQA 2Q01A 2C79A 2INFA 4L6HA 1QWKA 4IL0A 3KTCA 3R1ZA 3NYDA 1SJDA 3SDOA 2PS2A 4MWAE 3FYOA 3W7NA 1TREA 4FX6M 2OKOA 3WFZA 3NQEA 4MY8A 2DZTA 3EPMA 1TUXA 2HXUA 3H2AA 5HMEA 1IGWA 4HK5A 3H54A 4DZIA 3NQ7A 2VEGA 4ACZB 2G97A 2WZIA 1KCXA 2ZE3A 3W1TA 1ZPTA 2B81A 5EFFA 5G4WA 1WDRA 1DV7A 4WKFA 3W71A 1GOWA 1HNYA 3S47A 3GKFA 3RO6A 3MVIA 4L4OA 1LDCA 4TTUA 2DFAA 2DH2A 1YX1A 4Q8MA 4QBXA 3CUXA 3BTNA 1M7JA 4JXCA 4PMXA 3W2MA 1A53A 1M9HA 1N8FA 4PUMA 4UZSA 4E8GA 4Q8VA 3UPMA 2XVKA 3HJEA 4JQ4A 4C65A 1B54A 3LRKA 3CH0A 4DVOA 3W24A 3QYQA 1AL8A 4GCXA 3LPGA 3UESA 1CLXA 2W9MA 3BLDA 4XAFA 3GVRA 1J2BA 3CV1A 4YCPA 1JZ7A 4Y2WA 1QTWA 1S3HA 3ARSA 3FDGA 5E6YA 2V9DA 2BVDA 2CITA 3BAJA 2ZDSA 2ZXQA 4IL2A 1OF8A 2AMXA 3GRIA 4HHPA 3RO8A 1K7EA 4AF0A 3FHQA 3L4VA 1KBIA 4MDOA 2EKCA 2GSJA 3GR8A 2BODX 3R79A 3Q67A 1XJBA 1V02A 1B1YA 4NNBA 4GIYA 4ACYA 4HYWA 1FHUA 4F0MA 4UFLA 2QJGA 4JKKA 4XZNX 5DANA 3GXFA 3A3HA 3OLEA 3W7KA 1FDJA 1XCWA 5IBXA 5HULA 5FEXA 2EPMX 1RZMA 2CLIA 4FALA 3ZLFA 1SR9A 1AMKA 1G94A 1LM1A 3L21A 4WJEA 4ZBCA 1G5AA 2EHHA 4MPKA 1R3RA 2I16A 3NXFA 1AUSL 1SQ7A 1BYBA 3ID7A 2ACSA 2ICSA 3QGKC 1GZGA 1Q85A 1FP8A 2Y7GA 1ISVA 3UG3A 1SW7A 1VCFA 4J28A 1M3UA 2WJZA 4WEVX 5SWUA 1X1ZA 1WDDA 2VEMA 4JR5A 3VD9A 3IVTA 3U7BA 3WDRA 2Z00A 2E67A 5C9XA 3U0HA 2ZUWA 1F5ZA 4ZODA 1LUCA 2ZRWA 3N34A 1AH0A 2FB2A 3TTYA 3WLKX 4LB3A 3Q2DA 4ML4A 2GJXA 4KCTA 2J13A 3KCOA 4KCVA 3IIXA 5AYZA 1T6MA 4ROPA 3AXKA 4N6FA 4D6JA 2XZ7A 3BG5A 4PTWA 1GCYA 1KXHA 3ARYA 4UR7A 2W91A 2WLZA 1FUYA 1JCTA 3EMZA 4F0LA 4Q4SA 1Q6DA 3FEMA 1AQ0A 3NZQA 3LERA 5AY7A 1EJWC 3DHPA 5FJIA 3G3DA 1HTIA 4NY2A 2BNJA 5C8BB 2ZRVA 3CHEA 2JQXA 1K1DA 2E7FA 5DELA 2RDTA 1AMYA 2DW7A 4XKYA 4ZOCA 2NX3A 1I2QA 4MHBA 4CLMA 1FXPA 4CD4A 3P14A 3W7CA 2YDQA 1TMQA 1PX4A 1RPKA 1JZ8A 4P5UA 4LRSA 1FTXA 5BMXA 1XBXA 5EMLA 3QFWA 5CAHA 1VIZA 3PJXA 4LF2A 1A5UA 3KL3A 2F6KA 2FH8A 3GIQA 4O13A 4EF9A 4UQBA 4MDPA 3V5FA 4Y9NA 3FEQA 4I9AA 4PUWA 1DJIA 3GTIA 3OYXA 3C5QA 3B0YA 4Z1BA 5LA0A 1PVNA 1P0DA 1C8VA 1YXDA 4NU7A 4DIAA 5CQ1A 4D6DA 4QIUA 4NZJA 4JYDA 2HEJA 1B30A 1H7NA 2WM0A 2OLSA 3FV9A 1UQZA 2VCAA 4K39A 3V36A 3NA8A 1DE5A 4GUHA 1QNPA 4HMEA 2OLHA 4KGLA 3O7UA 2PUZA 3AWNA 3LUTA 4Y6GA 4BF9A 4QXIA 1KCKA 4JL1A 4BI6A 3FJLA 1DTNA 2XFFA 3S2LA 3REQA 3W86A 4ZTXA 1V3KA 3P5ZA 3GH4A 3R8RA 4E2OA 1OK4A 5CSSA 1GOIA 2FTWA 3ERPA 1GG0A 1IHIA 4IIHA 1C91A 1CECA 2C16A 1J93A 2Q6ZA 4QCFA 1TV8A 3ABRA 4H7ZA 3GD6A 4UTTA 4LH8A 1H7RA 1RA0A 4M6UA 1A5BA 1PCWA 5DT5A 1HKVA 5DCBA 3LNPA 4MKNA 3H24A 4LFYA 1DJYA 3W74A 1EX5A 3N11A 3TSMA 5AHMA 3WBYA 3F7JA 3GNDA 1V3IA 4QS6A 3B0VC 3KOYA 4F0KA 2W67A 4GBDA 4M29A 4GQBA 3GXDA 4TR9A 7TIMA 2NSOA 3D6NA 4PB4A 1EC8A 4NT0A 5EMUA 4M56A 4YMZA 3H4GA 4LUTB 1HW6A 3SRFA 2ABBA 2OQHA 5T8GA 3ITXA 3PZIA 4ZB0A 3KBVA 2ANUA 4MY9A 3AXMA 2YBVA 5U7SA 5DFAA 2OSXA 4I5UA 3FDKA 7XIMA 4U2ZA 1KTNA 3CEPA 3WH9A 4PN2A 3PBUA 2XVPA 1OCBA 1GYLA 3A47A 4JFSA 1J79A 3LHZA 4K2SA 3CM4A 1QHZA 3BLFA 3OG2A 3FSTA 3MCMA 4PMUA 3RU6A 2ZX7A 3NTYA 3HU7A 2A0NA 4GVGA 4YNGA 3SUTA 2VZUA 2D0FA 3COTA 1E55A 1UR3M 1U83A 3TC3A 2D3LA 3M5VA 3W7GA 2Y89A 2OX4A 2DUXA 2CHOA 4E2VA 3UZJA 3IEBA 3WYZA 5FF4A 3KRBA 4P7LA 2H90A 1B3VA 1GPWA 3PBGA 1TPC1 2NLIA 1XI3A 1UH2A 1NJJA 2ZCGA 2AAMA 4O1CA 4W93A 2FTYA 1KGWA 1PZ0A 4QSHA 4F2UA 3WFAA 3CL6A 4AIEA 1RAKA 1W9XA 3F2CA 4FXRA 4N7QA 4HSOA 3OZYA 3MSDA 4YL2A 3LHWA 3BGGA 2Z7GA 4MAZA 3ZR5A 1OCNA 5KZ6A 4GK8A 1UKQA 1AQMA 1VS1A 2WZEA 4G2DA 1Z42A 3VNIA 2A3LA 3W7EA 1HJVA 1OY0A 4S3FA 2Z26A 5ENLA 4DYEA 3SIMA 2PURA 3NDOA 4JTRA 4O1DA 4U5KA 3SGZA 4IM4A 4TX9A 1YXCA 4LC8A 1FWNA 1XLKA 4WIWA 1ALDA 4RPQA 2PZNA 5CZKA 1G6CA 1H1NA 3GNNA 4QSFA 3XIMA 3BH4A 3CWNA 1EUNA 2W4XA 1W8GA 1ADSA 3CYVA 6ALDA 3NGJA 3WNLA 3BURA 4H1ZA 1TWZA 3TNBA 5H2ZA 2DJLA 4JICA 3AHZA 3TQVA 3BLEA 2WWCA 2VX7A 2Z1SA 2D2OA 4XQ6A 4CNUA 4DLMA 4GRSA 1YPFA 4S3KA 4Q6JA 5C6MA 1YIXA 3P82A 3OZPA 4HPXA 1C8YA 4KBXA 3GDBA 4REQB 3FKRA 1XG4A 1MW2A 1PHQA 4Q33A 3F5KA 3SCNA 4ZR8A 2I9EA 4R7JA 1BXCA 1TZZA 3FY1A 1NDZA 1C8XA 2J6XA 2WZMA 4CU6A 1RK6A 1S2UA 5LHFA 4ROQA 4B91A 2PRLA 3UR8A 3C2YA 4PL1A 4W7VA 2TRSA 3UXAA 4DXKA 2BHUA 3L4TA 3STCA 3OGVA 1FWIC 4WKHA 4W5UA 4E38A 2Q3OA 1JAKA 1CLVA 1M7XA 5BMWA 1EL3A 1UA7A 3BSHA 1JI2A 3SGUA 3NURA 2YXOA 1MNSA 4X2RA 5HUOA 2J47A 1EFZA 4GY7A 5DY3A 2ALDA 1JVNA 1I2RA 1HJQA 5C7HA 1F8IA 1UD6A 4HCDA 3BOXA 4CEUC 1R46A 2R6OA 4IZGA 3W84A 3SJ3A 3H7VA 4MNMA 1OFQA 5BU6A 2X1RA 1WE5A 4AYSA 1ISWA 3N15A 2AGTA 1CGXA 2Q8ZA 5I3DA 1XSIA 1EZWA 3F2DA 1KGUA 1OGSA 4UQDA 3N2XA 3NOYA 4O53A 3S1XA 2X40A 2HK1A 1KQYA 3G1SA 3UP8A 2E28A 5D30A 1MZRA 5H8UA 4AD3A 1RBAA 1J6PA 2ZQ0A 2PA6A 2E6DA 1JDFA 3M0IA 4MG4A 5F2MA 3B9EA 4IPNB 3VMNA 4AHPA 3BICA 4LEQA 5HQEA 4HYRA 1AA1B 5HK4A 2ABAA 3AZRA 2RGMA 3C0JA 1K9TA 3BV7A 3DOPA 1DQXA 2J62A 4KS0A 4CCDA 1V6VA 4GA8A 1SGJA 3NQAA 4ENLA 4H8NA 3E5BA 3OP2A 5CSUA 4DO6A 3LD5A 1DIEA 1V77A 3WF0A 2VP8A 4AVFA 3Q65A 2GDUA 4L61A 1C9WA 4M51A 3QY6A 3TNOA 2ZWYA 2WSKA 2EG8A 3QY7A 4V2XA 1Q8AA 4GH3A 3WJXA 3AC0A 3VNLA 2PSNA 4S3CA 4B5TA 3G0SA 2ZIDA 4JYFA 3I3BA 5REQB 5A2BA 4GYJA 4WY0B 3C3UA 3L0KA 4AVNA 5JVLA 3PANA 1X8CA 2I56A 2JKEA 1EKOA 2CZFA 2PCEA 1NY1A 4TIMA 5JMUA 5KINA 1O66A 4Z1AA 2GWNA 3XISA 4IP4A 2Y6ZA 5FESA 1HO4A 4GZJA 1M01A 3UG4A 4DI9A 3TUUA 3O15A 4D6IA 3N4EA 2Y88A 4GE8A 4CKQA 3WG6A 3N29A 5EY5A 3H12A 1G9HA 1NOWA 3QW4B 1OC6A 5KZDA 3T81A 3SCQA 1ZLPA 2V5KA 3BOLA 3WLTA 1ZAIA 3E96A 2WSRA 3DERA 1L6GA 2GVJA 4JNYA 1QPNA 3M5ZA 1UBPC 1ITQA 3USZA 1V3MA 4HJFA 2TYSA 4OUIA 1T40A 1UD2A 3A12A 4HVXA 2ATSA 4RV8A 3T0DA 1XF0A 4XV0A 2NVCA 3SRHA 4BQ4A 3N4FA 4JTDA 4XVEA 5C2GA 4UQEA 4LEFA 4GACA 4GUJA 3N4AA 3NPWA 2XM2A 3UVAA 1PIIA 3GH5A 1BYAA 3ITLA 4DNHA 4ERIA 4GPNA 3BCFA 3SY8A 1XRTA 4WR3A 2BHYA 4K8EA 3T0BA 3Q37A 4IP7A 4NI8A 4LW7A 3W1QA 1O5XA 1NH6A 5FSDC 3W25A 1PTAA 1EGZA 1XQLA 3R25A 1Q2RA 3W6YA 4A22A 3UR7A 2BMBA 1UR2A 4FR1A 4RZ6A 3M0YA 2CHNA 5KTLA 1ME9A 1PIFA 3CL7A 4O11A 4O8RA 5J5DA 3OGRA 4F8XA 5LXEA 1JL8A 4WDXA 1VQTA 1TPH1 3NCOA 1OX4B 3WEZA 4REQA 4FX7A 2GVYA 4IMFA 3W73A 1FWDC 1DXEA 3KVJA 3KOFA 1OD8A 4U28A 3NQMA 3PWAA 3W2LA 1ZP3A 5FCZA 4A3UA 2H9AB 4BQ5A 2E9BA 5BOFA 2BVTA 3GS6A 4FLRA 2DV0A 3KRUA 1BVNP 4NZ3A 3T2OA 4JIIX 4UZUA 4QGCA 3CPGA 4XTIA 3AALA 1K8YA 4LNCA 5JU6A 4QQUA 4HBKA 2NVAA 1QUMA 1Z7AA 3HO8A 1JZ4A 3B4UA 4NASA 3LTSA 5CZJA 3OVGA 3MDUA 3NPUA 4G9PA 2X0SA 3TA6A 3LV5A 3VOJA 1YPXA 3AXIA 3NUKA 5FAJA 3ZR6A 2XFYA 3E38A 3AS0A 4BA0A 3TXVA 2WNZA 3PUEA 1UZ1A 3R12A 3EWDA 3I3DA 1UOZA 3QKEA 1UWAA 4AHOA 4MB3A 3VGFA 4P8XA 2FKPA 4Q8TA 4YVPA 4L9ZA 5DMMA 1A0CA 1SZEA 1LLZA 2WMFA 3M5YA 5AYIA 4AUBA 1M53A 1EC9A 4PEEA 1F7BA 3W75A 4PMVA 2F2KA 4O1BA 1SJBA 1EDGA 1H5YA 1GJWA 4UXDA 1O95A 4J4KA 3GDLA 2OJPA 3MMWA 1Z6KA 4A35A 2VR5A 3KWSA 1FWAC 4JTEA 3DBNA 2PBGA 3PSVA 2QNEA 1QO2A 5G2HA 3Q58A 3TDFA 2BXYA 2YCLB 5E09A 3G0XA 3KM8A 4DB7A 5A2CA 2GJPA 1KCLA 3AU6A 5C5YA 1K7XA 4WUIA 3ATYA 2O0TA 4C90A 1TMLA 3VVGA 4IPJA 1P0KA 1A0EA 2ISFA 1EP2A 1SO6A 3BQ5A 1XLEA 1K70A 3E49A 2WQDA 1AW2A 3W0KA 3L4ZA 2OWWA 3M7WA 5CGTA 3FXYA 5I3HA 1IEWA 5I2UA 4H9YA 3U2EA 3MI3A 1TTQA 1G4EA 5HNTA 2ZC8A 4FEZA 2QJNA 3K2GA 3DXIA 3PJWA 3AIRA 3F03K 3OJGA 1PEZA 4CGTA 3EA1A 5F4WA 4H7CA 4DYJA 2UZ9A 4NRSA 3PUOA 1EWDA 4B9YA 4KH2A 4P8WA 3V5OA 3ARPA 3EWBX 1UPPA 3OBAA 1XLMA 1SFTA 3EKZA 3UWQA 3I6RA 3M0VA 4JGDA 3QKZA 5REQA 1W9PA 3LXBA 4WDUA 1FCBA 3SCPA 4P7QA 4CD5A 3T05A 2J7DA 2P50A 3S9IA 5DLCA 2BSLA 4O54A 3UZXA 2J27A 5I3JA 4GNVA 1C90A 4M0XA 4TVUA 2A7PA 4DN1A 2QDDA 1OD0A 7ODCA 4JPGA 3L4XA 1AFSA 3V0TA 1L9WA 3NQ6A 1C92A 2ZUMA 3OA3A 2B7PA 4NVTA 3RX2A 3NG3A 2HVNA 3G1XA 2WBKA 2B4GA 3UZ5A 1TIMA 3MJMA 1EJUC 2IKJA 1BQCA 1NWSA 3ZVHB 1GPFA 3M0LA 3G3MA 2W27A 4FAMA 3T8LA 5KZMA 3HFTA 5AVHA 4IIEA 4CVWA 3LS9A 2GPTA 3WLHA 1RBOB 3CIXA 2BY2A 5AKQA 1HL2A 3PJUA 5BXRA 1QHOA 5EPDA 3QHOA 2X16A 3N2CA 3VIJA 2XISA 3A3WA 4US5D 5F1VA 3QSRA 2EXOA 2JE8A 3V75A 1QI5A 3AIVA 4C91A 4I8DA 3KZPA 4NNAA 3E2QA 3ZM8A 2XSAA 1IXNA 1O60A 4NAEA 4DAFA 2F9RA 1E9IA 2CERA 1TO3A 3L66A 2Y7EA 4POCA 1E6RA 4PUEA 3CC1A 3PTMA 4Z2HA 3M9YA 4DHGA 1WPCA 3M0HA 2C19A 1DXIA 4WXYA 1GYMA 1IR1A 4P7OA 2P0OA 1JR1A 3VDBA 1ITCA 3QLLA 2FZMA 3S42A 2BXVA 2OR2A 2OELA 3N18A 4U10A 1EJVC 4TMBA 2DJXA 2RJGA 5IXEA 3V18A 4JDBA 1UIOA 3DN5A 2WC7A 2CZEA 2RH9A 1BSIA 4Z2JA 4FIRA 1GVQA 3TR9A 5BNKA 1H61A 3AIWA 4UTMA 2TODA 4C6NA 1NAL1 5LA2A 3CLWA 1CB2A 3W7LA 3VM5A 1EWEA 4C1LA 1TJRA 1GG1A 3AJXA 2PWVA 5D37A 4QLLA 3MJYA 2Z25A 3I65A 1KFLA 1VEMA 5D05A 3T42A 3TYAA 1MQRA 3KHJA 2E6YA 3TW9A 3QHNA 1FWHC 4Z2IA 2DU2A 5BROA 3GIPA 3PTQA 2Z2AA 3WUFA 1E4LA 1XLHA 3T44A 1G01A 2YB1A 3RF9A 2DVXA 5E9XA 5ECVA 3W1RA 3DH7A 2DZSA 3ZWSA 2J7GA 1WNOA 5BRQA 3WELA 3OGSA 2B7OA 5I5RA 5E5CA 2E5DA 3R94A 3DI0A 4Q8PA 3OO2A 2GUUA 3DYPA 4M5PA 4WK9A 1XIHA 1X97A 3PFRA 1K8XA 2I57A 4LAKA 1VBUA 4L4MA 1GHSA 2FZNA 4JTTA 4E6MA 1RA5A 4MFEA 4NZ5A 1UMLA 4IJCA 1UROA 1WKFA 2EPKX 1R5YA 1FP9A 4CNOA 2V3DA 4XIMA 4AAJA 1WKYA 4GYFA 3WQVA 3DGRA 1WXZA 5I07A 3NJ3A 3O6DA 4PE8A 3OU8A 3UCDA 4PMOA 1ZJHA 4EIVA 1BRLA 4GJIA 1CBGA 4MGGA 3LPOA 3WD1A 3DG6A 3LI0A 4HD5A 5AZ1A 2YDSA 4MYXA 4D1JA 3G1RA 1TRDA 2QCLA 1VFFA 4DEFA 4H6EA 2AGKA 1NF0A 1ZTVA 3VUPA 4IXXA 1DXFA 2BB0A 3KLKA 1XBZA 1GJPA 3VKAA 4D6CA 5BCAA 3AYVA 1GTEA 1LLWA 4TX6A 1VBRA 2VCCA 3TX9A 2OB3A 2YCEA 3GVGA 3OVPA 1C7TA 4LVAA 5D2VA 3RJYA 1JI1A 3UWUA 1UQYA 3H4WA 3UY7A 2GSEA 3TMLA 1Q6FA 6TIMA 3VGGA 5IDIA 2WMKA 2PP3A 3S5SA 3QN3A 4PUNA 3N14A 1FFQA 3PJTA 3R8HA 2V38A 4JKLA 2V2HA 2UY3A 4LQ1A 6PTDA 4C6OA 4IGSA 4DUOA 4S3GA 1KR1A 4E8CA 3VGBA 3MS8A 3G0UA 2Y4SA 4GISA 2XDFA 3DKLA 1W1PA 4C1NB 4LUSB 1I8JA 1KD0A 3TTEA 2WJEA 1XIEA 2W62A 1XP3A 2C14A 3LHVA 1X7IA 1XFCA 3V16A 4UOQA 2GJLA 1JF6A 3A3XA 1DJHA 1ENUA 4UQ9A 2PDJA 3VDCA 1UBSA 2YDAA 4XBJA 4UMBA 1NSJA 1UUQA 4W85A 1HN1A 3DU0A 5HDRA 2AL2A 3R2GA 1V6UA 3IACA 2GK1B 2QVHA 4HIBA 3S5ZA 4DO5A 1S2CA 2Y62A 1VFSA 1E5JA 3C2VA 3IWPA 3RPDA 1CX9A 3G5EA 3VFCA 3KUMA 1O5RA 2UV8G 2FLIA 2GVLA 3KX6A 4RE0A 3E0IA 1BWLA 3ITCA 3W7PA 3UWVA 1DIDA 5CBJA 4LCRA 3LOTA 3ABQA 4LXFA 2ACUA 1EP1A 4LYQA 4Q4RA 3VMPA 2DT0A 3SJNA 5U4NA 5HJYA 1QOQA 4L4PA 4F79A 1E6ZA 2V6AA 8XIMA 4W8LA 3DYMA 4A8LA 1XUUA 3EWCA 2TMDA 1J0KA 2R8WA 1Y0EA 3R4IA 5C0QA 1TE1A 1KRCC 1RHCA 1L6SA 4NKCA 4BCEA 5I77A 2EPNA 1N2VA 4E4FA 2WB5A 2C0AA 3P67A 4KERA 1FWBC 3CMFA 4J27A 4D71A 1N55A 4ORIA 3PP7A 3UA4A 1VIWA 4O57A 1YEYA 4ZO9A 1BYDA 2GQ9A 3EWWA 3GXNA 1B0IA 3GZ3A 3MCOA 3BPWA 5GJPA 1GKPA 4LY8A 3LTYA 1YDOA 1JGMA 2GVEA 3HG5A 3L12A 2RUSA 3ECQA 4HZMA 4IICA 5IHRA 3CUIA 3KS6A 4LS2A 1JUBA 3EDJA 1IWBA 1FBAA 5D04C 2Y24A 3NEHA 3C2RA 4R34A 4R3UA 5XINA 3BZJA 3EOLA 4U4MA 4OKDA 2BY0A 4QEEA 2FVLA 1XIFA 3A4JA 4E3TA 3BUVA 3PB2A 3MUIA 5LZLA 5A2AA 4NXSA 1UOKA 3DEQA 3EDFA 2YL5A 5F1UA 5ABGA 2TSYA 1GOXA 3ARTA 2CLHA 3GHUA 4IX2A 3GU2A 3NZGA 1VZWA 4K3ZA 6REQB 8TIMA 2MUCA 1EC7A 1L6FA 3QXBA 4PB3A 2QJMA 1NF7A 2WBGA 4BI7A 4H04A 4WOQA 2XUCA 1BAGA 3BG9A 1RV8A 2XVGA 2PC8A 1UWQA 3NWRA 3CHFA 3GXIA 4JQ1A 4KQNA 5I24A 4O0ZA 4JBRA 3BOFA 2PDGA 2Y70A 2VEKA 3DHUA 4KEVA 2WVUA 3BZGA 1E4MM 4IMDA 1DPMA 1VPQA 1OADA 2A2IA 1K3UA 3W38A 2Y5SA 3QV8A 2Y2WA 3WLLA 3GNRA 4XAGA 1AJZA 9XIAA 3PZ9A 1O7AA 3PK7A 1XYCA 2FGLA 4G7FA 1KLYA 4LUYA 1IT7A 1GW9A 4R27A 4ATWA 2Q8XA 2WMIA 3DHDA 1SMAA 4KWSA 1ZJBA 1WZAA 3CV6A 4LV4A 5A6LA 1J0ZA 4J40A 1RLCL 2NW0A 4LBUA 3NGFA 4LC6A 5T26A 2BXZA 3SBFA 2VELA 3B04A 5DRIA 5HATA 3TYBA 1FCQA 3B0XA 2PMQA 1JG9A 3J7HA 1TV3A 5M1TA 2IPFA 1JF5A 3I4EA 2HNHA 4WOZA 3QQ0A 4OE7A 3NFUA 2QV5A 5TNVA 2XFRA 4B3LA 2QS8A 4MJZA 1Z9AA 1UWSA 4KRUA 5E70A 4BQ3A 4PTDA 1ZBWA 1GORA 4TMCA 3TOYA 3IIVA 3C86A 4MWAC 4PCPA 5E93A 1HL9A 1Z44A 1AW1A 3VNDA 4YU1A 4QITA 1GVOA 4S3DA 1TTPA 1WB0A 2YCJA 4X0VA 1DHPA 4ORMA 5CJMA 4GD0A 1FH7A 3I7RA 1VFTA 1F3WA 2BFGA 1O5KA 3NQCA 4J3VA 1VLIA 4X9SA 1EJ7L 3WJZA 4BS0A 1N7KA 3FX4A 4H7VA 3BAXA 4GUIA 1ODUA 1NDWA 1NELA 2W92A 5A6SA 3VKCA 3DZ1A 4HMCA 2CXEA 1PYMA 4RLIA 3LCGA 3EKLA 3GSMA 1FH8A 1NFGA 4MAVA 5I3IA 1JFXA 5HJLA 5A8PA 2VZSA 2ZXDA 1OB0A 3W81A 4MNKA 4HA1A 3CO4A 4K7VA 3FOKA 1E0TA 5M5DA 4CD6A 3CUHA 4I90A 5AHFA 3O05A 2ZZ5A 5I78A 4E3VA 1HL8A 4GC4A 5IFPA 4CCEA 4IMCA 4M7TA 4M81A 3IAQA 3DESA 4M6QA 3XINA 1FWFC 3AI0A 4ES4A 1TMHA 3M4HA 3GTNA 1JEZA 4RDVA 2J7HA 4GC3A 5K2ZA 3TK7A 2VURA 3VINA 1F6KA 3MSGA 3YPIA 3QF0A 5CPLA 2XWDA 3C8FA 1A5OC 4S3JA 3HPZA 3GDMA 1OCJA 3URAA 5FEWA 2BX7A 1RCXB 1OBAA 1OG6A 3S4TA 4P2VA 1R2SA 2VYOA 4IIDA 3AOFA 1DJWA 3WDHA 1M7OA 2PWDA 3CTTA 4DNMA 5CG0A 3NL3A 2R1MA 2YSWA 2GGGA 4IPLA 5ABTA 4DX3A 2A3HA 4CEXC 1TZ7A 3ZVIA 2ALRA 3T0TA 2DZBA 1A50A 1NDVA 2WSQA 5H91A 4ICNA 2B31A 5LSMA 4C5ZA 3T40A 2ZA3A 4WCJA 1TFVA 3QR0A 1WZLA 4NUWA 1AZ1A 2A85A 1F3TA 4C6QA 4NHVA 3C52A 1MW1A 4Q7IA 4LX4A 1D8WA 5GNYA 4B5WA 4MPQA 3RM8A 1EXBA 4GXPA 4HMNA 6A3HA 1ECEA 4N02A 2CIPA 2JFEX 1HKJA 1XD1A 4H83A 4YCOA 4GQQA 4A6GA 1VYRA 4O0QA 3H2MA 3G1DA 5HWJA 6REQA 1O94A 1XH0A 4ADTA 4GZIA 1RJPA 2CBIA 1MZHA 1GT8A 1TPUA 4ADUA 4D8AA 3LM3A 2J9YA 4LGXA 1Y65A 4L9XA 3F4CA 1FWJC 2PF0A 1EBGA 3KVKA 1RCOB 3L23A 3TR2A 1TZ9A 3LV6A 2DY3A 2HCVA 1VEOA 3CUGA 4J3XA 1BWVA 4PMNA 1FCVA 1W3TA 2YLLA 3PHAA 4EPEC 1UD8A 4LVDA 3CAWA 4GCAA 5IFTA 3T07A 4ZQPA 3CO8A 2Y8KA 4TV6A 3M0XA 3BG3A 4RZ4A 2WOQA 1K8CA 4EKJA 2PTXA 1H2JA 1I75A 4KFPA 2D20A 3LG3A 3R43A 3MI2A 1KXQA 3QR3A 4LAUA 4GABA 3GE7A 2Y7DA 1E73M 1NVMA 5J04A 2P8CA 3TYDA 2D2HA 2Q02A 1NOUA 4R7OA 1JQXA 4PB5A 4PBEA 3UGRA 1QNQA 4JTCA 4Q4PA 2OT0A 1YNPA 3IJ7A 3MC5A 3ORWA 4DJFC 1UB3A 5A69A 1D9EA 5HUPA 5HWNA 1E6QM 1FWWA 3H6OA 2ZUNA 2FMOA 4MWAB 1XIBA 2WC3A 1TX0A 1YXYA 4EXQA 4MKVA 3B06A 5DMLA 4KW2A 4XO6A 4NJIA 1R87A 4AZHA 1SYTA 3NO1A 2VGIA 5G1TA 2CBJA 4N9BA 2ZTKA 1JDEA 4GX8A 1DWGM 2CFFA 3FVMA 3VKJA 4W89A 2WZTA 1PE1A 4N42A 2HK0A 3QJAA 4F0HA 1ZJAA 2ZKMX 3BLOA 2P3ZA 2C13A 3L65A 3MZNA 4CQDA 3VGEA 1IXQA 1W6TA 3NL5A 1Z32X 1MEWA 4FXFA 4J3ZA 2YDRA 4ZVJA 5C9WA 4L6OA 1T0OA 4FB7A 1EO5A 2QCEA 1W3LA 2VD8A 1WZMA 3GX9A 1A3XA 3V0SA 3STGA 3TYCA 3DX5A 2QR6A 4PBGA 1XCXA 3GNPA 3T2PA 3AHXA 1REQB 2H8XA 4ZFMA 3DBPA 2ZRYA 4MJ4A 1LWHA 3OPSA 4O1EA 4EP8C 1L6WA 4BWLC 3L5MA 2PC4A 3IJ6A 2A6LA 4HP5A 1JXJA 3MYPA 4PC8A 3LK6A 3EWZA 4HSNA 1HVQA 4L4LA 4G1NA 2HQAA 2DSZA 3TP4A 4I6KA 5FSEC 1Z41A 4W84A 3VOGA 4TVCA 4LVGA 2HMCA 3G1FA 3UG8A 3PBVA 3EDEA 2FJKA 1DKWA 1M41A 3GG0A 5HAOA 2GQ8A 1QPKA 3W1UA 1ZUAX 2FDMA 4YLWA 2X30A 4GIEA 4HTYA 1VJZA 3PNUA 4HNNA 1Z89A 4CNSA 3MHUA 1A80A 4XZBA 1P6WA 4U33A 3QR1A 1GVIA 3FNDA 3DG7A 3CQ0A 3E0FA 3WF1A 4H9ZA 3O9NA 4FHAA 4WRHA 4NJKA 1XD0A 3VZXA 2I5QA 5E0KA 1EHNA 4HJWA 4D2JA 3DDMA 2JGQA 2V5BA 5BRBA 1IIGA 4M82A 2W66A 3LBCA 1LJYA 5DT7A 5BWFA 4US6A 4OIFA 2GGJA 2X1IA 1RY8A 4IFKA 2REQA 4DUWA 1PAMA 3DAQA 2EGZA 1CPUA 3MKVA 2QCDA 3CJPA 4E0CA 1BVZA 2YGYA 4KKXA 1W2VA 3IVSA 4JX5A 3F5LA 1C8QA 4PRWA 3BMWA 1ECQA 3PVFA 4GIAA 2QAFA 1ZNNA 2IMRA 3UNDA 3NXLA 4GH1A 2W79A 1XQKA 1IEQA 1WBHA 4UR8A 1K9DA 2PE4A 2XFWA 2VDHA 3U2CA 4H3DA 2DSKA 4FOJA 2QIIA 3UYCA 3A21A 3UZYA 1A5SA 4S2CA 4UIOA 4O15A 1KR0A 1Q6RA 3WLOA 4M8UA 3SN0A 3CIVA 3LCHA 5KITA 3DGBA 5XIAA 3V5CA 1W3HA 2GFTA 3GTXA 3G2GA 3R7MA 3SCWA 3MPGA 1ZRQA 1TCDA 4Q7BA 3VIPA 2A4AA 4ASTA 2PWUA 2W61A 3C56A 2YA0A 5FJOA 2ZUTA 2PGWA 3HF3A 1C7SA 2YW4A 3T4WA 1XUZA 3PY2A 5BZAA 1UR4A 3CHCA 3V0UA 3PZTA 3HGSA 2XM1A 4XAPA 3LTPA 2BGNE 2GOUA 3S5NA 3W22A 4KWOA 4BF7A 1EA0A 1TSIA 4AC7C 2PODA 5FJJA 3W00A 4GYPA 1UZHA 2E1DA 2VZVA 4HK6A 4QE5A 4LY4A 2WPGA 4AMCA 2A3CA 4JTAA 3TH6A 3S1WA 3QQWA 1NP0A 1P43A 1UWUA 1BPLB 4LPCA 5TF0A 1OFEA 4M6PA 4PGLA 2QULA 4KEUA 3TN3A 3RLHA 1W54A 3MBFA 3MBDA 3CV7A 1JAEA 4X60A 3EB3A 3VDHA 2J79A 3DECA 4A3YA 1A49A 5D8WA 1OABA 2OKTA 3EX2A 1X96A 4DWSC 1ZU8A 5TQLA 2FMNA 1D3CA 2E5BA 1R3TA 4YIWA 5AB3A 2R9RA 2GVGA 5AYBA 3AMKA 3AFBA 1WDQA 4AYGA 2PDMA 2UWFA 4S2BA 2Z6IA 2VFDA 2VI0A 4MWAA 1WX0A 5CZSA 3S1VA 4ZXOA 3JR2A 1FWSA 3JW7A 4FOUA 4IIBA 1PDYA 3UF9A 5LIYX 3HGRA 4AZCB 3FA4A 5C9RA 3P2VA 1O4UA 4BK9A 5C2XA 2WSPA 1TRIA 4IIGA 1ZAJA 1QW9A 3AXXA 3U7VA 3PNZA 1UZDA 1W5OA 5HINA 3HJZA 1B2YA 3P5YA 2EJ1A 1AQHA 3AAMA 3RU8X 5GNXA 3W1MA 4K6AA 4J35A 1HP5A 4V33A 2VGGA 2VGBA 1JD7A 1XINA 4B3ZA 1XGDA 1LQ0A 3HPXA 3CWHA 2H3DA 3V7PA 1TVNA 4RDZA 1SO3A 3NQBA 4LYKA 3UXIA 3SCRA 4N6EA 4MF4A 2G4FA 3QTPA 4XZMX 3MT1A 3H2CA 4C6EA 3RCYA 5CPOA 1HQTA 2LLEA 1TTJA 3IGXA 2CLLA 1FKWA 4JTKA 1GK8A 4OV4A 4B15A 4HOXA 2VO5A 1OT2A 2HS8A 4ONVA 4NZ1A 4B2DA 1E70M 1W3IA 2J7CA 2C0HA 2Z1XA 3R11A 4PUDA 4WSHA 1CTNA 1KM1A 3H22A 2BDQA 2YW3A 1LZOA 1WXJA 3AZSA 5L6UA 2V5JA 1UD5A 2F7FA 2Z24A 4N0RA 3S1GA 3ZLGA 1KTBA 2WANA 4AEEA 3RM4A 4GQRA 2G5WA 1HKIA 1NP2A 5BXTA 4TV5A 4DJEC 5A95A 3O6CA 2IKHA 3MP3A 1JNDA 1B57A 1KGXA 2Z27A 3UNTA 3HOJA 3E2RA 1SSDA 3L0GA 3MO4A 2VFIA 1U33A 1JJKA 1KO0A 4YTTA