3L1AA

Structural ordering of disordered ligand binding loops of biotin protein ligase into active conformations as a consequence of dehydration
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
264
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 83
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l1aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l1aA01
4UP8A 4M78E 3EFSA 3RF1A 2YLBA 4UP7A 4M7DC 1I4K1 4M77A 4EMHA 2EJ9A 4PNOA 2JN0A 5LJ3f 3RUXA 3QO8A 4DQ2A 4ZIBA 4M78C 4NL3A 2DTHA 3LSSA 4XEMA 3L4GB 3JB9J 3RESA 4YRQA 1WQ7A 2CJBA 1G51A 4HWOA 5GAN2 2FYKA 4NOYA 4V2SA 4M7AG 1X2HA 3QO3A 4TVYA 4F7UA 4H2TA 4YRRA 4F7UE 11ASA 2DEQA 5GAOm 3JCMh 2VXEA 1ADJA 2ZINA 5K1PA 1D3BA 3NETA 4MMLA 1BBWA 2RA2A 5GANe 2P0LA 5GMKl 4C92B 4MMKA 2DZ9A 1NYQA 3P8YA 3RL6A 2C8MA 4JRKA 1KMMA 4TQDA 3HSBA 3IALA 4H2XA 4YPFA 1EQRA 1EIYB 1B76A 3HXYA 4H02A 3RKXA 3SWNB 4PJOA 1VQZA 4C8QB 2DQ3A 2ZNIA 4JRIA 4PJOE 4XTVA 3JCMW 4X9DA 1BIBA 3NEMA 5GAOr 1JBMA 2XGTA 3JCMf 2ODRD 4PJOC 1RIQA 3A5YA 4QVCA 3R07A 4M75D 2DDZA 3A31A 2DXTA 5ELNA 4M7DG 3HXUA 3QTCA 5GAOl 5GANh 1WYDA 4EMGA 1BIAA 2QHUA 1HXDA 1LJOA 3L4GA 4M78G 1E24A 3QNEA 3MEYA 4P75C 2J3MA 4EMKB 3UGQA 1H4SA 2QHVA 4G84A 1C0AA 4M77G 3VQXA 1Y96B 4P73A 2ZNJA 3SB2A 1U1SA 4M77D 3NELA 3PGGA 5GAMe 4XTXA 4P73C 2QHTA 4XTWA 1GGMA 4CH4A 2DXUA 3QO5A 5GANj 2DVEA 4F7UG 1HC7A 2E3CA 4PG3A 1E1TA 4C92A 3AHUA 2DU5A 4NCXA 4C92E 2Q7HA 1G5IA 2ZZEA 2ZZGA 4K87A 2EJFA 2ZTGA 1H4QA 2AKWB 5GANf 3RKWA 2DJZA 3IG2A 4C92C 3MF2A 3ICAA 2Q7GA 4YRSA 1EIYA 5GMKe 3W3SA 3SWNA 2I4MA 3L1AA 5I21A 4HWTA 4C8QA 4CS2A 3FIFA 1I81A 1B7YB 3RACA 4P3PA 3SWNC 1NJ2A 4M75F 1NJ5A 3NENA 3HRKA 1KMNA 4RQEA 2I4NA 2Q5IA 4PJOG 2CGHA 5GAMh 3LC0A 4EO4A 1YFTA 2C7IA 3RIRA 5HGQA 4RDXA 5C51B 2QTXA 3HFOA 2ZR3A 2CJAA 3A74A 4YRNA 4RCBA 4TQFA 1JJCA 3CMQA 3DSQA 4WI1A 2XTIA 4EMKA 1X55A 1WNLA 1M8VA 3M4QA 4LNSA 2IY5A 2DU7A 1Y96A 4HVCA 4M77F 5LJ3g 3IKLA 3JB9H 3JB9G 1N9WA 3BY7A 5GMKh 4EMKC 2YLCA 4L87A 3JB9D 2VC8A 4XEOA 5GAMj 3HXVA 4YCVA 4YRKA 1MGQA 4YRGA 2G4CA 1ATIA 4RCCA 3HFZB 3EFRA 2HNIA 4M7AD 4YRLA 4UPAA 5GAMf 1ASYA 5GAN4 4CH3A 1B70B 2E65A 3JCMX 2EAYA 5ELOA 2AKWA 3UFGA 2RHSA 4XU0A 2ALYB 1X2GA 5GMKj 5LJ3d 4RMFA 5GAN6 1SETA 4C92G 3V7RA 3V8JA 2Q7EA 4RQFA 4TTVA 1NYRA 3HXWA 4Q15A 5GAN3 4H2UA 1LOJA 4YRFA 12ASA 2VXFA 2QHSA 4J6XA 4E51A 5LJ5e 4CH6A 4CS3A 4KR3A 4C8QG 2RHQB 4C8QD 1SESA 2CJ9A 4XQ3A 3E9HA 4YRTA 3JCMg 3RGLA 3VQWA 3L2ZA 4JUVA 4J6YA 2DKGA 4AH6A 4P72C 4P75A 2DTOA 3HY1A 2ZIOA 2DQ0A 4YRIA 4XU2A 4M7DD 1USYA 4M78D 4J5YA 3V7CA 1EOVA 4M7AF 3PZCA 1YFSA 3HFZA 1E22A 1USYC 3VQVA 3TUPA 3UGTA 1KQ2A 1W66A 4M75B 3JCMd 3JCMP 3VQYA 1B70A 5LJ5h 1B34B 5DY9A 2ALYA 4O2DA 4YCWA 3A7AA 2EWNA 1YCYA 4OLFA 1U1TA 1TH7A 4P3OA 3E9IA 1NNHA 5GAOp 2EL9A 3REUA 4HWPA 4M77B 3V7SA 5E3IA 1N9SA 3QHSA 5GANg 3V8LA 4YP0A 2E64A 1KOGA 3INZA 1EVLA 5LJ5j 1G5HA 4WF2A 3FJPA 1WPYA 2P5IA 2RHQA 4XTZA 4A53A 4YCUA 2ZT5A 1NJ8A 1EVKA 1HTTA 4XTUA 3HXXA 4X9CA 1QE0A 5C53B 5LJ5f 2RM4A 4J6WA 3GIBA 4HT9A 4YROA 2Q5HA 3M4GA 4PJOD 1E1OA 4M7DF 4H2VA 4EX5A 5GANd 5GAOn 2E1HA 4HWSA 1I8FA 4OP0A 1ADYA 3HFNA 4M78F 5GAN5 2ARUA 1H4TA 1LNXA 5GAOq 3JCMc 4HT8A 1FYFA 5GMKi 3HRIA 5C52B 4JLIA 4M75E 1B34A 1LYLA 4YYEA 3QUIA 4DPGA 4A54A 1I5LA 2ODRC 4G85A 1QF6A 3PCOB 4M75C 3TEHB 4F7UF 2ZR2A 1BBUA 3WQZA 3I7FA 1X54A 3LSQA 4P71C 4ZTZB 4KQEA 5KNNA 3JCMV 4QVDA 5GAMg 2ZT7A 3REXA 4H2SA 4ZTUB 1PYSB 2PMEA 2E10A 4TVWA 4P74C 1WQWA 4M77E 2FB7A 1KQ1A 3HY0A 1H4VB 4M77C 3TEGA 4XTYA 2DZCA 4C92D 3M4PA 1B7YA 4M7AB 1YGBA 3JCMQ 2ZGWA 3BFMA 2AMCB 3BDUA 2ZXFA 4YRCA 5GAMd 1YFRA 3KFUA 3V8KA 4PJOF 4H2YA 3A7UA 4P72A 2ZZFA 4CS4A 3HFVA 3BW1A 1B8AA 3BJUA 3G1ZA 1N9RA 3JCMb 1L0WA 3P8TA 4BWAA 1SERA 3ERRA 2CIMA 2RB6A 4XU1A 3JB9F 2ZCEA 3MF1A 4Y91A 3JCMJ 3A7RA 2Y90A 5K1XA 1HK9A 1M5Q1 3PCOA 3TEHA 4H2WA 4XU3A 3UH0A 4M75G 4BW9A 4KR2A 2I4LA 4Q6GA 1EFWA 4K88A 1PYSA 2ZT6A 2I2LA 4TVAB 3RKYA 4M7DB 3QSUA 3QO7A 5LJ3e 4J15A 1JJCB 4TWAA 4C92F 4YREA 4M78B 2IY5B 4HA8A 4N0AA 1YB3A 3IKMB 4M7AA 4P3NA 4M7AE 2K57A 2E41A 2AMCA 4NL2A 4UP9A 4N0AC 3HTZA 1Z7MA 2J3LA 4C8QF 4M7AC 3HXZA 2EJGA 4F7UB 1X56A 5LJ5g 1SRYA 2PMFA 2RD1A 4PHCA 2RHSB 3JB9I 4HWRA 1X01A 1Z7NA 4YRJA 1D3BB 1J5WA 5LJ3h 3RERA 4YRMA 4WJ4A 3P8VA 1NJ6A 3A5ZA 4C8QE 5CAIA 1IL2A 1WLEA 3OD1A 1ASZA 4YRPA 5GAN7 2ZIMA 4K86A 4H2XB 5GAN8 4WJ3M 4M75A 4C8QC 4X5OA 3VBBA 4CH5A 5LJ5d 4YDQA 3JCMe 2ARSA 3FB9A 2ZT8A 4P71A 1H641 5GMKm 2DTIA 4PJOB 2ARTA 2I4OA 4TVAA 4M7DA 3A32A 3VU3C 4M7DE 5LJ3j 1WU7A 4P74A 1NJ1A 5F5WA 2YHTA 4M78A 2E5AA 1JRIA
chains in the Genus database with same CATH superfamily
4UP8A 2BTTA 2DFUA 2M16A 3WVDB 1WXUA 2QQ9A 5DLQE 2EJ9A 4PNOA 5LJ3f 2D6FA 4OMQA 1M4ZA 4DQ2A 3M57A 3NTKA 2KY9A 1AWOA 3JB9J 1TSFA 2O9SA 4HWOA 2CJBA 1AZGB 4X34A 1X2KA 1BCMA 1Q7YC 2CH4A 4RG2A 4TVYA 2QDYB 4NS5A 5IH2A 1OQKA 11ASA 1T3SA 2AZSA 1PKTA 2EPDA 2KT8A 1UECA 1NYGA 3X28B 5K1PA 1D3BA 3QJYA 1VQLA 2A7YA 1VQKT 5GMKl 4C92B 1VQ5T 3P8YA 2HD0A 2A0FB 3RL6A 4JRKA 1V1CA 2MI6A 2X3WD 3D7SB 3G4ST 1M8MA 2GTOA 3VS1A 1EIYB 5FU7B 1ZUYA 2I0NA 1ZBJA 3C0CA 3SWNB 4JRIA 3NEMA 2XDBA 4FYVB 3FJ5A 2GNCA 2HQEA 2HKQB 2YRCA 2RJDA 1GXIE 4QVCA 1RADB 2F2XA 2DDZA 3EHRA 4D8KA 1OPKA 1IRXA 4EMGA 2QHUA 2MYSA 2VB6A 4E7LA 1IHVA 3L4GA 4MDXA 4C0ZA 1VQOA 3UGQA 5CIUA 4G84A 3CMEQ 4P73A 2ZNJA 1U5SA 1AWJA 1IZ6A 2LX9A 3A8OB 2XK0A 1TXQA 2QI2A 3CCRA 5GANj 1YI2T 1NYFA 1VQNQ 3AHUA 1W2BA 3NMZC 2ZZEA 2CKKA 1JJ2S 3E19A 4EDUA 2DJZA 3CCEQ 3GBQA 4QQGA 1UB4A 4HWTA 3L1AA 2RK2A 3VKIA 2RI5A 3OBWA 4DBQA 2E5KA 1I07A 4P3PA 1Q7YU 3FEOA 4RQEA 2J6OA 2KRNA 5I2SA 3OYLA 3LC0A 4EO4A 1YFTA 4BI8B 2QTXA 2B8AA 3I55A 4RUGA 4HKEA 1TUDA 4TQFA 3DSQA 3OB9A 5J3BA 4EMKA 1X55A 1M90C 2J6KA 1M8VA 4HVCA 3G71Q 2EQJA 3BY7A 1QVPA 4OGCA 5GAMj 4OMOA 2AHJB 2VVKA 3U23A 4C0FA 1G3WA 1ZA2B 1M2VB 3H9NA 5IXFA 4YRLA 5A0GA 4UPAA 1K73U 2QEXA 1ZSZB 2PQWA 2CSIA 3VV0A 5ELOA 3UPUA 2XIDA 1G5VA 2O01E 4JJCA 4PL6A 2ALYB 3NTIA 4F16A 4RTYA 4RMFA 1XJWB 2HMAA 3L2UA 2RO0A 3CBOA 3TU4K 1QCOA 1VQPT 3CCJA 3DB3A 4ESRA 2RMOA 2BZXA 4J6XA 3PMIA 1YHQQ 1VIEA 1GBQA 2DAQA 3DKMA 5LJ5e 4CH6A 4E51A 4LVLA 4KR3A 3OYHA 5CCAA 2RN8A 3M59A 2CJ9A 2KXCA 2X51A 2WSFE 3E9HA 4YRTA 4FYYB 1K76A 2EFIA 3HPWA 4J9EA 4P72C 4ORZA 3CCLA 2LRQA 4M7DD 1USYA 2K4YA 1TWBA 4ZN3A 4J5YA 4BE1A 1Q95G 1NPRA 3V7CA 3CCMQ 5ECAA 2MCNA 1UGQB 3VQVA 3CC7T 3UGTA 1TTHB 3JCMd 1ZX6A 3VQYA 3M54A 1B34B 2ECZA 4YCWA 1KIKA 3MEAA 1YCYA 5FWCA 4OLFA 1TH7A 3VS6A 4LNPA 2LJ3A 5GAOp 3GOXA 1RUWA 1U3OA 4HWPA 5GANg 3V8LA 3FDRA 2E64A 3INZA 4WF2A 3FJPA 2L8DA 4XTZA 4A53A 1B07A 4E7SA 1EVKA 1WXBA 1BCOA 1R8OB 3HXXA 5LJ5f 2M0OA 3A8LB 1YN8A 1OU9A 3GIBA 4YROA 1AD5A 2YUQA 4RG8A 2Q5HA 4LUDA 4PJOD 4M7DF 4QQ6A 1BI1A 1I8FA 3HKSA 4OB3B 1H8KA 3RMQA 2KRMA 5GAN5 2HKNA 2ARUA 2W0ZA 1LNXA 1P92A 4KULA 3CXCA 4D8DA 4PJJA 1MUZA 2C0OA 2FEIA 2VGNA 2BUDA 4HCKA 2JZ2A 1GFCA 1UGPB 4FYWB 1NPPA 2NUTA 3CD6Q 2ZR2A 3LSQA 4P71C 5HY6A 1OOTA 5KNNA 5GAMg 4ZTUB 1PYSB 4Q5WA 1N6AA 1WQWA 4M77E 3OYIA 2FB7A 4BE0A 1KQ1A 3UATA 2H3JA 3OYFA 1JJ2P 2DPPB 1JB0E 1HSQA 4OB2B 1VQLT 2GTJA 8ATCB 2L89A 4TVRA 2DZCA 3M4PA 1CKBA 1YGBA 2XU8A 5KCHA 4Y28E 2ZPIB 2ZXFA 3PFSA 3KFUA 4PJOF 4KT0E 1VQKA 3HFVA 3BW1A 2K9GA 3CCET 2F5TX 1N9RA 3JCMb 5GJWB 2OTJA 1BBZA 1UHCA 2L5QA 3P8TA 5AYFA 3CCQA 2F2VA 1GBRA 2H8HA 4QW2A 2CIMA 2RI3A 2RB6A 2ZCEA 3MF1A 4JRQA 1B3QA 3A7RA 1MMGA 5D6WA 4BDZA 1HK9A 1IGQA 1M5Q1 4JJDA 4UC4A 1OX9A 4VUBA 2KROA 3JRZA 3CQTA 4J9CA 3TCJA 4LXCA 4Q6GA 1YIJQ 1QKXA 3KBGA 1U8RA 1KD1U 1PC0A 2F69A 2EYYA 1YWPA 3QSUA 3E9FA 4JDSA 3QO7A 3CCRT 2QGGA 3I5SA 1YJ9T 4YREA 3C94A 3IKMB 4M7AA 4M7AE 2KSSA 3A8HB 2E41A 3WVEB 2AMCA 3EGDA 3OS2A 1BI2A 4R0KA 1Z7MA 2BZYA 4PFOA 3BE3A 4C8QF 1YI2A 2OTLT 2LVMA 3SD4A 1RAAB 4F7UB 3LGFA 2EYZA 5L23A 2COWA 3S3NA 2RD1A 1VIFA 3E2UA 4C5EA 1J5WA 2ZPEB 3C12A 3I55T 2JTEA 1V29B 2K3BA 1UE9A 1WIEA 5I22A 1VQ7Q 2JMAA 2ROTA 1YJWQ 1R77A 4J7IA 4M75A 1I5OB 1PD1A 4X5OA 2D1XA 4YDQA 2RQTA 2LDMA 2HZYA 3LH0A 1QVFS 3PE0A 2ZT8A 1H641 3OYNA 2PNIA 2YWWA 4TVAA 3L2RA 2CT3A 3VU3C 1UUEA 2XMFA 5F5WA 4M78A 2E5AA 1JRIA 2Y4YA 3EFSA 4M78E 2YLBA 4M7DC 1I4K1 3CCVA 2FO0A 2XI9A 4EMHA 1KJWA 4LVIA 3CMAT 3QO8A 3X24B 4NL3A 1UTIA 2KK4A 5FU6C 4RTWA 1XQHA 1K73R 2P0KA 3I5RA 2HAXA 1G51A 5GAN2 2FYKA 3CC2Q 4V2SA 4R56A 2EGCA 4M7AG 4DBHA 2HDAA 4H2TA 1W4SA 3CCJT 1FXXA 3QYGB 2XD0A 4AFQC 3EAEA 1ADJA 4IUQA 1MMDA 4LDWA 2ZINA 2QK0A 4CRIA 2E3HA 1BBWA 4GLKA 2AZVA 1BI0A 4FSXA 1VQPA 4A4GA 1QCNA 2PVGB 2CYZB 1PRMC 2HQXA 2QGFB 2CREA 2CP0A 2RQVA 2X35A 4A4EA 2G6FX 5J39A 2EQUA 1VQ4Q 1HJDA 4TQDA 1SHGA 4H2XA 4YPFA 2FG0A 1WI7A 4KGXB 3P8BB 5KYWB 3CCLT 5L8RE 4BY6C 2DLPA 1WJRA 4KGZB 2PUKB 3I56Q 5GAOr 1JBMA 1K8AU 2KGTA 4PJOC 4M75D 2C06A 2A3LA 1Q81U 2DXTA 3A31A 5ELNA 1SEMA 3HXUA 3MHXA 5GAOl 5GANh 1EX4A 2JNGA 2KMTA 1HXDA 2QQSA 1KC8R 2VGMA 4LDXA 4M78G 1E24A 5AT1B 3LH5A 2J3MA 4O5VA 4E7KA 1QVGS 1YITQ 2QG9B 4X1VA 4PLIA 2EKOA 1SRMA 4BE2A 4A4FA 4DBRA 2RJEA 1NJIU 5C0MA 3PGGA 2NS6A 2A08A 4Z88A 2QTVA 2QHTA 2LX7A 1JO8A 3EGXB 2DVEA 3PT9A 1M9SA 2E3CA 2QAZA 8AT1B 4FT2A 4C92A 2DU5A 4C92E 2Q7HA 1G5IA 3OBYA 2EJFA 2V1QA 2QQAA 5FLXE 1D0YA 5HK3A 2Y4XA 4OMMA 3CCUQ 1F1BB 3IG2A 2QA4Q 3MF2A 1EIYA 2NUPB 2DILA 2ATCB 2OAUA 3SWNA 3GP8A 1Q86U 3A1PA 3OYGA 4ZGEB 1B7YB 1WFWA 1RI9A 2C0IA 3M55A 1G8XA 1WHKA 3VUZA 1PWTA 3DLLA 2F1LA 1NJ2A 4M75F 4KH1B 3NPFA 9ATCB 2RHYA 2Q5IA 5GAMh 3M58A 2VYTA 5CKBA 4RCBA 2RI2A 3I35A 4LDYA 1UDLA 2XKOC 1SG5A 2SRCA 2CZ7B 4LNSA 2DU7A 2EYXA 2COYA 3M56A 3JB9G 3O5ZA 1MV3A 2M1HA 3VRZA 2DE0X 2ZPHB 3JB9D 1RLPC 2VC8A 5D6YA 1YNZA 1MNEA 4YCVA 5GJVB 4HT4A 2G4CA 1ATIA 3HFZB 1X27A 2D0NA 1TUGB 2EQMA 1EIFA 2ZPGB 4OB0B 5GAN4 4ELYC 1B70B 1RL2A 1WA7A 1K4US 2EAYA 2CDTA 3UFGA 3CMEA 2RHSA 4XU0A 1GCPA 1X2GA 5GMKj 5LJ3d 5GAN6 2PZ1A 4C92G 3V7RA 2Q7EA 4RQFA 1WX6A 4TTVA 3HXWA 1QKWA 5FW9A 2OTJT 4Q15A 1LOJA 1KQSA 2QHSA 3CCQT 2FVUA 2K79A 4IUUA 3QIIA 2CZ1B 1LCKA 4B6MA 3M53A 2M02A 3CCEA 3IQLA 4PK4A 1K73C 3JCMg 1QVFP 3RGLA 3VQWA 4Z8AA 4J6YA 4RTVA 2JM9A 3MKDA 4P75A 2KT1A 1C1AA 1ZSGA 1X6BA 5CR2A 3ME9A 4LDVA 4YRIA 4E7IA 4CC2A 2MK5A 2R58A 1NZ9A 2PVDB 1VQ9Q 1K1ZA 1M2VA 1KD1R 1SF9A 3TUPA 2WSCE 2P84A 1ZSZA 2LNHB 3OYMA 3J81E 4F04B 2ALYA 5FRNA 4O2DA 1MHNA 2GFUA 1YJ9A 1U1TA 4P3OA 1VQMT 1UJYA 3MEVA 1RLQC 4KBMB 3REUA 4ATOA 3V7SA 1QVFA 5E3IA 1S72Q 3L2VA 1G5HA 3EH1A 4KUDK 2OTLA 1VYUA 4DEXA 3EG9B 2FL7A 4MDWA 4FIBA 1KC8C 2ZT5A 1HTTA 3EG3A 4X9CA 1IHWA 3URGA 3RBBB 3REAB 2A8EA 2RHUA 3CPWS 2JTMA 2DM1A 4J6WA 2CP6A 4H2VA 2J05A 3CCSQ 2FZGB 4E2FB 4LDUA 3VS5A 2QDLA 4OGEA 1YHQA 4HWSA 1ADYA 1VQ8T 1Z9ZA 3E1SA 4PKCC 1BYMA 2GBQA 5KYXB 1QMCA 3VRYA 1YJNQ 4QVZA 5GMKi 1WJQA 4OVAA 4YTLA 5DLOA 3CCVT 5KYUB 1QVGP 2X3XD 1O9SA 1B34A 2ZCFB 2A36A 4ZTJA 3PCOB 4M75C 5KYNA 2IIMA 3WQZA 1CKAA 1UGVA 2YXYA 1NEGA 2ZAEA 4C0DB 3JCMV 4H2SA 3CMAA 2PMEA 3R6NA 1Z9QA 2P4RA 1YITT 3HY0A 2DNUA 2ZPFB 3OSSC 4BB7A 2EKHA 1HYOA 2BZ8A 3VJPA 4ME7A 1KSWA 3BDLA 1QP3A 3EG0A 2L3QA 3DLMA 3BFMA 2MPXC 3OW2S 3OYBA 3BDUA 2HEQA 2EQKA 1YFRA 3V8KA 5FRMA 4BUGA 1HD3A 2FPEA 1X43A 3VS4A 4CS4A 2JMCA 2LZ6B 1PCXA 1B8AA 1M3CA 3BJUA 4N4HA 4IUTA 1SERA 4J9DA 1OZ2A 1M1KU 3VS0A 3ERRA 1KHCA 1K8AR 1QWEA 4E6RA 4LVJA 2DMOA 4HCZA 3A5ZB 2K5LA 2DIQA 1WXTA 1Y7XA 1M2OA 1Q81R 1KHIA 4XU3A 1KC8U 1X6OA 3UH0A 4PFPA 2I4LA 3SFMA 4K88A 1PYSA 2ZT6A 3RKYA 4M7DB 3H41A 1T0JA 1ARKA 1JXOA 3EFOB 2IY5B 1FMKA 1XTDA 1NJIR 2RQUA 1YB3A 5FU6B 3J7AF 5IHIA 2EBPA 3QDRB 3CD6A 1K9MU 1Y57A 3L2WA 2IVWA 1VA7A 2V8JA 4N0AC 2O2OA 1GCQC 4J83A 3PNWC 4CC3A 3NTHA 4Y92A 1VQ6Q 1KD1C 1SRYA 2K7AA 2PMFA 1WJSA 4LUEA 1Q86R 4PHCA 4CI0C 2D8HA 1W70A 1X01A 4IIOA 4YRJA 2LQ8A 1PSEA 3TSZA 3RERA 4YRMA 4WJ4A 4JS5A 5CKDA 3S6WA 3VS3A 4C8QE 4BY6B 1WLEA 3OD1A 4YRPA 2O4XB 4K86A 2WACA 3EHQA 3FLGA 5GAN8 4WJ3M 4J9HA 1AWXA 3CC4Q 3VBBA 5LJ5d 2ARSA 3FB9A 2E12A 5GMKm 4FU6A 1WGSA 4RMOA 4PJOB 1WHJA 2ESWA 3NFCA 5LJ3j 5KH6A 1WU7A 4ANJA 5IHNA 2MWPA 1N8RR 3RF1A 4UP7A 2F2WA 1O75A 1PM3A 4M77A 3RUXA 1WHHA 3CBPA 4L5GA 3ER0A 1G2BA 2MOXA 3G7ZA 3CMET 4ZIBA 2EW3A 3ULRB 4C5GA 3LGLA 3LSSA 4XEMA 1U06A 3M9QA 4YRQA 2E3IA 4N4GA 2DK3A 1X2HA 4F7UA 2MMPA 5KE2A 4F7UE 1ZLMA 2CZ0B 2CZ6B 3JCMh 2VXEA 1KK7A 1VQNT 1JQQA 1YBYA 3ZL7C 2KYBA 1S1NA 3HL8A 3NETA 1W1FA 3MP1A 2BE7D 5GANe 2LJ1A 3R6OA 1PSFA 3CPWP 3PVQA 4DBFA 4D6WA 1NYQA 3M4YA 3UT1A 1IO6A 2GGRA 4ZNXA 3IALA 4E47A 2EGAA 4RKUE 1I1JA 2LQNA 1UGSB 1B76A 1VQZA 2KXDA 2FRYA 3KFVA 4C8QB 1J3TA 1BIBA 2M9UA 2DXBA 1JJ2A 3X25B 2PUOB 2XGTA 3OMCA 3QXEB 1WHMA 4HVWA 3LW5E 2ODRD 4JZ3A 1RIQA 1RI0A 3A5YA 3R07A 2DBKA 5A2QE 3OS5A 1NLOC 1VQ7A 2W10A 1YJWA 5CO7A 1YJNT 4MZPA 2HL5C 2HQHA 2ABLA 3G71T 1WHLA 1LJOA 2VWFA 2DL3A 2DERA 4ZGDB 3MEYA 3QNEA 1EFNA 4P75C 1RACB 2QHVA 2YUOA 3LWHA 5EC7A 4M77G 1Y96B 3CPWA 2YUNA 3HRTA 5CKHA 4M77D 1Y07A 2BE9B 3M0RA 4JRPA 5HKCA 2RF0A 2V26A 5GAMe 4P73C 2LMJA 1K8AC 1D0XA 4CH4A 2DXUA 3QO5A 5I2MA 3OW2P 1VQMA 4F7UG 1HC7A 2NUTB 4PG3A 1E1TA 2K3XA 4A4HA 2LT4A 1FYNA 1Q81C 4K87A 1NG2A 3CC2A 1H4QA 2AKWB 5IAYA 4AMCA 5GANf 1V76A 3MEWA 1UGRB 3RKWA 1VQ5Q 3ICAA 2Q7GA 2JVVA 1TU0B 4YRSA 5CQXA 5KYWA 2OJ2A 1ABQA 3G4SQ 2LQWA 1YHQT 3FIFA 4M4ZA 2AKKA 3REBB 1FMVA 1NJIC 1OZ3A 5A0LA 1TOVA 1D0ZA 2FZCB 2LC4A 1NJ5A 1RAHB 4JPBW 2CGHA 1VQ4A 2RNAA 1JXMA 2YSQA 5CKEA 1I0CA 5HGQA 4RDXA 3OS1A 1SKUB 2CJAA 3A74A 2O88A 3THKA 1VQ8A 1JJCA 3NHNA 4O6JA 3KXTA 2XTIA 1D09B 4AT1B 1WNLA 2GCXA 3I56A 5KYYB 1W2BS 2HBPA 4M77F 5LJ3g 2D9TA 3MJXA 3JB9H 4QT7A 3CCMT 2HL3A 1MV0B 5GMKh 1Q86C 4EMKC 2YLCA 2O9VA 4XEOA 4YRKA 4BI4A 5M9OA 1MNDA 2Z0WA 3EGXA 4YRGA 4M7AD 5C6SA 5GAMf 2E65A 4OMFB 3JCMX 1FMWA 1YITA 5DM7R 1QQJA 3GLXA 2NUPA 1SETA 4J9IA 5I11A 1WHGA 2V8KA 3JAME 4RTXA 2K2VA 3ASKA 2DJQA 1NYRA 1N8RC 4RTTA 4DOWA 2R5AA 2PU9B 3N5BB 2XDDA 2DD5A 2JS0A 4HXJA 2JM8A 4CS3A 3M0SA 2RHQB 3FC3A 1SESA 2RQWA 2QA4A 1M1KR 1PKSA 1A0NB 4E7JA 4WCIA 2CSQA 3L2ZA 4B9XA 2XDPA 2DKGA 3HY1A 1B7TA 2ZIOA 3OYJA 4MZTA 2X9HA 2KBTA 3QZ9B 4FL6A 3CC4T 2K5FA 4M78D 2CUBA 1EOVA 4M7AF 3HFZA 1E22A 1USYC 2D8JA 1W66A 4M75B 3JCMP 1B70A 1R0BG 3CD6T 1XNIA 2KQWA 2ROLA 3SDZA 5DY9A 3RR6A 4LD6A 1ZQ1A 3TVTA 3A7AA 2EWNA 2HCKA 2P4TA 3UA7A 2J06A 3VS7A 1K9MR 1NNHA 2EL9A 2AIRB 3LX7A 1KFZA 3JV3A 1N27A 2RK1A 1N9SA 3QHSA 2ED1A 2FRWA 2RHZA 1EVLA 1VQPQ 5LJ5j 2EVRA 4OMNA 2JT4A 2B86A 4FW1A 5HCKA 1X6GA 3LLRA 3WXMB 1NJ8A 3MPUB 4XTUA 4DEYA 2K5IA 1AEYA 1VYTA 2DRMA 3J80E 1QE0A 3GNFB 2AT1B 2QQRA 3M4GA 2BIVA 2E6NA 4EX5A 3OQ5A 5GAOn 2E1HA 3VYGA 3UA6A 2OAWA 4OP0A 3HFNA 4M78F 3OA6A 5GAOq 1G3SA 3JCMc 4HT8A 1FYFA 1OI1A 1T3LA 3S3OA 5C52B 3G6EQ 1N8RU 4E7HA 3L42A 2LT1A 1LYLA 1ZUKA 2K6DA 2MIOA 3QUIA 4DPGA 2ODRC 4G85A 1YIJT 3CC7Q 2RHXA 4OB1B 2EYWA 3TEHB 3I7FA 3HP9A 2LJ0A 4KQEA 4QKUA 4ZTFA 3REXA 1OEBA 4QVDA 2ZT7A 2ZZDA 2G3RA 1ABOA 1VQ9A 4GLMA 1GFDA 2L3SA 3L2QA 2JW4A 1IGUA 1WDXA 3EG9A 4M77C 5J26A 3LWIA 2CP7A 4XTYA 4R55A 4C92D 2JS2A 1Q82U 1LVKA 3JCMQ 2ZGWA 2NWMA 1VQNA 3CXCS 2RJCA 3VUBA 4A63B 3META 3SEMA 3H0FA 4H2YA 4Z89A 1S72A 1BK2A 3DB4A 5KYXA 3G1ZA 1L0WA 2DL7A 2QYZA 3CBMA 4N4IA 2DA9A 4BWAA 2QXFA 2P0QA 5KYUA 1SRLA 4XU1A 4AFSC 4CC4B 1VQ7T 3JB9F 4Y91A 1YJWT 3JCMJ 3M0PA 1W2BP 2LCCA 2RHIA 2Y90A 2D0QB 5K1XA 3QYHB 4HCBA 3PCOA 5FROA 1T0HA 1M1FA 3CCSA 4H2WA 3MP8A 2KDSA 4KR2A 1EFWA 3HRSA 1D1BA 3EH2A 1YJNA 3EG2A 2M0YA 3G71A 2DX1A 4TWAA 4C92F 2FHDA 4HA8A 1M1KC 3ZBDA 1CSKA 4P3NA 2XG8D 2K57A 1VQLQ 3CC2T 1UHFA 3RMSA 1E7OA 4NL2A 4UP9A 4IIMA 4MZMA 3QWYA 5HK0A 4M7AC 3PIPA 4FT4A 2YT6A 2YUPA 3HXZA 2EJGA 3MP6A 4J8OA 3QKJA 1X56A 5LJ5g 3H0IA 2DEUA 3P8HA 2JUFA 1AOJA 2RHSB 1UG1A 2DYBA 4HWRA 1NLPC 1Z7NA 1MMAA 1QCFA 1D3BB 4AFUC 1VQ4T 2AKLA 4Z02A 5LJ3h 1PRLC 1H3HA 1NJ6A 2X4XA 2O31A 3A5ZA 2DRKA 5CAIA 1YCSB 5IT9E 2K3YA 1K9MC 2F5KA 2MAMA 5GAN7 3I56T 1NM7A 1ZUUA 1PNJA 3JCMe 3QDFA 1QLYA 4DOVA 1VQOQ 4OMPA 1QP2A 2ED0A 2ARTA 2KEAA 1FWZA 1RAFB 2DXCA 2DETA 4AFZC 4M7DA 3A32A 1OYXA 4M7DE 4P74A 2LTOA 3RDVA 2KR3A 1G83A 1NJ1A 3EFOA 2YHTA 3M0TA 2HBWA 2IY5A 3EG1A 4KRTA 2J7IA 1VOMA 2EIFA 1N5ZA 2EGEA 2JN0A 3CCMA 2V8IA 3CCRQ 3UF4A 1YJ9Q 5IHKA 4M78C 2DTHA 1ACMB 1RABB 1OX8A 2OX7A 3L4GB 3RESA 2CUDA 2MWOA 2YDLA 1WQ7A 2KVQG 4NOYA 3OYKA 3SHWA 4K11A 3QO3A 2PTKA 4YRRA 3P8DA 3HRUA 3E9GA 4KGVB 2DEQA 5GAOm 2OTLQ 2HSPA 3UWNA 3TSWA 2A37A 3OYDA 4MMLA 2RA2A 1QVGA 1GRIA 2P0LA 3CCUT 4MMKA 2QA4T 2DZ9A 2C8MA 4C5IA 2EQIA 1KMMA 3HSBA 2O4XA 1NBEB 2IG0A 3I55Q 1RAGB 1EQRA 2AK5A 4F14A 4IUVA 5CK9A 1VQ6A 3RKXA 4PJOA 3HXYA 4H02A 2KNBB 2DQ3A 2ZNIA 4XTVA 3JCMW 4PJOE 4X9DA 4RTUA 5KCOA 2RPNA 4RTZA 6AT1B 2LNVA 3JCMf 2RH2A 1TS9A 1K0SA 4C5HA 2E5QA 1K0XA 4IURA 5CQYA 4M7DG 3QTCA 4BDYA 2RQRA 1WYDA 4L6V5 2KYMA 1BIAA 4ZN1A 3CC4A 3S3MA 3G6ET 2DBMA 2QEXQ 1SPKA 2CP5A 3CMAQ 4EMKB 1H4SA 4IKFA 1C0AA 3VQXA 4XAXB 3SB2A 1U1SA 4KH0B 1QW1A 1PHTA 1VYVA 4BACA 3NELA 4KUIA 3QJ6A 4XTXA 3CCJQ 4XTWA 1GGMA 1M3BA 3QZ5B 2DL4A 4GY5A 3CXCP 2DF6A 2L2PA 4NCXA 2ZZGA 2CH4W 2ZTGA 3AT1B 4DA4A 2EYQA 1M90U 3OMGA 4C92C 1X75C 2JTFA 5GMKe 3W3SA 2I4MA 4CS2A 5I21A 4C8QA 1ZBXA 4IUPA 2H3EB 1M1GA 2HSEB 3QWXX 1I81A 3A8MB 1WLPB 1JU5C 3CCLQ 3RACA 5FU7C 4LN2A 3SWNC 1E6GA 1RAEB 4JJBA 3NENA 3HRKA 1KMNA 1C6VX 2L0AA 2I4NA 4PJOG 4LVMA 2VV5A 4II1A 3GNGA 4EPCA 2C7IA 3RIRA 5C51B 4HCCA 2ZR3A 1PD0A 1XOVA 2QASA 3HFOA 4YRNA 3CEYA 3CMQA 4FCYA 1M3AA 4WI1A 4PJMA 2DIGA 3T9NA 2QQBA 5KE3A 3M4QA 4B9WA 1Y96A 4OMLA 2E4HA 1ZHIA 5IN1A 3TQ7P 3IKLA 3OYCA 2JXBA 3HHTB 1VQ9T 1N9WA 4L87A 2COZA 1YIJA 1AVZC 3HXVA 1Y0MA 3QPHA 1MGQA 1AHJB 4EIKA 2K2MA 3X26B 4RCCA 1JEGA 3EFRA 2HNIA 1X69A 1K9AA 1ASYA 4CH3A 3UDCA 1UFFA 1BI3A 1Y71A 7AT1B 3OYAA 2AKWA 2YRVA 3ZEHA 1Q82R 3M5AA 1YP5A 1SHFA 1DJ7B 4QQDA 2CP2A 2YRDA 4ELZC 1S72T 4LVKA 2CT4A 3V8JA 2E70A 4JJNK 1G3TA 5GAN3 2FZKB 4H2UA 4YRFA 2ZPBB 12ASA 2VXFA 2L3PA 2LP5A 3JSCA 1AZEA 4E7ZA 1IXDA 4PFZA 2DYIA 4C8QG 3O8VA 3KUFA 1AWWA 4XK8E 4C8QD 2KE9A 1VQ5A 4XQ3A 2FPFA 3G1JA 4JUVA 2LCSA 3CCST 4JS4A 1BB9A 3G4SA 3MEUA 5KYYA 4AH6A 2XHCA 2KI7A 1SSFA 2DTOA 5IXBA 1AT1B 4LE9A 2ENMA 2DQ0A 4XU2A 3MCAB 4WTOB 1H3ZA 1VQOT 2OI3A 1W6XA 3PZCA 2VASA 1YFSA 3H6ZA 1KQ2A 2KRSA 4HVUA 5LJ5h 3C4SA 3MO8A 1KQSS 4JLGA 2CP3A 2M51A 3OYEA 3GF5A 4C0DC 1ZSZC 2LCLA 3VYHB 3E9IA 1PG5B 2JJ9A 3M0QA 2WSEE 4PJLA 4AG2C 4M77B 4YP0A 2C0TA 1VQKQ 5D7UA 1KOGA 5CKFA 4OF1A 1WPYA 2P5IA 2OTJQ 2RHQA 1FX7A 4YCUA 3X20B 3CCQQ 3EGUA 2R57A 1E6HA 5C53B 3QG1A 1RAIB 2RM4A 3H8ZA 4HT9A 1M30A 2LQKA 5EG2A 1E1OA 4L59A 5GANd 1SSHA 2NYSA 1Q7YR 2R5MA 3C95A 1H4TA 3OW2A 3Q1JA 5LL6S 1D1AA 3HRIA 2VUBA 4BI3A 4JLIA 4M75E 1VUBA 1GL5A 3OS0A 3VS2A 5CVIA 3H0HA 4YYEA 4A54A 1I5LA 1QF6A 1QWFA 2DD4A 2GF7A 2DL5A 2X4YA 3GPLA 4F7UF 1BBUA 1IB8A 3TEEA 1X54A 4ZTZB 1WYXA 1MMNA 1KG1A 1YI2Q 2E10A 2QEXT 4TVWA 4P74C 1WZOA 1VQMQ 3NGPA 1BKBA 2SEMA 2J6FA 1EZZB 1H4VB 3TEGA 2CS7A 4CC7A 2KAFA 4FW2A 1B7YA 2A28A 4M7AB 3M0UA 4PLLA 3OSVA 3PIOA 1YFNA 1TG0A 3A8GB 2AMCB 3EGDB 4JZ4A 3QBYA 4YRCA 2XICA 5GAMd 1OV3A 1VQ6T 1H92A 3A7UA 4ZGJB 3CCUA 4P72A 2ZZFA 4LD9K 3A98A 1C0MA 5A0DA 4GBQA 3F70A 1UJ0A 3I9QA 4P5NA 1D1CA 4BD3A 1VQ8Q 1Q82C 3FRNA 2GQVA 3CCVQ 5FWBA 3TEHA 4F17A 5D6XA 2NLUA 3OY9A 4M75G 4BW9A 1BU1A 2I2LA 4FYXB 4TVAB 4FM4B 2X4WA 3G6EA 4C0GA 5LJ3e 4J15A 1JJCB 2X4JA 2V1RA 4M78B 4J9FA 2PVOB 4N0AA 1OPLA 3CC7A 1GCQA 2VKNA 1YWOA 2DO3A 1M27C 3HTRA 3CPFA 3HTZA 1IREB 2J3LA 4FSSA 4J9GA 1NE8A 1G3YA 1R0CB 1M90R 3ZFJA 4A4KA 3TREA 3PVLA 2DVJA 1TUCA 1NEBA 2IPOB 3PMTA 4HVVA 3JB9I 1UEBA 1X2QA 2E6ZA 3RNJA 4J7FA 3P8VA 3OYYA 2RJFA 2JOYA 2GQIA 1IL2A 2P0PA 1ASZA 2GFAA 1OULA 2MF2A 1ZA1B 1OU8A 2ZIMA 2FPDA 4H2XB 2DL8A 4AG1C 4C8QC 2L3RA 4CH5A 1LPLA 3LYIA 4P71A 2DTIA 3MQZA 2I4OA 4PJNA 4J9BA 2BKDN 2NUZA 3PTAA 1KQSP
chains in the Genus database with same CATH topology
4UP8A 2M16A 3WVDB 2QQ9A 5DLQE 2EJ9A 4PNOA 5LJ3f 2D6FA 1M4ZA 4DQ2A 3M57A 3NTKA 2KY9A 3JB9J 4HWOA 2CJBA 4X34A 1Q7YC 4RG2A 4TVYA 2QDYB 4NS5A 11ASA 3X28B 5K1PA 1D3BA 3QJYA 1VQLA 2A7YA 1VQKT 5GMKl 4C92B 1VQ5T 3P8YA 2HD0A 3RL6A 4JRKA 2MI6A 3G4ST 1EIYB 5FU7B 3SWNB 4JRIA 3NEMA 2XDBA 2HQEA 2RJDA 1GXIE 4QVCA 2DDZA 4EMGA 2QHUA 4E7LA 3L4GA 4MDXA 4C0ZA 1VQOA 3UGQA 5CIUA 4G84A 4P73A 2ZNJA 1IZ6A 2LX9A 3A8OB 2XK0A 2QI2A 3CCRA 5GANj 1YI2T 3AHUA 1W2BA 2ZZEA 2CKKA 1JJ2S 3E19A 4EDUA 2DJZA 4QQGA 1UB4A 4HWTA 3L1AA 2RK2A 3VKIA 2RI5A 3OBWA 4P3PA 1Q7YU 3FEOA 4RQEA 5I2SA 3OYLA 3LC0A 4EO4A 1YFTA 4BI8B 2QTXA 2B8AA 3I55A 4HKEA 4TQFA 3DSQA 3OB9A 5J3BA 4EMKA 1X55A 1M90C 1M8VA 4HVCA 2EQJA 3BY7A 1QVPA 4OGCA 5GAMj 2AHJB 4C0FA 1G3WA 4YRLA 5A0GA 4UPAA 1K73U 2QEXA 2PQWA 3VV0A 5ELOA 3UPUA 2XIDA 1G5VA 2O01E 4PL6A 2ALYB 3NTIA 4RMFA 3L2UA 2RO0A 3CBOA 3TU4K 1VQPT 3CCJA 3DB3A 4J6XA 3PMIA 1VIEA 2DAQA 3DKMA 5LJ5e 4CH6A 4E51A 4LVLA 4KR3A 3OYHA 5CCAA 3M59A 2CJ9A 3E9HA 4YRTA 2WSFE 2EFIA 3HPWA 4P72C 3CCLA 2LRQA 4M7DD 1USYA 2K4YA 4ZN3A 4J5YA 4BE1A 1NPRA 3V7CA 1UGQB 3VQVA 3CC7T 3UGTA 3JCMd 3VQYA 3M54A 1B34B 4YCWA 3MEAA 1YCYA 4OLFA 1TH7A 5GAOp 3GOXA 4HWPA 5GANg 3V8LA 3FDRA 2E64A 3INZA 4WF2A 3FJPA 2L8DA 4XTZA 4A53A 1EVKA 1R8OB 3HXXA 5LJ5f 2M0OA 3A8LB 3GIBA 4YROA 4RG8A 2Q5HA 4PJOD 4M7DF 4QQ6A 1BI1A 1I8FA 3HKSA 4OB3B 3RMQA 5GAN5 2ARUA 3CXCA 1LNXA 1P92A 4KULA 2VGNA 2BUDA 2JZ2A 1UGPB 1NPPA 2ZR2A 3LSQA 4P71C 5HY6A 5KNNA 5GAMg 4ZTUB 1PYSB 4Q5WA 1N6AA 1WQWA 4M77E 3OYIA 2FB7A 4BE0A 1KQ1A 2H3JA 3OYFA 2DPPB 1JB0E 1VQLT 4OB2B 2L89A 4TVRA 2DZCA 3M4PA 1YGBA 2XU8A 5KCHA 4Y28E 2ZPIB 2ZXFA 3PFSA 3KFUA 4PJOF 4KT0E 1VQKA 3HFVA 3BW1A 3CCET 2F5TX 1N9RA 3JCMb 2OTJA 2L5QA 3P8TA 5AYFA 3CCQA 4QW2A 2CIMA 2RI3A 2RB6A 2ZCEA 3MF1A 4JRQA 3A7RA 5D6WA 4BDZA 1M5Q1 1HK9A 4UC4A 4VUBA 3JRZA 3TCJA 4Q6GA 3KBGA 1U8RA 1KD1U 2F69A 3QSUA 3E9FA 4JDSA 3QO7A 3CCRT 1YJ9T 4YREA 3C94A 3IKMB 4M7AA 4M7AE 2KSSA 3A8HB 2E41A 3WVEB 2AMCA 3OS2A 1BI2A 1Z7MA 4C8QF 1YI2A 2OTLT 2LVMA 3SD4A 4F7UB 3LGFA 3S3NA 2RD1A 1VIFA 4C5EA 1J5WA 2ZPEB 3C12A 3I55T 1V29B 4J7IA 4M75A 4X5OA 4YDQA 2LDMA 3LH0A 2ZT8A 1QVFS 1H641 3OYNA 4TVAA 3L2RA 3VU3C 5F5WA 4M78A 2E5AA 1JRIA 2Y4YA 3EFSA 4M78E 2YLBA 4M7DC 1I4K1 3CCVA 2XI9A 4EMHA 4LVIA 3CMAT 3QO8A 3X24B 4NL3A 2KK4A 5FU6C 1XQHA 2P0KA 2HAXA 1G51A 5GAN2 2FYKA 4V2SA 4R56A 4M7AG 4H2TA 1W4SA 3CCJT 1FXXA 3QYGB 2XD0A 3EAEA 1ADJA 4IUQA 4LDWA 2ZINA 4CRIA 1BBWA 4GLKA 1BI0A 4FSXA 1VQPA 4A4GA 2PVGB 2CYZB 2HQXA 4A4EA 2X35A 5J39A 2EQUA 4TQDA 4H2XA 4YPFA 3P8BB 3CCLT 5L8RE 4BY6C 1WJRA 2PUKB 5GAOr 1JBMA 1K8AU 4PJOC 4M75D 2C06A 2A3LA 1Q81U 2DXTA 3A31A 5ELNA 3HXUA 3MHXA 5GAOl 5GANh 2JNGA 4LDXA 2KMTA 1HXDA 2QQSA 2VGMA 4M78G 1E24A 2J3MA 4O5VA 4E7KA 1QVGS 4PLIA 2EKOA 4BE2A 4A4FA 2RJEA 1NJIU 5C0MA 3PGGA 2NS6A 2QHTA 2DVEA 3PT9A 1M9SA 2E3CA 4FT2A 4C92A 2DU5A 4C92E 2Q7HA 1G5IA 3OBYA 2EJFA 2QQAA 5FLXE 5HK3A 2Y4XA 3IG2A 3MF2A 1EIYA 2OAUA 3SWNA 3GP8A 1Q86U 3OYGA 4ZGEB 1B7YB 3M55A 3VUZA 3DLLA 1NJ2A 4M75F 2RHYA 2Q5IA 5GAMh 3M58A 2VYTA 5CKBA 4RCBA 2RI2A 4LDYA 2XKOC 2CZ7B 4LNSA 2DU7A 3M56A 3JB9G 2M1HA 2ZPHB 3JB9D 2VC8A 5D6YA 4YCVA 4HT4A 2G4CA 1ATIA 3HFZB 2EQMA 1EIFA 2ZPGB 4OB0B 5GAN4 4ELYC 1B70B 1RL2A 2EAYA 3UFGA 2RHSA 3CMEA 4XU0A 1X2GA 5GMKj 5LJ3d 5GAN6 4C92G 3V7RA 2Q7EA 4RQFA 4TTVA 3HXWA 4Q15A 2OTJT 1LOJA 1KQSA 2QHSA 3CCQT 2FVUA 4IUUA 3QIIA 2CZ1B 3M53A 3CCEA 1K73C 3JCMg 3RGLA 3VQWA 4J6YA 4P75A 5CR2A 3ME9A 4LDVA 4YRIA 4E7IA 2R58A 2PVDB 1NZ9A 3TUPA 2WSCE 3OYMA 3J81E 2ALYA 5FRNA 4O2DA 1MHNA 2GFUA 1YJ9A 1U1TA 4P3OA 1VQMT 3MEVA 4KBMB 3REUA 4ATOA 3V7SA 1QVFA 5E3IA 3L2VA 1G5HA 4KUDK 2OTLA 2FL7A 4MDWA 4FIBA 1KC8C 2ZT5A 1HTTA 4X9CA 3URGA 2A8EA 2RHUA 3CPWS 2JTMA 4J6WA 4H2VA 4LDUA 4OGEA 1YHQA 4HWSA 1ADYA 1VQ8T 3E1SA 4PKCC 1BYMA 4QVZA 5GMKi 1WJQA 4OVAA 4YTLA 5DLOA 3CCVT 1O9SA 1B34A 2ZCFB 4ZTJA 3PCOB 4M75C 3WQZA 4C0DB 3JCMV 4H2SA 3CMAA 2PMEA 1YITT 3HY0A 2ZPFB 3OSSC 4BB7A 3VJPA 4ME7A 3BDLA 1QP3A 3DLMA 3BFMA 3OW2S 3OYBA 3BDUA 2EQKA 1YFRA 3V8KA 5FRMA 4BUGA 4CS4A 1B8AA 3BJUA 4N4HA 4IUTA 1SERA 1OZ2A 1M1KU 3ERRA 1KHCA 4LVJA 4HCZA 3A5ZB 2K5LA 2DIQA 1Y7XA 1KHIA 4XU3A 1KC8U 1X6OA 3UH0A 2I4LA 3SFMA 4K88A 1PYSA 2ZT6A 3RKYA 4M7DB 2IY5B 1XTDA 1YB3A 5FU6B 3J7AF 3QDRB 3CD6A 1K9MU 3L2WA 2IVWA 2V8JA 4N0AC 4J83A 3PNWC 3NTHA 1KD1C 1SRYA 2PMFA 1WJSA 4PHCA 4CI0C 1X01A 4YRJA 2LQ8A 1PSEA 3RERA 4YRMA 4WJ4A 4JS5A 5CKDA 3S6WA 4C8QE 4BY6B 1WLEA 3OD1A 4YRPA 2O4XB 4K86A 2WACA 3FLGA 5GAN8 4WJ3M 3VBBA 5LJ5d 2ARSA 3FB9A 2E12A 5GMKm 4FU6A 1WGSA 4RMOA 4PJOB 3NFCA 5LJ3j 5KH6A 1WU7A 2MWPA 3RF1A 4UP7A 1O75A 4M77A 3RUXA 3CBPA 4L5GA 3ER0A 3G7ZA 3CMET 4ZIBA 4C5GA 3LGLA 3LSSA 4XEMA 3M9QA 4YRQA 4N4GA 2DK3A 1X2HA 4F7UA 2MMPA 5KE2A 4F7UE 2CZ0B 2CZ6B 3JCMh 2VXEA 1VQNT 1YBYA 3HL8A 3NETA 3MP1A 5GANe 3R6OA 1PSFA 4D6WA 1NYQA 3M4YA 3UT1A 3IALA 4E47A 4RKUE 1UGSB 1B76A 1VQZA 4C8QB 1BIBA 2M9UA 2DXBA 1JJ2A 3X25B 2PUOB 2XGTA 3OMCA 3QXEB 3LW5E 2ODRD 1RIQA 1RI0A 3A5YA 3R07A 5A2QE 3OS5A 1VQ7A 1YJWA 5CO7A 1YJNT 4MZPA 3G71T 1LJOA 3QNEA 3MEYA 4ZGDB 4P75C 2QHVA 3LWHA 4M77G 1Y96B 3CPWA 3HRTA 5CKHA 4M77D 1Y07A 4JRPA 5HKCA 5GAMe 4P73C 1K8AC 4CH4A 2DXUA 3QO5A 5I2MA 1VQMA 4F7UG 1HC7A 4PG3A 1E1TA 2K3XA 4A4HA 2LT4A 1Q81C 4K87A 3CC2A 1H4QA 2AKWB 5IAYA 5GANf 3MEWA 1UGRB 3RKWA 3ICAA 2Q7GA 2JVVA 4YRSA 5CQXA 1YHQT 3FIFA 1NJIC 1OZ3A 5A0LA 2LC4A 1NJ5A 2CGHA 1VQ4A 5CKEA 5HGQA 4RDXA 3OS1A 2CJAA 3A74A 1VQ8A 1JJCA 4O6JA 3KXTA 2XTIA 1WNLA 2GCXA 3I56A 1W2BS 2HBPA 4M77F 5LJ3g 2D9TA 3JB9H 3CCMT 5GMKh 1Q86C 4EMKC 2YLCA 4XEOA 4YRKA 4BI4A 5M9OA 4YRGA 4M7AD 5C6SA 5GAMf 2E65A 4OMFB 3JCMX 1YITA 5DM7R 3GLXA 1SETA 2V8KA 3JAME 2K2VA 3ASKA 1NYRA 1N8RC 4DOWA 2R5AA 2PU9B 3N5BB 2XDDA 2DD5A 4CS3A 2RHQB 3FC3A 1SESA 2QA4A 4E7JA 3L2ZA 4B9XA 2XDPA 2DKGA 3HY1A 2ZIOA 3OYJA 4MZTA 3QZ9B 4FL6A 3CC4T 2K5FA 4M78D 1EOVA 4M7AF 3HFZA 1E22A 1USYC 1W66A 4M75B 3JCMP 1B70A 3CD6T 1XNIA 2KQWA 3SDZA 5DY9A 4LD6A 1ZQ1A 3A7AA 2EWNA 2P4TA 1NNHA 2EL9A 3LX7A 1N27A 2RK1A 1N9SA 3QHSA 1EVLA 2RHZA 5LJ5j 3LLRA 3WXMB 1NJ8A 4XTUA 2K5IA 3J80E 1QE0A 3GNFB 2QQRA 3M4GA 2BIVA 2E6NA 4EX5A 3OQ5A 5GAOn 2E1HA 3VYGA 4OP0A 3HFNA 4M78F 3OA6A 5GAOq 1G3SA 3JCMc 4HT8A 1FYFA 1OI1A 3S3OA 5C52B 1N8RU 4E7HA 3L42A 2LT1A 1LYLA 3QUIA 4DPGA 2ODRC 4G85A 1YIJT 2RHXA 4OB1B 3TEHB 3I7FA 3HP9A 4KQEA 4ZTFA 3REXA 4QVDA 2ZT7A 2ZZDA 2G3RA 1VQ9A 3L2QA 3LWIA 5J26A 4M77C 4XTYA 4R55A 4C92D 1Q82U 3JCMQ 2ZGWA 1VQNA 3CXCS 2RJCA 3VUBA 3META 4H2YA 1S72A 3DB4A 3G1ZA 1L0WA 3CBMA 4N4IA 4BWAA 2QXFA 2P0QA 3JB9F 4XU1A 1VQ7T 4Y91A 1YJWT 3JCMJ 2LCCA 2RHIA 2Y90A 2D0QB 5K1XA 3QYHB 4HCBA 3PCOA 5FROA 1M1FA 3CCSA 4H2WA 3MP8A 2KDSA 4KR2A 1EFWA 3HRSA 1YJNA 3G71A 4TWAA 4C92F 2FHDA 4HA8A 1M1KC 3ZBDA 4P3NA 2XG8D 2K57A 3CC2T 3RMSA 4NL2A 4UP9A 4MZMA 4M7AC 5HK0A 3PIPA 4FT4A 3HXZA 2EJGA 3MP6A 4J8OA 3QKJA 1X56A 5LJ5g 3P8HA 2JUFA 2RHSB 4HWRA 1Z7NA 1D3BB 1VQ4T 4Z02A 5LJ3h 1NJ6A 2X4XA 3A5ZA 5CAIA 5IT9E 2K3YA 1K9MC 2F5KA 2MAMA 5GAN7 3I56T 3JCMe 4DOVA 1QP2A 2ARTA 1FWZA 2DXCA 4M7DA 3A32A 1OYXA 4M7DE 4P74A 2LTOA 1NJ1A 2YHTA 2IY5A 2EIFA 2JN0A 3CCMA 2V8IA 4M78C 2DTHA 3L4GB 3RESA 2MWOA 1WQ7A 2KVQG 4NOYA 3OYKA 3QO3A 4YRRA 3P8DA 3HRUA 3E9GA 2DEQA 5GAOm 3UWNA 3OYDA 4MMLA 2RA2A 1QVGA 2P0LA 3CCUT 4MMKA 2QA4T 2DZ9A 2C8MA 4C5IA 1KMMA 3HSBA 2O4XA 2IG0A 1EQRA 5CK9A 4IUVA 1VQ6A 3HXYA 3RKXA 4PJOA 4H02A 2DQ3A 2ZNIA 4XTVA 3JCMW 4PJOE 4X9DA 5KCOA 2LNVA 3JCMf 2RH2A 4C5HA 2E5QA 4IURA 5CQYA 4M7DG 3QTCA 4BDYA 1WYDA 4L6V5 1BIAA 4ZN1A 3CC4A 3S3MA 3G6ET 4EMKB 1H4SA 4IKFA 1C0AA 3VQXA 4XAXB 3SB2A 1U1SA 1QW1A 4BACA 3NELA 4KUIA 3QJ6A 4XTXA 4XTWA 1GGMA 3QZ5B 4GY5A 4NCXA 2ZZGA 2ZTGA 4DA4A 2EYQA 1M90U 3OMGA 4C92C 1X75C 2JTFA 5GMKe 3W3SA 2I4MA 4CS2A 5I21A 4C8QA 1ZBXA 4IUPA 1M1GA 1I81A 3A8MB 3RACA 5FU7C 3SWNC 3NENA 3HRKA 1KMNA 2I4NA 4PJOG 4LVMA 2VV5A 4II1A 3GNGA 4EPCA 2C7IA 3RIRA 5C51B 4HCCA 2ZR3A 1XOVA 3HFOA 4YRNA 3CEYA 3CMQA 4WI1A 2DIGA 3T9NA 2QQBA 5KE3A 3M4QA 4B9WA 1Y96A 1ZHIA 5IN1A 3IKLA 3OYCA 3HHTB 1VQ9T 1N9WA 4L87A 1YIJA 3HXVA 3QPHA 1MGQA 1AHJB 3X26B 4RCCA 3EFRA 2HNIA 1ASYA 4CH3A 3UDCA 1BI3A 1Y71A 3OYAA 2AKWA 2YRVA 3ZEHA 3M5AA 1DJ7B 4QQDA 4ELZC 1S72T 4LVKA 3V8JA 2E70A 4JJNK 1G3TA 5GAN3 4H2UA 4YRFA 2ZPBB 12ASA 2VXFA 3JSCA 4C8QG 3O8VA 3KUFA 4XK8E 4C8QD 1VQ5A 4XQ3A 4JUVA 3CCST 4JS4A 3G4SA 3MEUA 4AH6A 2XHCA 1SSFA 2DTOA 2DQ0A 4XU2A 3MCAB 1H3ZA 1VQOT 3PZCA 1YFSA 3H6ZA 1KQ2A 5LJ5h 3C4SA 3MO8A 1KQSS 4JLGA 3OYEA 3GF5A 4C0DC 2LCLA 3VYHB 3E9IA 2WSEE 4M77B 4YP0A 1KOGA 5CKFA 4OF1A 1WPYA 2P5IA 2RHQA 1FX7A 4YCUA 3X20B 2R57A 5C53B 3QG1A 2RM4A 3H8ZA 4HT9A 5EG2A 2LQKA 1E1OA 4L59A 5GANd 2R5MA 3C95A 1H4TA 3OW2A 3Q1JA 5LL6S 3HRIA 2VUBA 4BI3A 4JLIA 4M75E 1VUBA 3OS0A 5CVIA 4YYEA 4A54A 1I5LA 1QF6A 2DD4A 2GF7A 3GPLA 2X4YA 4F7UF 1BBUA 3TEEA 1X54A 4ZTZB 1KG1A 2E10A 2QEXT 4TVWA 4P74C 1BKBA 1H4VB 3TEGA 2CS7A 2KAFA 1B7YA 4M7AB 4PLLA 3OSVA 3PIOA 3A8GB 2AMCB 3QBYA 4YRCA 2XICA 5GAMd 1VQ6T 3A7UA 4ZGJB 3CCUA 4P72A 2ZZFA 4LD9K 5A0DA 3F70A 4P5NA 4BD3A 1Q82C 3FRNA 2GQVA 3TEHA 5D6XA 2NLUA 3OY9A 4M75G 4BW9A 2I2LA 4TVAB 4FM4B 2X4WA 3G6EA 4C0GA 5LJ3e 4J15A 1JJCB 2X4JA 4M78B 2PVOB 4N0AA 3CC7A 2DO3A 3CPFA 3HTZA 1IREB 2J3LA 1NE8A 1G3YA 3ZFJA 4A4KA 3TREA 3PMTA 3JB9I 1UEBA 2E6ZA 4J7FA 3P8VA 3OYYA 2RJFA 2JOYA 1IL2A 2P0PA 1ASZA 2GFAA 2MF2A 2ZIMA 4H2XB 4C8QC 2L3RA 4CH5A 3LYIA 4P71A 2DTIA 3MQZA 2I4OA 2BKDN 3PTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP8 A;  4M78 E;  3EFS A;  3RF1 A;  2YLB A;  4UP7 A;  4M7D C;  1I4K 1;  4M77 A;  4EMH A;  2EJ9 A;  4PNO A;  2JN0 A;  5LJ3 f;  3RUX A;  3QO8 A;  4DQ2 A;  4ZIB A;  4M78 C;  4NL3 A;  2DTH A;  3LSS A;  4XEM A;  3L4G B;  3JB9 J;  3RES A;  4YRQ A;  1WQ7 A;  2CJB A;  1G51 A;  4HWO A;  5GAN 2;  2FYK A;  4NOY A;  4V2S A;  4M7A G;  1X2H A;  3QO3 A;  4TVY A;  4F7U A;  4H2T A;  4YRR A;  4F7U E;  11AS A;  2DEQ A;  5GAO m;  3JCM h;  2VXE A;  1ADJ A;  2ZIN A;  5K1P A;  1D3B A;  3NET A;  4MML A;  1BBW A;  2RA2 A;  5GAN e;  2P0L A;  5GMK l;  4C92 B;  4MMK A;  2DZ9 A;  1NYQ A;  3P8Y A;  3RL6 A;  2C8M A;  4JRK A;  1KMM A;  4TQD A;  3HSB A;  3IAL A;  4H2X A;  4YPF A;  1EQR A;  1EIY B;  1B76 A;  3HXY A;  4H02 A;  3RKX A;  3SWN B;  4PJO A;  1VQZ A;  4C8Q B;  2DQ3 A;  2ZNI A;  4JRI A;  4PJO E;  4XTV A;  3JCM W;  4X9D A;  1BIB A;  3NEM A;  5GAO r;  1JBM A;  2XGT A;  3JCM f;  2ODR D;  4PJO C;  1RIQ A;  3A5Y A;  4QVC A;  3R07 A;  4M75 D;  2DDZ A;  3A31 A;  2DXT A;  5ELN A;  4M7D G;  3HXU A;  3QTC A;  5GAO l;  5GAN h;  1WYD A;  4EMG A;  1BIA A;  2QHU A;  1HXD A;  1LJO A;  3L4G A;  4M78 G;  1E24 A;  3QNE A;  3MEY A;  4P75 C;  2J3M A;  4EMK B;  3UGQ A;  1H4S A;  2QHV A;  4G84 A;  1C0A A;  4M77 G;  3VQX A;  1Y96 B;  4P73 A;  2ZNJ A;  3SB2 A;  1U1S A;  4M77 D;  3NEL A;  3PGG A;  5GAM e;  4XTX A;  4P73 C;  2QHT A;  4XTW A;  1GGM A;  4CH4 A;  2DXU A;  3QO5 A;  5GAN j;  2DVE A;  4F7U G;  1HC7 A;  2E3C A;  4PG3 A;  1E1T A;  4C92 A;  3AHU A;  2DU5 A;  4NCX A;  4C92 E;  2Q7H A;  1G5I A;  2ZZE A;  2ZZG A;  4K87 A;  2EJF A;  2ZTG A;  1H4Q A;  2AKW B;  5GAN f;  3RKW A;  2DJZ A;  3IG2 A;  4C92 C;  3MF2 A;  3ICA A;  2Q7G A;  4YRS A;  1EIY A;  5GMK e;  3W3S A;  3SWN A;  2I4M A;  3L1A A;  5I21 A;  4HWT A;  4C8Q A;  4CS2 A;  3FIF A;  1I81 A;  1B7Y B;  3RAC A;  4P3P A;  3SWN C;  1NJ2 A;  4M75 F;  1NJ5 A;  3NEN A;  3HRK A;  1KMN A;  4RQE A;  2I4N A;  2Q5I A;  4PJO G;  2CGH A;  5GAM h;  3LC0 A;  4EO4 A;  1YFT A;  2C7I A;  3RIR A;  5HGQ A;  4RDX A;  5C51 B;  2QTX A;  3HFO A;  2ZR3 A;  2CJA A;  3A74 A;  4YRN A;  4RCB A;  4TQF A;  1JJC A;  3CMQ A;  3DSQ A;  4WI1 A;  2XTI A;  4EMK A;  1X55 A;  1WNL A;  1M8V A;  3M4Q A;  4LNS A;  2IY5 A;  2DU7 A;  1Y96 A;  4HVC A;  4M77 F;  5LJ3 g;  3IKL A;  3JB9 H;  3JB9 G;  1N9W A;  3BY7 A;  5GMK h;  4EMK C;  2YLC A;  4L87 A;  3JB9 D;  2VC8 A;  4XEO A;  5GAM j;  3HXV A;  4YCV A;  4YRK A;  1MGQ A;  4YRG A;  2G4C A;  1ATI A;  4RCC A;  3HFZ B;  3EFR A;  2HNI A;  4M7A D;  4YRL A;  4UPA A;  5GAM f;  1ASY A;  5GAN 4;  4CH3 A;  1B70 B;  2E65 A;  3JCM X;  2EAY A;  5ELO A;  2AKW A;  3UFG A;  2RHS A;  4XU0 A;  2ALY B;  1X2G A;  5GMK j;  5LJ3 d;  4RMF A;  5GAN 6;  1SET A;  4C92 G;  3V7R A;  3V8J A;  2Q7E A;  4RQF A;  4TTV A;  1NYR A;  3HXW A;  4Q15 A;  5GAN 3;  4H2U A;  1LOJ A;  4YRF A;  12AS A;  2VXF A;  2QHS A;  4J6X A;  4E51 A;  5LJ5 e;  4CH6 A;  4CS3 A;  4KR3 A;  4C8Q G;  2RHQ B;  4C8Q D;  1SES A;  2CJ9 A;  4XQ3 A;  3E9H A;  4YRT A;  3JCM g;  3RGL A;  3VQW A;  3L2Z A;  4JUV A;  4J6Y A;  2DKG A;  4AH6 A;  4P72 C;  4P75 A;  2DTO A;  3HY1 A;  2ZIO A;  2DQ0 A;  4YRI A;  4XU2 A;  4M7D D;  1USY A;  4M78 D;  4J5Y A;  3V7C A;  1EOV A;  4M7A F;  3PZC A;  1YFS A;  3HFZ A;  1E22 A;  1USY C;  3VQV A;  3TUP A;  3UGT A;  1KQ2 A;  1W66 A;  4M75 B;  3JCM d;  3JCM P;  3VQY A;  1B70 A;  5LJ5 h;  1B34 B;  5DY9 A;  2ALY A;  4O2D A;  4YCW A;  3A7A A;  2EWN A;  1YCY A;  4OLF A;  1U1T A;  1TH7 A;  4P3O A;  3E9I A;  1NNH A;  5GAO p;  2EL9 A;  3REU A;  4HWP A;  4M77 B;  3V7S A;  5E3I A;  1N9S A;  3QHS A;  5GAN g;  3V8L A;  4YP0 A;  2E64 A;  1KOG A;  3INZ A;  1EVL A;  5LJ5 j;  1G5H A;  4WF2 A;  3FJP A;  1WPY A;  2P5I A;  2RHQ A;  4XTZ A;  4A53 A;  4YCU A;  2ZT5 A;  1NJ8 A;  1EVK A;  1HTT A;  4XTU A;  3HXX A;  4X9C A;  1QE0 A;  5C53 B;  5LJ5 f;  2RM4 A;  4J6W A;  3GIB A;  4HT9 A;  4YRO A;  2Q5H A;  3M4G A;  4PJO D;  1E1O A;  4M7D F;  4H2V A;  4EX5 A;  5GAN d;  5GAO n;  2E1H A;  4HWS A;  1I8F A;  4OP0 A;  1ADY A;  3HFN A;  4M78 F;  5GAN 5;  2ARU A;  1H4T A;  1LNX A;  5GAO q;  3JCM c;  4HT8 A;  1FYF A;  5GMK i;  3HRI A;  5C52 B;  4JLI A;  4M75 E;  1B34 A;  1LYL A;  4YYE A;  3QUI A;  4DPG A;  4A54 A;  1I5L A;  2ODR C;  4G85 A;  1QF6 A;  3PCO B;  4M75 C;  3TEH B;  4F7U F;  2ZR2 A;  1BBU A;  3WQZ A;  3I7F A;  1X54 A;  3LSQ A;  4P71 C;  4ZTZ B;  4KQE A;  5KNN A;  3JCM V;  4QVD A;  5GAM g;  2ZT7 A;  3REX A;  4H2S A;  4ZTU B;  1PYS B;  2PME A;  2E10 A;  4TVW A;  4P74 C;  1WQW A;  4M77 E;  2FB7 A;  1KQ1 A;  3HY0 A;  1H4V B;  4M77 C;  3TEG A;  4XTY A;  2DZC A;  4C92 D;  3M4P A;  1B7Y A;  4M7A B;  1YGB A;  3JCM Q;  2ZGW A;  3BFM A;  2AMC B;  3BDU A;  2ZXF A;  4YRC A;  5GAM d;  1YFR A;  3KFU A;  3V8K A;  4PJO F;  4H2Y A;  3A7U A;  4P72 A;  2ZZF A;  4CS4 A;  3HFV A;  3BW1 A;  1B8A A;  3BJU A;  3G1Z A;  1N9R A;  3JCM b;  1L0W A;  3P8T A;  4BWA A;  1SER A;  3ERR A;  2CIM A;  2RB6 A;  4XU1 A;  3JB9 F;  2ZCE A;  3MF1 A;  4Y91 A;  3JCM J;  3A7R A;  2Y90 A;  5K1X A;  1HK9 A;  1M5Q 1;  3PCO A;  3TEH A;  4H2W A;  4XU3 A;  3UH0 A;  4M75 G;  4BW9 A;  4KR2 A;  2I4L A;  4Q6G A;  1EFW A;  4K88 A;  1PYS A;  2ZT6 A;  2I2L A;  4TVA B;  3RKY A;  4M7D B;  3QSU A;  3QO7 A;  5LJ3 e;  4J15 A;  1JJC B;  4TWA A;  4C92 F;  4YRE A;  4M78 B;  2IY5 B;  4HA8 A;  4N0A A;  1YB3 A;  3IKM B;  4M7A A;  4P3N A;  4M7A E;  2K57 A;  2E41 A;  2AMC A;  4NL2 A;  4UP9 A;  4N0A C;  3HTZ A;  1Z7M A;  2J3L A;  4C8Q F;  4M7A C;  3HXZ A;  2EJG A;  4F7U B;  1X56 A;  5LJ5 g;  1SRY A;  2PMF A;  2RD1 A;  4PHC A;  2RHS B;  3JB9 I;  4HWR A;  1X01 A;  1Z7N A;  4YRJ A;  1D3B B;  1J5W A;  5LJ3 h;  3RER A;  4YRM A;  4WJ4 A;  3P8V A;  1NJ6 A;  3A5Z A;  4C8Q E;  5CAI A;  1IL2 A;  1WLE A;  3OD1 A;  1ASZ A;  4YRP A;  5GAN 7;  2ZIM A;  4K86 A;  4H2X B;  5GAN 8;  4WJ3 M;  4M75 A;  4C8Q C;  4X5O A;  3VBB A;  4CH5 A;  5LJ5 d;  4YDQ A;  3JCM e;  2ARS A;  3FB9 A;  2ZT8 A;  4P71 A;  1H64 1;  5GMK m;  2DTI A;  4PJO B;  2ART A;  2I4O A;  4TVA A;  4M7D A;  3A32 A;  3VU3 C;  4M7D E;  5LJ3 j;  1WU7 A;  4P74 A;  1NJ1 A;  5F5W A;  2YHT A;  4M78 A;  2E5A A;  1JRI A; 
#chains in the Genus database with same CATH topology
 4UP8 A;  2BTT A;  2DFU A;  2M16 A;  3WVD B;  1WXU A;  2QQ9 A;  5DLQ E;  2EJ9 A;  4PNO A;  5LJ3 f;  2D6F A;  4OMQ A;  1M4Z A;  4DQ2 A;  3M57 A;  3NTK A;  2KY9 A;  1AWO A;  3JB9 J;  1TSF A;  2O9S A;  4HWO A;  2CJB A;  1AZG B;  4X34 A;  1X2K A;  1BCM A;  1Q7Y C;  2CH4 A;  4RG2 A;  4TVY A;  2QDY B;  4NS5 A;  5IH2 A;  1OQK A;  11AS A;  1T3S A;  2AZS A;  1PKT A;  2EPD A;  2KT8 A;  1UEC A;  1NYG A;  3X28 B;  5K1P A;  1D3B A;  3QJY A;  1VQL A;  2A7Y A;  1VQK T;  5GMK l;  4C92 B;  1VQ5 T;  3P8Y A;  2HD0 A;  2A0F B;  3RL6 A;  4JRK A;  1V1C A;  2MI6 A;  2X3W D;  3D7S B;  3G4S T;  1M8M A;  2GTO A;  3VS1 A;  1EIY B;  5FU7 B;  1ZUY A;  2I0N A;  1ZBJ A;  3C0C A;  3SWN B;  4JRI A;  3NEM A;  2XDB A;  4FYV B;  3FJ5 A;  2GNC A;  2HQE A;  2HKQ B;  2YRC A;  2RJD A;  1GXI E;  4QVC A;  1RAD B;  2F2X A;  2DDZ A;  3EHR A;  4D8K A;  1OPK A;  1IRX A;  4EMG A;  2QHU A;  2MYS A;  2VB6 A;  4E7L A;  1IHV A;  3L4G A;  4MDX A;  4C0Z A;  1VQO A;  3UGQ A;  5CIU A;  4G84 A;  3CME Q;  4P73 A;  2ZNJ A;  1U5S A;  1AWJ A;  1IZ6 A;  2LX9 A;  3A8O B;  2XK0 A;  1TXQ A;  2QI2 A;  3CCR A;  5GAN j;  1YI2 T;  1NYF A;  1VQN Q;  3AHU A;  1W2B A;  3NMZ C;  2ZZE A;  2CKK A;  1JJ2 S;  3E19 A;  4EDU A;  2DJZ A;  3CCE Q;  3GBQ A;  4QQG A;  1UB4 A;  4HWT A;  3L1A A;  2RK2 A;  3VKI A;  2RI5 A;  3OBW A;  4DBQ A;  2E5K A;  1I07 A;  4P3P A;  1Q7Y U;  3FEO A;  4RQE A;  2J6O A;  2KRN A;  5I2S A;  3OYL A;  3LC0 A;  4EO4 A;  1YFT A;  4BI8 B;  2QTX A;  2B8A A;  3I55 A;  4RUG A;  4HKE A;  1TUD A;  4TQF A;  3DSQ A;  3OB9 A;  5J3B A;  4EMK A;  1X55 A;  1M90 C;  2J6K A;  1M8V A;  4HVC A;  3G71 Q;  2EQJ A;  3BY7 A;  1QVP A;  4OGC A;  5GAM j;  4OMO A;  2AHJ B;  2VVK A;  3U23 A;  4C0F A;  1G3W A;  1ZA2 B;  1M2V B;  3H9N A;  5IXF A;  4YRL A;  5A0G A;  4UPA A;  1K73 U;  2QEX A;  1ZSZ B;  2PQW A;  2CSI A;  3VV0 A;  5ELO A;  3UPU A;  2XID A;  1G5V A;  2O01 E;  4JJC A;  4PL6 A;  2ALY B;  3NTI A;  4F16 A;  4RTY A;  4RMF A;  1XJW B;  2HMA A;  3L2U A;  2RO0 A;  3CBO A;  3TU4 K;  1QCO A;  1VQP T;  3CCJ A;  3DB3 A;  4ESR A;  2RMO A;  2BZX A;  4J6X A;  3PMI A;  1YHQ Q;  1VIE A;  1GBQ A;  2DAQ A;  3DKM A;  5LJ5 e;  4CH6 A;  4E51 A;  4LVL A;  4KR3 A;  3OYH A;  5CCA A;  2RN8 A;  3M59 A;  2CJ9 A;  2KXC A;  2X51 A;  2WSF E;  3E9H A;  4YRT A;  4FYY B;  1K76 A;  2EFI A;  3HPW A;  4J9E A;  4P72 C;  4ORZ A;  3CCL A;  2LRQ A;  4M7D D;  1USY A;  2K4Y A;  1TWB A;  4ZN3 A;  4J5Y A;  4BE1 A;  1Q95 G;  1NPR A;  3V7C A;  3CCM Q;  5ECA A;  2MCN A;  1UGQ B;  3VQV A;  3CC7 T;  3UGT A;  1TTH B;  3JCM d;  1ZX6 A;  3VQY A;  3M54 A;  1B34 B;  2ECZ A;  4YCW A;  1KIK A;  3MEA A;  1YCY A;  5FWC A;  4OLF A;  1TH7 A;  3VS6 A;  4LNP A;  2LJ3 A;  5GAO p;  3GOX A;  1RUW A;  1U3O A;  4HWP A;  5GAN g;  3V8L A;  3FDR A;  2E64 A;  3INZ A;  4WF2 A;  3FJP A;  2L8D A;  4XTZ A;  4A53 A;  1B07 A;  4E7S A;  1EVK A;  1WXB A;  1BCO A;  1R8O B;  3HXX A;  5LJ5 f;  2M0O A;  3A8L B;  1YN8 A;  1OU9 A;  3GIB A;  4YRO A;  1AD5 A;  2YUQ A;  4RG8 A;  2Q5H A;  4LUD A;  4PJO D;  4M7D F;  4QQ6 A;  1BI1 A;  1I8F A;  3HKS A;  4OB3 B;  1H8K A;  3RMQ A;  2KRM A;  5GAN 5;  2HKN A;  2ARU A;  2W0Z A;  1LNX A;  1P92 A;  4KUL A;  3CXC A;  4D8D A;  4PJJ A;  1MUZ A;  2C0O A;  2FEI A;  2VGN A;  2BUD A;  4HCK A;  2JZ2 A;  1GFC A;  1UGP B;  4FYW B;  1NPP A;  2NUT A;  3CD6 Q;  2ZR2 A;  3LSQ A;  4P71 C;  5HY6 A;  1OOT A;  5KNN A;  5GAM g;  4ZTU B;  1PYS B;  4Q5W A;  1N6A A;  1WQW A;  4M77 E;  3OYI A;  2FB7 A;  4BE0 A;  1KQ1 A;  3UAT A;  2H3J A;  3OYF A;  1JJ2 P;  2DPP B;  1JB0 E;  1HSQ A;  4OB2 B;  1VQL T;  2GTJ A;  8ATC B;  2L89 A;  4TVR A;  2DZC A;  3M4P A;  1CKB A;  1YGB A;  2XU8 A;  5KCH A;  4Y28 E;  2ZPI B;  2ZXF A;  3PFS A;  3KFU A;  4PJO F;  4KT0 E;  1VQK A;  3HFV A;  3BW1 A;  2K9G A;  3CCE T;  2F5T X;  1N9R A;  3JCM b;  5GJW B;  2OTJ A;  1BBZ A;  1UHC A;  2L5Q A;  3P8T A;  5AYF A;  3CCQ A;  2F2V A;  1GBR A;  2H8H A;  4QW2 A;  2CIM A;  2RI3 A;  2RB6 A;  2ZCE A;  3MF1 A;  4JRQ A;  1B3Q A;  3A7R A;  1MMG A;  5D6W A;  4BDZ A;  1HK9 A;  1IGQ A;  1M5Q 1;  4JJD A;  4UC4 A;  1OX9 A;  4VUB A;  2KRO A;  3JRZ A;  3CQT A;  4J9C A;  3TCJ A;  4LXC A;  4Q6G A;  1YIJ Q;  1QKX A;  3KBG A;  1U8R A;  1KD1 U;  1PC0 A;  2F69 A;  2EYY A;  1YWP A;  3QSU A;  3E9F A;  4JDS A;  3QO7 A;  3CCR T;  2QGG A;  3I5S A;  1YJ9 T;  4YRE A;  3C94 A;  3IKM B;  4M7A A;  4M7A E;  2KSS A;  3A8H B;  2E41 A;  3WVE B;  2AMC A;  3EGD A;  3OS2 A;  1BI2 A;  4R0K A;  1Z7M A;  2BZY A;  4PFO A;  3BE3 A;  4C8Q F;  1YI2 A;  2OTL T;  2LVM A;  3SD4 A;  1RAA B;  4F7U B;  3LGF A;  2EYZ A;  5L23 A;  2COW A;  3S3N A;  2RD1 A;  1VIF A;  3E2U A;  4C5E A;  1J5W A;  2ZPE B;  3C12 A;  3I55 T;  2JTE A;  1V29 B;  2K3B A;  1UE9 A;  1WIE A;  5I22 A;  1VQ7 Q;  2JMA A;  2ROT A;  1YJW Q;  1R77 A;  4J7I A;  4M75 A;  1I5O B;  1PD1 A;  4X5O A;  2D1X A;  4YDQ A;  2RQT A;  2LDM A;  2HZY A;  3LH0 A;  1QVF S;  3PE0 A;  2ZT8 A;  1H64 1;  3OYN A;  2PNI A;  2YWW A;  4TVA A;  3L2R A;  2CT3 A;  3VU3 C;  1UUE A;  2XMF A;  5F5W A;  4M78 A;  2E5A A;  1JRI A;  2Y4Y A;  3EFS A;  4M78 E;  2YLB A;  4M7D C;  1I4K 1;  3CCV A;  2FO0 A;  2XI9 A;  4EMH A;  1KJW A;  4LVI A;  3CMA T;  3QO8 A;  3X24 B;  4NL3 A;  1UTI A;  2KK4 A;  5FU6 C;  4RTW A;  1XQH A;  1K73 R;  2P0K A;  3I5R A;  2HAX A;  1G51 A;  5GAN 2;  2FYK A;  3CC2 Q;  4V2S A;  4R56 A;  2EGC A;  4M7A G;  4DBH A;  2HDA A;  4H2T A;  1W4S A;  3CCJ T;  1FXX A;  3QYG B;  2XD0 A;  4AFQ C;  3EAE A;  1ADJ A;  4IUQ A;  1MMD A;  4LDW A;  2ZIN A;  2QK0 A;  4CRI A;  2E3H A;  1BBW A;  4GLK A;  2AZV A;  1BI0 A;  4FSX A;  1VQP A;  4A4G A;  1QCN A;  2PVG B;  2CYZ B;  1PRM C;  2HQX A;  2QGF B;  2CRE A;  2CP0 A;  2RQV A;  2X35 A;  4A4E A;  2G6F X;  5J39 A;  2EQU A;  1VQ4 Q;  1HJD A;  4TQD A;  1SHG A;  4H2X A;  4YPF A;  2FG0 A;  1WI7 A;  4KGX B;  3P8B B;  5KYW B;  3CCL T;  5L8R E;  4BY6 C;  2DLP A;  1WJR A;  4KGZ B;  2PUK B;  3I56 Q;  5GAO r;  1JBM A;  1K8A U;  2KGT A;  4PJO C;  4M75 D;  2C06 A;  2A3L A;  1Q81 U;  2DXT A;  3A31 A;  5ELN A;  1SEM A;  3HXU A;  3MHX A;  5GAO l;  5GAN h;  1EX4 A;  2JNG A;  2KMT A;  1HXD A;  2QQS A;  1KC8 R;  2VGM A;  4LDX A;  4M78 G;  1E24 A;  5AT1 B;  3LH5 A;  2J3M A;  4O5V A;  4E7K A;  1QVG S;  1YIT Q;  2QG9 B;  4X1V A;  4PLI A;  2EKO A;  1SRM A;  4BE2 A;  4A4F A;  4DBR A;  2RJE A;  1NJI U;  5C0M A;  3PGG A;  2NS6 A;  2A08 A;  4Z88 A;  2QTV A;  2QHT A;  2LX7 A;  1JO8 A;  3EGX B;  2DVE A;  3PT9 A;  1M9S A;  2E3C A;  2QAZ A;  8AT1 B;  4FT2 A;  4C92 A;  2DU5 A;  4C92 E;  2Q7H A;  1G5I A;  3OBY A;  2EJF A;  2V1Q A;  2QQA A;  5FLX E;  1D0Y A;  5HK3 A;  2Y4X A;  4OMM A;  3CCU Q;  1F1B B;  3IG2 A;  2QA4 Q;  3MF2 A;  1EIY A;  2NUP B;  2DIL A;  2ATC B;  2OAU A;  3SWN A;  3GP8 A;  1Q86 U;  3A1P A;  3OYG A;  4ZGE B;  1B7Y B;  1WFW A;  1RI9 A;  2C0I A;  3M55 A;  1G8X A;  1WHK A;  3VUZ A;  1PWT A;  3DLL A;  2F1L A;  1NJ2 A;  4M75 F;  4KH1 B;  3NPF A;  9ATC B;  2RHY A;  2Q5I A;  5GAM h;  3M58 A;  2VYT A;  5CKB A;  4RCB A;  2RI2 A;  3I35 A;  4LDY A;  1UDL A;  2XKO C;  1SG5 A;  2SRC A;  2CZ7 B;  4LNS A;  2DU7 A;  2EYX A;  2COY A;  3M56 A;  3JB9 G;  3O5Z A;  1MV3 A;  2M1H A;  3VRZ A;  2DE0 X;  2ZPH B;  3JB9 D;  1RLP C;  2VC8 A;  5D6Y A;  1YNZ A;  1MNE A;  4YCV A;  5GJV B;  4HT4 A;  2G4C A;  1ATI A;  3HFZ B;  1X27 A;  2D0N A;  1TUG B;  2EQM A;  1EIF A;  2ZPG B;  4OB0 B;  5GAN 4;  4ELY C;  1B70 B;  1RL2 A;  1WA7 A;  1K4U S;  2EAY A;  2CDT A;  3UFG A;  3CME A;  2RHS A;  4XU0 A;  1GCP A;  1X2G A;  5GMK j;  5LJ3 d;  5GAN 6;  2PZ1 A;  4C92 G;  3V7R A;  2Q7E A;  4RQF A;  1WX6 A;  4TTV A;  3HXW A;  1QKW A;  5FW9 A;  2OTJ T;  4Q15 A;  1LOJ A;  1KQS A;  2QHS A;  3CCQ T;  2FVU A;  2K79 A;  4IUU A;  3QII A;  2CZ1 B;  1LCK A;  4B6M A;  3M53 A;  2M02 A;  3CCE A;  3IQL A;  4PK4 A;  1K73 C;  3JCM g;  1QVF P;  3RGL A;  3VQW A;  4Z8A A;  4J6Y A;  4RTV A;  2JM9 A;  3MKD A;  4P75 A;  2KT1 A;  1C1A A;  1ZSG A;  1X6B A;  5CR2 A;  3ME9 A;  4LDV A;  4YRI A;  4E7I A;  4CC2 A;  2MK5 A;  2R58 A;  1NZ9 A;  2PVD B;  1VQ9 Q;  1K1Z A;  1M2V A;  1KD1 R;  1SF9 A;  3TUP A;  2WSC E;  2P84 A;  1ZSZ A;  2LNH B;  3OYM A;  3J81 E;  4F04 B;  2ALY A;  5FRN A;  4O2D A;  1MHN A;  2GFU A;  1YJ9 A;  1U1T A;  4P3O A;  1VQM T;  1UJY A;  3MEV A;  1RLQ C;  4KBM B;  3REU A;  4ATO A;  3V7S A;  1QVF A;  5E3I A;  1S72 Q;  3L2V A;  1G5H A;  3EH1 A;  4KUD K;  2OTL A;  1VYU A;  4DEX A;  3EG9 B;  2FL7 A;  4MDW A;  4FIB A;  1KC8 C;  2ZT5 A;  1HTT A;  3EG3 A;  4X9C A;  1IHW A;  3URG A;  3RBB B;  3REA B;  2A8E A;  2RHU A;  3CPW S;  2JTM A;  2DM1 A;  4J6W A;  2CP6 A;  4H2V A;  2J05 A;  3CCS Q;  2FZG B;  4E2F B;  4LDU A;  3VS5 A;  2QDL A;  4OGE A;  1YHQ A;  4HWS A;  1ADY A;  1VQ8 T;  1Z9Z A;  3E1S A;  4PKC C;  1BYM A;  2GBQ A;  5KYX B;  1QMC A;  3VRY A;  1YJN Q;  4QVZ A;  5GMK i;  1WJQ A;  4OVA A;  4YTL A;  5DLO A;  3CCV T;  5KYU B;  1QVG P;  2X3X D;  1O9S A;  1B34 A;  2ZCF B;  2A36 A;  4ZTJ A;  3PCO B;  4M75 C;  5KYN A;  2IIM A;  3WQZ A;  1CKA A;  1UGV A;  2YXY A;  1NEG A;  2ZAE A;  4C0D B;  3JCM V;  4H2S A;  3CMA A;  2PME A;  3R6N A;  1Z9Q A;  2P4R A;  1YIT T;  3HY0 A;  2DNU A;  2ZPF B;  3OSS C;  4BB7 A;  2EKH A;  1HYO A;  2BZ8 A;  3VJP A;  4ME7 A;  1KSW A;  3BDL A;  1QP3 A;  3EG0 A;  2L3Q A;  3DLM A;  3BFM A;  2MPX C;  3OW2 S;  3OYB A;  3BDU A;  2HEQ A;  2EQK A;  1YFR A;  3V8K A;  5FRM A;  4BUG A;  1HD3 A;  2FPE A;  1X43 A;  3VS4 A;  4CS4 A;  2JMC A;  2LZ6 B;  1PCX A;  1B8A A;  1M3C A;  3BJU A;  4N4H A;  4IUT A;  1SER A;  4J9D A;  1OZ2 A;  1M1K U;  3VS0 A;  3ERR A;  1KHC A;  1K8A R;  1QWE A;  4E6R A;  4LVJ A;  2DMO A;  4HCZ A;  3A5Z B;  2K5L A;  2DIQ A;  1WXT A;  1Y7X A;  1M2O A;  1Q81 R;  1KHI A;  4XU3 A;  1KC8 U;  1X6O A;  3UH0 A;  4PFP A;  2I4L A;  3SFM A;  4K88 A;  1PYS A;  2ZT6 A;  3RKY A;  4M7D B;  3H41 A;  1T0J A;  1ARK A;  1JXO A;  3EFO B;  2IY5 B;  1FMK A;  1XTD A;  1NJI R;  2RQU A;  1YB3 A;  5FU6 B;  3J7A F;  5IHI A;  2EBP A;  3QDR B;  3CD6 A;  1K9M U;  1Y57 A;  3L2W A;  2IVW A;  1VA7 A;  2V8J A;  4N0A C;  2O2O A;  1GCQ C;  4J83 A;  3PNW C;  4CC3 A;  3NTH A;  4Y92 A;  1VQ6 Q;  1KD1 C;  1SRY A;  2K7A A;  2PMF A;  1WJS A;  4LUE A;  1Q86 R;  4PHC A;  4CI0 C;  2D8H A;  1W70 A;  1X01 A;  4IIO A;  4YRJ A;  2LQ8 A;  1PSE A;  3TSZ A;  3RER A;  4YRM A;  4WJ4 A;  4JS5 A;  5CKD A;  3S6W A;  3VS3 A;  4C8Q E;  4BY6 B;  1WLE A;  3OD1 A;  4YRP A;  2O4X B;  4K86 A;  2WAC A;  3EHQ A;  3FLG A;  5GAN 8;  4WJ3 M;  4J9H A;  1AWX A;  3CC4 Q;  3VBB A;  5LJ5 d;  2ARS A;  3FB9 A;  2E12 A;  5GMK m;  4FU6 A;  1WGS A;  4RMO A;  4PJO B;  1WHJ A;  2ESW A;  3NFC A;  5LJ3 j;  5KH6 A;  1WU7 A;  4ANJ A;  5IHN A;  2MWP A;  1N8R R;  3RF1 A;  4UP7 A;  2F2W A;  1O75 A;  1PM3 A;  4M77 A;  3RUX A;  1WHH A;  3CBP A;  4L5G A;  3ER0 A;  1G2B A;  2MOX A;  3G7Z A;  3CME T;  4ZIB A;  2EW3 A;  3ULR B;  4C5G A;  3LGL A;  3LSS A;  4XEM A;  1U06 A;  3M9Q A;  4YRQ A;  2E3I A;  4N4G A;  2DK3 A;  1X2H A;  4F7U A;  2MMP A;  5KE2 A;  4F7U E;  1ZLM A;  2CZ0 B;  2CZ6 B;  3JCM h;  2VXE A;  1KK7 A;  1VQN T;  1JQQ A;  1YBY A;  3ZL7 C;  2KYB A;  1S1N A;  3HL8 A;  3NET A;  1W1F A;  3MP1 A;  2BE7 D;  5GAN e;  2LJ1 A;  3R6O A;  1PSF A;  3CPW P;  3PVQ A;  4DBF A;  4D6W A;  1NYQ A;  3M4Y A;  3UT1 A;  1IO6 A;  2GGR A;  4ZNX A;  3IAL A;  4E47 A;  2EGA A;  4RKU E;  1I1J A;  2LQN A;  1UGS B;  1B76 A;  1VQZ A;  2KXD A;  2FRY A;  3KFV A;  4C8Q B;  1J3T A;  1BIB A;  2M9U A;  2DXB A;  1JJ2 A;  3X25 B;  2PUO B;  2XGT A;  3OMC A;  3QXE B;  1WHM A;  4HVW A;  3LW5 E;  2ODR D;  4JZ3 A;  1RIQ A;  1RI0 A;  3A5Y A;  3R07 A;  2DBK A;  5A2Q E;  3OS5 A;  1NLO C;  1VQ7 A;  2W10 A;  1YJW A;  5CO7 A;  1YJN T;  4MZP A;  2HL5 C;  2HQH A;  2ABL A;  3G71 T;  1WHL A;  1LJO A;  2VWF A;  2DL3 A;  2DER A;  4ZGD B;  3MEY A;  3QNE A;  1EFN A;  4P75 C;  1RAC B;  2QHV A;  2YUO A;  3LWH A;  5EC7 A;  4M77 G;  1Y96 B;  3CPW A;  2YUN A;  3HRT A;  5CKH A;  4M77 D;  1Y07 A;  2BE9 B;  3M0R A;  4JRP A;  5HKC A;  2RF0 A;  2V26 A;  5GAM e;  4P73 C;  2LMJ A;  1K8A C;  1D0X A;  4CH4 A;  2DXU A;  3QO5 A;  5I2M A;  3OW2 P;  1VQM A;  4F7U G;  1HC7 A;  2NUT B;  4PG3 A;  1E1T A;  2K3X A;  4A4H A;  2LT4 A;  1FYN A;  1Q81 C;  4K87 A;  1NG2 A;  3CC2 A;  1H4Q A;  2AKW B;  5IAY A;  4AMC A;  5GAN f;  1V76 A;  3MEW A;  1UGR B;  3RKW A;  1VQ5 Q;  3ICA A;  2Q7G A;  2JVV A;  1TU0 B;  4YRS A;  5CQX A;  5KYW A;  2OJ2 A;  1ABQ A;  3G4S Q;  2LQW A;  1YHQ T;  3FIF A;  4M4Z A;  2AKK A;  3REB B;  1FMV A;  1NJI C;  1OZ3 A;  5A0L A;  1TOV A;  1D0Z A;  2FZC B;  2LC4 A;  1NJ5 A;  1RAH B;  4JPB W;  2CGH A;  1VQ4 A;  2RNA A;  1JXM A;  2YSQ A;  5CKE A;  1I0C A;  5HGQ A;  4RDX A;  3OS1 A;  1SKU B;  2CJA A;  3A74 A;  2O88 A;  3THK A;  1VQ8 A;  1JJC A;  3NHN A;  4O6J A;  3KXT A;  2XTI A;  1D09 B;  4AT1 B;  1WNL A;  2GCX A;  3I56 A;  5KYY B;  1W2B S;  2HBP A;  4M77 F;  5LJ3 g;  2D9T A;  3MJX A;  3JB9 H;  4QT7 A;  3CCM T;  2HL3 A;  1MV0 B;  5GMK h;  1Q86 C;  4EMK C;  2YLC A;  2O9V A;  4XEO A;  4YRK A;  4BI4 A;  5M9O A;  1MND A;  2Z0W A;  3EGX A;  4YRG A;  4M7A D;  5C6S A;  5GAM f;  2E65 A;  4OMF B;  3JCM X;  1FMW A;  1YIT A;  5DM7 R;  1QQJ A;  3GLX A;  2NUP A;  1SET A;  4J9I A;  5I11 A;  1WHG A;  2V8K A;  3JAM E;  4RTX A;  2K2V A;  3ASK A;  2DJQ A;  1NYR A;  1N8R C;  4RTT A;  4DOW A;  2R5A A;  2PU9 B;  3N5B B;  2XDD A;  2DD5 A;  2JS0 A;  4HXJ A;  2JM8 A;  4CS3 A;  3M0S A;  2RHQ B;  3FC3 A;  1SES A;  2RQW A;  2QA4 A;  1M1K R;  1PKS A;  1A0N B;  4E7J A;  4WCI A;  2CSQ A;  3L2Z A;  4B9X A;  2XDP A;  2DKG A;  3HY1 A;  1B7T A;  2ZIO A;  3OYJ A;  4MZT A;  2X9H A;  2KBT A;  3QZ9 B;  4FL6 A;  3CC4 T;  2K5F A;  4M78 D;  2CUB A;  1EOV A;  4M7A F;  3HFZ A;  1E22 A;  1USY C;  2D8J A;  1W66 A;  4M75 B;  3JCM P;  1B70 A;  1R0B G;  3CD6 T;  1XNI A;  2KQW A;  2ROL A;  3SDZ A;  5DY9 A;  3RR6 A;  4LD6 A;  1ZQ1 A;  3TVT A;  3A7A A;  2EWN A;  2HCK A;  2P4T A;  3UA7 A;  2J06 A;  3VS7 A;  1K9M R;  1NNH A;  2EL9 A;  2AIR B;  3LX7 A;  1KFZ A;  3JV3 A;  1N27 A;  2RK1 A;  1N9S A;  3QHS A;  2ED1 A;  2FRW A;  2RHZ A;  1EVL A;  1VQP Q;  5LJ5 j;  2EVR A;  4OMN A;  2JT4 A;  2B86 A;  4FW1 A;  5HCK A;  1X6G A;  3LLR A;  3WXM B;  1NJ8 A;  3MPU B;  4XTU A;  4DEY A;  2K5I A;  1AEY A;  1VYT A;  2DRM A;  3J80 E;  1QE0 A;  3GNF B;  2AT1 B;  2QQR A;  3M4G A;  2BIV A;  2E6N A;  4EX5 A;  3OQ5 A;  5GAO n;  2E1H A;  3VYG A;  3UA6 A;  2OAW A;  4OP0 A;  3HFN A;  4M78 F;  3OA6 A;  5GAO q;  1G3S A;  3JCM c;  4HT8 A;  1FYF A;  1OI1 A;  1T3L A;  3S3O A;  5C52 B;  3G6E Q;  1N8R U;  4E7H A;  3L42 A;  2LT1 A;  1LYL A;  1ZUK A;  2K6D A;  2MIO A;  3QUI A;  4DPG A;  2ODR C;  4G85 A;  1YIJ T;  3CC7 Q;  2RHX A;  4OB1 B;  2EYW A;  3TEH B;  3I7F A;  3HP9 A;  2LJ0 A;  4KQE A;  4QKU A;  4ZTF A;  3REX A;  1OEB A;  4QVD A;  2ZT7 A;  2ZZD A;  2G3R A;  1ABO A;  1VQ9 A;  4GLM A;  1GFD A;  2L3S A;  3L2Q A;  2JW4 A;  1IGU A;  1WDX A;  3EG9 A;  4M77 C;  5J26 A;  3LWI A;  2CP7 A;  4XTY A;  4R55 A;  4C92 D;  2JS2 A;  1Q82 U;  1LVK A;  3JCM Q;  2ZGW A;  2NWM A;  1VQN A;  3CXC S;  2RJC A;  3VUB A;  4A63 B;  3MET A;  3SEM A;  3H0F A;  4H2Y A;  4Z89 A;  1S72 A;  1BK2 A;  3DB4 A;  5KYX A;  3G1Z A;  1L0W A;  2DL7 A;  2QYZ A;  3CBM A;  4N4I A;  2DA9 A;  4BWA A;  2QXF A;  2P0Q A;  5KYU A;  1SRL A;  4XU1 A;  4AFS C;  4CC4 B;  1VQ7 T;  3JB9 F;  4Y91 A;  1YJW T;  3JCM J;  3M0P A;  1W2B P;  2LCC A;  2RHI A;  2Y90 A;  2D0Q B;  5K1X A;  3QYH B;  4HCB A;  3PCO A;  5FRO A;  1T0H A;  1M1F A;  3CCS A;  4H2W A;  3MP8 A;  2KDS A;  4KR2 A;  1EFW A;  3HRS A;  1D1B A;  3EH2 A;  1YJN A;  3EG2 A;  2M0Y A;  3G71 A;  2DX1 A;  4TWA A;  4C92 F;  2FHD A;  4HA8 A;  1M1K C;  3ZBD A;  1CSK A;  4P3N A;  2XG8 D;  2K57 A;  1VQL Q;  3CC2 T;  1UHF A;  3RMS A;  1E7O A;  4NL2 A;  4UP9 A;  4IIM A;  4MZM A;  3QWY A;  5HK0 A;  4M7A C;  3PIP A;  4FT4 A;  2YT6 A;  2YUP A;  3HXZ A;  2EJG A;  3MP6 A;  4J8O A;  3QKJ A;  1X56 A;  5LJ5 g;  3H0I A;  2DEU A;  3P8H A;  2JUF A;  1AOJ A;  2RHS B;  1UG1 A;  2DYB A;  4HWR A;  1NLP C;  1Z7N A;  1MMA A;  1QCF A;  1D3B B;  4AFU C;  1VQ4 T;  2AKL A;  4Z02 A;  5LJ3 h;  1PRL C;  1H3H A;  1NJ6 A;  2X4X A;  2O31 A;  3A5Z A;  2DRK A;  5CAI A;  1YCS B;  5IT9 E;  2K3Y A;  1K9M C;  2F5K A;  2MAM A;  5GAN 7;  3I56 T;  1NM7 A;  1ZUU A;  1PNJ A;  3JCM e;  3QDF A;  1QLY A;  4DOV A;  1VQO Q;  4OMP A;  1QP2 A;  2ED0 A;  2ART A;  2KEA A;  1FWZ A;  1RAF B;  2DXC A;  2DET A;  4AFZ C;  4M7D A;  3A32 A;  1OYX A;  4M7D E;  4P74 A;  2LTO A;  3RDV A;  2KR3 A;  1G83 A;  1NJ1 A;  3EFO A;  2YHT A;  3M0T A;  2HBW A;  2IY5 A;  3EG1 A;  4KRT A;  2J7I A;  1VOM A;  2EIF A;  1N5Z A;  2EGE A;  2JN0 A;  3CCM A;  2V8I A;  3CCR Q;  3UF4 A;  1YJ9 Q;  5IHK A;  4M78 C;  2DTH A;  1ACM B;  1RAB B;  1OX8 A;  2OX7 A;  3L4G B;  3RES A;  2CUD A;  2MWO A;  2YDL A;  1WQ7 A;  2KVQ G;  4NOY A;  3OYK A;  3SHW A;  4K11 A;  3QO3 A;  2PTK A;  4YRR A;  3P8D A;  3HRU A;  3E9G A;  4KGV B;  2DEQ A;  5GAO m;  2OTL Q;  2HSP A;  3UWN A;  3TSW A;  2A37 A;  3OYD A;  4MML A;  2RA2 A;  1QVG A;  1GRI A;  2P0L A;  3CCU T;  4MMK A;  2QA4 T;  2DZ9 A;  2C8M A;  4C5I A;  2EQI A;  1KMM A;  3HSB A;  2O4X A;  1NBE B;  2IG0 A;  3I55 Q;  1RAG B;  1EQR A;  2AK5 A;  4F14 A;  4IUV A;  5CK9 A;  1VQ6 A;  3RKX A;  4PJO A;  3HXY A;  4H02 A;  2KNB B;  2DQ3 A;  2ZNI A;  4XTV A;  3JCM W;  4PJO E;  4X9D A;  4RTU A;  5KCO A;  2RPN A;  4RTZ A;  6AT1 B;  2LNV A;  3JCM f;  2RH2 A;  1TS9 A;  1K0S A;  4C5H A;  2E5Q A;  1K0X A;  4IUR A;  5CQY A;  4M7D G;  3QTC A;  4BDY A;  2RQR A;  1WYD A;  4L6V 5;  2KYM A;  1BIA A;  4ZN1 A;  3CC4 A;  3S3M A;  3G6E T;  2DBM A;  2QEX Q;  1SPK A;  2CP5 A;  3CMA Q;  4EMK B;  1H4S A;  4IKF A;  1C0A A;  3VQX A;  4XAX B;  3SB2 A;  1U1S A;  4KH0 B;  1QW1 A;  1PHT A;  1VYV A;  4BAC A;  3NEL A;  4KUI A;  3QJ6 A;  4XTX A;  3CCJ Q;  4XTW A;  1GGM A;  1M3B A;  3QZ5 B;  2DL4 A;  4GY5 A;  3CXC P;  2DF6 A;  2L2P A;  4NCX A;  2ZZG A;  2CH4 W;  2ZTG A;  3AT1 B;  4DA4 A;  2EYQ A;  1M90 U;  3OMG A;  4C92 C;  1X75 C;  2JTF A;  5GMK e;  3W3S A;  2I4M A;  4CS2 A;  5I21 A;  4C8Q A;  1ZBX A;  4IUP A;  2H3E B;  1M1G A;  2HSE B;  3QWX X;  1I81 A;  3A8M B;  1WLP B;  1JU5 C;  3CCL Q;  3RAC A;  5FU7 C;  4LN2 A;  3SWN C;  1E6G A;  1RAE B;  4JJB A;  3NEN A;  3HRK A;  1KMN A;  1C6V X;  2L0A A;  2I4N A;  4PJO G;  4LVM A;  2VV5 A;  4II1 A;  3GNG A;  4EPC A;  2C7I A;  3RIR A;  5C51 B;  4HCC A;  2ZR3 A;  1PD0 A;  1XOV A;  2QAS A;  3HFO A;  4YRN A;  3CEY A;  3CMQ A;  4FCY A;  1M3A A;  4WI1 A;  4PJM A;  2DIG A;  3T9N A;  2QQB A;  5KE3 A;  3M4Q A;  4B9W A;  1Y96 A;  4OML A;  2E4H A;  1ZHI A;  5IN1 A;  3TQ7 P;  3IKL A;  3OYC A;  2JXB A;  3HHT B;  1VQ9 T;  1N9W A;  4L87 A;  2COZ A;  1YIJ A;  1AVZ C;  3HXV A;  1Y0M A;  3QPH A;  1MGQ A;  1AHJ B;  4EIK A;  2K2M A;  3X26 B;  4RCC A;  1JEG A;  3EFR A;  2HNI A;  1X69 A;  1K9A A;  1ASY A;  4CH3 A;  3UDC A;  1UFF A;  1BI3 A;  1Y71 A;  7AT1 B;  3OYA A;  2AKW A;  2YRV A;  3ZEH A;  1Q82 R;  3M5A A;  1YP5 A;  1SHF A;  1DJ7 B;  4QQD A;  2CP2 A;  2YRD A;  4ELZ C;  1S72 T;  4LVK A;  2CT4 A;  3V8J A;  2E70 A;  4JJN K;  1G3T A;  5GAN 3;  2FZK B;  4H2U A;  4YRF A;  2ZPB B;  12AS A;  2VXF A;  2L3P A;  2LP5 A;  3JSC A;  1AZE A;  4E7Z A;  1IXD A;  4PFZ A;  2DYI A;  4C8Q G;  3O8V A;  3KUF A;  1AWW A;  4XK8 E;  4C8Q D;  2KE9 A;  1VQ5 A;  4XQ3 A;  2FPF A;  3G1J A;  4JUV A;  2LCS A;  3CCS T;  4JS4 A;  1BB9 A;  3G4S A;  3MEU A;  5KYY A;  4AH6 A;  2XHC A;  2KI7 A;  1SSF A;  2DTO A;  5IXB A;  1AT1 B;  4LE9 A;  2ENM A;  2DQ0 A;  4XU2 A;  3MCA B;  4WTO B;  1H3Z A;  1VQO T;  2OI3 A;  1W6X A;  3PZC A;  2VAS A;  1YFS A;  3H6Z A;  1KQ2 A;  2KRS A;  4HVU A;  5LJ5 h;  3C4S A;  3MO8 A;  1KQS S;  4JLG A;  2CP3 A;  2M51 A;  3OYE A;  3GF5 A;  4C0D C;  1ZSZ C;  2LCL A;  3VYH B;  3E9I A;  1PG5 B;  2JJ9 A;  3M0Q A;  2WSE E;  4PJL A;  4AG2 C;  4M77 B;  4YP0 A;  2C0T A;  1VQK Q;  5D7U A;  1KOG A;  5CKF A;  4OF1 A;  1WPY A;  2P5I A;  2OTJ Q;  2RHQ A;  1FX7 A;  4YCU A;  3X20 B;  3CCQ Q;  3EGU A;  2R57 A;  1E6H A;  5C53 B;  3QG1 A;  1RAI B;  2RM4 A;  3H8Z A;  4HT9 A;  1M30 A;  2LQK A;  5EG2 A;  1E1O A;  4L59 A;  5GAN d;  1SSH A;  2NYS A;  1Q7Y R;  2R5M A;  3C95 A;  1H4T A;  3OW2 A;  3Q1J A;  5LL6 S;  1D1A A;  3HRI A;  2VUB A;  4BI3 A;  4JLI A;  4M75 E;  1VUB A;  1GL5 A;  3OS0 A;  3VS2 A;  5CVI A;  3H0H A;  4YYE A;  4A54 A;  1I5L A;  1QF6 A;  1QWF A;  2DD4 A;  2GF7 A;  2DL5 A;  2X4Y A;  3GPL A;  4F7U F;  1BBU A;  1IB8 A;  3TEE A;  1X54 A;  4ZTZ B;  1WYX A;  1MMN A;  1KG1 A;  1YI2 Q;  2E10 A;  2QEX T;  4TVW A;  4P74 C;  1WZO A;  1VQM Q;  3NGP A;  1BKB A;  2SEM A;  2J6F A;  1EZZ B;  1H4V B;  3TEG A;  2CS7 A;  4CC7 A;  2KAF A;  4FW2 A;  1B7Y A;  2A28 A;  4M7A B;  3M0U A;  4PLL A;  3OSV A;  3PIO A;  1YFN A;  1TG0 A;  3A8G B;  2AMC B;  3EGD B;  4JZ4 A;  3QBY A;  4YRC A;  2XIC A;  5GAM d;  1OV3 A;  1VQ6 T;  1H92 A;  3A7U A;  4ZGJ B;  3CCU A;  4P72 A;  2ZZF A;  4LD9 K;  3A98 A;  1C0M A;  5A0D A;  4GBQ A;  3F70 A;  1UJ0 A;  3I9Q A;  4P5N A;  1D1C A;  4BD3 A;  1VQ8 Q;  1Q82 C;  3FRN A;  2GQV A;  3CCV Q;  5FWB A;  3TEH A;  4F17 A;  5D6X A;  2NLU A;  3OY9 A;  4M75 G;  4BW9 A;  1BU1 A;  2I2L A;  4FYX B;  4TVA B;  4FM4 B;  2X4W A;  3G6E A;  4C0G A;  5LJ3 e;  4J15 A;  1JJC B;  2X4J A;  2V1R A;  4M78 B;  4J9F A;  2PVO B;  4N0A A;  1OPL A;  3CC7 A;  1GCQ A;  2VKN A;  1YWO A;  2DO3 A;  1M27 C;  3HTR A;  3CPF A;  3HTZ A;  1IRE B;  2J3L A;  4FSS A;  4J9G A;  1NE8 A;  1G3Y A;  1R0C B;  1M90 R;  3ZFJ A;  4A4K A;  3TRE A;  3PVL A;  2DVJ A;  1TUC A;  1NEB A;  2IPO B;  3PMT A;  4HVV A;  3JB9 I;  1UEB A;  1X2Q A;  2E6Z A;  3RNJ A;  4J7F A;  3P8V A;  3OYY A;  2RJF A;  2JOY A;  2GQI A;  1IL2 A;  2P0P A;  1ASZ A;  2GFA A;  1OUL A;  2MF2 A;  1ZA1 B;  1OU8 A;  2ZIM A;  2FPD A;  4H2X B;  2DL8 A;  4AG1 C;  4C8Q C;  2L3R A;  4CH5 A;  1LPL A;  3LYI A;  4P71 A;  2DTI A;  3MQZ A;  2I4O A;  4PJN A;  4J9B A;  2BKD N;  2NUZ A;  3PTA A;  1KQS P; 
#chains in the Genus database with same CATH homology
 4UP8 A;  2M16 A;  3WVD B;  2QQ9 A;  5DLQ E;  2EJ9 A;  4PNO A;  5LJ3 f;  2D6F A;  1M4Z A;  4DQ2 A;  3M57 A;  3NTK A;  2KY9 A;  3JB9 J;  4HWO A;  2CJB A;  4X34 A;  1Q7Y C;  4RG2 A;  4TVY A;  2QDY B;  4NS5 A;  11AS A;  3X28 B;  5K1P A;  1D3B A;  3QJY A;  1VQL A;  2A7Y A;  1VQK T;  5GMK l;  4C92 B;  1VQ5 T;  3P8Y A;  2HD0 A;  3RL6 A;  4JRK A;  2MI6 A;  3G4S T;  1EIY B;  5FU7 B;  3SWN B;  4JRI A;  3NEM A;  2XDB A;  2HQE A;  2RJD A;  1GXI E;  4QVC A;  2DDZ A;  4EMG A;  2QHU A;  4E7L A;  3L4G A;  4MDX A;  4C0Z A;  1VQO A;  3UGQ A;  5CIU A;  4G84 A;  4P73 A;  2ZNJ A;  1IZ6 A;  2LX9 A;  3A8O B;  2XK0 A;  2QI2 A;  3CCR A;  5GAN j;  1YI2 T;  3AHU A;  1W2B A;  2ZZE A;  2CKK A;  1JJ2 S;  3E19 A;  4EDU A;  2DJZ A;  4QQG A;  1UB4 A;  4HWT A;  3L1A A;  2RK2 A;  3VKI A;  2RI5 A;  3OBW A;  4P3P A;  1Q7Y U;  3FEO A;  4RQE A;  5I2S A;  3OYL A;  3LC0 A;  4EO4 A;  1YFT A;  4BI8 B;  2QTX A;  2B8A A;  3I55 A;  4HKE A;  4TQF A;  3DSQ A;  3OB9 A;  5J3B A;  4EMK A;  1X55 A;  1M90 C;  1M8V A;  4HVC A;  2EQJ A;  3BY7 A;  1QVP A;  4OGC A;  5GAM j;  2AHJ B;  4C0F A;  1G3W A;  4YRL A;  5A0G A;  4UPA A;  1K73 U;  2QEX A;  2PQW A;  3VV0 A;  5ELO A;  3UPU A;  2XID A;  1G5V A;  2O01 E;  4PL6 A;  2ALY B;  3NTI A;  4RMF A;  3L2U A;  2RO0 A;  3CBO A;  3TU4 K;  1VQP T;  3CCJ A;  3DB3 A;  4J6X A;  3PMI A;  1VIE A;  2DAQ A;  3DKM A;  5LJ5 e;  4CH6 A;  4E51 A;  4LVL A;  4KR3 A;  3OYH A;  5CCA A;  3M59 A;  2CJ9 A;  3E9H A;  4YRT A;  2WSF E;  2EFI A;  3HPW A;  4P72 C;  3CCL A;  2LRQ A;  4M7D D;  1USY A;  2K4Y A;  4ZN3 A;  4J5Y A;  4BE1 A;  1NPR A;  3V7C A;  1UGQ B;  3VQV A;  3CC7 T;  3UGT A;  3JCM d;  3VQY A;  3M54 A;  1B34 B;  4YCW A;  3MEA A;  1YCY A;  4OLF A;  1TH7 A;  5GAO p;  3GOX A;  4HWP A;  5GAN g;  3V8L A;  3FDR A;  2E64 A;  3INZ A;  4WF2 A;  3FJP A;  2L8D A;  4XTZ A;  4A53 A;  1EVK A;  1R8O B;  3HXX A;  5LJ5 f;  2M0O A;  3A8L B;  3GIB A;  4YRO A;  4RG8 A;  2Q5H A;  4PJO D;  4M7D F;  4QQ6 A;  1BI1 A;  1I8F A;  3HKS A;  4OB3 B;  3RMQ A;  5GAN 5;  2ARU A;  3CXC A;  1LNX A;  1P92 A;  4KUL A;  2VGN A;  2BUD A;  2JZ2 A;  1UGP B;  1NPP A;  2ZR2 A;  3LSQ A;  4P71 C;  5HY6 A;  5KNN A;  5GAM g;  4ZTU B;  1PYS B;  4Q5W A;  1N6A A;  1WQW A;  4M77 E;  3OYI A;  2FB7 A;  4BE0 A;  1KQ1 A;  2H3J A;  3OYF A;  2DPP B;  1JB0 E;  1VQL T;  4OB2 B;  2L89 A;  4TVR A;  2DZC A;  3M4P A;  1YGB A;  2XU8 A;  5KCH A;  4Y28 E;  2ZPI B;  2ZXF A;  3PFS A;  3KFU A;  4PJO F;  4KT0 E;  1VQK A;  3HFV A;  3BW1 A;  3CCE T;  2F5T X;  1N9R A;  3JCM b;  2OTJ A;  2L5Q A;  3P8T A;  5AYF A;  3CCQ A;  4QW2 A;  2CIM A;  2RI3 A;  2RB6 A;  2ZCE A;  3MF1 A;  4JRQ A;  3A7R A;  5D6W A;  4BDZ A;  1M5Q 1;  1HK9 A;  4UC4 A;  4VUB A;  3JRZ A;  3TCJ A;  4Q6G A;  3KBG A;  1U8R A;  1KD1 U;  2F69 A;  3QSU A;  3E9F A;  4JDS A;  3QO7 A;  3CCR T;  1YJ9 T;  4YRE A;  3C94 A;  3IKM B;  4M7A A;  4M7A E;  2KSS A;  3A8H B;  2E41 A;  3WVE B;  2AMC A;  3OS2 A;  1BI2 A;  1Z7M A;  4C8Q F;  1YI2 A;  2OTL T;  2LVM A;  3SD4 A;  4F7U B;  3LGF A;  3S3N A;  2RD1 A;  1VIF A;  4C5E A;  1J5W A;  2ZPE B;  3C12 A;  3I55 T;  1V29 B;  4J7I A;  4M75 A;  4X5O A;  4YDQ A;  2LDM A;  3LH0 A;  2ZT8 A;  1QVF S;  1H64 1;  3OYN A;  4TVA A;  3L2R A;  3VU3 C;  5F5W A;  4M78 A;  2E5A A;  1JRI A;  2Y4Y A;  3EFS A;  4M78 E;  2YLB A;  4M7D C;  1I4K 1;  3CCV A;  2XI9 A;  4EMH A;  4LVI A;  3CMA T;  3QO8 A;  3X24 B;  4NL3 A;  2KK4 A;  5FU6 C;  1XQH A;  2P0K A;  2HAX A;  1G51 A;  5GAN 2;  2FYK A;  4V2S A;  4R56 A;  4M7A G;  4H2T A;  1W4S A;  3CCJ T;  1FXX A;  3QYG B;  2XD0 A;  3EAE A;  1ADJ A;  4IUQ A;  4LDW A;  2ZIN A;  4CRI A;  1BBW A;  4GLK A;  1BI0 A;  4FSX A;  1VQP A;  4A4G A;  2PVG B;  2CYZ B;  2HQX A;  4A4E A;  2X35 A;  5J39 A;  2EQU A;  4TQD A;  4H2X A;  4YPF A;  3P8B B;  3CCL T;  5L8R E;  4BY6 C;  1WJR A;  2PUK B;  5GAO r;  1JBM A;  1K8A U;  4PJO C;  4M75 D;  2C06 A;  2A3L A;  1Q81 U;  2DXT A;  3A31 A;  5ELN A;  3HXU A;  3MHX A;  5GAO l;  5GAN h;  2JNG A;  4LDX A;  2KMT A;  1HXD A;  2QQS A;  2VGM A;  4M78 G;  1E24 A;  2J3M A;  4O5V A;  4E7K A;  1QVG S;  4PLI A;  2EKO A;  4BE2 A;  4A4F A;  2RJE A;  1NJI U;  5C0M A;  3PGG A;  2NS6 A;  2QHT A;  2DVE A;  3PT9 A;  1M9S A;  2E3C A;  4FT2 A;  4C92 A;  2DU5 A;  4C92 E;  2Q7H A;  1G5I A;  3OBY A;  2EJF A;  2QQA A;  5FLX E;  5HK3 A;  2Y4X A;  3IG2 A;  3MF2 A;  1EIY A;  2OAU A;  3SWN A;  3GP8 A;  1Q86 U;  3OYG A;  4ZGE B;  1B7Y B;  3M55 A;  3VUZ A;  3DLL A;  1NJ2 A;  4M75 F;  2RHY A;  2Q5I A;  5GAM h;  3M58 A;  2VYT A;  5CKB A;  4RCB A;  2RI2 A;  4LDY A;  2XKO C;  2CZ7 B;  4LNS A;  2DU7 A;  3M56 A;  3JB9 G;  2M1H A;  2ZPH B;  3JB9 D;  2VC8 A;  5D6Y A;  4YCV A;  4HT4 A;  2G4C A;  1ATI A;  3HFZ B;  2EQM A;  1EIF A;  2ZPG B;  4OB0 B;  5GAN 4;  4ELY C;  1B70 B;  1RL2 A;  2EAY A;  3UFG A;  2RHS A;  3CME A;  4XU0 A;  1X2G A;  5GMK j;  5LJ3 d;  5GAN 6;  4C92 G;  3V7R A;  2Q7E A;  4RQF A;  4TTV A;  3HXW A;  4Q15 A;  2OTJ T;  1LOJ A;  1KQS A;  2QHS A;  3CCQ T;  2FVU A;  4IUU A;  3QII A;  2CZ1 B;  3M53 A;  3CCE A;  1K73 C;  3JCM g;  3RGL A;  3VQW A;  4J6Y A;  4P75 A;  5CR2 A;  3ME9 A;  4LDV A;  4YRI A;  4E7I A;  2R58 A;  2PVD B;  1NZ9 A;  3TUP A;  2WSC E;  3OYM A;  3J81 E;  2ALY A;  5FRN A;  4O2D A;  1MHN A;  2GFU A;  1YJ9 A;  1U1T A;  4P3O A;  1VQM T;  3MEV A;  4KBM B;  3REU A;  4ATO A;  3V7S A;  1QVF A;  5E3I A;  3L2V A;  1G5H A;  4KUD K;  2OTL A;  2FL7 A;  4MDW A;  4FIB A;  1KC8 C;  2ZT5 A;  1HTT A;  4X9C A;  3URG A;  2A8E A;  2RHU A;  3CPW S;  2JTM A;  4J6W A;  4H2V A;  4LDU A;  4OGE A;  1YHQ A;  4HWS A;  1ADY A;  1VQ8 T;  3E1S A;  4PKC C;  1BYM A;  4QVZ A;  5GMK i;  1WJQ A;  4OVA A;  4YTL A;  5DLO A;  3CCV T;  1O9S A;  1B34 A;  2ZCF B;  4ZTJ A;  3PCO B;  4M75 C;  3WQZ A;  4C0D B;  3JCM V;  4H2S A;  3CMA A;  2PME A;  1YIT T;  3HY0 A;  2ZPF B;  3OSS C;  4BB7 A;  3VJP A;  4ME7 A;  3BDL A;  1QP3 A;  3DLM A;  3BFM A;  3OW2 S;  3OYB A;  3BDU A;  2EQK A;  1YFR A;  3V8K A;  5FRM A;  4BUG A;  4CS4 A;  1B8A A;  3BJU A;  4N4H A;  4IUT A;  1SER A;  1OZ2 A;  1M1K U;  3ERR A;  1KHC A;  4LVJ A;  4HCZ A;  3A5Z B;  2K5L A;  2DIQ A;  1Y7X A;  1KHI A;  4XU3 A;  1KC8 U;  1X6O A;  3UH0 A;  2I4L A;  3SFM A;  4K88 A;  1PYS A;  2ZT6 A;  3RKY A;  4M7D B;  2IY5 B;  1XTD A;  1YB3 A;  5FU6 B;  3J7A F;  3QDR B;  3CD6 A;  1K9M U;  3L2W A;  2IVW A;  2V8J A;  4N0A C;  4J83 A;  3PNW C;  3NTH A;  1KD1 C;  1SRY A;  2PMF A;  1WJS A;  4PHC A;  4CI0 C;  1X01 A;  4YRJ A;  2LQ8 A;  1PSE A;  3RER A;  4YRM A;  4WJ4 A;  4JS5 A;  5CKD A;  3S6W A;  4C8Q E;  4BY6 B;  1WLE A;  3OD1 A;  4YRP A;  2O4X B;  4K86 A;  2WAC A;  3FLG A;  5GAN 8;  4WJ3 M;  3VBB A;  5LJ5 d;  2ARS A;  3FB9 A;  2E12 A;  5GMK m;  4FU6 A;  1WGS A;  4RMO A;  4PJO B;  3NFC A;  5LJ3 j;  5KH6 A;  1WU7 A;  2MWP A;  3RF1 A;  4UP7 A;  1O75 A;  4M77 A;  3RUX A;  3CBP A;  4L5G A;  3ER0 A;  3G7Z A;  3CME T;  4ZIB A;  4C5G A;  3LGL A;  3LSS A;  4XEM A;  3M9Q A;  4YRQ A;  4N4G A;  2DK3 A;  1X2H A;  4F7U A;  2MMP A;  5KE2 A;  4F7U E;  2CZ0 B;  2CZ6 B;  3JCM h;  2VXE A;  1VQN T;  1YBY A;  3HL8 A;  3NET A;  3MP1 A;  5GAN e;  3R6O A;  1PSF A;  4D6W A;  1NYQ A;  3M4Y A;  3UT1 A;  3IAL A;  4E47 A;  4RKU E;  1UGS B;  1B76 A;  1VQZ A;  4C8Q B;  1BIB A;  2M9U A;  2DXB A;  1JJ2 A;  3X25 B;  2PUO B;  2XGT A;  3OMC A;  3QXE B;  3LW5 E;  2ODR D;  1RIQ A;  1RI0 A;  3A5Y A;  3R07 A;  5A2Q E;  3OS5 A;  1VQ7 A;  1YJW A;  5CO7 A;  1YJN T;  4MZP A;  3G71 T;  1LJO A;  3QNE A;  3MEY A;  4ZGD B;  4P75 C;  2QHV A;  3LWH A;  4M77 G;  1Y96 B;  3CPW A;  3HRT A;  5CKH A;  4M77 D;  1Y07 A;  4JRP A;  5HKC A;  5GAM e;  4P73 C;  1K8A C;  4CH4 A;  2DXU A;  3QO5 A;  5I2M A;  1VQM A;  4F7U G;  1HC7 A;  4PG3 A;  1E1T A;  2K3X A;  4A4H A;  2LT4 A;  1Q81 C;  4K87 A;  3CC2 A;  1H4Q A;  2AKW B;  5IAY A;  5GAN f;  3MEW A;  1UGR B;  3RKW A;  3ICA A;  2Q7G A;  2JVV A;  4YRS A;  5CQX A;  1YHQ T;  3FIF A;  1NJI C;  1OZ3 A;  5A0L A;  2LC4 A;  1NJ5 A;  2CGH A;  1VQ4 A;  5CKE A;  5HGQ A;  4RDX A;  3OS1 A;  2CJA A;  3A74 A;  1VQ8 A;  1JJC A;  4O6J A;  3KXT A;  2XTI A;  1WNL A;  2GCX A;  3I56 A;  1W2B S;  2HBP A;  4M77 F;  5LJ3 g;  2D9T A;  3JB9 H;  3CCM T;  5GMK h;  1Q86 C;  4EMK C;  2YLC A;  4XEO A;  4YRK A;  4BI4 A;  5M9O A;  4YRG A;  4M7A D;  5C6S A;  5GAM f;  2E65 A;  4OMF B;  3JCM X;  1YIT A;  5DM7 R;  3GLX A;  1SET A;  2V8K A;  3JAM E;  2K2V A;  3ASK A;  1NYR A;  1N8R C;  4DOW A;  2R5A A;  2PU9 B;  3N5B B;  2XDD A;  2DD5 A;  4CS3 A;  2RHQ B;  3FC3 A;  1SES A;  2QA4 A;  4E7J A;  3L2Z A;  4B9X A;  2XDP A;  2DKG A;  3HY1 A;  2ZIO A;  3OYJ A;  4MZT A;  3QZ9 B;  4FL6 A;  3CC4 T;  2K5F A;  4M78 D;  1EOV A;  4M7A F;  3HFZ A;  1E22 A;  1USY C;  1W66 A;  4M75 B;  3JCM P;  1B70 A;  3CD6 T;  1XNI A;  2KQW A;  3SDZ A;  5DY9 A;  4LD6 A;  1ZQ1 A;  3A7A A;  2EWN A;  2P4T A;  1NNH A;  2EL9 A;  3LX7 A;  1N27 A;  2RK1 A;  1N9S A;  3QHS A;  1EVL A;  2RHZ A;  5LJ5 j;  3LLR A;  3WXM B;  1NJ8 A;  4XTU A;  2K5I A;  3J80 E;  1QE0 A;  3GNF B;  2QQR A;  3M4G A;  2BIV A;  2E6N A;  4EX5 A;  3OQ5 A;  5GAO n;  2E1H A;  3VYG A;  4OP0 A;  3HFN A;  4M78 F;  3OA6 A;  5GAO q;  1G3S A;  3JCM c;  4HT8 A;  1FYF A;  1OI1 A;  3S3O A;  5C52 B;  1N8R U;  4E7H A;  3L42 A;  2LT1 A;  1LYL A;  3QUI A;  4DPG A;  2ODR C;  4G85 A;  1YIJ T;  2RHX A;  4OB1 B;  3TEH B;  3I7F A;  3HP9 A;  4KQE A;  4ZTF A;  3REX A;  4QVD A;  2ZT7 A;  2ZZD A;  2G3R A;  1VQ9 A;  3L2Q A;  3LWI A;  5J26 A;  4M77 C;  4XTY A;  4R55 A;  4C92 D;  1Q82 U;  3JCM Q;  2ZGW A;  1VQN A;  3CXC S;  2RJC A;  3VUB A;  3MET A;  4H2Y A;  1S72 A;  3DB4 A;  3G1Z A;  1L0W A;  3CBM A;  4N4I A;  4BWA A;  2QXF A;  2P0Q A;  3JB9 F;  4XU1 A;  1VQ7 T;  4Y91 A;  1YJW T;  3JCM J;  2LCC A;  2RHI A;  2Y90 A;  2D0Q B;  5K1X A;  3QYH B;  4HCB A;  3PCO A;  5FRO A;  1M1F A;  3CCS A;  4H2W A;  3MP8 A;  2KDS A;  4KR2 A;  1EFW A;  3HRS A;  1YJN A;  3G71 A;  4TWA A;  4C92 F;  2FHD A;  4HA8 A;  1M1K C;  3ZBD A;  4P3N A;  2XG8 D;  2K57 A;  3CC2 T;  3RMS A;  4NL2 A;  4UP9 A;  4MZM A;  4M7A C;  5HK0 A;  3PIP A;  4FT4 A;  3HXZ A;  2EJG A;  3MP6 A;  4J8O A;  3QKJ A;  1X56 A;  5LJ5 g;  3P8H A;  2JUF A;  2RHS B;  4HWR A;  1Z7N A;  1D3B B;  1VQ4 T;  4Z02 A;  5LJ3 h;  1NJ6 A;  2X4X A;  3A5Z A;  5CAI A;  5IT9 E;  2K3Y A;  1K9M C;  2F5K A;  2MAM A;  5GAN 7;  3I56 T;  3JCM e;  4DOV A;  1QP2 A;  2ART A;  1FWZ A;  2DXC A;  4M7D A;  3A32 A;  1OYX A;  4M7D E;  4P74 A;  2LTO A;  1NJ1 A;  2YHT A;  2IY5 A;  2EIF A;  2JN0 A;  3CCM A;  2V8I A;  4M78 C;  2DTH A;  3L4G B;  3RES A;  2MWO A;  1WQ7 A;  2KVQ G;  4NOY A;  3OYK A;  3QO3 A;  4YRR A;  3P8D A;  3HRU A;  3E9G A;  2DEQ A;  5GAO m;  3UWN A;  3OYD A;  4MML A;  2RA2 A;  1QVG A;  2P0L A;  3CCU T;  4MMK A;  2QA4 T;  2DZ9 A;  2C8M A;  4C5I A;  1KMM A;  3HSB A;  2O4X A;  2IG0 A;  1EQR A;  5CK9 A;  4IUV A;  1VQ6 A;  3HXY A;  3RKX A;  4PJO A;  4H02 A;  2DQ3 A;  2ZNI A;  4XTV A;  3JCM W;  4PJO E;  4X9D A;  5KCO A;  2LNV A;  3JCM f;  2RH2 A;  4C5H A;  2E5Q A;  4IUR A;  5CQY A;  4M7D G;  3QTC A;  4BDY A;  1WYD A;  4L6V 5;  1BIA A;  4ZN1 A;  3CC4 A;  3S3M A;  3G6E T;  4EMK B;  1H4S A;  4IKF A;  1C0A A;  3VQX A;  4XAX B;  3SB2 A;  1U1S A;  1QW1 A;  4BAC A;  3NEL A;  4KUI A;  3QJ6 A;  4XTX A;  4XTW A;  1GGM A;  3QZ5 B;  4GY5 A;  4NCX A;  2ZZG A;  2ZTG A;  4DA4 A;  2EYQ A;  1M90 U;  3OMG A;  4C92 C;  1X75 C;  2JTF A;  5GMK e;  3W3S A;  2I4M A;  4CS2 A;  5I21 A;  4C8Q A;  1ZBX A;  4IUP A;  1M1G A;  1I81 A;  3A8M B;  3RAC A;  5FU7 C;  3SWN C;  3NEN A;  3HRK A;  1KMN A;  2I4N A;  4PJO G;  4LVM A;  2VV5 A;  4II1 A;  3GNG A;  4EPC A;  2C7I A;  3RIR A;  5C51 B;  4HCC A;  2ZR3 A;  1XOV A;  3HFO A;  4YRN A;  3CEY A;  3CMQ A;  4WI1 A;  2DIG A;  3T9N A;  2QQB A;  5KE3 A;  3M4Q A;  4B9W A;  1Y96 A;  1ZHI A;  5IN1 A;  3IKL A;  3OYC A;  3HHT B;  1VQ9 T;  1N9W A;  4L87 A;  1YIJ A;  3HXV A;  3QPH A;  1MGQ A;  1AHJ B;  3X26 B;  4RCC A;  3EFR A;  2HNI A;  1ASY A;  4CH3 A;  3UDC A;  1BI3 A;  1Y71 A;  3OYA A;  2AKW A;  2YRV A;  3ZEH A;  3M5A A;  1DJ7 B;  4QQD A;  4ELZ C;  1S72 T;  4LVK A;  3V8J A;  2E70 A;  4JJN K;  1G3T A;  5GAN 3;  4H2U A;  4YRF A;  2ZPB B;  12AS A;  2VXF A;  3JSC A;  4C8Q G;  3O8V A;  3KUF A;  4XK8 E;  4C8Q D;  1VQ5 A;  4XQ3 A;  4JUV A;  3CCS T;  4JS4 A;  3G4S A;  3MEU A;  4AH6 A;  2XHC A;  1SSF A;  2DTO A;  2DQ0 A;  4XU2 A;  3MCA B;  1H3Z A;  1VQO T;  3PZC A;  1YFS A;  3H6Z A;  1KQ2 A;  5LJ5 h;  3C4S A;  3MO8 A;  1KQS S;  4JLG A;  3OYE A;  3GF5 A;  4C0D C;  2LCL A;  3VYH B;  3E9I A;  2WSE E;  4M77 B;  4YP0 A;  1KOG A;  5CKF A;  4OF1 A;  1WPY A;  2P5I A;  2RHQ A;  1FX7 A;  4YCU A;  3X20 B;  2R57 A;  5C53 B;  3QG1 A;  2RM4 A;  3H8Z A;  4HT9 A;  5EG2 A;  2LQK A;  1E1O A;  4L59 A;  5GAN d;  2R5M A;  3C95 A;  1H4T A;  3OW2 A;  3Q1J A;  5LL6 S;  3HRI A;  2VUB A;  4BI3 A;  4JLI A;  4M75 E;  1VUB A;  3OS0 A;  5CVI A;  4YYE A;  4A54 A;  1I5L A;  1QF6 A;  2DD4 A;  2GF7 A;  3GPL A;  2X4Y A;  4F7U F;  1BBU A;  3TEE A;  1X54 A;  4ZTZ B;  1KG1 A;  2E10 A;  2QEX T;  4TVW A;  4P74 C;  1BKB A;  1H4V B;  3TEG A;  2CS7 A;  2KAF A;  1B7Y A;  4M7A B;  4PLL A;  3OSV A;  3PIO A;  3A8G B;  2AMC B;  3QBY A;  4YRC A;  2XIC A;  5GAM d;  1VQ6 T;  3A7U A;  4ZGJ B;  3CCU A;  4P72 A;  2ZZF A;  4LD9 K;  5A0D A;  3F70 A;  4P5N A;  4BD3 A;  1Q82 C;  3FRN A;  2GQV A;  3TEH A;  5D6X A;  2NLU A;  3OY9 A;  4M75 G;  4BW9 A;  2I2L A;  4TVA B;  4FM4 B;  2X4W A;  3G6E A;  4C0G A;  5LJ3 e;  4J15 A;  1JJC B;  2X4J A;  4M78 B;  2PVO B;  4N0A A;  3CC7 A;  2DO3 A;  3CPF A;  3HTZ A;  1IRE B;  2J3L A;  1NE8 A;  1G3Y A;  3ZFJ A;  4A4K A;  3TRE A;  3PMT A;  3JB9 I;  1UEB A;  2E6Z A;  4J7F A;  3P8V A;  3OYY A;  2RJF A;  2JOY A;  1IL2 A;  2P0P A;  1ASZ A;  2GFA A;  2MF2 A;  2ZIM A;  4H2X B;  4C8Q C;  2L3R A;  4CH5 A;  3LYI A;  4P71 A;  2DTI A;  3MQZ A;  2I4O A;  2BKD N;  3PTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...