3L1AA

Structural ordering of disordered ligand binding loops of biotin protein ligase into active conformations as a consequence of dehydration
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
264
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 83
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l1aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l1aA01
3L1AA 4YCVA 4M77E 3JCMP 3PCOA 3RGLA 2XTIA 4X5OA 2Q5IA 4RQFA 1X01A 3BY7A 2I4MA 3TEHA 4C92B 1NNHA 4C8QG 2ZT8A 4M75E 1N9RA 5GMKj 1NJ1A 3UGQA 1SESA 4KQEA 3V8LA 1Z7NA 2YLBA 3HXXA 1YFTA 4CS3A 4M77F 2FYKA 3P8VA 3VQYA 1NYQA 5GANd 5LJ3h 3RKYA 3SWNC 4H2WA 3RL6A 2QHVA 4EX5A 4OP0A 5F5WA 3VU3C 5GAMf 2Q5HA 1IL2A 5LJ3e 4TVAA 1X2HA 3W3SA 4PJOC 1JBMA 4M75F 4P73A 2ODRD 3LC0A 2EWNA 3BW1A 4M7AE 4WJ3M 4TQDA 4YRPA 1E24A 1USYC 1WU7A 4YDQA 2CJ9A 3M4GA 3JB9D 2DZCA 4NOYA 1H4TA 2HNIA 4YCUA 4J6WA 4H2XB 1HTTA 3EFRA 3QHSA 4F7UA 3RKWA 4C92C 2DKGA 2DZ9A 4M7AF 1WQWA 4RDXA 5C52B 1BBWA 1HK9A 1X55A 4C8QE 3QO5A 4BW9A 4H02A 2I4LA 4YRLA 1Y96B 2ARTA 2ZIMA 5GAN4 5GAN8 2I4NA 1ASYA 3JCMd 4M77D 4XU3A 3JCMX 2YHTA 5GAMh 4RQEA 1M5Q1 4YCWA 1B70A 2ZT6A 4M78D 3MF2A 4XQ3A 4CH4A 3VBBA 3A7AA 5GAMe 2EJGA 4C8QF 4M77B 3HFOA 4M75D 4XTUA 4XU1A 2RHSB 3R07A 3INZA 3SWNA 1NYRA 1D3BB 3M4QA 2AMCA 3HXUA 2ZR2A 3V7CA 3G1ZA 3VQVA 4PJOA 1X54A 4Q15A 1N9WA 4KR2A 3HFNA 3TUPA 4AH6A 4M75B 5LJ3g 3LSSA 4NL2A 4N0AC 2AKWB 3FJPA 4WF2A 4A54A 4YRGA 5LJ5f 4L87A 1USYA 3HRKA 2DQ0A 5ELNA 2ZTGA 1B7YB 3P8TA 3BJUA 4JRKA 4HT9A 1JJCA 5GAOq 3TEGA 5HGQA 4C92A 5GANf 4XTYA 3JCMc 1EVKA 4UP7A 4M7AB 3BFMA 2RB6A 3L2ZA 4WJ4A 1HC7A 3RERA 4J6XA 3UGTA 4CH3A 2E3CA 1YFSA 3VQWA 2J3MA 4G84A 2E5AA 2P0LA 4UPAA 4M77C 1JRIA 4EMHA 4M7DG 4C8QD 2ZZGA 3A32A 2RD1A 4YRCA 1NJ8A 4JLIA 4M78C 2RHQB 3UH0A 4P3NA 4MMLA 1YB3A 4EMKC 2C8MA 4H2TA 4M75C 4C8QB 1E1OA 1KMMA 2DQ3A 3HFVA 1KOGA 3MF1A 4CS2A 4HWRA 5GAMg 1SERA 5LJ5h 4JUVA 5GAOm 3RKXA 2DVEA 2CJBA 1WQ7A 3GIBA 4F7UE 2YLCA 5LJ5e 2ARUA 4YRIA 1WPYA 1I4K1 4K86A 4XU2A 4N0AA 3RACA 1LNXA 2ZXFA 5GANh 2ZINA 2DJZA 3JCMf 2I4OA 4TVYA 12ASA 4M7AC 4EO4A 5CAIA 5GANe 3NELA 1EIYB 4F7UF 1Y96A 3HSBA 1LYLA 1FYFA 4X9DA 1LOJA 1H4SA 1X56A 3FB9A 4P74C 3HY1A 3NENA 3QTCA 2E65A 1H4QA 2QHSA 5DY9A 1LJOA 2CGHA 2PMEA 4M7DE 2Q7GA 4XEMA 5GAOp 3HXWA 1PYSB 3TEHB 3RIRA 5K1XA 4J15A 4V2SA 3OD1A 3NETA 4C8QC 1QE0A 4M77A 3HXYA 1YGBA 2G4CA 4P72A 3CMQA 4LNSA 3REXA 1ATIA 4M78A 4YRJA 4BWAA 4HWOA 5K1PA 2FB7A 4M7DF 4KR3A 4EMKA 4M75A 3QO3A 2AKWA 3V8JA 5LJ3j 4HA8A 3JB9H 3JB9G 3IG2A 4H2SA 1B7YA 3JCMe 2E41A 3BDUA 4XTWA 4Y91A 5LJ5g 3HXVA 3QNEA 4PG3A 4J5YA 4WI1A 2EJFA 1TH7A 1ADJA 3SB2A 4HT8A 5KNNA 5GAN6 4K87A 2DTOA 2ALYB 4M7AA 1KQ1A 1WLEA 3HFZB 3V7SA 5GAN5 4RCCA 4F7UG 4F7UB 1I81A 5GANg 4XTXA 2Y90A 5GMKl 4YRRA 2QTXA 1WNLA 3A74A 2QHUA 1YCYA 3EFSA 4M7AD 1VQZA 3HRIA 1B34B 4XEOA 2Q7EA 1H641 2I2LA 2Q7HA 3JB9J 4HWPA 4YROA 4C8QA 2DXUA 3QUIA 4NL3A 3A7RA 5GMKh 4TQFA 4M7DD 4QVDA 3P8YA 2ZCEA 5GAOr 2DU7A 5GAMj 4K88A 3RF1A 5GMKe 4YRTA 1U1SA 3FIFA 3RUXA 4HWSA 4EMGA 2RM4A 1ADYA 3LSQA 4RMFA 3V8KA 1EOVA 3PGGA 4YRQA 4M7DB 4YPFA 1B76A 3RESA 5GAN7 2AMCB 1G5IA 4UP8A 1J5WA 2EJ9A 4E51A 4P3PA 4PJOG 4H2VA 4PNOA 3JCMQ 4RCBA 5GAN2 4H2YA 3JCMV 3L4GB 1H4VB 2EAYA 1EIYA 3JB9F 3HXZA 1KMNA 3WQZA 4DQ2A 4DPGA 1JJCB 1X2GA 2VC8A 4OLFA 4YREA 1EFWA 4H2UA 4H2XA 3QO8A 1PYSA 4M78E 5LJ5d 4C92G 2IY5B 3HY0A 4NCXA 5E3IA 4A53A 4Q6GA 1KQ2A 4XU0A 1W66A 5LJ3d 2DEQA 1SETA 4CH5A 1NJ5A 4X9CA 4M7DC 4TWAA 3AHUA 3PCOB 3ICAA 4M78F 2C7IA 4TVWA 1YFRA 1C0AA 3IKLA 1HXDA 4YYEA 2DTHA 2ZT5A 2ZGWA 1GGMA 2P5IA 2ZZEA 3IALA 4PJOE 3E9IA 3NEMA 2RHSA 5GAOl 2J3LA 4P71C 2VXFA 5LJ5j 1D3BA 3ERRA 4ZIBA 4HVCA 4UP9A 1EVLA 1B8AA 2ALYA 4ZTZB 4ZTUB 5C51B 5GAOn 4J6YA 1QF6A 1MGQA 3HFZA 4QVCA 3JCMh 4G85A 1G5HA 4PJOF 4P75C 4TVAB 11ASA 4JRIA 2DXTA 4YP0A 5GMKm 5GANj 1G51A 4C92E 3KFUA 1SRYA 2ARSA 1ASZA 4XTZA 4MMKA 1L0WA 2E10A 2VXEA 1B34A 5GAMd 3DSQA 3UFGA 3JB9I 2E1HA 3MEYA 1WYDA 4YRKA 1BBUA 2DU5A 2ZT7A 5GMKi 4PHCA 3I7FA 4CH6A 2ZR3A 4C92F 4CS4A 1BIAA 2DTIA 4M77G 4P74A 1I8FA 3QO7A 4YRSA 4M7DA 4O2DA 2ZIOA 2K57A 5I21A 4M78G 4M78B 2ZNIA 2RHQA 3VQXA 2ODRC 4P3OA 4YRMA 2XGTA 4EMKB 4M75G 2PMFA 3V7RA 2JN0A 2EL9A 2DDZA 3L4GA 4YRNA 1N9SA 1B70B 4P71A 1NJ6A 1M8VA 4XTVA 3REUA 1BIBA 1EQRA 4P73C 4PJOD 1E1TA 2RA2A 1Z7MA 2CJAA 3A31A 3PZCA 3IKMB 4TTVA 2ZZFA 3SWNB 5C53B 5LJ3f 2ZNJA 3JCMb 5GAN3 3HTZA 1NJ2A 2QHTA 4P75A 2E64A 3A5ZA 2IY5A 4PJOB 3QSUA 3JCMW 4YRFA 4M7AG 1U1TA 2CIMA 5ELOA 1I5LA 3JCMJ 1RIQA 3JCMg 3E9HA 3A7UA 4HWTA 4P72C 3M4PA 4C92D 1E22A 3A5YA
chains in the Genus database with same CATH superfamily
2RPNA 3EG9B 3JCMP 1YI2A 2L8DA 2JXBA 2CYZB 2JM9A 4RQFA 3EGDB 1MV3A 1AZEA 3VS3A 1VQKT 2ZT8A 4E47A 2KT1A 3M0SA 5GMKj 4ATOA 4R56A 1V76A 4KQEA 3V8LA 5DLOA 2L3RA 3P8VA 1NYQA 1TSFA 5LJ3h 2GFUA 3RL6A 1NJIC 1VQLQ 1OZ2A 2DEUA 4EX5A 3MPUB 2RI2A 4TVAA 3EFOB 4KH0B 1X2HA 3W3SA 2C0TA 2ZPFB 3UA7A 2AZSA 2EWNA 4WJ3M 4TQDA 4OMNA 4YRPA 2M02A 1BU1A 2LDMA 3FLGA 2LQNA 1WU7A 2QXFA 2CJ9A 1ZSZC 3OSSC 3NFCA 3M4GA 3G71Q 3OSVA 1GFDA 1H4TA 2HBWA 2HNIA 3U23A 3CD6A 4YCUA 4F16A 5IXBA 4H2XB 4BI3A 2YUPA 3EFRA 3QHSA 3M0QA 1VQ7Q 4C92C 1QCOA 2HQEA 3OS5A 2KEAA 2FRYA 3TREA 3L42A 1F1BB 4FSSA 1K9AA 1QVFS 2QA4A 2JVVA 3CMEA 2XG8D 1YN8A 1XQHA 1ASYA 4PFOA 5IHIA 3QYHB 2QGFB 5GAMh 2L3PA 3M58A 1O75A 4CRIA 2DD5A 4OGCA 3SHWA 3VBBA 3HRUA 1ZUYA 2EJGA 5FU6B 4HVWA 3HRSA 2EKHA 4BB7A 3M4QA 2ZR2A 3ZEHA 2A28A 2KNBB 1X54A 1N9WA 3TUPA 3HFNA 2DM1A 1PNJA 4N0AC 1G83A 5LJ5f 3M0PA 1N27A 2ENMA 3HRKA 2DQ0A 2GF7A 1ZSZA 2FZKB 2ZTGA 1OU8A 5CKFA 3PMIA 3FDRA 4AFZC 3BJUA 4JRKA 1JJCA 2EFIA 4OB3B 3CC4A 3OW2A 2FEIA 4C92A 1VQPA 5GANf 6AT1B 3CC2T 3BFMA 4Z02A 4ORZA 1WFWA 5DLQE 2E3CA 1PCXA 2LJ0A 3X24B 2CKKA 2OI3A 2P0LA 4UPAA 4C8QD 1Q82C 2RHIA 4M78C 1KJWA 1VQ5T 2QI2A 4IUUA 3CCLA 1RI0A 1IO6A 2C8MA 4RTTA 2F69A 2OTJQ 2DQ3A 4HWRA 4L59A 1EFNA 1PKTA 1UTIA 2AZVA 2DVEA 2RHYA 2EQJA 2WSCE 1WQ7A 4E7LA 2B86A 3QPHA 2YLCA 1N8RC 2ARUA 4BI4A 3M0RA 4A4EA 1R77A 4E7HA 4OB1B 1E7OA 1XNIA 4ESRA 2ED1A 4N0AA 1ZLMA 1W4SA 1SG5A 1ACMB 2K79A 3UT1A 1YFNA 12ASA 5CAIA 3MEUA 1EIYB 4DBRA 1Y96A 3HSBA 1X27A 2E5KA 1H4SA 1VUBA 1YI2T 3FB9A 1QP2A 4P74C 3HY1A 1G3WA 1KD1C 5FWCA 3CCSA 1PHTA 4DBFA 2DETA 2CGHA 4HCCA 2VGMA 4XAXB 5I11A 1UJ0A 2Q7GA 4XEMA 3P8HA 3HXWA 3E2UA 3TEHB 2BE9B 2EYXA 3M54A 2C06A 3OD1A 2RMOA 4PJNA 1PD0A 1RUWA 2ZPBB 1TOVA 4OMFB 1UHFA 3MHXA 4M78A 3DB4A 2YRCA 3ASKA 1RAIB 5K1PA 4EIKA 3J81E 4M7DF 2EGAA 2WSEE 3H0IA 2DPPB 1M90C 2DL7A 3FEOA 3V8JA 4Y92A 5J3BA 2F1LA 4LD6A 2M1HA 1BB9A 1X6BA 2LZ6B 1FMWA 3C95A 3I56Q 2KSSA 2NUPB 1B7YA 3JCMe 2E41A 1SF9A 1IHWA 1UB4A 1IB8A 2FVUA 3CD6T 1RL2A 2K3YA 2ROTA 4FT4A 3CMAA 1W2BP 1M2OA 3LGLA 3V7SA 3KXTA 5EC7A 4FCYA 1HYOA 3PE0A 1VQLA 2Y90A 1YIJT 4YRRA 3QBYA 2QA4T 4Q5WA 3CMET 4J83A 2QHUA 1U3OA 1YBYA 2CS7A 3OYFA 4M7AD 5KH6A 3DB3A 4OMPA 1B34B 1D1CA 2YUNA 1QVFA 4XEOA 3S3NA 2EVRA 2RQVA 2DO3A 5DM7R 3LW5E 5EG2A 4NL3A 2CH4A 5GMKh 4QVDA 3G4SQ 2BIVA 5D7UA 2E3HA 2O88A 1BCOA 3RF1A 3OB9A 4DOVA 4UC4A 1T0JA 2K5IA 2P84A 1VQ7A 2J6OA 3PGGA 1H3ZA 4YRQA 4YPFA 1B76A 3RESA 3CCJT 2AMCB 4UP8A 1J5WA 4PNOA 5GAN2 3JCMV 3L4GB 1SPKA 4RTYA 3JB9F 4LVIA 3M0UA 3LGFA 3NTKA 4DQ2A 3H41A 1OULA 3CC4T 4DPGA 3E9FA 1PM3A 2MCNA 3JRZA 1VQPT 4YREA 4OLFA 3EG1A 1EFWA 3OYLA 2OTLA 1QWFA 5D6YA 4LVKA 3HY0A 1SRLA 4NCXA 1YJNT 3HTRA 4LVMA 2QQ9A 3TCJA 2DEQA 1WGSA 3A8LB 1SETA 4CH5A 4M7DC 3VS5A 2Z0WA 2MF2A 2DFUA 1YFRA 1ZQ1A 2JW4A 1B7TA 1M3BA 3G6EQ 1TUDA 4B9WA 2P5IA 2LX9A 2X4WA 4PJOE 1IRXA 1D3BA 1KFZA 1WXUA 1ABOA 3P8BB 4BE0A 1KHIA 1VYTA 4X1VA 1JJ2S 2CP0A 4HVCA 1JU5C 1O9SA 5HK0A 3META 1Y07A 4ZTZB 3CPWP 3M59A 1QF6A 2X35A 1HJDA 4QQDA 3JCMh 4P75C 1ZX6A 11ASA 2J6KA 2D6FA 4YP0A 4FYWB 1ZHIA 5CVIA 2DAQA 1TS9A 1RI9A 2PVGB 3LLRA 4PKCC 2OTJA 2E10A 3CCST 3UFGA 2E1HA 3MEYA 1WYDA 1P92A 2DU5A 1M27C 2JM8A 4CH6A 1EX4A 2M9UA 2JT4A 2E5QA 2K5LA 1K76A 1I8FA 3QO7A 4M7DA 2ZIOA 4AFQC 3SDZA 1NYGA 1QCNA 2RHQA 2LMJA 3EAEA 1I07A 3S6WA 2ODRC 1AWOA 2XDPA 2LNVA 1EIFA 2JN0A 4C0DB 4MDXA 3NPFA 3OYJA 1UGQB 1B70B 3TEEA 2NUZA 1JXOA 3OYDA 2JS2A 1RAAB 2X3XD 1V1CA 1A0NB 1Z7MA 2F5KA 2EQKA 4AFSC 3IKMB 5C53B 5GAN3 1JB0E 4P75A 2ZPEB 4PJOB 2EQIA 2IY5A 1VQLT 1U1TA 2JOYA 2CIMA 1UHCA 3FJ5A 5ELOA 4WTOB 1I5LA 1PKSA 4GLMA 1YJWT 2PVDB 2EYWA 1YP5A 2M0OA 4C92D 4GLKA 4M77E 3PCOA 2RK2A 3RGLA 2O4XA 1C6VX 2Q5IA 3G71T 3BY7A 2DE0X 1GRIA 4B6MA 4C8QG 1AEYA 2KXCA 3CCMQ 4M75E 2WSFE 3N5BB 5KYWB 1VQ7T 1SESA 2NYSA 1QCFA 2QDYB 2YLBA 4CS3A 2PUKB 3OBYA 5FRNA 1M1KR 4ZNXA 2FYKA 5CK9A 3VQYA 2JTFA 5GANd 4A4KA 3RNJA 3SWNC 3OYEA 4H2WA 3SFMA 5LJ3e 2ZPIB 1R8OB 9ATCB 2E6NA 5FLXE 3LC0A 3URGA 4MZPA 3BW1A 3JV3A 1M1KU 4M7AE 3X28B 1QVGP 1USYC 2MWOA 4NOYA 3H0FA 1RADB 2BZ8A 1NE8A 4QQGA 4HCZA 1SSHA 1HTTA 1XTDA 1QVFP 2DILA 2D0NA 4F7UA 3MQZA 1MMGA 2CP5A 1AT1B 1D1AA 4ZTFA 5AT1B 2V8IA 2DYIA 5FW9A 1BBWA 1HK9A 4GBQA 1X55A 3D7SB 3QO5A 2FO0A 4AT1B 2DL4A 3M9QA 2ARTA 1FX7A 2I4NA 3OS2A 3JCMX 4II1A 1BI0A 2L0AA 1M5Q1 4JZ4A 2ZT6A 3CC7Q 4RTWA 1R0CB 4M78D 3A7AA 2VGNA 5GAMe 2ED0A 1LVKA 1ZSGA 1D0XA 5IN1A 4M77B 5FRMA 1N6AA 4XTUA 2RHSB 3SWNA 3NMZC 2EKOA 3HXUA 2A36A 4KRTA 2BE7D 3G1ZA 2DD4A 1JJ2A 4KR2A 4AH6A 4M75B 5KYXA 1YJ9Q 4NL2A 2AKWB 2CZ7B 4WF2A 5KYUA 2DIGA 4YRGA 1ABQA 1USYA 2OTJT 2PNIA 2LRQA 2G3RA 2KMTA 1SKUB 3G6EA 1K1ZA 1UFFA 3P8TA 3EG9A 1VQMQ 2K2VA 4HT9A 5GAOq 3M55A 2WACA 3EGDA 5I2SA 3TEGA 4E7SA 5GJVB 1EVKA 5A0LA 4M7AB 3L2ZA 4R0KA 2FRWA 1YFSA 4LDYA 4G84A 1RLPC 2HEQA 1SEMA 5FU6C 1X6GA 4BE1A 3CQTA 4EMHA 1B07A 2CT4A 3A32A 1QMCA 3QG1A 4YRCA 1KQSA 3UH0A 1Y57A 2P0PA 2QTVA 2FL7A 3EHQA 3X25B 1YB3A 4JDSA 2OAUA 2L5QA 4DBQA 5IHKA 1D0ZA 2DJQA 1KHCA 1I1JA 2CJBA 2O9VA 3MCAB 4JPBW 3OYHA 1GBRA 2W10A 2CSQA 4C0GA 2X3WD 3UA6A 4QVZA 1AWWA 3RACA 1EZZB 3MEVA 2ZXFA 1FXXA 1VQ8Q 2K2MA 4A4FA 3TU4K 2ZINA 2DJZA 1K73R 3JCMf 2GFAA 4LUEA 1YJWQ 3EH2A 4EO4A 4ANJA 3NHNA 3I56T 5IH2A 3NENA 4GY5A 2CH4W 3GNGA 5DY9A 1VQNQ 1K73U 3UATA 2PMEA 4LXCA 2IVWA 2C0OA 2RQRA 3OYBA 4V2SA 1QE0A 1K9MR 2G4CA 4JJBA 4LNSA 3L2UA 2KYMA 3CXCS 5CKEA 2MYSA 1YIJA 2PU9B 1VQ6Q 4BWAA 4HWOA 4BUGA 5FWBA 2E12A 2KY9A 5D6WA 1NEBA 4FYVB 1TXQA 1K9MU 1PG5B 3JB9H 1AZGB 2CUBA 2K3BA 3P8DA 3RR6A 3G4ST 4E7ZA 1K8AR 4IIOA 5LJ5g 3HXVA 2KBTA 3CCMA 3UF4A 5HCKA 2E4HA 1Q86U 5KNNA 4HT8A 3CCJA 1M1GA 2DK3A 1K8AU 3HP9A 4FYXB 4RCCA 5GANg 2DNUA 3CCUQ 2CT3A 1KK7A 4D8DA 2D0QB 3ME9A 4JS4A 1YCYA 2JMCA 3EFSA 2COYA 3UDCA 3MEAA 1WA7A 2I2LA 3VS2A 2Q7HA 2DL3A 1X6OA 2A0FB 3AT1B 1WLPB 3QUIA 4TQFA 2HQXA 3MO8A 4M7DD 1WI7A 3PMTA 4K88A 1WHLA 5GMKe 3RUXA 1YJNA 4EMGA 4PJJA 4RUGA 3LSQA 3V8KA 1EOVA 1VQ4Q 3VS4A 2EYQA 2HCKA 1DJ7B 3PNWC 2XDBA 1G5IA 1UGVA 4LDXA 2EJ9A 2W0ZA 2XICA 2NS6A 5A0DA 3JCMQ 2V1QA 2LTOA 4E7JA 2DLPA 2ABLA 1MHNA 2LCSA 2DIQA 3G6ET 1WXBA 2JMAA 3OYNA 3VYGA 1EIYA 3QKJA 3MP8A 2VUBA 2RK1A 1AWXA 4JZ3A 1JJCB 5HKCA 3I5SA 1UG1A 2DRMA 3QO8A 2D9TA 4M78E 4C92G 1X2QA 3LWHA 5J39A 2BUDA 5E3IA 2J05A 2L3SA 1KQ2A 1YJ9A 2CP3A 1W66A 3GLXA 1M2VA 1Y71A 2VWFA 3THKA 4N4GA 2X4YA 4IIMA 5KYYB 3AHUA 3ICAA 1BI3A 1Z9QA 1VQMA 4LNPA 1OPLA 2RNAA 4KGVB 2ZGWA 1NYFA 3IALA 2NUPA 4E2FB 3QDRB 4LE9A 3NEMA 2R57A 4BDYA 2J3LA 5LJ5j 3ERRA 4L6V5 3UWNA 3PIOA 1G3SA 3H0HA 3OMCA 4J6YA 1MGQA 4J9IA 4QVCA 4PJOF 2DXTA 5GANj 1G51A 3FC3A 3H9NA 2QEXQ 2LCCA 2RHUA 2ARSA 1QW1A 5CO7A 2DYBA 1PSEA 1B34A 1M3CA 2HSPA 1NJIR 3HKSA 1FYNA 2P0KA 4YTLA 4XK8E 3DSQA 3JB9I 4RTUA 4YRKA 1PWTA 3A8MB 4OMOA 5GMKi 4N4IA 1KQSP 3I7FA 2AHJB 3NTHA 2ZR3A 2RI3A 4CS4A 1IGUA 3EH1A 1VQ8A 4PL6A 1C1AA 3A1PA 4P74A 1UGSB 4DOWA 1NJIU 1YJWA 3E1SA 1QWEA 2F5TX 1MMDA 2KRSA 2RH2A 4F17A 3CXCA 2YWWA 4M78G 4M78B 2O2OA 4Z8AA 1Q95G 1WHMA 1QQJA 2VYTA 2XGTA 4J9EA 2PMFA 2EL9A 2SEMA 3G71A 4C5GA 4C0FA 1GL5A 3L4GA 4LDVA 1ARKA 1VQNA 2QGGA 1M8VA 3CCMT 1G3TA 3H8ZA 3LH0A 5KYNA 4P73C 1E1TA 3M57A 2RA2A 2F2VA 1SSFA 3A31A 3PZCA 3QYGB 4CC4B 1UECA 5LJ3f 1TTHB 1M1KC 1UJYA 2GQIA 2XU8A 1VQ6A 2ZPGB 4D8KA 4IURA 3OYAA 4YRFA 3M53A 1WHHA 2NLUA 3JCMJ 1VQ9Q 1RIQA 1NM7A 3E9HA 2D8HA 4P72C 1OU9A 3L1AA 4PLLA 1W70A 4YCVA 3TSZA 3H6ZA 3VV0A 3CPFA 2RJCA 2I4MA 3VRYA 2J6FA 4O6JA 2KRNA 1VIEA 4C0DC 5CR2A 3PTAA 2RJDA 2RJEA 1UDLA 4KH1B 4ZN3A 1NJ1A 3UGQA 2GTOA 1GBQA 4M77F 2QYZA 1RAHB 2A8EA 3EGXB 1XJWB 4PFZA 3RKYA 2SRCA 2QHVA 1BKBA 4OP0A 5F5WA 3VU3C 2O31A 4C5HA 5GAMf 4R55A 4RMOA 3QDFA 2YRDA 4PJOC 1E6HA 1JBMA 4M75F 3VUBA 4P73A 3CC7T 2HDAA 2CSIA 1GXIE 1E24A 1D0YA 3VKIA 5GJWB 2DZCA 4OB2B 3DKMA 3QWXX 1K0SA 4J6WA 1VQ4A 3MEWA 2ESWA 1YCSB 3OW2P 1YJ9T 4PFPA 1D09B 1NZ9A 4PJMA 4M7AF 1WQWA 2PUOB 2EYYA 1TUGB 4RDXA 4C8QE 2E6ZA 4F14A 4YRLA 3EGUA 4CC3A 2DL5A 2GBQA 2ZIMA 5GAN4 2KR3A 5GAN8 1OOTA 1WJQA 2YDLA 3HL8A 3RMSA 3JCMd 4E7IA 1VQMT 4IKFA 5CKDA 4XU3A 2L89A 2YHTA 2VV5A 3HRTA 2KDSA 4YCWA 1B70A 1JXMA 1V29B 3MF2A 4XQ3A 4CH4A 1N5ZA 3LWIA 5CKBA 4LUDA 4F04B 1J3TA 4DEXA 2RQWA 2KI7A 3A98A 3MP6A 2RO0A 3HFOA 1M30A 3R07A 3INZA 1WDXA 2M0YA 2HKNA 1D3BB 3REAB 2XHCA 4HVUA 1NPPA 3PFSA 1OX9A 1BBZA 3EG2A 3V7CA 3VQVA 1S1NA 5CQXA 4PJOA 2H3JA 1CKBA 8ATCB 3LSSA 2GNCA 3FJPA 4KGXB 5I22A 4L87A 5ELNA 4LVLA 3VS7A 1KD1U 1WZOA 1W2BS 2CP2A 2V26A 4BI8B 2ROLA 1UE9A 3LH5A 1Z9ZA 4AG1C 5HGQA 4BD3A 4XTYA 1KC8R 2GTJA 2YUQA 3JCMc 2GQVA 2M51A 2QQAA 2V8KA 5J26A 2RB6A 1VQ8T 4L5GA 3RERA 3BE3A 4J6XA 5KYWA 1NLOC 1K73C 3BDLA 3PT9A 2K9GA 3A8GB 1OPKA 2J3MA 5CKHA 4M77C 1MMNA 4M7DG 2VKNA 4HXJA 3I56A 2ZZGA 2QEXA 3I55Q 1NJ8A 1KC8U 1WX6A 5A2QE 1FMVA 2RHQB 2KT8A 4P3NA 2HL3A 3HPWA 4AMCA 3J80E 1VQNT 4H2TA 4EMKC 4M75C 2V8JA 3T9NA 4C8QB 1E1OA 3HFVA 1BCMA 4CS2A 1SERA 5LJ5h 4HVVA 2NUTB 1K9MC 3JSCA 5FU7B 4F7UE 4BY6B 2H3EB 4YRIA 1HSQA 1RAFB 1WPYA 1VQ6T 5A0GA 1IREB 1WJRA 1VQOQ 4K86A 4XU2A 1E6GA 2EQMA 2PTKA 3OQ5A 2LQKA 3Q1JA 5GANh 3QZ9B 5C0MA 4QT7A 2I4OA 3OS1A 2JUFA 4M7AC 2J7IA 2DERA 1S72Q 4FM4B 1LYLA 1FYFA 4CC7A 3G4SA 1K8AC 4X9DA 1LOJA 4E6RA 2FPEA 2E65A 2QHSA 2LT1A 3L2WA 3VYHB 5GAOp 1PYSB 2DBKA 3MP1A 3RIRA 1OZ3A 3NETA 3QJYA 4M77A 1WJSA 3HXYA 4WCIA 4ME7A 3CCRQ 4FIBA 3MKDA 1ATIA 3CCUT 4RTZA 4KUDK 2MAMA 4OMMA 4EMKA 4M75A 4D6WA 2AKWA 2FZGB 4MDWA 4HA8A 3L2VA 3I9QA 3JB9G 3IG2A 1GCPA 1GCQC 1YITQ 3WVDB 2K7AA 4H2SA 2AKKA 1ZA1B 3CPWS 3BDUA 4XTWA 4KT0E 3CCQQ 2ZZDA 1U5SA 2DA9A 3CCLQ 4PG3A 2LCLA 4J5YA 2YRVA 5IT9E 2EJFA 4PLIA 3CCVQ 1VQ4T 4JJCA 4OF1A 1ADJA 3OYYA 5GAN6 3QXEB 2DTOA 2F2XA 2ALYB 4M7AA 2H8HA 4LDWA 1WLEA 3HFZB 2L3QA 5GAN5 3L2QA 4F7UG 4F7UB 1I81A 4XTXA 3ZBDA 3QIIA 3CCEQ 2RN8A 2OJ2A 3CBPA 4MZTA 2ZAEA 1NBEB 3HRIA 1X75C 1LPLA 4HWPA 1KIKA 2DXUA 3A7RA 1LCKA 3M4YA 4FW1A 3P8YA 4J9DA 4DEYA 2ZCEA 3FRNA 3ZL7C 3C12A 3E19A 3FIFA 4HWSA 2VVKA 1IXDA 2KRMA 5L8RE 4CI0C 2DBMA 1ZUUA 2XMFA 4IUQA 2YUOA 4CC2A 3JAME 1Q81R 2R5AA 4KGZB 3OYCA 3EFOA 1GCQA 2X4JA 4X34A 2FZCB 4RCBA 2IIMA 4QKUA 4JJDA 2QQBA 4H2YA 1H4VB 1ZA2B 1VOMA 2ZPHB 4VUBA 2CP6A 1KMNA 3WQZA 2PVOB 4JRQA 1KG1A 1Q81U 2G6FX 2QG9B 1W2BA 2IG0A 1X2GA 1WYXA 4LN2A 4OMQA 4H2XA 2EIFA 2XKOC 3A5ZB 2YT6A 1RAGB 2BKDN 1Q7YR 2O9SA 5LJ3d 1KSWA 1WXTA 3CMAQ 2QEXT 2EGEA 2MI6A 4Z89A 1NJ5A 2LC4A 4ZGJB 4TWAA 4IUVA 1UEBA 2XD0A 2HL5C 4M78F 4QW2A 2C7IA 1C0AA 3IKLA 1HXDA 2KE9A 2LVMA 3PVLA 2CP7A 1GGMA 1Q7YU 2ZZEA 1VA7A 3E9IA 5GAOl 2R58A 1RACB 1ZBXA 3KFVA 1OYXA 3G7ZA 1YHQQ 4UP9A 5CIUA 3OYKA 1EVLA 4OMLA 3X20B 4ZTUB 1QVGS 4BACA 1Q86R 2JTMA 3I55A 2PQWA 1G5HA 4TVAB 3LYIA 4JRIA 5GMKm 5KCHA 2EQUA 4C92E 1H3HA 1SRYA 4OGEA 4XTZA 1L0WA 4RG2A 2VXEA 1OV3A 5GAMd 4FU6A 1BBUA 2FG0A 5M9OA 1W1FA 1VQOA 4JJNK 1BIAA 2DXCA 2A37A 2DVJA 3CBOA 2EGCA 2MOXA 4YRSA 1VQ9T 4J9HA 4O2DA 3DLMA 2OTLQ 1G3YA 4J9BA 1WHGA 1S72A 1K4US 3V7RA 2DDZA 2M16A 4YRNA 3HHTB 1C0MA 4XTVA 5I2MA 1BIBA 1Y7XA 1EQRA 3WXMB 4PJOD 3CPWA 2KQWA 4TTVA 2ZZFA 2QDLA 3JCMb 4RG8A 3CCRA 3HTZA 4DBHA 1WHKA 2HZYA 1NJ2A 3EHRA 2QHTA 2E64A 1QLYA 2HAXA 1AHJB 2QAZA 1PSFA 3JCMW 1OX8A 2ATCB 5IHNA 1K0XA 3LX7A 3QWYA 2CDTA 4Z88A 3CC7A 1ZSZB 3M4PA 4RTXA 4LDUA 1E22A 2MIOA 3O8VA 1YITA 5C6SA 3A5YA 2AK5A 1XOVA 5KYYA 2D1XA 2XTIA 3R6OA 3REBB 2KAFA 3CCQA 4X5OA 3GF5A 1X01A 4O5VA 3TEHA 4C92B 1NNHA 3CCVA 3VS0A 4HCKA 1N9RA 3C0CA 5FROA 3TQ7P 2EBPA 1Z7NA 3HXXA 1RABB 1YFTA 1FWZA 4J9GA 3C94A 2FPFA 3CCEA 3UPUA 1TWBA 3OBWA 2QQSA 1SHFA 2RI5A 3RMQA 3TVTA 2LX7A 2Q5HA 4J9FA 3OA6A 1IL2A 2HQHA 4OVAA 2DL8A 2ODRD 1JJ2P 1NEGA 2CUDA 3PIPA 2FHDA 3ULRB 2BZYA 4YDQA 2XK0A 2RHZA 3OY9A 3JB9D 4A4GA 1IZ6A 3M0TA 2ECZA 4BDZA 1VQKQ 2FPDA 2XIDA 3RKWA 4BE2A 2A7YA 2DKGA 3IQLA 1U06A 2DZ9A 1IGQA 5C52B 3R6NA 1PRMC 4H02A 2I4LA 4BW9A 1Y96B 1M2VB 2B8AA 2COZA 1WHJA 1MUZA 4M77D 4RQEA 3KUFA 4JS5A 2LJ3A 4HKEA 2A3LA 1KC8C 1PC0A 4C8QF 2LJ1A 1BYMA 4Y28E 3QJ6A 4M75D 4XU1A 1JO8A 2MK5A 1NYRA 2COWA 2AMCA 4MZMA 2VB6A 2C0IA 1I5OB 4Q15A 2K4YA 3GBQA 3I55T 7AT1B 5LJ3g 4LVJA 1PRLC 2LT4A 3VRZA 4A54A 1QVGA 1SRMA 1JQQA 1IHVA 4RKUE 1B7YB 5D6XA 2F2WA 3L2RA 2R5MA 1NLPC 4ELZC 2HD0A 1RLQC 4KBMB 1VIFA 1QKXA 1VQOT 2X4XA 4J7FA 2HSEB 4AFUC 4UP7A 3QZ5B 1YHQA 1HD3A 4WJ4A 1HC7A 3UGTA 4CH3A 4OB0B 3VQWA 3M5AA 2XI9A 4PJLA 3VJPA 2E5AA 4RTVA 1JRIA 3EGXA 3ZFJA 1S72T 1MNEA 2RD1A 4JLIA 3C4SA 1UGPB 4C5EA 4FT2A 3OS0A 4MMLA 4KUIA 2NWMA 2KYBA 1AVZC 3EG3A 4A4HA 2RF0A 1KMMA 1KOGA 1H92A 3MF1A 5GAMg 4JUVA 5GAOm 3RKXA 4FYYB 2EYZA 1VYVA 2LNHB 4ZGDB 1YNZA 3GIBA 2QK0A 5LJ5e 1U8RA 2AKLA 2AIRB 2YXYA 3CCRT 3PVQA 3CCUA 2JJ9A 1I4K1 4IUTA 3CC2Q 1LNXA 2PZ1A 3RDVA 3J7AF 2DX1A 4TVYA 1T0HA 1T3SA 4ZGEB 2QQRA 1ZUKA 5GANe 3E9GA 2X9HA 1YITT 4A63B 4F7UF 3NELA 2KGTA 1FMKA 1Q82R 1X56A 1G2BA 3CCQT 1VQ5Q 3QTCA 1H4QA 3CCLT 1LJOA 1ZBJA 4M7DE 1MV0B 3CCVT 2HBPA 3WVEB 5K1XA 1TU0B 4J15A 5KE2A 5ECAA 2A08A 4C8QC 4C0ZA 4P72A 1YGBA 1Q82U 1YWOA 3CMQA 5IAYA 1N8RR 3REXA 4NS5A 3CCET 2LQ8A 1M3AA 4YRJA 5FU7C 3VS1A 2DF6A 4BY6C 2FB7A 4EPCA 2E3IA 4KR3A 2E70A 2IPOB 3QO3A 4JRPA 3O5ZA 5LJ3j 1G8XA 3NTIA 2JNGA 1N8RU 3GOXA 1YI2Q 4Y91A 1AWJA 2KK4A 3KBGA 3QNEA 2KXDA 1KD1R 4WI1A 3A8HB 1TH7A 3CEYA 3NGPA 3SB2A 2LQWA 4K87A 4JLGA 1Q81C 1OEBA 1KQ1A 1QKWA 2BZXA 1M4ZA 2L2PA 2LP5A 1BI1A 1PD1A 4J9CA 1AOJA 1BI2A 5HK3A 5GMKl 2QTXA 1WNLA 3GP8A 3A74A 1KQSS 2ZCFB 2K3XA 1VQZA 4B9XA 2HMAA 1TUCA 1M90R 2Q7EA 1H641 3JB9J 3G1JA 4YROA 4C8QA 2JS0A 2MWPA 3VS6A 4FL6A 4KULA 3GPLA 4K11A 5GAOr 2NUTA 2DU7A 5GAMj 1OI1A 4C5IA 1VQKA 4YRTA 1U1SA 4M4ZA 3CD6Q 2RM4A 1ADYA 4P5NA 4RMFA 1Q7YC 1M90U 2RQUA 3VUZA 4M7DB 3TSWA 2MPXC 4N4HA 4FW2A 3CMAT 1H8KA 3OYIA 5GAN7 4E51A 4P3PA 4PJOG 4H2VA 1G5VA 3F70A 1UUEA 2CREA 2RJFA 1YIJQ 1B3QA 2XDDA 2QA4Q 2EAYA 1SHGA 3EG0A 3CMEQ 2KROA 5HY6A 3HXZA 1I0CA 2DRKA 3I5RA 3GNFB 4FSXA 3MJXA 2K6DA 1X69A 1BK2A 5AYFA 3OYMA 2RHXA 2VC8A 4H2UA 1MMAA 3M56A 1YHQT 1Y0MA 1PYSA 5LJ5d 1M9SA 2X51A 4J8OA 4DA4A 2IY5B 5KE3A 2P4TA 1Q86C 4A53A 4PK4A 3RBBB 4Q6GA 4E7KA 2GGRA 3DLLA 2YSQA 4XU0A 3CCJQ 4EDUA 1M8MA 4X9CA 3PCOB 2QASA 2O4XB 1CSKA 4TVWA 2JTEA 2K5FA 3CXCP 4YYEA 1QVPA 5CCAA 1CKAA 2DTHA 1M1FA 2ZT5A 4HCBA 3CBMA 2OAWA 2J06A 1GFCA 2O01E 2RHSA 3CC4Q 4QQ6A 4TVRA 4P71C 2VXFA 2P0QA 4ZIBA 2Y4XA 1VQPQ 1MNDA 1WIEA 1RAEB 5IXFA 1VQ9A 1W6XA 3OMGA 2OTLT 1B8AA 2ALYA 2CZ1B 5C51B 5GAOn 3HFZA 2BTTA 1YJNQ 2VASA 4G85A 5CQYA 4LD9K 2AT1B 5KCOA 1OQKA 3KFUA 2RQTA 1ASZA 2JZ2A 4MMKA 4J7IA 3OW2S 3SD4A 3X26B 3SEMA 1AD5A 1X43A 2ZT7A 1QP3A 2CZ6B 1TG0A 2EW3A 4PHCA 2DXBA 2EPDA 4C92F 3CC2A 2DTIA 2HKQB 4M77G 5LL6S 2K57A 4HT4A 3S3MA 5I21A 1D1BA 2ZNIA 2CZ0B 2P4RA 1R0BG 3VQXA 1T3LA 4P3OA 4YRMA 2OX7A 1NG2A 4EMKB 2D8JA 4ZN1A 4M75G 1VQ5A 4AG2C 4IUPA 2MMPA 1N9SA 4P71A 3OYGA 1NJ6A 1VYUA 3REUA 3I35A 3CCSQ 2V1RA 2CJAA 1JEGA 3SWNB 2KVQG 2ZNJA 5L23A 4ZTJA 8AT1B 1UGRB 3A5ZA 3QSUA 1NPRA 2GCXA 4M7AG 5KYXB 2DMOA 1YWPA 2I0NA 5KYUB 3S3OA 4ELYC 1X2KA 3A8OB 3ER0A 3JCMg 3A7UA 2Y4YA 4HWTA
chains in the Genus database with same CATH topology
3JCMP 1YI2A 2L8DA 2CYZB 4RQFA 1VQKT 2ZT8A 4E47A 5GMKj 4ATOA 4R56A 4KQEA 3V8LA 5DLOA 2L3RA 3P8VA 1NYQA 5LJ3h 2GFUA 3RL6A 1NJIC 1OZ2A 4EX5A 2RI2A 4TVAA 1X2HA 3W3SA 2ZPFB 2EWNA 4WJ3M 4TQDA 4YRPA 2LDMA 3FLGA 1WU7A 2QXFA 2CJ9A 3OSSC 3NFCA 3M4GA 3OSVA 1H4TA 2HNIA 3CD6A 4YCUA 4H2XB 4BI3A 3EFRA 3QHSA 4C92C 2HQEA 3OS5A 3TREA 3L42A 1QVFS 2QA4A 2JVVA 3CMEA 2XG8D 1XQHA 1ASYA 3QYHB 5GAMh 3M58A 1O75A 4CRIA 2DD5A 4OGCA 3VBBA 3HRUA 2EJGA 5FU6B 3HRSA 4BB7A 3M4QA 2ZR2A 3ZEHA 1X54A 1N9WA 3TUPA 3HFNA 4N0AC 5LJ5f 1N27A 3HRKA 2DQ0A 2GF7A 2ZTGA 5CKFA 3PMIA 3FDRA 3BJUA 4JRKA 1JJCA 2EFIA 4OB3B 3CC4A 3OW2A 4C92A 1VQPA 5GANf 3CC2T 3BFMA 4Z02A 5DLQE 2E3CA 3X24B 2CKKA 2P0LA 4UPAA 4C8QD 1Q82C 2RHIA 4M78C 1VQ5T 2QI2A 4IUUA 3CCLA 1RI0A 2C8MA 2F69A 2DQ3A 4HWRA 4L59A 2DVEA 2RHYA 2EQJA 2WSCE 1WQ7A 4E7LA 3QPHA 1N8RC 2YLCA 2ARUA 4BI4A 4A4EA 4E7HA 4OB1B 1XNIA 4N0AA 1W4SA 3UT1A 12ASA 5CAIA 3MEUA 1EIYB 1Y96A 3HSBA 1H4SA 1VUBA 1YI2T 3FB9A 1QP2A 4P74C 3HY1A 1G3WA 1KD1C 3CCSA 2CGHA 4HCCA 2VGMA 4XAXB 2Q7GA 4XEMA 3P8HA 3HXWA 3TEHB 3M54A 2C06A 3OD1A 2ZPBB 4OMFB 4M78A 3MHXA 3DB4A 3ASKA 5K1PA 3J81E 4M7DF 2WSEE 2DPPB 1M90C 3V8JA 3FEOA 5J3BA 4LD6A 2M1HA 3C95A 2KSSA 1B7YA 3JCMe 2E41A 1UB4A 2FVUA 3CD6T 1RL2A 2K3YA 4FT4A 3CMAA 3LGLA 3V7SA 3KXTA 1VQLA 2Y90A 1YIJT 4YRRA 3QBYA 2QA4T 4Q5WA 3CMET 4J83A 2QHUA 1YBYA 2CS7A 3OYFA 4M7AD 5KH6A 3DB3A 1B34B 4XEOA 1QVFA 3S3NA 5DM7R 2DO3A 3LW5E 5EG2A 4NL3A 5GMKh 4QVDA 2BIVA 3RF1A 3OB9A 4DOVA 4UC4A 2K5IA 1VQ7A 3PGGA 1H3ZA 4YRQA 4YPFA 1B76A 3RESA 3CCJT 2AMCB 4UP8A 1J5WA 4PNOA 5GAN2 3JCMV 3L4GB 3JB9F 4LVIA 3LGFA 3NTKA 4DQ2A 3CC4T 4DPGA 3E9FA 3JRZA 1VQPT 4YREA 4OLFA 1EFWA 3OYLA 2OTLA 5D6YA 4LVKA 3HY0A 4NCXA 1YJNT 4LVMA 2QQ9A 3TCJA 2DEQA 1WGSA 3A8LB 1SETA 4CH5A 4M7DC 2MF2A 1YFRA 1ZQ1A 4B9WA 2P5IA 2LX9A 2X4WA 4PJOE 1D3BA 3P8BB 4BE0A 1KHIA 1JJ2S 4HVCA 1O9SA 5HK0A 3META 1Y07A 4ZTZB 3M59A 1QF6A 2X35A 4QQDA 3JCMh 4P75C 11ASA 2D6FA 4YP0A 1ZHIA 5CVIA 2DAQA 2PVGB 3LLRA 4PKCC 2OTJA 2E10A 3CCST 3UFGA 2E1HA 3MEYA 1WYDA 1P92A 2DU5A 4CH6A 2M9UA 2E5QA 2K5LA 1I8FA 3QO7A 4M7DA 2ZIOA 3SDZA 2RHQA 3EAEA 3S6WA 2ODRC 2XDPA 2LNVA 1EIFA 2JN0A 4C0DB 4MDXA 3OYJA 1UGQB 1B70B 3TEEA 3OYDA 1Z7MA 2F5KA 2EQKA 3IKMB 5C53B 5GAN3 1JB0E 4P75A 2ZPEB 4PJOB 2IY5A 1VQLT 1U1TA 2JOYA 2CIMA 5ELOA 1I5LA 1YJWT 2PVDB 4C92D 2M0OA 4GLKA 4M77E 3PCOA 2RK2A 3RGLA 2O4XA 2Q5IA 3G71T 3BY7A 4C8QG 4M75E 2WSFE 3N5BB 1VQ7T 1SESA 2QDYB 2YLBA 4CS3A 2PUKB 3OBYA 5FRNA 2FYKA 5CK9A 3VQYA 2JTFA 5GANd 4A4KA 3SWNC 3OYEA 4H2WA 3SFMA 5LJ3e 2ZPIB 1R8OB 2E6NA 5FLXE 3LC0A 3URGA 4MZPA 3BW1A 1M1KU 4M7AE 3X28B 1USYC 2MWOA 4NOYA 4QQGA 1NE8A 4HCZA 1HTTA 1XTDA 4F7UA 3MQZA 4ZTFA 2V8IA 1BBWA 1HK9A 1X55A 3QO5A 3M9QA 2ARTA 1FX7A 2I4NA 3OS2A 3JCMX 4II1A 1BI0A 1M5Q1 2ZT6A 4M78D 3A7AA 2VGNA 5GAMe 5IN1A 4M77B 5FRMA 1N6AA 4XTUA 2RHSB 3SWNA 2EKOA 3HXUA 3G1ZA 2DD4A 1JJ2A 4KR2A 4AH6A 4M75B 4NL2A 2AKWB 2CZ7B 4WF2A 2DIGA 4YRGA 1USYA 2OTJT 2LRQA 2G3RA 2KMTA 3G6EA 3P8TA 2K2VA 4HT9A 5GAOq 3M55A 2WACA 5I2SA 3TEGA 1EVKA 5A0LA 4M7AB 3L2ZA 1YFSA 4LDYA 4G84A 5FU6C 4BE1A 4EMHA 3A32A 3QG1A 4YRCA 1KQSA 3UH0A 2P0PA 2FL7A 3X25B 1YB3A 2OAUA 4JDSA 2L5QA 1KHCA 2CJBA 3MCAB 3OYHA 4C0GA 4QVZA 3RACA 3MEVA 2ZXFA 1FXXA 4A4FA 3TU4K 2ZINA 2DJZA 3JCMf 2GFAA 4EO4A 3I56T 3NENA 4GY5A 3GNGA 5DY9A 1K73U 2PMEA 2IVWA 3OYBA 4V2SA 1QE0A 2G4CA 4LNSA 3L2UA 3CXCS 5CKEA 1YIJA 2PU9B 4BWAA 4HWOA 4BUGA 2E12A 2KY9A 5D6WA 1K9MU 3JB9H 3P8DA 3G4ST 5LJ5g 3HXVA 3CCMA 1Q86U 5KNNA 4HT8A 3CCJA 1M1GA 2DK3A 1K8AU 3HP9A 4RCCA 5GANg 2D0QB 3ME9A 4JS4A 1YCYA 3EFSA 3UDCA 3MEAA 2I2LA 2Q7HA 1X6OA 3QUIA 4TQFA 2HQXA 3MO8A 4M7DD 3PMTA 4K88A 5GMKe 3RUXA 1YJNA 4EMGA 3LSQA 3V8KA 1EOVA 2EYQA 1DJ7B 3PNWC 2XDBA 1G5IA 4LDXA 2EJ9A 2XICA 2NS6A 5A0DA 3JCMQ 2LTOA 4E7JA 1MHNA 2DIQA 3G6ET 3OYNA 3VYGA 1EIYA 3QKJA 3MP8A 2VUBA 2RK1A 1JJCB 5HKCA 3QO8A 2D9TA 4M78E 4C92G 3LWHA 5J39A 2BUDA 5E3IA 1KQ2A 1YJ9A 1W66A 3GLXA 1Y71A 4N4GA 2X4YA 3AHUA 3ICAA 1BI3A 1VQMA 2ZGWA 3IALA 3QDRB 3NEMA 2R57A 4BDYA 2J3LA 5LJ5j 3ERRA 4L6V5 3UWNA 3PIOA 1G3SA 3OMCA 4J6YA 1MGQA 4QVCA 4PJOF 2DXTA 5GANj 1G51A 3FC3A 2LCCA 2RHUA 2ARSA 1QW1A 5CO7A 1PSEA 1B34A 3HKSA 2P0KA 4YTLA 4XK8E 3DSQA 3JB9I 4YRKA 3A8MB 5GMKi 4N4IA 3I7FA 2AHJB 3NTHA 2ZR3A 2RI3A 4CS4A 1VQ8A 4PL6A 4P74A 1UGSB 4DOWA 1NJIU 1YJWA 3E1SA 2F5TX 2RH2A 3CXCA 4M78G 4M78B 2VYTA 2XGTA 2PMFA 2EL9A 3G71A 4C5GA 4C0FA 3L4GA 4LDVA 1VQNA 1M8VA 3CCMT 1G3TA 3H8ZA 3LH0A 4P73C 1E1TA 3M57A 2RA2A 1SSFA 3A31A 3PZCA 3QYGB 5LJ3f 1M1KC 2XU8A 1VQ6A 2ZPGB 4IURA 3OYAA 4YRFA 3M53A 2NLUA 3JCMJ 1RIQA 3E9HA 4P72C 3L1AA 4PLLA 4YCVA 3H6ZA 3VV0A 3CPFA 2RJCA 2I4MA 4O6JA 1VIEA 4C0DC 5CR2A 3PTAA 2RJDA 2RJEA 4ZN3A 1NJ1A 3UGQA 4M77F 2A8EA 3RKYA 2QHVA 1BKBA 4OP0A 5F5WA 3VU3C 4C5HA 5GAMf 4R55A 4RMOA 4PJOC 1JBMA 4M75F 3VUBA 4P73A 3CC7T 1GXIE 1E24A 3VKIA 2DZCA 4OB2B 3DKMA 4J6WA 1VQ4A 3MEWA 1YJ9T 1NZ9A 4M7AF 1WQWA 2PUOB 4RDXA 4C8QE 2E6ZA 4YRLA 2ZIMA 5GAN4 5GAN8 1VQMT 1WJQA 3HL8A 3RMSA 4E7IA 3JCMd 4IKFA 5CKDA 4XU3A 2L89A 2YHTA 2VV5A 3HRTA 2KDSA 4YCWA 1B70A 1V29B 3MF2A 4XQ3A 4CH4A 3LWIA 5CKBA 3MP6A 2RO0A 3HFOA 3R07A 3INZA 1D3BB 2XHCA 1NPPA 3PFSA 3V7CA 3VQVA 5CQXA 4PJOA 2H3JA 3LSSA 3FJPA 4L87A 5ELNA 4LVLA 1KD1U 1W2BS 4BI8B 5HGQA 4BD3A 4XTYA 3JCMc 2GQVA 2QQAA 2V8KA 5J26A 2RB6A 1VQ8T 4L5GA 3RERA 4J6XA 1K73C 3BDLA 3PT9A 3A8GB 2J3MA 5CKHA 4M77C 4M7DG 2ZZGA 3I56A 2QEXA 1NJ8A 1KC8U 5A2QE 2RHQB 4P3NA 3HPWA 3J80E 1VQNT 4H2TA 4EMKC 4M75C 2V8JA 3T9NA 4C8QB 1E1OA 3HFVA 4CS2A 1SERA 5LJ5h 1K9MC 3JSCA 5FU7B 4F7UE 4BY6B 4YRIA 1WPYA 1VQ6T 5A0GA 1IREB 1WJRA 4K86A 4XU2A 2EQMA 3OQ5A 2LQKA 3Q1JA 5GANh 3QZ9B 5C0MA 2I4OA 3OS1A 2JUFA 4M7AC 4FM4B 1LYLA 1FYFA 3G4SA 1K8AC 4X9DA 1LOJA 2E65A 2QHSA 2LT1A 3L2WA 3VYHB 5GAOp 1PYSB 3MP1A 3RIRA 1OZ3A 3NETA 3QJYA 4M77A 1WJSA 3HXYA 4ME7A 4FIBA 1ATIA 3CCUT 4KUDK 2MAMA 4EMKA 4M75A 4D6WA 2AKWA 4MDWA 4HA8A 3L2VA 3JB9G 3IG2A 3WVDB 4H2SA 3CPWS 3BDUA 4XTWA 4KT0E 2ZZDA 4PG3A 2LCLA 4J5YA 2YRVA 5IT9E 2EJFA 4PLIA 1VQ4T 1ADJA 4OF1A 3OYYA 5GAN6 3QXEB 2DTOA 2ALYB 4M7AA 4LDWA 1WLEA 3HFZB 5GAN5 3L2QA 4F7UG 4F7UB 1I81A 4XTXA 3ZBDA 3QIIA 3CBPA 4MZTA 3HRIA 1X75C 4HWPA 2DXUA 3A7RA 3M4YA 3P8YA 2ZCEA 3FRNA 3C12A 3E19A 3FIFA 4HWSA 5L8RE 4CI0C 4IUQA 3JAME 2R5AA 3OYCA 2X4JA 4X34A 4RCBA 2QQBA 4H2YA 1H4VB 2ZPHB 4VUBA 1KMNA 3WQZA 2PVOB 4JRQA 1KG1A 1Q81U 1W2BA 2IG0A 1X2GA 4H2XA 2EIFA 2XKOC 3A5ZB 2BKDN 5LJ3d 2QEXT 2MI6A 1NJ5A 2LC4A 4ZGJB 4TWAA 4IUVA 1UEBA 2XD0A 4M78F 4QW2A 2C7IA 1C0AA 3IKLA 1HXDA 2LVMA 1GGMA 1Q7YU 2ZZEA 3E9IA 5GAOl 2R58A 1ZBXA 1OYXA 3G7ZA 4UP9A 5CIUA 3OYKA 1EVLA 4ZTUB 3X20B 1QVGS 4BACA 2JTMA 3I55A 2PQWA 1G5HA 4TVAB 3LYIA 4JRIA 5GMKm 5KCHA 2EQUA 4C92E 1SRYA 4OGEA 4XTZA 1L0WA 4RG2A 2VXEA 5GAMd 4FU6A 1BBUA 5M9OA 1VQOA 4JJNK 1BIAA 2DXCA 3CBOA 4YRSA 1VQ9T 4O2DA 3DLMA 1G3YA 1S72A 3V7RA 2DDZA 2M16A 4YRNA 3HHTB 4XTVA 5I2MA 1BIBA 1Y7XA 1EQRA 3WXMB 4PJOD 3CPWA 2KQWA 4TTVA 2ZZFA 3JCMb 4RG8A 3CCRA 3HTZA 1NJ2A 2QHTA 2E64A 2HAXA 1AHJB 3JCMW 1PSFA 3LX7A 3CC7A 3M4PA 4LDUA 1E22A 1YITA 3O8VA 5C6SA 3A5YA 1XOVA 2XTIA 3R6OA 2KAFA 3CCQA 4X5OA 3GF5A 1X01A 4O5VA 3TEHA 4C92B 1NNHA 3CCVA 1N9RA 5FROA 1Z7NA 3HXXA 1YFTA 1FWZA 3C94A 3CCEA 3UPUA 3OBWA 2QQSA 2RI5A 3RMQA 2Q5HA 3OA6A 1IL2A 4OVAA 2ODRD 3PIPA 2FHDA 4YDQA 2XK0A 2RHZA 3OY9A 3JB9D 4A4GA 1IZ6A 4BDZA 2XIDA 3RKWA 4BE2A 2A7YA 2DKGA 2DZ9A 5C52B 4BW9A 4H02A 2I4LA 1Y96B 2B8AA 4M77D 4RQEA 3KUFA 4JS5A 4HKEA 2A3LA 1KC8C 4C8QF 1BYMA 4Y28E 3QJ6A 4M75D 4XU1A 1NYRA 2AMCA 4MZMA 4Q15A 2K4YA 3I55T 5LJ3g 4LVJA 2LT4A 4A54A 1QVGA 4RKUE 1B7YB 5D6XA 3L2RA 2R5MA 4ELZC 2HD0A 4KBMB 1VIFA 1VQOT 2X4XA 4J7FA 4UP7A 3QZ5B 1YHQA 4WJ4A 1HC7A 3UGTA 4CH3A 4OB0B 3VQWA 3M5AA 2XI9A 3VJPA 2E5AA 1JRIA 3ZFJA 1S72T 2RD1A 4JLIA 3C4SA 1UGPB 4C5EA 4FT2A 3OS0A 4MMLA 4KUIA 4A4HA 1KMMA 1KOGA 3MF1A 5GAMg 4JUVA 5GAOm 3RKXA 4ZGDB 3GIBA 5LJ5e 1U8RA 3CCRT 3CCUA 1I4K1 4IUTA 1LNXA 3J7AF 4TVYA 4ZGEB 2QQRA 5GANe 3E9GA 1YITT 3NELA 4F7UF 1X56A 3CCQT 3QTCA 1H4QA 3CCLT 1LJOA 4M7DE 3CCVT 2HBPA 3WVEB 5K1XA 4J15A 5KE2A 4C8QC 4C0ZA 4P72A 1YGBA 1Q82U 3CMQA 5IAYA 3REXA 4NS5A 3CCET 2LQ8A 4YRJA 5FU7C 4BY6C 2FB7A 4EPCA 4KR3A 2E70A 3QO3A 4JRPA 5LJ3j 3NTIA 2JNGA 1N8RU 3GOXA 4Y91A 2KK4A 3KBGA 3QNEA 4WI1A 3A8HB 1TH7A 3CEYA 3SB2A 4K87A 4JLGA 1Q81C 1KQ1A 1M4ZA 1BI1A 1BI2A 5HK3A 5GMKl 2QTXA 1WNLA 3GP8A 3A74A 1KQSS 2ZCFB 2K3XA 1VQZA 4B9XA 2Q7EA 1H641 3JB9J 4YROA 4C8QA 2MWPA 4FL6A 4KULA 3GPLA 5GAOr 2DU7A 5GAMj 1OI1A 4C5IA 1VQKA 4YRTA 1U1SA 1ADYA 2RM4A 4P5NA 4RMFA 1Q7YC 1M90U 3VUZA 4M7DB 4N4HA 3CMAT 3OYIA 5GAN7 4E51A 4P3PA 4PJOG 4H2VA 1G5VA 3F70A 2RJFA 2XDDA 2EAYA 5HY6A 3HXZA 3GNFB 4FSXA 5AYFA 3OYMA 2RHXA 2VC8A 4H2UA 3M56A 1YHQT 1PYSA 5LJ5d 1M9SA 4J8OA 4DA4A 2IY5B 5KE3A 2P4TA 1Q86C 4A53A 4Q6GA 4E7KA 3DLLA 4XU0A 4EDUA 4X9CA 3PCOB 2O4XB 4TVWA 2K5FA 4YYEA 1QVPA 5CCAA 2DTHA 1M1FA 2ZT5A 4HCBA 3CBMA 2O01E 2RHSA 4QQ6A 4TVRA 4P71C 2VXFA 2P0QA 4ZIBA 2Y4XA 1VQ9A 3OMGA 2OTLT 1B8AA 2ALYA 2CZ1B 5C51B 5GAOn 3HFZA 4G85A 5CQYA 4LD9K 5KCOA 3KFUA 1ASZA 2JZ2A 4MMKA 4J7IA 3OW2S 3SD4A 3X26B 2ZT7A 1QP3A 2CZ6B 4PHCA 2DXBA 4C92F 3CC2A 2DTIA 4M77G 5LL6S 2K57A 4HT4A 3S3MA 5I21A 2ZNIA 2CZ0B 3VQXA 4P3OA 4YRMA 4EMKB 4ZN1A 4M75G 1VQ5A 4IUPA 2MMPA 1N9SA 4P71A 3OYGA 1NJ6A 3REUA 2CJAA 3SWNB 2KVQG 2ZNJA 4ZTJA 1UGRB 3A5ZA 3QSUA 1NPRA 2GCXA 4M7AG 3S3OA 4ELYC 3A8OB 3ER0A 3JCMg 3A7UA 2Y4YA 4HWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1A A;  4YCV A;  4M77 E;  3JCM P;  3PCO A;  3RGL A;  2XTI A;  4X5O A;  2Q5I A;  4RQF A;  1X01 A;  3BY7 A;  2I4M A;  3TEH A;  4C92 B;  1NNH A;  4C8Q G;  2ZT8 A;  4M75 E;  1N9R A;  5GMK j;  1NJ1 A;  3UGQ A;  1SES A;  4KQE A;  3V8L A;  1Z7N A;  2YLB A;  3HXX A;  1YFT A;  4CS3 A;  4M77 F;  2FYK A;  3P8V A;  3VQY A;  1NYQ A;  5GAN d;  5LJ3 h;  3RKY A;  3SWN C;  4H2W A;  3RL6 A;  2QHV A;  4EX5 A;  4OP0 A;  5F5W A;  3VU3 C;  5GAM f;  2Q5H A;  1IL2 A;  5LJ3 e;  4TVA A;  1X2H A;  3W3S A;  4PJO C;  1JBM A;  4M75 F;  4P73 A;  2ODR D;  3LC0 A;  2EWN A;  3BW1 A;  4M7A E;  4WJ3 M;  4TQD A;  4YRP A;  1E24 A;  1USY C;  1WU7 A;  4YDQ A;  2CJ9 A;  3M4G A;  3JB9 D;  2DZC A;  4NOY A;  1H4T A;  2HNI A;  4YCU A;  4J6W A;  4H2X B;  1HTT A;  3EFR A;  3QHS A;  4F7U A;  3RKW A;  4C92 C;  2DKG A;  2DZ9 A;  4M7A F;  1WQW A;  4RDX A;  5C52 B;  1BBW A;  1HK9 A;  1X55 A;  4C8Q E;  3QO5 A;  4BW9 A;  4H02 A;  2I4L A;  4YRL A;  1Y96 B;  2ART A;  2ZIM A;  5GAN 4;  5GAN 8;  2I4N A;  1ASY A;  3JCM d;  4M77 D;  4XU3 A;  3JCM X;  2YHT A;  5GAM h;  4RQE A;  1M5Q 1;  4YCW A;  1B70 A;  2ZT6 A;  4M78 D;  3MF2 A;  4XQ3 A;  4CH4 A;  3VBB A;  3A7A A;  5GAM e;  2EJG A;  4C8Q F;  4M77 B;  3HFO A;  4M75 D;  4XTU A;  4XU1 A;  2RHS B;  3R07 A;  3INZ A;  3SWN A;  1NYR A;  1D3B B;  3M4Q A;  2AMC A;  3HXU A;  2ZR2 A;  3V7C A;  3G1Z A;  3VQV A;  4PJO A;  1X54 A;  4Q15 A;  1N9W A;  4KR2 A;  3HFN A;  3TUP A;  4AH6 A;  4M75 B;  5LJ3 g;  3LSS A;  4NL2 A;  4N0A C;  2AKW B;  3FJP A;  4WF2 A;  4A54 A;  4YRG A;  5LJ5 f;  4L87 A;  1USY A;  3HRK A;  2DQ0 A;  5ELN A;  2ZTG A;  1B7Y B;  3P8T A;  3BJU A;  4JRK A;  4HT9 A;  1JJC A;  5GAO q;  3TEG A;  5HGQ A;  4C92 A;  5GAN f;  4XTY A;  3JCM c;  1EVK A;  4UP7 A;  4M7A B;  3BFM A;  2RB6 A;  3L2Z A;  4WJ4 A;  1HC7 A;  3RER A;  4J6X A;  3UGT A;  4CH3 A;  2E3C A;  1YFS A;  3VQW A;  2J3M A;  4G84 A;  2E5A A;  2P0L A;  4UPA A;  4M77 C;  1JRI A;  4EMH A;  4M7D G;  4C8Q D;  2ZZG A;  3A32 A;  2RD1 A;  4YRC A;  1NJ8 A;  4JLI A;  4M78 C;  2RHQ B;  3UH0 A;  4P3N A;  4MML A;  1YB3 A;  4EMK C;  2C8M A;  4H2T A;  4M75 C;  4C8Q B;  1E1O A;  1KMM A;  2DQ3 A;  3HFV A;  1KOG A;  3MF1 A;  4CS2 A;  4HWR A;  5GAM g;  1SER A;  5LJ5 h;  4JUV A;  5GAO m;  3RKX A;  2DVE A;  2CJB A;  1WQ7 A;  3GIB A;  4F7U E;  2YLC A;  5LJ5 e;  2ARU A;  4YRI A;  1WPY A;  1I4K 1;  4K86 A;  4XU2 A;  4N0A A;  3RAC A;  1LNX A;  2ZXF A;  5GAN h;  2ZIN A;  2DJZ A;  3JCM f;  2I4O A;  4TVY A;  12AS A;  4M7A C;  4EO4 A;  5CAI A;  5GAN e;  3NEL A;  1EIY B;  4F7U F;  1Y96 A;  3HSB A;  1LYL A;  1FYF A;  4X9D A;  1LOJ A;  1H4S A;  1X56 A;  3FB9 A;  4P74 C;  3HY1 A;  3NEN A;  3QTC A;  2E65 A;  1H4Q A;  2QHS A;  5DY9 A;  1LJO A;  2CGH A;  2PME A;  4M7D E;  2Q7G A;  4XEM A;  5GAO p;  3HXW A;  1PYS B;  3TEH B;  3RIR A;  5K1X A;  4J15 A;  4V2S A;  3OD1 A;  3NET A;  4C8Q C;  1QE0 A;  4M77 A;  3HXY A;  1YGB A;  2G4C A;  4P72 A;  3CMQ A;  4LNS A;  3REX A;  1ATI A;  4M78 A;  4YRJ A;  4BWA A;  4HWO A;  5K1P A;  2FB7 A;  4M7D F;  4KR3 A;  4EMK A;  4M75 A;  3QO3 A;  2AKW A;  3V8J A;  5LJ3 j;  4HA8 A;  3JB9 H;  3JB9 G;  3IG2 A;  4H2S A;  1B7Y A;  3JCM e;  2E41 A;  3BDU A;  4XTW A;  4Y91 A;  5LJ5 g;  3HXV A;  3QNE A;  4PG3 A;  4J5Y A;  4WI1 A;  2EJF A;  1TH7 A;  1ADJ A;  3SB2 A;  4HT8 A;  5KNN A;  5GAN 6;  4K87 A;  2DTO A;  2ALY B;  4M7A A;  1KQ1 A;  1WLE A;  3HFZ B;  3V7S A;  5GAN 5;  4RCC A;  4F7U G;  4F7U B;  1I81 A;  5GAN g;  4XTX A;  2Y90 A;  5GMK l;  4YRR A;  2QTX A;  1WNL A;  3A74 A;  2QHU A;  1YCY A;  3EFS A;  4M7A D;  1VQZ A;  3HRI A;  1B34 B;  4XEO A;  2Q7E A;  1H64 1;  2I2L A;  2Q7H A;  3JB9 J;  4HWP A;  4YRO A;  4C8Q A;  2DXU A;  3QUI A;  4NL3 A;  3A7R A;  5GMK h;  4TQF A;  4M7D D;  4QVD A;  3P8Y A;  2ZCE A;  5GAO r;  2DU7 A;  5GAM j;  4K88 A;  3RF1 A;  5GMK e;  4YRT A;  1U1S A;  3FIF A;  3RUX A;  4HWS A;  4EMG A;  2RM4 A;  1ADY A;  3LSQ A;  4RMF A;  3V8K A;  1EOV A;  3PGG A;  4YRQ A;  4M7D B;  4YPF A;  1B76 A;  3RES A;  5GAN 7;  2AMC B;  1G5I A;  4UP8 A;  1J5W A;  2EJ9 A;  4E51 A;  4P3P A;  4PJO G;  4H2V A;  4PNO A;  3JCM Q;  4RCB A;  5GAN 2;  4H2Y A;  3JCM V;  3L4G B;  1H4V B;  2EAY A;  1EIY A;  3JB9 F;  3HXZ A;  1KMN A;  3WQZ A;  4DQ2 A;  4DPG A;  1JJC B;  1X2G A;  2VC8 A;  4OLF A;  4YRE A;  1EFW A;  4H2U A;  4H2X A;  3QO8 A;  1PYS A;  4M78 E;  5LJ5 d;  4C92 G;  2IY5 B;  3HY0 A;  4NCX A;  5E3I A;  4A53 A;  4Q6G A;  1KQ2 A;  4XU0 A;  1W66 A;  5LJ3 d;  2DEQ A;  1SET A;  4CH5 A;  1NJ5 A;  4X9C A;  4M7D C;  4TWA A;  3AHU A;  3PCO B;  3ICA A;  4M78 F;  2C7I A;  4TVW A;  1YFR A;  1C0A A;  3IKL A;  1HXD A;  4YYE A;  2DTH A;  2ZT5 A;  2ZGW A;  1GGM A;  2P5I A;  2ZZE A;  3IAL A;  4PJO E;  3E9I A;  3NEM A;  2RHS A;  5GAO l;  2J3L A;  4P71 C;  2VXF A;  5LJ5 j;  1D3B A;  3ERR A;  4ZIB A;  4HVC A;  4UP9 A;  1EVL A;  1B8A A;  2ALY A;  4ZTZ B;  4ZTU B;  5C51 B;  5GAO n;  4J6Y A;  1QF6 A;  1MGQ A;  3HFZ A;  4QVC A;  3JCM h;  4G85 A;  1G5H A;  4PJO F;  4P75 C;  4TVA B;  11AS A;  4JRI A;  2DXT A;  4YP0 A;  5GMK m;  5GAN j;  1G51 A;  4C92 E;  3KFU A;  1SRY A;  2ARS A;  1ASZ A;  4XTZ A;  4MMK A;  1L0W A;  2E10 A;  2VXE A;  1B34 A;  5GAM d;  3DSQ A;  3UFG A;  3JB9 I;  2E1H A;  3MEY A;  1WYD A;  4YRK A;  1BBU A;  2DU5 A;  2ZT7 A;  5GMK i;  4PHC A;  3I7F A;  4CH6 A;  2ZR3 A;  4C92 F;  4CS4 A;  1BIA A;  2DTI A;  4M77 G;  4P74 A;  1I8F A;  3QO7 A;  4YRS A;  4M7D A;  4O2D A;  2ZIO A;  2K57 A;  5I21 A;  4M78 G;  4M78 B;  2ZNI A;  2RHQ A;  3VQX A;  2ODR C;  4P3O A;  4YRM A;  2XGT A;  4EMK B;  4M75 G;  2PMF A;  3V7R A;  2JN0 A;  2EL9 A;  2DDZ A;  3L4G A;  4YRN A;  1N9S A;  1B70 B;  4P71 A;  1NJ6 A;  1M8V A;  4XTV A;  3REU A;  1BIB A;  1EQR A;  4P73 C;  4PJO D;  1E1T A;  2RA2 A;  1Z7M A;  2CJA A;  3A31 A;  3PZC A;  3IKM B;  4TTV A;  2ZZF A;  3SWN B;  5C53 B;  5LJ3 f;  2ZNJ A;  3JCM b;  5GAN 3;  3HTZ A;  1NJ2 A;  2QHT A;  4P75 A;  2E64 A;  3A5Z A;  2IY5 A;  4PJO B;  3QSU A;  3JCM W;  4YRF A;  4M7A G;  1U1T A;  2CIM A;  5ELO A;  1I5L A;  3JCM J;  1RIQ A;  3JCM g;  3E9H A;  3A7U A;  4HWT A;  4P72 C;  3M4P A;  4C92 D;  1E22 A;  3A5Y A; 
#chains in the Genus database with same CATH topology
 2RPN A;  3EG9 B;  3JCM P;  1YI2 A;  2L8D A;  2JXB A;  2CYZ B;  2JM9 A;  4RQF A;  3EGD B;  1MV3 A;  1AZE A;  3VS3 A;  1VQK T;  2ZT8 A;  4E47 A;  2KT1 A;  3M0S A;  5GMK j;  4ATO A;  4R56 A;  1V76 A;  4KQE A;  3V8L A;  5DLO A;  2L3R A;  3P8V A;  1NYQ A;  1TSF A;  5LJ3 h;  2GFU A;  3RL6 A;  1NJI C;  1VQL Q;  1OZ2 A;  2DEU A;  4EX5 A;  3MPU B;  2RI2 A;  4TVA A;  3EFO B;  4KH0 B;  1X2H A;  3W3S A;  2C0T A;  2ZPF B;  3UA7 A;  2AZS A;  2EWN A;  4WJ3 M;  4TQD A;  4OMN A;  4YRP A;  2M02 A;  1BU1 A;  2LDM A;  3FLG A;  2LQN A;  1WU7 A;  2QXF A;  2CJ9 A;  1ZSZ C;  3OSS C;  3NFC A;  3M4G A;  3G71 Q;  3OSV A;  1GFD A;  1H4T A;  2HBW A;  2HNI A;  3U23 A;  3CD6 A;  4YCU A;  4F16 A;  5IXB A;  4H2X B;  4BI3 A;  2YUP A;  3EFR A;  3QHS A;  3M0Q A;  1VQ7 Q;  4C92 C;  1QCO A;  2HQE A;  3OS5 A;  2KEA A;  2FRY A;  3TRE A;  3L42 A;  1F1B B;  4FSS A;  1K9A A;  1QVF S;  2QA4 A;  2JVV A;  3CME A;  2XG8 D;  1YN8 A;  1XQH A;  1ASY A;  4PFO A;  5IHI A;  3QYH B;  2QGF B;  5GAM h;  2L3P A;  3M58 A;  1O75 A;  4CRI A;  2DD5 A;  4OGC A;  3SHW A;  3VBB A;  3HRU A;  1ZUY A;  2EJG A;  5FU6 B;  4HVW A;  3HRS A;  2EKH A;  4BB7 A;  3M4Q A;  2ZR2 A;  3ZEH A;  2A28 A;  2KNB B;  1X54 A;  1N9W A;  3TUP A;  3HFN A;  2DM1 A;  1PNJ A;  4N0A C;  1G83 A;  5LJ5 f;  3M0P A;  1N27 A;  2ENM A;  3HRK A;  2DQ0 A;  2GF7 A;  1ZSZ A;  2FZK B;  2ZTG A;  1OU8 A;  5CKF A;  3PMI A;  3FDR A;  4AFZ C;  3BJU A;  4JRK A;  1JJC A;  2EFI A;  4OB3 B;  3CC4 A;  3OW2 A;  2FEI A;  4C92 A;  1VQP A;  5GAN f;  6AT1 B;  3CC2 T;  3BFM A;  4Z02 A;  4ORZ A;  1WFW A;  5DLQ E;  2E3C A;  1PCX A;  2LJ0 A;  3X24 B;  2CKK A;  2OI3 A;  2P0L A;  4UPA A;  4C8Q D;  1Q82 C;  2RHI A;  4M78 C;  1KJW A;  1VQ5 T;  2QI2 A;  4IUU A;  3CCL A;  1RI0 A;  1IO6 A;  2C8M A;  4RTT A;  2F69 A;  2OTJ Q;  2DQ3 A;  4HWR A;  4L59 A;  1EFN A;  1PKT A;  1UTI A;  2AZV A;  2DVE A;  2RHY A;  2EQJ A;  2WSC E;  1WQ7 A;  4E7L A;  2B86 A;  3QPH A;  2YLC A;  1N8R C;  2ARU A;  4BI4 A;  3M0R A;  4A4E A;  1R77 A;  4E7H A;  4OB1 B;  1E7O A;  1XNI A;  4ESR A;  2ED1 A;  4N0A A;  1ZLM A;  1W4S A;  1SG5 A;  1ACM B;  2K79 A;  3UT1 A;  1YFN A;  12AS A;  5CAI A;  3MEU A;  1EIY B;  4DBR A;  1Y96 A;  3HSB A;  1X27 A;  2E5K A;  1H4S A;  1VUB A;  1YI2 T;  3FB9 A;  1QP2 A;  4P74 C;  3HY1 A;  1G3W A;  1KD1 C;  5FWC A;  3CCS A;  1PHT A;  4DBF A;  2DET A;  2CGH A;  4HCC A;  2VGM A;  4XAX B;  5I11 A;  1UJ0 A;  2Q7G A;  4XEM A;  3P8H A;  3HXW A;  3E2U A;  3TEH B;  2BE9 B;  2EYX A;  3M54 A;  2C06 A;  3OD1 A;  2RMO A;  4PJN A;  1PD0 A;  1RUW A;  2ZPB B;  1TOV A;  4OMF B;  1UHF A;  3MHX A;  4M78 A;  3DB4 A;  2YRC A;  3ASK A;  1RAI B;  5K1P A;  4EIK A;  3J81 E;  4M7D F;  2EGA A;  2WSE E;  3H0I A;  2DPP B;  1M90 C;  2DL7 A;  3FEO A;  3V8J A;  4Y92 A;  5J3B A;  2F1L A;  4LD6 A;  2M1H A;  1BB9 A;  1X6B A;  2LZ6 B;  1FMW A;  3C95 A;  3I56 Q;  2KSS A;  2NUP B;  1B7Y A;  3JCM e;  2E41 A;  1SF9 A;  1IHW A;  1UB4 A;  1IB8 A;  2FVU A;  3CD6 T;  1RL2 A;  2K3Y A;  2ROT A;  4FT4 A;  3CMA A;  1W2B P;  1M2O A;  3LGL A;  3V7S A;  3KXT A;  5EC7 A;  4FCY A;  1HYO A;  3PE0 A;  1VQL A;  2Y90 A;  1YIJ T;  4YRR A;  3QBY A;  2QA4 T;  4Q5W A;  3CME T;  4J83 A;  2QHU A;  1U3O A;  1YBY A;  2CS7 A;  3OYF A;  4M7A D;  5KH6 A;  3DB3 A;  4OMP A;  1B34 B;  1D1C A;  2YUN A;  1QVF A;  4XEO A;  3S3N A;  2EVR A;  2RQV A;  2DO3 A;  5DM7 R;  3LW5 E;  5EG2 A;  4NL3 A;  2CH4 A;  5GMK h;  4QVD A;  3G4S Q;  2BIV A;  5D7U A;  2E3H A;  2O88 A;  1BCO A;  3RF1 A;  3OB9 A;  4DOV A;  4UC4 A;  1T0J A;  2K5I A;  2P84 A;  1VQ7 A;  2J6O A;  3PGG A;  1H3Z A;  4YRQ A;  4YPF A;  1B76 A;  3RES A;  3CCJ T;  2AMC B;  4UP8 A;  1J5W A;  4PNO A;  5GAN 2;  3JCM V;  3L4G B;  1SPK A;  4RTY A;  3JB9 F;  4LVI A;  3M0U A;  3LGF A;  3NTK A;  4DQ2 A;  3H41 A;  1OUL A;  3CC4 T;  4DPG A;  3E9F A;  1PM3 A;  2MCN A;  3JRZ A;  1VQP T;  4YRE A;  4OLF A;  3EG1 A;  1EFW A;  3OYL A;  2OTL A;  1QWF A;  5D6Y A;  4LVK A;  3HY0 A;  1SRL A;  4NCX A;  1YJN T;  3HTR A;  4LVM A;  2QQ9 A;  3TCJ A;  2DEQ A;  1WGS A;  3A8L B;  1SET A;  4CH5 A;  4M7D C;  3VS5 A;  2Z0W A;  2MF2 A;  2DFU A;  1YFR A;  1ZQ1 A;  2JW4 A;  1B7T A;  1M3B A;  3G6E Q;  1TUD A;  4B9W A;  2P5I A;  2LX9 A;  2X4W A;  4PJO E;  1IRX A;  1D3B A;  1KFZ A;  1WXU A;  1ABO A;  3P8B B;  4BE0 A;  1KHI A;  1VYT A;  4X1V A;  1JJ2 S;  2CP0 A;  4HVC A;  1JU5 C;  1O9S A;  5HK0 A;  3MET A;  1Y07 A;  4ZTZ B;  3CPW P;  3M59 A;  1QF6 A;  2X35 A;  1HJD A;  4QQD A;  3JCM h;  4P75 C;  1ZX6 A;  11AS A;  2J6K A;  2D6F A;  4YP0 A;  4FYW B;  1ZHI A;  5CVI A;  2DAQ A;  1TS9 A;  1RI9 A;  2PVG B;  3LLR A;  4PKC C;  2OTJ A;  2E10 A;  3CCS T;  3UFG A;  2E1H A;  3MEY A;  1WYD A;  1P92 A;  2DU5 A;  1M27 C;  2JM8 A;  4CH6 A;  1EX4 A;  2M9U A;  2JT4 A;  2E5Q A;  2K5L A;  1K76 A;  1I8F A;  3QO7 A;  4M7D A;  2ZIO A;  4AFQ C;  3SDZ A;  1NYG A;  1QCN A;  2RHQ A;  2LMJ A;  3EAE A;  1I07 A;  3S6W A;  2ODR C;  1AWO A;  2XDP A;  2LNV A;  1EIF A;  2JN0 A;  4C0D B;  4MDX A;  3NPF A;  3OYJ A;  1UGQ B;  1B70 B;  3TEE A;  2NUZ A;  1JXO A;  3OYD A;  2JS2 A;  1RAA B;  2X3X D;  1V1C A;  1A0N B;  1Z7M A;  2F5K A;  2EQK A;  4AFS C;  3IKM B;  5C53 B;  5GAN 3;  1JB0 E;  4P75 A;  2ZPE B;  4PJO B;  2EQI A;  2IY5 A;  1VQL T;  1U1T A;  2JOY A;  2CIM A;  1UHC A;  3FJ5 A;  5ELO A;  4WTO B;  1I5L A;  1PKS A;  4GLM A;  1YJW T;  2PVD B;  2EYW A;  1YP5 A;  2M0O A;  4C92 D;  4GLK A;  4M77 E;  3PCO A;  2RK2 A;  3RGL A;  2O4X A;  1C6V X;  2Q5I A;  3G71 T;  3BY7 A;  2DE0 X;  1GRI A;  4B6M A;  4C8Q G;  1AEY A;  2KXC A;  3CCM Q;  4M75 E;  2WSF E;  3N5B B;  5KYW B;  1VQ7 T;  1SES A;  2NYS A;  1QCF A;  2QDY B;  2YLB A;  4CS3 A;  2PUK B;  3OBY A;  5FRN A;  1M1K R;  4ZNX A;  2FYK A;  5CK9 A;  3VQY A;  2JTF A;  5GAN d;  4A4K A;  3RNJ A;  3SWN C;  3OYE A;  4H2W A;  3SFM A;  5LJ3 e;  2ZPI B;  1R8O B;  9ATC B;  2E6N A;  5FLX E;  3LC0 A;  3URG A;  4MZP A;  3BW1 A;  3JV3 A;  1M1K U;  4M7A E;  3X28 B;  1QVG P;  1USY C;  2MWO A;  4NOY A;  3H0F A;  1RAD B;  2BZ8 A;  1NE8 A;  4QQG A;  4HCZ A;  1SSH A;  1HTT A;  1XTD A;  1QVF P;  2DIL A;  2D0N A;  4F7U A;  3MQZ A;  1MMG A;  2CP5 A;  1AT1 B;  1D1A A;  4ZTF A;  5AT1 B;  2V8I A;  2DYI A;  5FW9 A;  1BBW A;  1HK9 A;  4GBQ A;  1X55 A;  3D7S B;  3QO5 A;  2FO0 A;  4AT1 B;  2DL4 A;  3M9Q A;  2ART A;  1FX7 A;  2I4N A;  3OS2 A;  3JCM X;  4II1 A;  1BI0 A;  2L0A A;  1M5Q 1;  4JZ4 A;  2ZT6 A;  3CC7 Q;  4RTW A;  1R0C B;  4M78 D;  3A7A A;  2VGN A;  5GAM e;  2ED0 A;  1LVK A;  1ZSG A;  1D0X A;  5IN1 A;  4M77 B;  5FRM A;  1N6A A;  4XTU A;  2RHS B;  3SWN A;  3NMZ C;  2EKO A;  3HXU A;  2A36 A;  4KRT A;  2BE7 D;  3G1Z A;  2DD4 A;  1JJ2 A;  4KR2 A;  4AH6 A;  4M75 B;  5KYX A;  1YJ9 Q;  4NL2 A;  2AKW B;  2CZ7 B;  4WF2 A;  5KYU A;  2DIG A;  4YRG A;  1ABQ A;  1USY A;  2OTJ T;  2PNI A;  2LRQ A;  2G3R A;  2KMT A;  1SKU B;  3G6E A;  1K1Z A;  1UFF A;  3P8T A;  3EG9 A;  1VQM Q;  2K2V A;  4HT9 A;  5GAO q;  3M55 A;  2WAC A;  3EGD A;  5I2S A;  3TEG A;  4E7S A;  5GJV B;  1EVK A;  5A0L A;  4M7A B;  3L2Z A;  4R0K A;  2FRW A;  1YFS A;  4LDY A;  4G84 A;  1RLP C;  2HEQ A;  1SEM A;  5FU6 C;  1X6G A;  4BE1 A;  3CQT A;  4EMH A;  1B07 A;  2CT4 A;  3A32 A;  1QMC A;  3QG1 A;  4YRC A;  1KQS A;  3UH0 A;  1Y57 A;  2P0P A;  2QTV A;  2FL7 A;  3EHQ A;  3X25 B;  1YB3 A;  4JDS A;  2OAU A;  2L5Q A;  4DBQ A;  5IHK A;  1D0Z A;  2DJQ A;  1KHC A;  1I1J A;  2CJB A;  2O9V A;  3MCA B;  4JPB W;  3OYH A;  1GBR A;  2W10 A;  2CSQ A;  4C0G A;  2X3W D;  3UA6 A;  4QVZ A;  1AWW A;  3RAC A;  1EZZ B;  3MEV A;  2ZXF A;  1FXX A;  1VQ8 Q;  2K2M A;  4A4F A;  3TU4 K;  2ZIN A;  2DJZ A;  1K73 R;  3JCM f;  2GFA A;  4LUE A;  1YJW Q;  3EH2 A;  4EO4 A;  4ANJ A;  3NHN A;  3I56 T;  5IH2 A;  3NEN A;  4GY5 A;  2CH4 W;  3GNG A;  5DY9 A;  1VQN Q;  1K73 U;  3UAT A;  2PME A;  4LXC A;  2IVW A;  2C0O A;  2RQR A;  3OYB A;  4V2S A;  1QE0 A;  1K9M R;  2G4C A;  4JJB A;  4LNS A;  3L2U A;  2KYM A;  3CXC S;  5CKE A;  2MYS A;  1YIJ A;  2PU9 B;  1VQ6 Q;  4BWA A;  4HWO A;  4BUG A;  5FWB A;  2E12 A;  2KY9 A;  5D6W A;  1NEB A;  4FYV B;  1TXQ A;  1K9M U;  1PG5 B;  3JB9 H;  1AZG B;  2CUB A;  2K3B A;  3P8D A;  3RR6 A;  3G4S T;  4E7Z A;  1K8A R;  4IIO A;  5LJ5 g;  3HXV A;  2KBT A;  3CCM A;  3UF4 A;  5HCK A;  2E4H A;  1Q86 U;  5KNN A;  4HT8 A;  3CCJ A;  1M1G A;  2DK3 A;  1K8A U;  3HP9 A;  4FYX B;  4RCC A;  5GAN g;  2DNU A;  3CCU Q;  2CT3 A;  1KK7 A;  4D8D A;  2D0Q B;  3ME9 A;  4JS4 A;  1YCY A;  2JMC A;  3EFS A;  2COY A;  3UDC A;  3MEA A;  1WA7 A;  2I2L A;  3VS2 A;  2Q7H A;  2DL3 A;  1X6O A;  2A0F B;  3AT1 B;  1WLP B;  3QUI A;  4TQF A;  2HQX A;  3MO8 A;  4M7D D;  1WI7 A;  3PMT A;  4K88 A;  1WHL A;  5GMK e;  3RUX A;  1YJN A;  4EMG A;  4PJJ A;  4RUG A;  3LSQ A;  3V8K A;  1EOV A;  1VQ4 Q;  3VS4 A;  2EYQ A;  2HCK A;  1DJ7 B;  3PNW C;  2XDB A;  1G5I A;  1UGV A;  4LDX A;  2EJ9 A;  2W0Z A;  2XIC A;  2NS6 A;  5A0D A;  3JCM Q;  2V1Q A;  2LTO A;  4E7J A;  2DLP A;  2ABL A;  1MHN A;  2LCS A;  2DIQ A;  3G6E T;  1WXB A;  2JMA A;  3OYN A;  3VYG A;  1EIY A;  3QKJ A;  3MP8 A;  2VUB A;  2RK1 A;  1AWX A;  4JZ3 A;  1JJC B;  5HKC A;  3I5S A;  1UG1 A;  2DRM A;  3QO8 A;  2D9T A;  4M78 E;  4C92 G;  1X2Q A;  3LWH A;  5J39 A;  2BUD A;  5E3I A;  2J05 A;  2L3S A;  1KQ2 A;  1YJ9 A;  2CP3 A;  1W66 A;  3GLX A;  1M2V A;  1Y71 A;  2VWF A;  3THK A;  4N4G A;  2X4Y A;  4IIM A;  5KYY B;  3AHU A;  3ICA A;  1BI3 A;  1Z9Q A;  1VQM A;  4LNP A;  1OPL A;  2RNA A;  4KGV B;  2ZGW A;  1NYF A;  3IAL A;  2NUP A;  4E2F B;  3QDR B;  4LE9 A;  3NEM A;  2R57 A;  4BDY A;  2J3L A;  5LJ5 j;  3ERR A;  4L6V 5;  3UWN A;  3PIO A;  1G3S A;  3H0H A;  3OMC A;  4J6Y A;  1MGQ A;  4J9I A;  4QVC A;  4PJO F;  2DXT A;  5GAN j;  1G51 A;  3FC3 A;  3H9N A;  2QEX Q;  2LCC A;  2RHU A;  2ARS A;  1QW1 A;  5CO7 A;  2DYB A;  1PSE A;  1B34 A;  1M3C A;  2HSP A;  1NJI R;  3HKS A;  1FYN A;  2P0K A;  4YTL A;  4XK8 E;  3DSQ A;  3JB9 I;  4RTU A;  4YRK A;  1PWT A;  3A8M B;  4OMO A;  5GMK i;  4N4I A;  1KQS P;  3I7F A;  2AHJ B;  3NTH A;  2ZR3 A;  2RI3 A;  4CS4 A;  1IGU A;  3EH1 A;  1VQ8 A;  4PL6 A;  1C1A A;  3A1P A;  4P74 A;  1UGS B;  4DOW A;  1NJI U;  1YJW A;  3E1S A;  1QWE A;  2F5T X;  1MMD A;  2KRS A;  2RH2 A;  4F17 A;  3CXC A;  2YWW A;  4M78 G;  4M78 B;  2O2O A;  4Z8A A;  1Q95 G;  1WHM A;  1QQJ A;  2VYT A;  2XGT A;  4J9E A;  2PMF A;  2EL9 A;  2SEM A;  3G71 A;  4C5G A;  4C0F A;  1GL5 A;  3L4G A;  4LDV A;  1ARK A;  1VQN A;  2QGG A;  1M8V A;  3CCM T;  1G3T A;  3H8Z A;  3LH0 A;  5KYN A;  4P73 C;  1E1T A;  3M57 A;  2RA2 A;  2F2V A;  1SSF A;  3A31 A;  3PZC A;  3QYG B;  4CC4 B;  1UEC A;  5LJ3 f;  1TTH B;  1M1K C;  1UJY A;  2GQI A;  2XU8 A;  1VQ6 A;  2ZPG B;  4D8K A;  4IUR A;  3OYA A;  4YRF A;  3M53 A;  1WHH A;  2NLU A;  3JCM J;  1VQ9 Q;  1RIQ A;  1NM7 A;  3E9H A;  2D8H A;  4P72 C;  1OU9 A;  3L1A A;  4PLL A;  1W70 A;  4YCV A;  3TSZ A;  3H6Z A;  3VV0 A;  3CPF A;  2RJC A;  2I4M A;  3VRY A;  2J6F A;  4O6J A;  2KRN A;  1VIE A;  4C0D C;  5CR2 A;  3PTA A;  2RJD A;  2RJE A;  1UDL A;  4KH1 B;  4ZN3 A;  1NJ1 A;  3UGQ A;  2GTO A;  1GBQ A;  4M77 F;  2QYZ A;  1RAH B;  2A8E A;  3EGX B;  1XJW B;  4PFZ A;  3RKY A;  2SRC A;  2QHV A;  1BKB A;  4OP0 A;  5F5W A;  3VU3 C;  2O31 A;  4C5H A;  5GAM f;  4R55 A;  4RMO A;  3QDF A;  2YRD A;  4PJO C;  1E6H A;  1JBM A;  4M75 F;  3VUB A;  4P73 A;  3CC7 T;  2HDA A;  2CSI A;  1GXI E;  1E24 A;  1D0Y A;  3VKI A;  5GJW B;  2DZC A;  4OB2 B;  3DKM A;  3QWX X;  1K0S A;  4J6W A;  1VQ4 A;  3MEW A;  2ESW A;  1YCS B;  3OW2 P;  1YJ9 T;  4PFP A;  1D09 B;  1NZ9 A;  4PJM A;  4M7A F;  1WQW A;  2PUO B;  2EYY A;  1TUG B;  4RDX A;  4C8Q E;  2E6Z A;  4F14 A;  4YRL A;  3EGU A;  4CC3 A;  2DL5 A;  2GBQ A;  2ZIM A;  5GAN 4;  2KR3 A;  5GAN 8;  1OOT A;  1WJQ A;  2YDL A;  3HL8 A;  3RMS A;  3JCM d;  4E7I A;  1VQM T;  4IKF A;  5CKD A;  4XU3 A;  2L89 A;  2YHT A;  2VV5 A;  3HRT A;  2KDS A;  4YCW A;  1B70 A;  1JXM A;  1V29 B;  3MF2 A;  4XQ3 A;  4CH4 A;  1N5Z A;  3LWI A;  5CKB A;  4LUD A;  4F04 B;  1J3T A;  4DEX A;  2RQW A;  2KI7 A;  3A98 A;  3MP6 A;  2RO0 A;  3HFO A;  1M30 A;  3R07 A;  3INZ A;  1WDX A;  2M0Y A;  2HKN A;  1D3B B;  3REA B;  2XHC A;  4HVU A;  1NPP A;  3PFS A;  1OX9 A;  1BBZ A;  3EG2 A;  3V7C A;  3VQV A;  1S1N A;  5CQX A;  4PJO A;  2H3J A;  1CKB A;  8ATC B;  3LSS A;  2GNC A;  3FJP A;  4KGX B;  5I22 A;  4L87 A;  5ELN A;  4LVL A;  3VS7 A;  1KD1 U;  1WZO A;  1W2B S;  2CP2 A;  2V26 A;  4BI8 B;  2ROL A;  1UE9 A;  3LH5 A;  1Z9Z A;  4AG1 C;  5HGQ A;  4BD3 A;  4XTY A;  1KC8 R;  2GTJ A;  2YUQ A;  3JCM c;  2GQV A;  2M51 A;  2QQA A;  2V8K A;  5J26 A;  2RB6 A;  1VQ8 T;  4L5G A;  3RER A;  3BE3 A;  4J6X A;  5KYW A;  1NLO C;  1K73 C;  3BDL A;  3PT9 A;  2K9G A;  3A8G B;  1OPK A;  2J3M A;  5CKH A;  4M77 C;  1MMN A;  4M7D G;  2VKN A;  4HXJ A;  3I56 A;  2ZZG A;  2QEX A;  3I55 Q;  1NJ8 A;  1KC8 U;  1WX6 A;  5A2Q E;  1FMV A;  2RHQ B;  2KT8 A;  4P3N A;  2HL3 A;  3HPW A;  4AMC A;  3J80 E;  1VQN T;  4H2T A;  4EMK C;  4M75 C;  2V8J A;  3T9N A;  4C8Q B;  1E1O A;  3HFV A;  1BCM A;  4CS2 A;  1SER A;  5LJ5 h;  4HVV A;  2NUT B;  1K9M C;  3JSC A;  5FU7 B;  4F7U E;  4BY6 B;  2H3E B;  4YRI A;  1HSQ A;  1RAF B;  1WPY A;  1VQ6 T;  5A0G A;  1IRE B;  1WJR A;  1VQO Q;  4K86 A;  4XU2 A;  1E6G A;  2EQM A;  2PTK A;  3OQ5 A;  2LQK A;  3Q1J A;  5GAN h;  3QZ9 B;  5C0M A;  4QT7 A;  2I4O A;  3OS1 A;  2JUF A;  4M7A C;  2J7I A;  2DER A;  1S72 Q;  4FM4 B;  1LYL A;  1FYF A;  4CC7 A;  3G4S A;  1K8A C;  4X9D A;  1LOJ A;  4E6R A;  2FPE A;  2E65 A;  2QHS A;  2LT1 A;  3L2W A;  3VYH B;  5GAO p;  1PYS B;  2DBK A;  3MP1 A;  3RIR A;  1OZ3 A;  3NET A;  3QJY A;  4M77 A;  1WJS A;  3HXY A;  4WCI A;  4ME7 A;  3CCR Q;  4FIB A;  3MKD A;  1ATI A;  3CCU T;  4RTZ A;  4KUD K;  2MAM A;  4OMM A;  4EMK A;  4M75 A;  4D6W A;  2AKW A;  2FZG B;  4MDW A;  4HA8 A;  3L2V A;  3I9Q A;  3JB9 G;  3IG2 A;  1GCP A;  1GCQ C;  1YIT Q;  3WVD B;  2K7A A;  4H2S A;  2AKK A;  1ZA1 B;  3CPW S;  3BDU A;  4XTW A;  4KT0 E;  3CCQ Q;  2ZZD A;  1U5S A;  2DA9 A;  3CCL Q;  4PG3 A;  2LCL A;  4J5Y A;  2YRV A;  5IT9 E;  2EJF A;  4PLI A;  3CCV Q;  1VQ4 T;  4JJC A;  4OF1 A;  1ADJ A;  3OYY A;  5GAN 6;  3QXE B;  2DTO A;  2F2X A;  2ALY B;  4M7A A;  2H8H A;  4LDW A;  1WLE A;  3HFZ B;  2L3Q A;  5GAN 5;  3L2Q A;  4F7U G;  4F7U B;  1I81 A;  4XTX A;  3ZBD A;  3QII A;  3CCE Q;  2RN8 A;  2OJ2 A;  3CBP A;  4MZT A;  2ZAE A;  1NBE B;  3HRI A;  1X75 C;  1LPL A;  4HWP A;  1KIK A;  2DXU A;  3A7R A;  1LCK A;  3M4Y A;  4FW1 A;  3P8Y A;  4J9D A;  4DEY A;  2ZCE A;  3FRN A;  3ZL7 C;  3C12 A;  3E19 A;  3FIF A;  4HWS A;  2VVK A;  1IXD A;  2KRM A;  5L8R E;  4CI0 C;  2DBM A;  1ZUU A;  2XMF A;  4IUQ A;  2YUO A;  4CC2 A;  3JAM E;  1Q81 R;  2R5A A;  4KGZ B;  3OYC A;  3EFO A;  1GCQ A;  2X4J A;  4X34 A;  2FZC B;  4RCB A;  2IIM A;  4QKU A;  4JJD A;  2QQB A;  4H2Y A;  1H4V B;  1ZA2 B;  1VOM A;  2ZPH B;  4VUB A;  2CP6 A;  1KMN A;  3WQZ A;  2PVO B;  4JRQ A;  1KG1 A;  1Q81 U;  2G6F X;  2QG9 B;  1W2B A;  2IG0 A;  1X2G A;  1WYX A;  4LN2 A;  4OMQ A;  4H2X A;  2EIF A;  2XKO C;  3A5Z B;  2YT6 A;  1RAG B;  2BKD N;  1Q7Y R;  2O9S A;  5LJ3 d;  1KSW A;  1WXT A;  3CMA Q;  2QEX T;  2EGE A;  2MI6 A;  4Z89 A;  1NJ5 A;  2LC4 A;  4ZGJ B;  4TWA A;  4IUV A;  1UEB A;  2XD0 A;  2HL5 C;  4M78 F;  4QW2 A;  2C7I A;  1C0A A;  3IKL A;  1HXD A;  2KE9 A;  2LVM A;  3PVL A;  2CP7 A;  1GGM A;  1Q7Y U;  2ZZE A;  1VA7 A;  3E9I A;  5GAO l;  2R58 A;  1RAC B;  1ZBX A;  3KFV A;  1OYX A;  3G7Z A;  1YHQ Q;  4UP9 A;  5CIU A;  3OYK A;  1EVL A;  4OML A;  3X20 B;  4ZTU B;  1QVG S;  4BAC A;  1Q86 R;  2JTM A;  3I55 A;  2PQW A;  1G5H A;  4TVA B;  3LYI A;  4JRI A;  5GMK m;  5KCH A;  2EQU A;  4C92 E;  1H3H A;  1SRY A;  4OGE A;  4XTZ A;  1L0W A;  4RG2 A;  2VXE A;  1OV3 A;  5GAM d;  4FU6 A;  1BBU A;  2FG0 A;  5M9O A;  1W1F A;  1VQO A;  4JJN K;  1BIA A;  2DXC A;  2A37 A;  2DVJ A;  3CBO A;  2EGC A;  2MOX A;  4YRS A;  1VQ9 T;  4J9H A;  4O2D A;  3DLM A;  2OTL Q;  1G3Y A;  4J9B A;  1WHG A;  1S72 A;  1K4U S;  3V7R A;  2DDZ A;  2M16 A;  4YRN A;  3HHT B;  1C0M A;  4XTV A;  5I2M A;  1BIB A;  1Y7X A;  1EQR A;  3WXM B;  4PJO D;  3CPW A;  2KQW A;  4TTV A;  2ZZF A;  2QDL A;  3JCM b;  4RG8 A;  3CCR A;  3HTZ A;  4DBH A;  1WHK A;  2HZY A;  1NJ2 A;  3EHR A;  2QHT A;  2E64 A;  1QLY A;  2HAX A;  1AHJ B;  2QAZ A;  1PSF A;  3JCM W;  1OX8 A;  2ATC B;  5IHN A;  1K0X A;  3LX7 A;  3QWY A;  2CDT A;  4Z88 A;  3CC7 A;  1ZSZ B;  3M4P A;  4RTX A;  4LDU A;  1E22 A;  2MIO A;  3O8V A;  1YIT A;  5C6S A;  3A5Y A;  2AK5 A;  1XOV A;  5KYY A;  2D1X A;  2XTI A;  3R6O A;  3REB B;  2KAF A;  3CCQ A;  4X5O A;  3GF5 A;  1X01 A;  4O5V A;  3TEH A;  4C92 B;  1NNH A;  3CCV A;  3VS0 A;  4HCK A;  1N9R A;  3C0C A;  5FRO A;  3TQ7 P;  2EBP A;  1Z7N A;  3HXX A;  1RAB B;  1YFT A;  1FWZ A;  4J9G A;  3C94 A;  2FPF A;  3CCE A;  3UPU A;  1TWB A;  3OBW A;  2QQS A;  1SHF A;  2RI5 A;  3RMQ A;  3TVT A;  2LX7 A;  2Q5H A;  4J9F A;  3OA6 A;  1IL2 A;  2HQH A;  4OVA A;  2DL8 A;  2ODR D;  1JJ2 P;  1NEG A;  2CUD A;  3PIP A;  2FHD A;  3ULR B;  2BZY A;  4YDQ A;  2XK0 A;  2RHZ A;  3OY9 A;  3JB9 D;  4A4G A;  1IZ6 A;  3M0T A;  2ECZ A;  4BDZ A;  1VQK Q;  2FPD A;  2XID A;  3RKW A;  4BE2 A;  2A7Y A;  2DKG A;  3IQL A;  1U06 A;  2DZ9 A;  1IGQ A;  5C52 B;  3R6N A;  1PRM C;  4H02 A;  2I4L A;  4BW9 A;  1Y96 B;  1M2V B;  2B8A A;  2COZ A;  1WHJ A;  1MUZ A;  4M77 D;  4RQE A;  3KUF A;  4JS5 A;  2LJ3 A;  4HKE A;  2A3L A;  1KC8 C;  1PC0 A;  4C8Q F;  2LJ1 A;  1BYM A;  4Y28 E;  3QJ6 A;  4M75 D;  4XU1 A;  1JO8 A;  2MK5 A;  1NYR A;  2COW A;  2AMC A;  4MZM A;  2VB6 A;  2C0I A;  1I5O B;  4Q15 A;  2K4Y A;  3GBQ A;  3I55 T;  7AT1 B;  5LJ3 g;  4LVJ A;  1PRL C;  2LT4 A;  3VRZ A;  4A54 A;  1QVG A;  1SRM A;  1JQQ A;  1IHV A;  4RKU E;  1B7Y B;  5D6X A;  2F2W A;  3L2R A;  2R5M A;  1NLP C;  4ELZ C;  2HD0 A;  1RLQ C;  4KBM B;  1VIF A;  1QKX A;  1VQO T;  2X4X A;  4J7F A;  2HSE B;  4AFU C;  4UP7 A;  3QZ5 B;  1YHQ A;  1HD3 A;  4WJ4 A;  1HC7 A;  3UGT A;  4CH3 A;  4OB0 B;  3VQW A;  3M5A A;  2XI9 A;  4PJL A;  3VJP A;  2E5A A;  4RTV A;  1JRI A;  3EGX A;  3ZFJ A;  1S72 T;  1MNE A;  2RD1 A;  4JLI A;  3C4S A;  1UGP B;  4C5E A;  4FT2 A;  3OS0 A;  4MML A;  4KUI A;  2NWM A;  2KYB A;  1AVZ C;  3EG3 A;  4A4H A;  2RF0 A;  1KMM A;  1KOG A;  1H92 A;  3MF1 A;  5GAM g;  4JUV A;  5GAO m;  3RKX A;  4FYY B;  2EYZ A;  1VYV A;  2LNH B;  4ZGD B;  1YNZ A;  3GIB A;  2QK0 A;  5LJ5 e;  1U8R A;  2AKL A;  2AIR B;  2YXY A;  3CCR T;  3PVQ A;  3CCU A;  2JJ9 A;  1I4K 1;  4IUT A;  3CC2 Q;  1LNX A;  2PZ1 A;  3RDV A;  3J7A F;  2DX1 A;  4TVY A;  1T0H A;  1T3S A;  4ZGE B;  2QQR A;  1ZUK A;  5GAN e;  3E9G A;  2X9H A;  1YIT T;  4A63 B;  4F7U F;  3NEL A;  2KGT A;  1FMK A;  1Q82 R;  1X56 A;  1G2B A;  3CCQ T;  1VQ5 Q;  3QTC A;  1H4Q A;  3CCL T;  1LJO A;  1ZBJ A;  4M7D E;  1MV0 B;  3CCV T;  2HBP A;  3WVE B;  5K1X A;  1TU0 B;  4J15 A;  5KE2 A;  5ECA A;  2A08 A;  4C8Q C;  4C0Z A;  4P72 A;  1YGB A;  1Q82 U;  1YWO A;  3CMQ A;  5IAY A;  1N8R R;  3REX A;  4NS5 A;  3CCE T;  2LQ8 A;  1M3A A;  4YRJ A;  5FU7 C;  3VS1 A;  2DF6 A;  4BY6 C;  2FB7 A;  4EPC A;  2E3I A;  4KR3 A;  2E70 A;  2IPO B;  3QO3 A;  4JRP A;  3O5Z A;  5LJ3 j;  1G8X A;  3NTI A;  2JNG A;  1N8R U;  3GOX A;  1YI2 Q;  4Y91 A;  1AWJ A;  2KK4 A;  3KBG A;  3QNE A;  2KXD A;  1KD1 R;  4WI1 A;  3A8H B;  1TH7 A;  3CEY A;  3NGP A;  3SB2 A;  2LQW A;  4K87 A;  4JLG A;  1Q81 C;  1OEB A;  1KQ1 A;  1QKW A;  2BZX A;  1M4Z A;  2L2P A;  2LP5 A;  1BI1 A;  1PD1 A;  4J9C A;  1AOJ A;  1BI2 A;  5HK3 A;  5GMK l;  2QTX A;  1WNL A;  3GP8 A;  3A74 A;  1KQS S;  2ZCF B;  2K3X A;  1VQZ A;  4B9X A;  2HMA A;  1TUC A;  1M90 R;  2Q7E A;  1H64 1;  3JB9 J;  3G1J A;  4YRO A;  4C8Q A;  2JS0 A;  2MWP A;  3VS6 A;  4FL6 A;  4KUL A;  3GPL A;  4K11 A;  5GAO r;  2NUT A;  2DU7 A;  5GAM j;  1OI1 A;  4C5I A;  1VQK A;  4YRT A;  1U1S A;  4M4Z A;  3CD6 Q;  2RM4 A;  1ADY A;  4P5N A;  4RMF A;  1Q7Y C;  1M90 U;  2RQU A;  3VUZ A;  4M7D B;  3TSW A;  2MPX C;  4N4H A;  4FW2 A;  3CMA T;  1H8K A;  3OYI A;  5GAN 7;  4E51 A;  4P3P A;  4PJO G;  4H2V A;  1G5V A;  3F70 A;  1UUE A;  2CRE A;  2RJF A;  1YIJ Q;  1B3Q A;  2XDD A;  2QA4 Q;  2EAY A;  1SHG A;  3EG0 A;  3CME Q;  2KRO A;  5HY6 A;  3HXZ A;  1I0C A;  2DRK A;  3I5R A;  3GNF B;  4FSX A;  3MJX A;  2K6D A;  1X69 A;  1BK2 A;  5AYF A;  3OYM A;  2RHX A;  2VC8 A;  4H2U A;  1MMA A;  3M56 A;  1YHQ T;  1Y0M A;  1PYS A;  5LJ5 d;  1M9S A;  2X51 A;  4J8O A;  4DA4 A;  2IY5 B;  5KE3 A;  2P4T A;  1Q86 C;  4A53 A;  4PK4 A;  3RBB B;  4Q6G A;  4E7K A;  2GGR A;  3DLL A;  2YSQ A;  4XU0 A;  3CCJ Q;  4EDU A;  1M8M A;  4X9C A;  3PCO B;  2QAS A;  2O4X B;  1CSK A;  4TVW A;  2JTE A;  2K5F A;  3CXC P;  4YYE A;  1QVP A;  5CCA A;  1CKA A;  2DTH A;  1M1F A;  2ZT5 A;  4HCB A;  3CBM A;  2OAW A;  2J06 A;  1GFC A;  2O01 E;  2RHS A;  3CC4 Q;  4QQ6 A;  4TVR A;  4P71 C;  2VXF A;  2P0Q A;  4ZIB A;  2Y4X A;  1VQP Q;  1MND A;  1WIE A;  1RAE B;  5IXF A;  1VQ9 A;  1W6X A;  3OMG A;  2OTL T;  1B8A A;  2ALY A;  2CZ1 B;  5C51 B;  5GAO n;  3HFZ A;  2BTT A;  1YJN Q;  2VAS A;  4G85 A;  5CQY A;  4LD9 K;  2AT1 B;  5KCO A;  1OQK A;  3KFU A;  2RQT A;  1ASZ A;  2JZ2 A;  4MMK A;  4J7I A;  3OW2 S;  3SD4 A;  3X26 B;  3SEM A;  1AD5 A;  1X43 A;  2ZT7 A;  1QP3 A;  2CZ6 B;  1TG0 A;  2EW3 A;  4PHC A;  2DXB A;  2EPD A;  4C92 F;  3CC2 A;  2DTI A;  2HKQ B;  4M77 G;  5LL6 S;  2K57 A;  4HT4 A;  3S3M A;  5I21 A;  1D1B A;  2ZNI A;  2CZ0 B;  2P4R A;  1R0B G;  3VQX A;  1T3L A;  4P3O A;  4YRM A;  2OX7 A;  1NG2 A;  4EMK B;  2D8J A;  4ZN1 A;  4M75 G;  1VQ5 A;  4AG2 C;  4IUP A;  2MMP A;  1N9S A;  4P71 A;  3OYG A;  1NJ6 A;  1VYU A;  3REU A;  3I35 A;  3CCS Q;  2V1R A;  2CJA A;  1JEG A;  3SWN B;  2KVQ G;  2ZNJ A;  5L23 A;  4ZTJ A;  8AT1 B;  1UGR B;  3A5Z A;  3QSU A;  1NPR A;  2GCX A;  4M7A G;  5KYX B;  2DMO A;  1YWP A;  2I0N A;  5KYU B;  3S3O A;  4ELY C;  1X2K A;  3A8O B;  3ER0 A;  3JCM g;  3A7U A;  2Y4Y A;  4HWT A; 
#chains in the Genus database with same CATH homology
 3JCM P;  1YI2 A;  2L8D A;  2CYZ B;  4RQF A;  1VQK T;  2ZT8 A;  4E47 A;  5GMK j;  4ATO A;  4R56 A;  4KQE A;  3V8L A;  5DLO A;  2L3R A;  3P8V A;  1NYQ A;  5LJ3 h;  2GFU A;  3RL6 A;  1NJI C;  1OZ2 A;  4EX5 A;  2RI2 A;  4TVA A;  1X2H A;  3W3S A;  2ZPF B;  2EWN A;  4WJ3 M;  4TQD A;  4YRP A;  2LDM A;  3FLG A;  1WU7 A;  2QXF A;  2CJ9 A;  3OSS C;  3NFC A;  3M4G A;  3OSV A;  1H4T A;  2HNI A;  3CD6 A;  4YCU A;  4H2X B;  4BI3 A;  3EFR A;  3QHS A;  4C92 C;  2HQE A;  3OS5 A;  3TRE A;  3L42 A;  1QVF S;  2QA4 A;  2JVV A;  3CME A;  2XG8 D;  1XQH A;  1ASY A;  3QYH B;  5GAM h;  3M58 A;  1O75 A;  4CRI A;  2DD5 A;  4OGC A;  3VBB A;  3HRU A;  2EJG A;  5FU6 B;  3HRS A;  4BB7 A;  3M4Q A;  2ZR2 A;  3ZEH A;  1X54 A;  1N9W A;  3TUP A;  3HFN A;  4N0A C;  5LJ5 f;  1N27 A;  3HRK A;  2DQ0 A;  2GF7 A;  2ZTG A;  5CKF A;  3PMI A;  3FDR A;  3BJU A;  4JRK A;  1JJC A;  2EFI A;  4OB3 B;  3CC4 A;  3OW2 A;  4C92 A;  1VQP A;  5GAN f;  3CC2 T;  3BFM A;  4Z02 A;  5DLQ E;  2E3C A;  3X24 B;  2CKK A;  2P0L A;  4UPA A;  4C8Q D;  1Q82 C;  2RHI A;  4M78 C;  1VQ5 T;  2QI2 A;  4IUU A;  3CCL A;  1RI0 A;  2C8M A;  2F69 A;  2DQ3 A;  4HWR A;  4L59 A;  2DVE A;  2RHY A;  2EQJ A;  2WSC E;  1WQ7 A;  4E7L A;  3QPH A;  1N8R C;  2YLC A;  2ARU A;  4BI4 A;  4A4E A;  4E7H A;  4OB1 B;  1XNI A;  4N0A A;  1W4S A;  3UT1 A;  12AS A;  5CAI A;  3MEU A;  1EIY B;  1Y96 A;  3HSB A;  1H4S A;  1VUB A;  1YI2 T;  3FB9 A;  1QP2 A;  4P74 C;  3HY1 A;  1G3W A;  1KD1 C;  3CCS A;  2CGH A;  4HCC A;  2VGM A;  4XAX B;  2Q7G A;  4XEM A;  3P8H A;  3HXW A;  3TEH B;  3M54 A;  2C06 A;  3OD1 A;  2ZPB B;  4OMF B;  4M78 A;  3MHX A;  3DB4 A;  3ASK A;  5K1P A;  3J81 E;  4M7D F;  2WSE E;  2DPP B;  1M90 C;  3V8J A;  3FEO A;  5J3B A;  4LD6 A;  2M1H A;  3C95 A;  2KSS A;  1B7Y A;  3JCM e;  2E41 A;  1UB4 A;  2FVU A;  3CD6 T;  1RL2 A;  2K3Y A;  4FT4 A;  3CMA A;  3LGL A;  3V7S A;  3KXT A;  1VQL A;  2Y90 A;  1YIJ T;  4YRR A;  3QBY A;  2QA4 T;  4Q5W A;  3CME T;  4J83 A;  2QHU A;  1YBY A;  2CS7 A;  3OYF A;  4M7A D;  5KH6 A;  3DB3 A;  1B34 B;  4XEO A;  1QVF A;  3S3N A;  5DM7 R;  2DO3 A;  3LW5 E;  5EG2 A;  4NL3 A;  5GMK h;  4QVD A;  2BIV A;  3RF1 A;  3OB9 A;  4DOV A;  4UC4 A;  2K5I A;  1VQ7 A;  3PGG A;  1H3Z A;  4YRQ A;  4YPF A;  1B76 A;  3RES A;  3CCJ T;  2AMC B;  4UP8 A;  1J5W A;  4PNO A;  5GAN 2;  3JCM V;  3L4G B;  3JB9 F;  4LVI A;  3LGF A;  3NTK A;  4DQ2 A;  3CC4 T;  4DPG A;  3E9F A;  3JRZ A;  1VQP T;  4YRE A;  4OLF A;  1EFW A;  3OYL A;  2OTL A;  5D6Y A;  4LVK A;  3HY0 A;  4NCX A;  1YJN T;  4LVM A;  2QQ9 A;  3TCJ A;  2DEQ A;  1WGS A;  3A8L B;  1SET A;  4CH5 A;  4M7D C;  2MF2 A;  1YFR A;  1ZQ1 A;  4B9W A;  2P5I A;  2LX9 A;  2X4W A;  4PJO E;  1D3B A;  3P8B B;  4BE0 A;  1KHI A;  1JJ2 S;  4HVC A;  1O9S A;  5HK0 A;  3MET A;  1Y07 A;  4ZTZ B;  3M59 A;  1QF6 A;  2X35 A;  4QQD A;  3JCM h;  4P75 C;  11AS A;  2D6F A;  4YP0 A;  1ZHI A;  5CVI A;  2DAQ A;  2PVG B;  3LLR A;  4PKC C;  2OTJ A;  2E10 A;  3CCS T;  3UFG A;  2E1H A;  3MEY A;  1WYD A;  1P92 A;  2DU5 A;  4CH6 A;  2M9U A;  2E5Q A;  2K5L A;  1I8F A;  3QO7 A;  4M7D A;  2ZIO A;  3SDZ A;  2RHQ A;  3EAE A;  3S6W A;  2ODR C;  2XDP A;  2LNV A;  1EIF A;  2JN0 A;  4C0D B;  4MDX A;  3OYJ A;  1UGQ B;  1B70 B;  3TEE A;  3OYD A;  1Z7M A;  2F5K A;  2EQK A;  3IKM B;  5C53 B;  5GAN 3;  1JB0 E;  4P75 A;  2ZPE B;  4PJO B;  2IY5 A;  1VQL T;  1U1T A;  2JOY A;  2CIM A;  5ELO A;  1I5L A;  1YJW T;  2PVD B;  4C92 D;  2M0O A;  4GLK A;  4M77 E;  3PCO A;  2RK2 A;  3RGL A;  2O4X A;  2Q5I A;  3G71 T;  3BY7 A;  4C8Q G;  4M75 E;  2WSF E;  3N5B B;  1VQ7 T;  1SES A;  2QDY B;  2YLB A;  4CS3 A;  2PUK B;  3OBY A;  5FRN A;  2FYK A;  5CK9 A;  3VQY A;  2JTF A;  5GAN d;  4A4K A;  3SWN C;  3OYE A;  4H2W A;  3SFM A;  5LJ3 e;  2ZPI B;  1R8O B;  2E6N A;  5FLX E;  3LC0 A;  3URG A;  4MZP A;  3BW1 A;  1M1K U;  4M7A E;  3X28 B;  1USY C;  2MWO A;  4NOY A;  4QQG A;  1NE8 A;  4HCZ A;  1HTT A;  1XTD A;  4F7U A;  3MQZ A;  4ZTF A;  2V8I A;  1BBW A;  1HK9 A;  1X55 A;  3QO5 A;  3M9Q A;  2ART A;  1FX7 A;  2I4N A;  3OS2 A;  3JCM X;  4II1 A;  1BI0 A;  1M5Q 1;  2ZT6 A;  4M78 D;  3A7A A;  2VGN A;  5GAM e;  5IN1 A;  4M77 B;  5FRM A;  1N6A A;  4XTU A;  2RHS B;  3SWN A;  2EKO A;  3HXU A;  3G1Z A;  2DD4 A;  1JJ2 A;  4KR2 A;  4AH6 A;  4M75 B;  4NL2 A;  2AKW B;  2CZ7 B;  4WF2 A;  2DIG A;  4YRG A;  1USY A;  2OTJ T;  2LRQ A;  2G3R A;  2KMT A;  3G6E A;  3P8T A;  2K2V A;  4HT9 A;  5GAO q;  3M55 A;  2WAC A;  5I2S A;  3TEG A;  1EVK A;  5A0L A;  4M7A B;  3L2Z A;  1YFS A;  4LDY A;  4G84 A;  5FU6 C;  4BE1 A;  4EMH A;  3A32 A;  3QG1 A;  4YRC A;  1KQS A;  3UH0 A;  2P0P A;  2FL7 A;  3X25 B;  1YB3 A;  2OAU A;  4JDS A;  2L5Q A;  1KHC A;  2CJB A;  3MCA B;  3OYH A;  4C0G A;  4QVZ A;  3RAC A;  3MEV A;  2ZXF A;  1FXX A;  4A4F A;  3TU4 K;  2ZIN A;  2DJZ A;  3JCM f;  2GFA A;  4EO4 A;  3I56 T;  3NEN A;  4GY5 A;  3GNG A;  5DY9 A;  1K73 U;  2PME A;  2IVW A;  3OYB A;  4V2S A;  1QE0 A;  2G4C A;  4LNS A;  3L2U A;  3CXC S;  5CKE A;  1YIJ A;  2PU9 B;  4BWA A;  4HWO A;  4BUG A;  2E12 A;  2KY9 A;  5D6W A;  1K9M U;  3JB9 H;  3P8D A;  3G4S T;  5LJ5 g;  3HXV A;  3CCM A;  1Q86 U;  5KNN A;  4HT8 A;  3CCJ A;  1M1G A;  2DK3 A;  1K8A U;  3HP9 A;  4RCC A;  5GAN g;  2D0Q B;  3ME9 A;  4JS4 A;  1YCY A;  3EFS A;  3UDC A;  3MEA A;  2I2L A;  2Q7H A;  1X6O A;  3QUI A;  4TQF A;  2HQX A;  3MO8 A;  4M7D D;  3PMT A;  4K88 A;  5GMK e;  3RUX A;  1YJN A;  4EMG A;  3LSQ A;  3V8K A;  1EOV A;  2EYQ A;  1DJ7 B;  3PNW C;  2XDB A;  1G5I A;  4LDX A;  2EJ9 A;  2XIC A;  2NS6 A;  5A0D A;  3JCM Q;  2LTO A;  4E7J A;  1MHN A;  2DIQ A;  3G6E T;  3OYN A;  3VYG A;  1EIY A;  3QKJ A;  3MP8 A;  2VUB A;  2RK1 A;  1JJC B;  5HKC A;  3QO8 A;  2D9T A;  4M78 E;  4C92 G;  3LWH A;  5J39 A;  2BUD A;  5E3I A;  1KQ2 A;  1YJ9 A;  1W66 A;  3GLX A;  1Y71 A;  4N4G A;  2X4Y A;  3AHU A;  3ICA A;  1BI3 A;  1VQM A;  2ZGW A;  3IAL A;  3QDR B;  3NEM A;  2R57 A;  4BDY A;  2J3L A;  5LJ5 j;  3ERR A;  4L6V 5;  3UWN A;  3PIO A;  1G3S A;  3OMC A;  4J6Y A;  1MGQ A;  4QVC A;  4PJO F;  2DXT A;  5GAN j;  1G51 A;  3FC3 A;  2LCC A;  2RHU A;  2ARS A;  1QW1 A;  5CO7 A;  1PSE A;  1B34 A;  3HKS A;  2P0K A;  4YTL A;  4XK8 E;  3DSQ A;  3JB9 I;  4YRK A;  3A8M B;  5GMK i;  4N4I A;  3I7F A;  2AHJ B;  3NTH A;  2ZR3 A;  2RI3 A;  4CS4 A;  1VQ8 A;  4PL6 A;  4P74 A;  1UGS B;  4DOW A;  1NJI U;  1YJW A;  3E1S A;  2F5T X;  2RH2 A;  3CXC A;  4M78 G;  4M78 B;  2VYT A;  2XGT A;  2PMF A;  2EL9 A;  3G71 A;  4C5G A;  4C0F A;  3L4G A;  4LDV A;  1VQN A;  1M8V A;  3CCM T;  1G3T A;  3H8Z A;  3LH0 A;  4P73 C;  1E1T A;  3M57 A;  2RA2 A;  1SSF A;  3A31 A;  3PZC A;  3QYG B;  5LJ3 f;  1M1K C;  2XU8 A;  1VQ6 A;  2ZPG B;  4IUR A;  3OYA A;  4YRF A;  3M53 A;  2NLU A;  3JCM J;  1RIQ A;  3E9H A;  4P72 C;  3L1A A;  4PLL A;  4YCV A;  3H6Z A;  3VV0 A;  3CPF A;  2RJC A;  2I4M A;  4O6J A;  1VIE A;  4C0D C;  5CR2 A;  3PTA A;  2RJD A;  2RJE A;  4ZN3 A;  1NJ1 A;  3UGQ A;  4M77 F;  2A8E A;  3RKY A;  2QHV A;  1BKB A;  4OP0 A;  5F5W A;  3VU3 C;  4C5H A;  5GAM f;  4R55 A;  4RMO A;  4PJO C;  1JBM A;  4M75 F;  3VUB A;  4P73 A;  3CC7 T;  1GXI E;  1E24 A;  3VKI A;  2DZC A;  4OB2 B;  3DKM A;  4J6W A;  1VQ4 A;  3MEW A;  1YJ9 T;  1NZ9 A;  4M7A F;  1WQW A;  2PUO B;  4RDX A;  4C8Q E;  2E6Z A;  4YRL A;  2ZIM A;  5GAN 4;  5GAN 8;  1VQM T;  1WJQ A;  3HL8 A;  3RMS A;  4E7I A;  3JCM d;  4IKF A;  5CKD A;  4XU3 A;  2L89 A;  2YHT A;  2VV5 A;  3HRT A;  2KDS A;  4YCW A;  1B70 A;  1V29 B;  3MF2 A;  4XQ3 A;  4CH4 A;  3LWI A;  5CKB A;  3MP6 A;  2RO0 A;  3HFO A;  3R07 A;  3INZ A;  1D3B B;  2XHC A;  1NPP A;  3PFS A;  3V7C A;  3VQV A;  5CQX A;  4PJO A;  2H3J A;  3LSS A;  3FJP A;  4L87 A;  5ELN A;  4LVL A;  1KD1 U;  1W2B S;  4BI8 B;  5HGQ A;  4BD3 A;  4XTY A;  3JCM c;  2GQV A;  2QQA A;  2V8K A;  5J26 A;  2RB6 A;  1VQ8 T;  4L5G A;  3RER A;  4J6X A;  1K73 C;  3BDL A;  3PT9 A;  3A8G B;  2J3M A;  5CKH A;  4M77 C;  4M7D G;  2ZZG A;  3I56 A;  2QEX A;  1NJ8 A;  1KC8 U;  5A2Q E;  2RHQ B;  4P3N A;  3HPW A;  3J80 E;  1VQN T;  4H2T A;  4EMK C;  4M75 C;  2V8J A;  3T9N A;  4C8Q B;  1E1O A;  3HFV A;  4CS2 A;  1SER A;  5LJ5 h;  1K9M C;  3JSC A;  5FU7 B;  4F7U E;  4BY6 B;  4YRI A;  1WPY A;  1VQ6 T;  5A0G A;  1IRE B;  1WJR A;  4K86 A;  4XU2 A;  2EQM A;  3OQ5 A;  2LQK A;  3Q1J A;  5GAN h;  3QZ9 B;  5C0M A;  2I4O A;  3OS1 A;  2JUF A;  4M7A C;  4FM4 B;  1LYL A;  1FYF A;  3G4S A;  1K8A C;  4X9D A;  1LOJ A;  2E65 A;  2QHS A;  2LT1 A;  3L2W A;  3VYH B;  5GAO p;  1PYS B;  3MP1 A;  3RIR A;  1OZ3 A;  3NET A;  3QJY A;  4M77 A;  1WJS A;  3HXY A;  4ME7 A;  4FIB A;  1ATI A;  3CCU T;  4KUD K;  2MAM A;  4EMK A;  4M75 A;  4D6W A;  2AKW A;  4MDW A;  4HA8 A;  3L2V A;  3JB9 G;  3IG2 A;  3WVD B;  4H2S A;  3CPW S;  3BDU A;  4XTW A;  4KT0 E;  2ZZD A;  4PG3 A;  2LCL A;  4J5Y A;  2YRV A;  5IT9 E;  2EJF A;  4PLI A;  1VQ4 T;  1ADJ A;  4OF1 A;  3OYY A;  5GAN 6;  3QXE B;  2DTO A;  2ALY B;  4M7A A;  4LDW A;  1WLE A;  3HFZ B;  5GAN 5;  3L2Q A;  4F7U G;  4F7U B;  1I81 A;  4XTX A;  3ZBD A;  3QII A;  3CBP A;  4MZT A;  3HRI A;  1X75 C;  4HWP A;  2DXU A;  3A7R A;  3M4Y A;  3P8Y A;  2ZCE A;  3FRN A;  3C12 A;  3E19 A;  3FIF A;  4HWS A;  5L8R E;  4CI0 C;  4IUQ A;  3JAM E;  2R5A A;  3OYC A;  2X4J A;  4X34 A;  4RCB A;  2QQB A;  4H2Y A;  1H4V B;  2ZPH B;  4VUB A;  1KMN A;  3WQZ A;  2PVO B;  4JRQ A;  1KG1 A;  1Q81 U;  1W2B A;  2IG0 A;  1X2G A;  4H2X A;  2EIF A;  2XKO C;  3A5Z B;  2BKD N;  5LJ3 d;  2QEX T;  2MI6 A;  1NJ5 A;  2LC4 A;  4ZGJ B;  4TWA A;  4IUV A;  1UEB A;  2XD0 A;  4M78 F;  4QW2 A;  2C7I A;  1C0A A;  3IKL A;  1HXD A;  2LVM A;  1GGM A;  1Q7Y U;  2ZZE A;  3E9I A;  5GAO l;  2R58 A;  1ZBX A;  1OYX A;  3G7Z A;  4UP9 A;  5CIU A;  3OYK A;  1EVL A;  4ZTU B;  3X20 B;  1QVG S;  4BAC A;  2JTM A;  3I55 A;  2PQW A;  1G5H A;  4TVA B;  3LYI A;  4JRI A;  5GMK m;  5KCH A;  2EQU A;  4C92 E;  1SRY A;  4OGE A;  4XTZ A;  1L0W A;  4RG2 A;  2VXE A;  5GAM d;  4FU6 A;  1BBU A;  5M9O A;  1VQO A;  4JJN K;  1BIA A;  2DXC A;  3CBO A;  4YRS A;  1VQ9 T;  4O2D A;  3DLM A;  1G3Y A;  1S72 A;  3V7R A;  2DDZ A;  2M16 A;  4YRN A;  3HHT B;  4XTV A;  5I2M A;  1BIB A;  1Y7X A;  1EQR A;  3WXM B;  4PJO D;  3CPW A;  2KQW A;  4TTV A;  2ZZF A;  3JCM b;  4RG8 A;  3CCR A;  3HTZ A;  1NJ2 A;  2QHT A;  2E64 A;  2HAX A;  1AHJ B;  3JCM W;  1PSF A;  3LX7 A;  3CC7 A;  3M4P A;  4LDU A;  1E22 A;  1YIT A;  3O8V A;  5C6S A;  3A5Y A;  1XOV A;  2XTI A;  3R6O A;  2KAF A;  3CCQ A;  4X5O A;  3GF5 A;  1X01 A;  4O5V A;  3TEH A;  4C92 B;  1NNH A;  3CCV A;  1N9R A;  5FRO A;  1Z7N A;  3HXX A;  1YFT A;  1FWZ A;  3C94 A;  3CCE A;  3UPU A;  3OBW A;  2QQS A;  2RI5 A;  3RMQ A;  2Q5H A;  3OA6 A;  1IL2 A;  4OVA A;  2ODR D;  3PIP A;  2FHD A;  4YDQ A;  2XK0 A;  2RHZ A;  3OY9 A;  3JB9 D;  4A4G A;  1IZ6 A;  4BDZ A;  2XID A;  3RKW A;  4BE2 A;  2A7Y A;  2DKG A;  2DZ9 A;  5C52 B;  4BW9 A;  4H02 A;  2I4L A;  1Y96 B;  2B8A A;  4M77 D;  4RQE A;  3KUF A;  4JS5 A;  4HKE A;  2A3L A;  1KC8 C;  4C8Q F;  1BYM A;  4Y28 E;  3QJ6 A;  4M75 D;  4XU1 A;  1NYR A;  2AMC A;  4MZM A;  4Q15 A;  2K4Y A;  3I55 T;  5LJ3 g;  4LVJ A;  2LT4 A;  4A54 A;  1QVG A;  4RKU E;  1B7Y B;  5D6X A;  3L2R A;  2R5M A;  4ELZ C;  2HD0 A;  4KBM B;  1VIF A;  1VQO T;  2X4X A;  4J7F A;  4UP7 A;  3QZ5 B;  1YHQ A;  4WJ4 A;  1HC7 A;  3UGT A;  4CH3 A;  4OB0 B;  3VQW A;  3M5A A;  2XI9 A;  3VJP A;  2E5A A;  1JRI A;  3ZFJ A;  1S72 T;  2RD1 A;  4JLI A;  3C4S A;  1UGP B;  4C5E A;  4FT2 A;  3OS0 A;  4MML A;  4KUI A;  4A4H A;  1KMM A;  1KOG A;  3MF1 A;  5GAM g;  4JUV A;  5GAO m;  3RKX A;  4ZGD B;  3GIB A;  5LJ5 e;  1U8R A;  3CCR T;  3CCU A;  1I4K 1;  4IUT A;  1LNX A;  3J7A F;  4TVY A;  4ZGE B;  2QQR A;  5GAN e;  3E9G A;  1YIT T;  3NEL A;  4F7U F;  1X56 A;  3CCQ T;  3QTC A;  1H4Q A;  3CCL T;  1LJO A;  4M7D E;  3CCV T;  2HBP A;  3WVE B;  5K1X A;  4J15 A;  5KE2 A;  4C8Q C;  4C0Z A;  4P72 A;  1YGB A;  1Q82 U;  3CMQ A;  5IAY A;  3REX A;  4NS5 A;  3CCE T;  2LQ8 A;  4YRJ A;  5FU7 C;  4BY6 C;  2FB7 A;  4EPC A;  4KR3 A;  2E70 A;  3QO3 A;  4JRP A;  5LJ3 j;  3NTI A;  2JNG A;  1N8R U;  3GOX A;  4Y91 A;  2KK4 A;  3KBG A;  3QNE A;  4WI1 A;  3A8H B;  1TH7 A;  3CEY A;  3SB2 A;  4K87 A;  4JLG A;  1Q81 C;  1KQ1 A;  1M4Z A;  1BI1 A;  1BI2 A;  5HK3 A;  5GMK l;  2QTX A;  1WNL A;  3GP8 A;  3A74 A;  1KQS S;  2ZCF B;  2K3X A;  1VQZ A;  4B9X A;  2Q7E A;  1H64 1;  3JB9 J;  4YRO A;  4C8Q A;  2MWP A;  4FL6 A;  4KUL A;  3GPL A;  5GAO r;  2DU7 A;  5GAM j;  1OI1 A;  4C5I A;  1VQK A;  4YRT A;  1U1S A;  1ADY A;  2RM4 A;  4P5N A;  4RMF A;  1Q7Y C;  1M90 U;  3VUZ A;  4M7D B;  4N4H A;  3CMA T;  3OYI A;  5GAN 7;  4E51 A;  4P3P A;  4PJO G;  4H2V A;  1G5V A;  3F70 A;  2RJF A;  2XDD A;  2EAY A;  5HY6 A;  3HXZ A;  3GNF B;  4FSX A;  5AYF A;  3OYM A;  2RHX A;  2VC8 A;  4H2U A;  3M56 A;  1YHQ T;  1PYS A;  5LJ5 d;  1M9S A;  4J8O A;  4DA4 A;  2IY5 B;  5KE3 A;  2P4T A;  1Q86 C;  4A53 A;  4Q6G A;  4E7K A;  3DLL A;  4XU0 A;  4EDU A;  4X9C A;  3PCO B;  2O4X B;  4TVW A;  2K5F A;  4YYE A;  1QVP A;  5CCA A;  2DTH A;  1M1F A;  2ZT5 A;  4HCB A;  3CBM A;  2O01 E;  2RHS A;  4QQ6 A;  4TVR A;  4P71 C;  2VXF A;  2P0Q A;  4ZIB A;  2Y4X A;  1VQ9 A;  3OMG A;  2OTL T;  1B8A A;  2ALY A;  2CZ1 B;  5C51 B;  5GAO n;  3HFZ A;  4G85 A;  5CQY A;  4LD9 K;  5KCO A;  3KFU A;  1ASZ A;  2JZ2 A;  4MMK A;  4J7I A;  3OW2 S;  3SD4 A;  3X26 B;  2ZT7 A;  1QP3 A;  2CZ6 B;  4PHC A;  2DXB A;  4C92 F;  3CC2 A;  2DTI A;  4M77 G;  5LL6 S;  2K57 A;  4HT4 A;  3S3M A;  5I21 A;  2ZNI A;  2CZ0 B;  3VQX A;  4P3O A;  4YRM A;  4EMK B;  4ZN1 A;  4M75 G;  1VQ5 A;  4IUP A;  2MMP A;  1N9S A;  4P71 A;  3OYG A;  1NJ6 A;  3REU A;  2CJA A;  3SWN B;  2KVQ G;  2ZNJ A;  4ZTJ A;  1UGR B;  3A5Z A;  3QSU A;  1NPR A;  2GCX A;  4M7A G;  3S3O A;  4ELY C;  3A8O B;  3ER0 A;  3JCM g;  3A7U A;  2Y4Y A;  4HWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...