3L1AA

Structural ordering of disordered ligand binding loops of biotin protein ligase into active conformations as a consequence of dehydration
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
264
Chain Sequence
DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords BirA bifunctional protein
total genus 83
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l1aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l1aA01
4XU1A 4YRLA 4YRIA 2RA2A 4WJ4A 5GANj 5GAMj 1BBUA 2E64A 3TUPA 4KQEA 3FJPA 2DEQA 4HVCA 5C52B 1X2GA 4C92E 3P8VA 4H2XA 4M77F 1EFWA 4H02A 3RESA 1G5IA 3L1AA 3RKYA 3MEYA 4H2UA 4XU2A 1JJCB 3L4GA 3EFRA 3JCMQ 3FB9A 4F7UB 1WPYA 1I8FA 1D3BA 1LNXA 1KOGA 2CGHA 5C51B 5LJ5d 4M78G 3SWNB 4M75A 2ZCEA 4N0AC 1PYSA 4P74A 2QHTA 4V2SA 4NOYA 4CH4A 4M7AE 2EL9A 2PMEA 3TEGA 1Z7MA 5LJ5e 3A32A 1YFTA 5GAOn 2CJAA 5GAMf 5GAOl 4L87A 4M75B 5ELNA 3AHUA 1YCYA 3MF1A 4YROA 1BBWA 4YRTA 1IL2A 1H4TA 2ZNJA 1SETA 4XTYA 3V8JA 5LJ3f 5LJ3h 2ODRD 1RIQA 4XTWA 1LOJA 4C92A 5LJ3j 3VU3C 4M77E 5GAMd 2DXTA 4H2YA 3V8KA 2ZIOA 1QE0A 2CJBA 3ERRA 4P3NA 1YB3A 4M7AC 3RIRA 1I4K1 3BFMA 3V8LA 4YPFA 2DTOA 4UPAA 4M7AA 2AMCB 2I4MA 5KNNA 3JB9D 4M77B 4K87A 3IKLA 4M7DD 2EWNA 2ZGWA 11ASA 1YGBA 1TH7A 3A7UA 4YRMA 5LJ3g 1M8VA 2AKWB 3V7SA 1WQWA 3QO3A 4PJOG 4YRQA 4C92C 12ASA 3JCMb 3QTCA 3VBBA 1EQRA 3JCMP 1PYSB 3JCMV 4NL3A 1G5HA 4PG3A 3JCMc 1KQ2A 1BIBA 2ZXFA 1ADJA 3LC0A 4RCCA 2E10A 4M75F 1U1TA 4X9DA 4YRNA 2ALYA 2RHQB 2DTHA 3QO7A 2EJGA 3HRIA 4P75A 4Q15A 3IKMB 4HWOA 5GAMh 5GANg 3RL6A 3QNEA 1NNHA 4K88A 4YRGA 4YYEA 4J6YA 1B7YA 3JCMe 5GAMe 2RM4A 2J3MA 1QF6A 3BY7A 1B76A 3QO5A 4YP0A 4M77C 2G4CA 4RMFA 4RQEA 1EOVA 4EMKB 5GANh 3QUIA 1EVKA 2QHVA 4TVWA 4YCVA 5GMKi 4TQDA 2JN0A 4UP7A 4CH5A 2DZCA 4A54A 3JCMd 2ARTA 4H2SA 3UGQA 3JCMf 1JJCA 4P73C 4JUVA 2RD1A 3TEHB 5LJ3e 3BDUA 3QO8A 1MGQA 2E41A 4M75D 1NJ5A 4EX5A 1D3BB 1SRYA 4PJOC 4M78E 4XTUA 2Q5HA 3SWNC 2XTIA 4DQ2A 1H641 2K57A 2YHTA 5LJ5h 2DQ3A 5LJ5j 2ZT5A 5ELOA 4G84A 1NYQA 3RF1A 2VXEA 1B7YB 4YCWA 1E22A 4EMKC 2E5AA 4EMGA 2YLCA 5DY9A 3A7RA 4M7DC 4AH6A 1WQ7A 4OP0A 2VXFA 4PHCA 1EIYB 2E65A 4XTVA 4MMKA 3VQVA 3HFVA 1ASZA 5LJ5g 1WLEA 4C92D 1N9WA 4LNSA 3REUA 4UP8A 2ARUA 3UH0A 4PJOF 1ADYA 3HXWA 1JBMA 2P5IA 3HFZA 4YRSA 4J5YA 2Q7HA 4KR3A 4YRPA 4H2XB 4XTXA 5GAN8 1LJOA 5K1PA 4RDXA 4OLFA 1WYDA 3PGGA 1KMMA 4CS2A 1YFSA 5GAOr 4X5OA 3IG2A 1B8AA 4YRJA 4C8QA 4EMHA 1Y96A 2ALYB 2RHQA 4M77D 3A7AA 3I7FA 3JB9G 4C92B 1USYA 3RKWA 1L0WA 5K1XA 4M7DB 5GAOm 2FB7A 4M78C 3SB2A 5GAOp 4F7UF 1X55A 2ZZFA 2DDZA 2ZTGA 2E1HA 3HXZA 4HT8A 4CS4A 4F7UA 4M7DE 2P0LA 3DSQA 1W66A 2EJFA 2ZT6A 3UGTA 1N9SA 1WNLA 3JB9J 4TVAB 5GMKl 3QSUA 3OD1A 1NJ1A 1C0AA 4TWAA 4TVYA 3JB9I 3R07A 4EMKA 3A5YA 1B34A 4ZIBA 4P3PA 4PJOE 1VQZA 4HWPA 2IY5A 1B70B 4YRCA 3A31A 5CAIA 1N9RA 5GMKm 4C8QF 2ZR3A 1B34B 3INZA 1KQ1A 2RB6A 3SWNA 3HXVA 3P8YA 1H4VB 4M78D 4J15A 4PJOA 3QHSA 4WI1A 2ZNIA 3M4PA 2AKWA 3REXA 3KFUA 3G1ZA 2FYKA 5LJ3d 1NYRA 3L4GB 4XU0A 1G51A 5HGQA 3PCOB 2QHSA 3NENA 1HXDA 3RKXA 4XEMA 3L2ZA 3RUXA 2E3CA 4UP9A 4M7DF 4P72A 1E24A 4C92G 1I81A 3UFGA 3VQYA 4KR2A 2DU5A 4HWRA 2I4OA 4H2WA 3LSQA 4Y91A 3JB9H 3JCMX 3CMQA 3A74A 1USYC 1Y96B 4DPGA 4C8QE 5GMKh 5GANd 4M7AG 2DTIA 3A5ZA 2I4NA 4C8QC 2Y90A 2I2LA 4HA8A 1SERA 2VC8A 3HXUA 3HRKA 4C92F 4QVDA 2C7IA 1HC7A 4XEOA 5GANf 3JCMJ 2IY5B 4P73A 2RHSA 2DQ0A 4NL2A 3W3SA 4MMLA 4M75G 2Q7GA 3VQXA 2DZ9A 4HWSA 2RHSB 4G85A 4TVAA 1X54A 3M4QA 2AMCA 4M77A 3GIBA 3PCOA 3RERA 1NJ2A 1NJ8A 4CH6A 3LSSA 1E1TA 4M7AF 4C8QB 4HT9A 3HXXA 4YRKA 4M78F 2HNIA 4WJ3M 3HFNA 1EIYA 4NCXA 2QTXA 2I4LA 4BWAA 2DXUA 4J6XA 3MF2A 3RGLA 4C8QD 4Q6GA 1FYFA 3HSBA 4CS3A 4M77G 1X56A 4X9CA 4JRKA 4E51A 1HTTA 5GAMg 4ZTUB 4M75E 2YLBA 3HY1A 1H4SA 1X01A 3TEHA 3PZCA 3FIFA 3NEMA 4CH3A 4M78A 4EO4A 3JB9F 4A53A 4TTVA 2DJZA 2J3LA 2ZR2A 3E9HA 5GAOq 4YRFA 2C8MA 3NETA 2EJ9A 3HXYA 2EAYA 4TQFA 3NELA 1M5Q1 2ARSA 4YRRA 1HK9A 5GAN6 5E3IA 5GAN2 4O2DA 4H2VA 1B70A 4ZTZB 2CIMA 3BW1A 5GAN3 2ZT7A 2DVEA 2QHUA 4PJOD 4P74C 1JRIA 5I21A 4JRIA 4XQ3A 4YREA 4M75C 2ZZGA 5GANe 4P71C 1ASYA 2PMFA 3V7CA 4XU3A 4YDQA 3JCMg 1EVLA 4PJOB 1YFRA 3WQZA 4M7DG 1I5LA 5LJ5f 4M7AB 4F7UG 2Q7EA 2ZIMA 2DU7A 2ZZEA 4C8QG 4P72C 1E1OA 1BIAA 4J6WA 4RCBA 1H4QA 4BW9A 1ATIA 4P71A 1NJ6A 4WF2A 1U1SA 1GGMA 5GAN7 3HFZB 3IALA 3BJUA 3P8TA 4M78B 4XTZA 5F5WA 4F7UE 4M7DA 2XGTA 3JCMh 1X2HA 5GMKe 5C53B 4N0AA 3HFOA 1KMNA 4JLIA 2ZT8A 3HY0A 1LYLA 2ZINA 5GMKj 3JCMW 5GAN5 3HTZA 4HWTA 4P75C 3RACA 3VQWA 3E9IA 4P3OA 4QVCA 4K86A 1Z7NA 2ODRC 3EFSA 5GAN4 1WU7A 3V7RA 4RQFA 1J5WA 2CJ9A 3M4GA 3ICAA 4PNOA 4H2TA 2DKGA 2Q5IA 4M7AD 1SESA 4YCUA
chains in the Genus database with same CATH superfamily
2SEMA 3GNGA 5KCHA 4LUEA 1BBUA 5I2SA 1N27A 1UB4A 3REAB 2VB6A 1UG1A 3TU4K 5FU6B 1Y07A 4HKEA 1K9MR 1W70A 2M0YA 4PJLA 3RESA 1G5IA 4GLMA 4H2UA 3G6EQ 1YJ9Q 3EFRA 4N4IA 3CMEQ 3LH5A 2CP2A 3J81E 4HVWA 2J6KA 2DPPB 3OSVA 2BZXA 3PVLA 5C51B 3SWNB 1QCNA 1NYFA 2QHTA 5KH6A 1RAFB 5GJVB 4CH4A 2PMEA 1Z7MA 1N8RR 1E7OA 3M5AA 2CJAA 1BCOA 5ELNA 5ECAA 1YWPA 3N5BB 3EGXA 1V29B 1H4TA 4LDVA 1JB0E 1T0JA 1M9SA 2DMOA 2ODRD 1X6BA 3P8HA 1WXTA 4XTWA 2L2PA 5KYYA 1Z9ZA 2ROTA 1N8RU 2XDPA 3S6WA 2RJDA 4WTOB 4RG8A 1VQMA 2RHXA 3ERRA 2QGGA 2K3BA 2EPDA 3CC7Q 1IXDA 4P3NA 4DBRA 4M7AC 2CP5A 1I4K1 4YPFA 1K73R 5FWCA 5KNNA 1QP2A 3IKLA 1NZ9A 2EWNA 3A7UA 1W1FA 2HL3A 3V7SA 4FM4B 3ME9A 4B9WA 3CCEA 2RJEA 3QO3A 4PJOG 4OB0B 2E3IA 5AT1B 3DLMA 2CZ6B 4ORZA 4HCZA 4CC2A 4C0ZA 4ZN3A 1VQKQ 4RCCA 4BACA 1U1TA 2PTKA 1KHIA 4KH0B 2COWA 2DTHA 1YIJQ 3ZL7C 1EIFA 3QO7A 5IAYA 3M57A 3NTHA 1D0XA 1ZA1B 2KROA 3RL6A 3QNEA 3QZ5B 4K88A 2KRNA 4Y92A 1OU8A 1B7YA 2V8IA 1QF6A 1ARKA 3VUBA 2HEQA 1U3OA 3QO5A 2O88A 2JNGA 2MPXC 4EPCA 2DIQA 3UA6A 1KQSA 3CC4A 4GLKA 4RQEA 1K0XA 1NM7A 3VYHB 5KE2A 4YCVA 5KYXA 4TVRA 2HZYA 1JXMA 2DZCA 2YUNA 1ZSZC 4L5GA 2ARTA 1JJCA 4JUVA 2EFIA 4J9CA 2COZA 3TEHB 4DBFA 1Q95G 4RTWA 1K9AA 2WACA 1RLQC 3M0PA 1D3BB 4J9BA 2YUQA 4FT2A 2RQUA 2JS2A 3NFCA 2K79A 2DL4A 2PVDB 2J6OA 4QQ6A 1K0SA 3CCET 2VXEA 1IO6A 1AVZC 4DEXA 3HP9A 1E22A 4ZTJA 1UJ0A 2XI9A 4DBHA 1V76A 2K5IA 3A7RA 3NTIA 2JVVA 1EIYB 4JJCA 2EYZA 3VQVA 3QXEB 3M59A 2LP5A 2V1RA 2M16A 2GTOA 4LNSA 3F70A 1VQ9Q 4UP8A 3SDZA 3HXWA 2P5IA 2KXDA 5D7UA 2HKQB 4J5YA 2LNVA 4H2XB 2HBWA 5HCKA 1LJOA 2XMFA 5K1PA 4JS4A 2O4XA 4CS2A 3PMIA 1Y57A 3IG2A 2E6NA 3A1PA 2B8AA 2FPFA 3E1SA 4C8QA 2JS0A 1YN8A 1M3CA 1IRXA 1D0YA 3MPUB 2K3XA 5K1XA 1KHCA 3VS3A 1UJYA 3A8GB 3G7ZA 2M02A 2GFAA 4F7UF 1G83A 2ZZFA 1MHNA 1RAAB 2PZ1A 1VA7A 2K2MA 2ZTGA 2FZCB 1TS9A 2E3HA 1W66A 3VV0A 3I9QA 3CCJT 4FIBA 5GMKl 3OD1A 3OYHA 1NJ1A 2P0KA 2XU8A 4TVYA 2ZPIB 3R07A 4XK8E 4N4HA 4ANJA 1NJIR 3QBYA 2HCKA 2IY5A 1B70B 1ZSZB 5GMKm 3KBGA 4PL6A 2ZR3A 1B34B 3CCSA 1KQ1A 2KEAA 2HD0A 1HD3A 1WDXA 4OGEA 4WI1A 2ZNIA 4E7SA 1BI2A 2K5FA 1TSFA 1UEBA 2AZVA 3KFUA 3A8LB 5LJ3d 5DM7R 1NYRA 4MDXA 2X51A 4HVVA 1BI0A 3NENA 1JO8A 1YFNA 3L2VA 2V8KA 1WHHA 2FZGB 4MZTA 4UP9A 4ELYC 5CK9A 4VUBA 1I81A 3UFGA 2FRWA 2CH4W 2I4OA 1C0MA 4FYVB 3LSQA 3CXCA 1AWJA 3G4SA 2JMCA 2L8DA 3CMQA 1MMGA 2D8JA 2NUPB 1Y0MA 2SRCA 2K2VA 1M90R 3HRTA 5GMKh 1D0ZA 5GANd 2LX9A 5A0DA 1SKUB 3PMTA 1CSKA 4FSSA 1IZ6A 1NPRA 2RHSA 1KFZA 3W3SA 4MMLA 4E6RA 2EQUA 5EC7A 2OAWA 1K4US 3EG0A 3HRUA 1YITQ 4JRPA 2DYIA 3UA7A 3REBB 3UATA 1QQJA 4CH6A 3I5SA 4MZPA 1NJ8A 3CCLT 3E9FA 4QW2A 2YRDA 1QMCA 2IIMA 3M0UA 1E1TA 4YTLA 5DLOA 3HXXA 2P84A 2HNIA 4WJ3M 3HFNA 1K8AC 1VQ8T 5IHNA 3I56Q 2MAMA 1FMVA 2OAUA 4J6XA 3MF2A 4C8QD 4LDUA 4Q6GA 1S72A 2A7YA 3CCJA 4CS3A 1S1NA 3J80E 3CPWA 2FPEA 4ME7A 4E51A 4RTXA 2X4WA 2HDAA 1RABB 4ZTUB 3C0CA 4M75E 2DERA 1UGSB 1H4SA 3ZEHA 1QVFA 1VQOT 4KUIA 1XNIA 1WJSA 2GCXA 4E2FB 3U23A 4NS5A 2LCLA 3TCJA 3GOXA 4IUTA 2Y4YA 4TTVA 4C0GA 4ELZC 5GAOq 1NPPA 1OEBA 4YRFA 4O6JA 5IHKA 4TQFA 2G6FX 2FZKB 4HCCA 2A08A 2A3LA 2CP3A 4YRRA 1HK9A 3CC4Q 1YJNQ 2D8HA 5GAN2 1B3QA 1ABQA 2JXBA 4ZTZB 2CIMA 2ZPEB 5KYUB 3OQ5A 2JTFA 2DVEA 1QCFA 4PJOD 4P74C 1WIEA 4M75C 2ZZGA 5GANe 4BY6C 4P71C 1ASYA 3G71T 1VQ9A 4YDQA 2JW4A 4PJOB 1YFRA 1KQSP 2JM8A 4JZ4A 3CCLA 1VQMQ 1I5LA 4M7DG 1ZUYA 2ZIMA 3SHWA 1HSQA 2JZ2A 2PVOB 1RAHB 1ZBXA 2F5TX 1BIAA 2HAXA 2MWOA 4Q5WA 2KDSA 1BI3A 5D6XA 1NJ6A 1U1SA 4UC4A 1GGMA 3HFZB 1YITA 1Y7XA 4M78B 5F5WA 1QLYA 5GMKe 1LYLA 4J7FA 1VQ7A 5GMKj 5GAN5 3RACA 3C12A 3DB3A 2NWMA 2KRSA 3E9IA 1VQ7Q 1K73U 3O8VA 1R77A 3I56A 1KC8C 1RAIB 1V1CA 1S72Q 1NJIC 1GL5A 2CJ9A 2QQSA 3ICAA 4PNOA 1UUEA 3EFOA 2QQBA 4BD3A 4YCUA 3CCMT 2EGEA 2QA4A 2RA2A 5GANj 2D9TA 4RMOA 2ESWA 2PUOB 3VS5A 2E64A 1M3AA 4KQEA 2CZ0B 3FJPA 5IT9E 3L2QA 1SRMA 1X2GA 2ZAEA 4LD9K 4H2XA 1EFWA 4PFZA 2GNCA 3MEYA 3VRYA 4XU2A 1JJCB 3L4GA 3FB9A 1WPYA 3DKMA 5L23A 3CCRA 4PKCC 1I8FA 2CGHA 3VKIA 2Y4XA 5LJ5d 2AT1B 1PYSA 3UF4A 2ED0A 4V2SA 4NOYA 4RTZA 4M7AE 3KFVA 5AYFA 3UT1A 2LJ0A 1GBRA 3A32A 1TUCA 1IHWA 1M4ZA 3MF1A 1YCYA 1BBWA 5D6WA 2NYSA 1TWBA 5L8RE 4C0FA 2JTEA 2VASA 1RIQA 1BU1A 1LOJA 2CSIA 4C92A 4M77E 2ZIOA 2C06A 3M55A 2JMAA 2F2XA 2O2OA 2RQWA 4Z89A 2RN8A 3BFMA 5CKDA 2DTOA 4M7AA 2AMCB 2RMOA 4K87A 2KMTA 2ZGWA 4C5EA 1YGBA 1IB8A 1QW1A 4HXJA 1OX9A 1M2VA 1I07A 2M51A 4CC3A 3EGDA 1NYGA 2HQHA 3CCEQ 3JCMb 2VWFA 3QTCA 2RHZA 1EQRA 1G5HA 4PG3A 3GP8A 1KQ2A 1BIBA 2ZXFA 2D1XA 3LC0A 4M75F 3CCUT 4X9DA 4YRNA 3IQLA 3Q1JA 2EJGA 1WHMA 4E7KA 1Q82C 3H0IA 4Q15A 2DILA 4HWOA 5GAMh 1WYXA 1TG0A 1QKXA 1YNZA 4J6YA 1ACMB 1Z9QA 3OB9A 3BY7A 2LCCA 4WCIA 2F5KA 3CBMA 1OULA 3C4SA 4II1A 4LDWA 1WGSA 3OMGA 1SEMA 4M77C 3HTRA 4RMFA 4J8OA 4LXCA 3QWYA 4OMMA 3CCMQ 3ER0A 1GCQC 3QUIA 5GMKi 4TQDA 4UP7A 2EIFA 1UGVA 1Q81U 2OTLQ 4A54A 4H2SA 2CREA 4HT4A 3JCMf 3ZFJA 1PKTA 2E5KA 2QI2A 2RD1A 1Q82R 5LJ3e 4C5GA 1MGQA 2J7IA 2E41A 4M75D 4RTUA 1NJ5A 5FU6C 4JZ3A 4PJOC 8ATCB 3HKSA 4OMOA 4A4KA 2DIGA 2Q5HA 4OMLA 2ATCB 3NTKA 1X2QA 4LVJA 2YHTA 1FXXA 3EHQA 1M2VB 3E9GA 5LJ5j 2ZT5A 5ELOA 3EGDB 4G84A 3TVTA 3OYFA 4J7IA 1RAGB 2QGFB 4YCWA 4EMKC 3CCVT 2E5AA 4EMGA 3OSSC 2RK1A 4FYXB 5DY9A 1G3WA 1OZ3A 4AH6A 4OP0A 2VXFA 1NLOC 1K73C 2NUPA 2JJ9A 1KQSS 4IIMA 1E6HA 2QAZA 3JV3A 3T9NA 4JJNK 5LJ5g 1WLEA 2A8EA 4C92D 2ZCFB 4E7IA 1AD5A 1FMKA 1SSFA 1SF9A 2L0AA 2O4XB 5CQYA 5CR2A 3VRZA 5HK0A 4JPBW 5KYNA 2LTOA 2L3RA 2O9VA 4XTXA 5GAN8 2KRMA 3OS0A 2I0NA 3VS7A 3O5ZA 3WVEB 2MCNA 1N8RC 1KMMA 1J3TA 2F2WA 1EX4A 5GAOr 3M53A 2KNBB 4OMPA 3RDVA 1B8AA 1UGQB 2K5LA 5CKBA 4YRJA 4KGXB 3FJ5A 1Y96A 4OB2B 4XAXB 2ALYB 2RHQA 3I7FA 3JB9G 1FYNA 5KYYB 1PRLC 2RHUA 3A5ZB 4LNPA 3RKWA 1FWZA 4BDZA 2FB7A 4M78C 5GAOp 4EIKA 3AT1B 3LWHA 5C0MA 2A28A 3HXZA 1WXBA 2HQXA 3EH2A 1VQ7T 2AHJB 2YRCA 3OS5A 2VV5A 2EJFA 1N9SA 1B07A 2VGMA 4RTYA 5M9OA 5J39A 1YITT 4TVAB 4HCBA 3QSUA 2DXCA 2ZPHB 4TWAA 3UWNA 1SHGA 4J83A 3A5YA 1B34A 2DL5A 4ATOA 4P3PA 1M1KU 2ABLA 4C8QF 2KT8A 1YJNA 2YWWA 3JSCA 3MHXA 3I56T 1PD1A 1DJ7B 3GF5A 4M78D 3CMEA 1XJWB 4J15A 2EKHA 4J9EA 1AHJB 3ASKA 2AKWA 5CVIA 1VQ4A 3L4GB 1G51A 1Q81R 4FYWB 4LUDA 3M4YA 3CMAQ 2M9UA 2E3CA 2NUTB 2DU5A 2ZPBB 1W2BA 4Y91A 1ZQ1A 2O01E 4RKUE 5CKHA 1Y96B 4DPGA 1GCPA 4M7AG 2KSSA 3A5ZA 2XDBA 4IUQA 2VC8A 3VJPA 2BZYA 4C92F 4XEOA 5FW9A 3FLGA 3OYAA 1RI0A 1PHTA 1NEGA 1AWOA 2Q7GA 1T3LA 2EQJA 3CMET 2DZ9A 3CCRT 4TVAA 2CP6A 2AMCA 1X75C 4PLLA 3GIBA 3PCOA 3RERA 3QG1A 2W10A 5HY6A 4DOWA 3I55A 5IHIA 3HHTB 2FVUA 3JAME 3I55Q 1KC8U 4M7AF 5I2MA 2HSEB 3EG9B 3A8MB 1EIYA 4NCXA 3LLRA 2I4LA 2QXFA 2H3EB 3RGLA 2KYMA 1FYFA 1BCMA 2JUFA 4ZTFA 1X56A 4X9CA 1K8AR 1VQ6A 2QQAA 2L3SA 5GAMg 2LZ6B 1Q86C 4FW1A 3HY1A 2ROLA 3TEHA 2BZ8A 2QA4Q 5FRMA 3NEMA 3JB9F 1KC8R 2PNIA 2DJZA 2J3LA 1AWWA 2EGAA 3VUZA 1VQPQ 1M5Q1 4ZGEB 2ARSA 4OMNA 1UFFA 5E3IA 2VKNA 2XHCA 4C5HA 2DK3A 5GAN3 1M90U 3QJ6A 1JRIA 2VGNA 5I21A 4JRIA 4XQ3A 4YREA 3CCQT 2PMFA 3A8OB 3NMZC 3WQZA 2LRQA 4DOVA 3A98A 4M7AB 5LJ5f 2QQRA 3G4ST 2XICA 2Q7EA 1R0CB 3G1JA 1PD0A 2XD0A 5KE3A 2LJ1A 1OPKA 4FT4A 4RCBA 1ATIA 1VQKT 4WF2A 2WSEE 1CKBA 2BKDN 2RI5A 1PG5B 2GFUA 2JOYA 3IALA 2VVKA 4ZNXA 4F7UE 4M7DA 2XGTA 2DD5A 1X2HA 2DE0X 5KCOA 1BKBA 2ZT8A 4OF1A 1VQ5Q 2ZINA 1BI1A 2DFUA 2F1LA 3JCMW 3HTZA 3VQWA 1X6GA 4KUDK 4AG2C 3CCST 4QVCA 2FHDA 2KYBA 3I55T 1LVKA 1R8OB 2E5QA 2YUOA 3OYMA 3EFSA 1WU7A 4DEYA 1XTDA 1ZUUA 3OBWA 3C94A 2WSCE 1K1ZA 1NLPC 1P92A 2JT4A 2PUKB 4M7AD 3EGUA 4YRLA 1W6XA 4YRIA 2FO0A 1RUWA 1QWEA 5GAMj 3TUPA 1SG5A 1B7TA 3OYLA 2CP0A 2DEQA 5C52B 4C92E 4M77F 4R55A 4H02A 2CUBA 2OX7A 2DL7A 3CCSQ 1HYOA 1NEBA 1YJNT 3KUFA 3G71Q 4PFPA 4F7UB 2K4YA 1D3BA 3LGFA 3L2WA 1LNXA 1YCSB 2KGTA 1KOGA 4KT0E 2K6DA 2ZCEA 3MCAB 4FL6A 4N0AC 2CSQA 3TEGA 1QVPA 4OB3B 5LJ5e 1VQ4T 2P0PA 1OI1A 2C0OA 4RTTA 2A0FB 5GAOn 1PSFA 2KQWA 5GAMf 4L87A 4M75B 1KD1R 4YRTA 4PK4A 4B6MA 1IL2A 1WA7A 3RR6A 1M90C 2ZNJA 3MEVA 3LWIA 2OTLA 2K3YA 4BI3A 3V8JA 5LJ3h 1X43A 5LJ3j 2QEXT 3VU3C 2EKOA 3OYNA 1YIJT 2LQKA 5GAMd 2DXTA 2OTJA 3V8KA 4H2YA 1BK2A 3DLLA 1G5VA 2E12A 1QVGS 1YB3A 3ULRB 3V8LA 3I5RA 2DRMA 5LL6S 2XG8D 3CCQQ 4QQGA 1Q81C 2I4MA 1C6VX 4M77B 1JQQA 2OI3A 1ZX6A 4M7DD 3CEYA 11ASA 1TH7A 3EHRA 4YRMA 5LJ3g 4FU6A 2AKWB 1WQWA 2EYXA 2DRKA 4YRQA 1WHLA 12ASA 1MMAA 1IHVA 3JCMP 1OV3A 4NL3A 4O5VA 4JS5A 1QVFP 1ADJA 1KIKA 3G4SQ 1VQ6T 2DA9A 3CCJQ 1UDLA 4N4GA 3HRIA 4P75A 3CPFA 1K9MU 1WFWA 3VYGA 3IKMB 1RADB 1VYUA 4JLGA 5GANg 2EQMA 4YYEA 1LCKA 4DA4A 3CXCP 3CCVA 1JEGA 4F16A 3PFSA 2RM4A 3CC4T 3R6NA 4HCKA 2L3QA 1B76A 1GBQA 3H9NA 4YP0A 3VS2A 1FMWA 4J9DA 1AZGB 5FWBA 1AT1B 3UPUA 1EOVA 1RL2A 3MEUA 5GANh 2RQTA 2QHVA 4TVWA 3OW2A 2X4YA 4K11A 4F14A 3OYEA 2Z0WA 1YHQQ 3JCMd 1M1GA 3CCRQ 2YSQA 4FCYA 4P73C 4AFZC 3X20B 3QIIA 1OZ2A 6AT1B 4ZGDB 1OX8A 5CO7A 4PJNA 3D7SB 1WJRA 2FPDA 2CKKA 4CRIA 1VUBA 2YUPA 4J9IA 1TXQA 4M78E 3M0SA 3SWNC 2EQKA 5FU7C 2DBMA 1H641 4DQ2A 4E7JA 4PJMA 4KGVB 3META 4X34A 2K57A 2MI6A 3HRSA 1ZLMA 1PCXA 2DQ3A 1OPLA 4CI0C 1YJWA 2F2VA 3RF1A 1B7YB 1YJWQ 2DBKA 3EAEA 2H8HA 1VQ5A 2KK4A 4BI4A 4PHCA 1LPLA 1WLPB 1WI7A 3EG3A 4XTVA 4MMKA 3HFVA 2DL8A 2NUZA 3PIPA 1MMDA 3M0TA 1YIJA 1VQ4Q 1F1BB 4BDYA 2QTVA 1G8XA 3REUA 4LE9A 2ARUA 2YXYA 2MMPA 4PJOF 3CMAT 3H0HA 2G3RA 1BBZA 1UHCA 2NS6A 4QQDA 2QEXQ 2Q7HA 4KR3A 2P4RA 1N6AA 1WHGA 2L5QA 3FC3A 4RDXA 1WYDA 4QVZA 1YFSA 2F69A 3RBBB 1QP3A 3VS1A 1GCQA 1NJIU 4M77D 3A7AA 4LDXA 4C92B 1L0WA 3OYGA 4M7DB 5A0LA 1YHQA 1TOVA 4LDYA 5GAOm 1VQOQ 1AWXA 1KD1U 1X55A 1VQOA 1K9MC 2D0QB 4CS4A 4A4EA 1OU9A 2CDTA 4E47A 3DSQA 2AKLA 2XDDA 1WNLA 4OGCA 3CBPA 2EYWA 2GBQA 2YDLA 2MK5A 3QJYA 4AG1C 3QYGB 3JB9I 4EMKA 2H3JA 3S3OA 5FRNA 1U5SA 1VQZA 3H8ZA 1WX6A 5KYUA 2FG0A 1PWTA 5CAIA 3OYKA 5IN1A 3P8YA 2RB6A 3SWNA 3HXVA 1VQLQ 1H4VB 1CKAA 4PJOA 3QHSA 3MEAA 3CCQA 3G1ZA 4XU0A 2DEUA 4EDUA 5HGQA 2QHSA 2QA4T 2QDLA 1M3BA 3RUXA 1Q82U 4GY5A 4CC7A 4M7DF 4P72A 4C92G 3CXCS 2LCSA 3VQYA 1M27C 4KR2A 1PKSA 4HWRA 3OS2A 2EBPA 3JB9H 1A0NB 1PM3A 4IUVA 3RMSA 2BE7D 2DLPA 4C8QE 1HJDA 3CBOA 2I4NA 1VQ8Q 4C8QC 1RAEB 2GTJA 2I2LA 2WSFE 2Y90A 4HA8A 1BYMA 1SERA 1G3YA 3HRKA 4QVDA 2C7IA 1T0HA 4C0DB 1UHFA 2IY5B 3MEWA 3R6OA 4P73A 4IUUA 2DQ0A 3OYYA 4R56A 3VQXA 2KVQG 3QDFA 4G85A 1YI2A 1X54A 1NBEB 1WXUA 3CC7T 4M77A 2LMJA 1NJ2A 3SFMA 3LSSA 2EYQA 5KYWA 2CT3A 3LGLA 3MQZA 5IXBA 3RMQA 5D6YA 4J9HA 2GQVA 1X2KA 4YRKA 3M0QA 2GQIA 4M78F 2QTXA 4BWAA 4GBQA 4A4HA 1YJ9A 1W4SA 4BE0A 4E7LA 4JJBA 3CCUA 1HTTA 1KG1A 2COYA 2YLBA 1VQ6Q 3PZCA 4X1VA 4HVUA 4CH3A 5CCAA 4Z8AA 4M78A 4EO4A 1UECA 2LVMA 4KULA 1M1FA 2BUDA 2ZR2A 3E9HA 3PTAA 2C8MA 2EAYA 2ENMA 5C6SA 3NELA 1IREB 1YJ9T 2XIDA 4H2VA 2RF0A 1ZSZA 2ZT7A 5I11A 3URGA 5FROA 1PSEA 3BE3A 2CYZB 3V7CA 4XU3A 3EFOB 1EVLA 1M1KC 4KGZB 2FEIA 2QG9B 4AFUC 1AEYA 2ZPFB 3X25B 3QYHB 2QASA 3CMAA 3NGPA 2DYBA 3CC7A 2DU7A 4AFSC 3M58A 3GBQA 3M54A 3OYDA 1E1OA 1YWOA 4BW9A 2R5AA 5CKEA 1I5OB 4P71A 1G3TA 4L59A 2BIVA 5GAN7 3P8TA 4XTZA 1Q7YC 4JRQA 1AOJA 4D6WA 5A2QE 1M8MA 1TU0B 4N0AA 1U06A 2JTMA 5FLXE 1VQ8A 3H6ZA 4HWTA 1VOMA 4BY6B 5IH2A 1O9SA 1YJWT 4LVKA 1Z7NA 1H3ZA 2CS7A 3CD6T 3LH0A 5GAN4 5CIUA 3OA6A 4E7ZA 3V7RA 2RI3A 4RQFA 1KJWA 2J6FA 4IIOA 3M4GA 2RPNA 2DKGA 1XOVA 2Q5IA 4XU1A 2KXCA 3HPWA 4WJ4A 3GPLA 1SRLA 3L42A 4HVCA 1N5ZA 3P8VA 4J9FA 3MP8A 3PIOA 1VQPA 3FEOA 3G6EA 1MMNA 3M0RA 3E2UA 3L1AA 3RKYA 1RLPC 3FDRA 2W0ZA 2HKNA 3JCMQ 4OVAA 5J3BA 3CCVQ 2KY9A 4FSXA 3LW5E 2KE9A 2QYZA 1QVGA 1Q7YU 4M78G 1OOTA 4RTVA 4M75A 4A4GA 1VIFA 1ZHIA 2O31A 4P74A 1XQHA 2P4TA 2YT6A 3S3MA 2DL3A 3OYJA 3GNFB 2CH4A 2EL9A 2R58A 4KRTA 3C95A 1YFTA 5GAOl 3AHUA 3PNWC 4YROA 3TREA 3I35A 2A37A 3QWXX 4A4FA 3EG2A 1SETA 4XTYA 3KXTA 4ZGJB 1GFCA 2PU9B 5LJ3f 1T3SA 2KR3A 2IG0A 2R5MA 3EGXB 4ZN1A 2CZ1B 2X35A 1QE0A 2CJBA 1WHJA 1TUDA 4FYYB 2MIOA 2XK0A 2VUBA 2PVGB 3LX7A 3RIRA 3WXMB 1JJ2P 1MNDA 2RHYA 1SPKA 4UPAA 5CKFA 1PC0A 2X9HA 3JB9D 3EH1A 2RQRA 1D1CA 2L89A 2X4JA 4PLIA 1VQMT 1M8VA 3DB4A 1SSHA 3RNJA 1X6OA 3CPWP 4C92C 4A63B 3VBBA 2QEXA 1PYSB 3JCMV 2CT4A 3JCMc 2BE9B 2E10A 5CQXA 2ALYA 2RHQB 1D1BA 3BDLA 4AT1B 2MF2A 4LVIA 2FL7A 2DD4A 2E70A 1M30A 1MUZA 1UGRB 3TSWA 3OYIA 1NG2A 1VQNT 4ESRA 1VQ5T 1NNHA 4YRGA 4FW2A 1W2BP 5HKCA 3JCMe 5GAMe 3M9QA 5HK3A 2J3MA 3CD6Q 4CC4B 1X69A 2EYYA 2L3PA 2G4CA 2RI2A 2V8JA 1WJQA 2RJFA 2QK0A 1ZA2B 3PT9A 2K9GA 9ATCB 2AZSA 2HQEA 2HMAA 4EMKB 2RK2A 3QPHA 1EVKA 2JN0A 4CH5A 3TQ7P 4OMQA 1R0BG 3UGQA 1NE8A 5KYWB 1Q86U 1YBYA 1X27A 1K8AU 5KYXB 3BDUA 3QO8A 1WZOA 2J06A 2HSPA 2ECZA 4EX5A 1SRYA 4IURA 1YP5A 4QKUA 2V26A 4XTUA 2CUDA 1G2BA 2XTIA 3NHNA 1D09B 4JJDA 2RJCA 2EQIA 5LJ5h 2EVRA 2LQNA 2LT1A 1NYQA 2VYTA 2ZZDA 1IGUA 3P8BB 5A0GA 2E4HA 3H41A 2RO0A 3OW2S 2KI7A 1IGQA 2YLCA 2B86A 4M7DC 1TTHB 1WQ7A 1GFDA 2MYSA 1MV3A 2EGCA 2E65A 1VQKA 1ASZA 4LVLA 2RHIA 2DX1A 2X4XA 1N9WA 1QCOA 3MJXA 1TUGB 3OY9A 3UH0A 2GGRA 2NLUA 1C1AA 1ADYA 4PFOA 1JBMA 3QZ9B 3CCLQ 1QKWA 3VS6A 3OMCA 2DVJA 3HFZA 3MP6A 4C5IA 4LD6A 4YRSA 4M4ZA 1KD1C 4YRPA 1VIEA 3OYBA 4OLFA 2QQ9A 2ED1A 3PGGA 1H92A 2X3WD 1KK7A 5GJWB 4X5OA 2LNHB 4B9XA 1W2BS 3EG9A 4EMHA 1FX7A 1USYA 1QWFA 1JU5C 2LX7A 1YHQT 2MOXA 3SB2A 4D8DA 2LQWA 4R0KA 3SD4A 2OTLT 4IUPA 3MKDA 2DDZA 3CC2A 2E1HA 4HT8A 4F7UA 4M7DE 1GXIE 3MP1A 2P0LA 2J05A 1YI2Q 3CCUQ 2ZT6A 3UGTA 5EG2A 2DM1A 1K76A 4F04B 3JB9J 1JJ2S 3CCMA 3H0FA 3M56A 2X3XD 2MWPA 4AFQC 4D8KA 5DLQE 1C0AA 4PJJA 4BI8B 4ZIBA 4PJOE 4HWPA 4C0DC 4YRCA 2OTJQ 3A31A 1KSWA 1N9RA 2OJ2A 3S3NA 3INZA 1RI9A 1H8KA 1UTIA 3G71A 1VQ9T 4IKFA 2RNAA 3M4PA 3REXA 2C0TA 1H3HA 2C0IA 2FYKA 1MV0B 4AMCA 1ABOA 2IPOB 1ZSGA 3PCOB 1OYXA 3TEEA 1VQNA 1HXDA 3RKXA 3THKA 2GF7A 1VYTA 3HL8A 1EFNA 3L2ZA 4XEMA 1Y71A 1E24A 1SHFA 2DO3A 1BB9A 4BE1A 2HL5C 4H2WA 3FRNA 3NPFA 3QDRB 4MDWA 3JCMX 3A74A 1QVGP 4LVMA 1USYC 2RQVA 3TSZA 3OBYA 4E7HA 2AIRB 2IVWA 1M1KR 2DTIA 2M0OA 5J26A 3HXUA 1HC7A 2O9SA 5GANf 3JCMJ 4MZMA 4KBMB 3CPWS 4BB7A 4NL2A 7AT1B 4M75G 2AK5A 3CC2Q 2FRYA 3VS0A 4L6V5 2PQWA 5I22A 1QVFS 4HWSA 2RHSB 3L2RA 3M4QA 2RH2A 3X28B 2KBTA 2KT1A 1YI2T 3EG1A 4QT7A 3G6ET 1JJ2A 1VQPT 2DETA 1Q86R 4C8QB 4HT9A 1VYVA 3JRZA 1E6GA 2DXUA 3X24B 3A8HB 5FU7B 4OB1B 4BUGA 2DJQA 1S72T 1VQLT 4KH1B 3HSBA 1M2OA 4M77G 2EW3A 4JRKA 1X01A 3CC2T 1O75A 3FIFA 1I1JA 4F17A 2QDYB 2LC4A 4A53A 2LDMA 4RUGA 3CD6A 1VQNQ 1UE9A 2D6FA 1WHKA 3QKJA 3NETA 2EJ9A 3HXYA 2D0NA 3WVDB 1GRIA 3VS4A 4OMFB 5GAN6 4O2DA 2K7AA 1Q7YR 2BTTA 3PE0A 3OYCA 1B70A 4JDSA 2M1HA 1VQLA 3BW1A 2QHUA 2DNUA 3LYIA 1ZUKA 1EZZB 1U8RA 1SESA 1PNJA 1G3SA 1PRMC 2OTJT 2CZ7B 2DF6A 4RG2A 3JCMg 4BE2A 1ZBJA 3J7AF 2HBPA 2A36A 4Z02A 2ZPGB 4F7UG 1D1AA 4Y28E 3OW2P 2ZZEA 2DAQA 3ZBDA 4C8QG 2JM9A 4P72C 3X26B 4J6WA 3SEMA 1H4QA 5IXFA 3E19A 1OQKA 2NUTA 3MO8A 2KAFA 3UDCA 3BJUA 3JCMh 2AKKA 1AZEA 5C53B 3HFOA 2V1QA 1KMNA 4JLIA 3HY0A 8AT1B 4P5NA 4P75C 1UGPB 3GLXA 4P3OA 3PVQA 2LJ3A 4Z88A 4K86A 3OS1A 2DXBA 4DBQA 2ODRC 3L2UA 2LQ8A 4LN2A 2XKOC 1MNEA 2LT4A 3CQTA 4J9GA 1RACB 3P8DA 2P0QA 1J5WA 2YRVA 2R57A 1JXOA 2E6ZA 4H2TA 1I0CA 2CP7A
chains in the Genus database with same CATH topology
3GNGA 5KCHA 1BBUA 5I2SA 1N27A 1UB4A 3TU4K 5FU6B 1Y07A 4HKEA 3RESA 1G5IA 4H2UA 3EFRA 4N4IA 3J81E 2DPPB 3OSVA 5C51B 3SWNB 2QHTA 5KH6A 4CH4A 2PMEA 1Z7MA 3M5AA 2CJAA 5ELNA 3N5BB 1V29B 1H4TA 4LDVA 1JB0E 1M9SA 2ODRD 3P8HA 4XTWA 1N8RU 2XDPA 3S6WA 2RJDA 4RG8A 1VQMA 2RHXA 3ERRA 4P3NA 4M7AC 4YPFA 1I4K1 5KNNA 1QP2A 3IKLA 1NZ9A 2EWNA 3A7UA 3V7SA 4FM4B 3ME9A 4B9WA 3CCEA 2RJEA 3QO3A 4PJOG 4OB0B 3DLMA 2CZ6B 4HCZA 4C0ZA 4ZN3A 4RCCA 4BACA 1U1TA 1KHIA 2DTHA 3QO7A 1EIFA 5IAYA 3M57A 3NTHA 3RL6A 3QNEA 3QZ5B 4K88A 1B7YA 2V8IA 1QF6A 3VUBA 3QO5A 2JNGA 4EPCA 2DIQA 1KQSA 3CC4A 4GLKA 4RQEA 3VYHB 5KE2A 4YCVA 4TVRA 2DZCA 4L5GA 2ARTA 1JJCA 4JUVA 2EFIA 3TEHB 2WACA 1D3BB 4FT2A 3NFCA 2PVDB 4QQ6A 3CCET 2VXEA 3HP9A 1E22A 4ZTJA 2XI9A 2K5IA 3A7RA 3NTIA 2JVVA 1EIYB 3VQVA 3QXEB 3M59A 2M16A 4LNSA 3F70A 4UP8A 3SDZA 3HXWA 2P5IA 4J5YA 4H2XB 2LNVA 1LJOA 5K1PA 4JS4A 2O4XA 4CS2A 3PMIA 3IG2A 2E6NA 2B8AA 3E1SA 4C8QA 2K3XA 5K1XA 1KHCA 3A8GB 3G7ZA 2GFAA 4F7UF 2ZZFA 1MHNA 2ZTGA 1W66A 3VV0A 3CCJT 4FIBA 5GMKl 3OD1A 3OYHA 1NJ1A 2P0KA 2XU8A 4TVYA 2ZPIB 3R07A 4XK8E 4N4HA 3QBYA 2IY5A 1B70B 5GMKm 3KBGA 4PL6A 2ZR3A 1B34B 3CCSA 1KQ1A 2HD0A 4OGEA 4WI1A 2ZNIA 1BI2A 2K5FA 1UEBA 3KFUA 3A8LB 5LJ3d 5DM7R 1NYRA 4MDXA 3NENA 1BI0A 3L2VA 2V8KA 4MZTA 4UP9A 4ELYC 5CK9A 4VUBA 1I81A 3UFGA 2I4OA 3LSQA 3CXCA 3G4SA 2L8DA 3CMQA 2K2VA 3HRTA 5GMKh 5GANd 2LX9A 5A0DA 3PMTA 1IZ6A 1NPRA 2RHSA 3W3SA 4MMLA 2EQUA 3HRUA 4JRPA 4CH6A 4MZPA 1NJ8A 3CCLT 3E9FA 4QW2A 1E1TA 4YTLA 5DLOA 3HXXA 2HNIA 4WJ3M 3HFNA 1K8AC 1VQ8T 2MAMA 2OAUA 4J6XA 3MF2A 4C8QD 4LDUA 4Q6GA 1S72A 2A7YA 3CCJA 4CS3A 3J80E 3CPWA 4ME7A 4E51A 2X4WA 4ZTUB 4M75E 1UGSB 1H4SA 3ZEHA 1QVFA 1VQOT 4KUIA 1XNIA 1WJSA 2GCXA 4NS5A 2LCLA 3TCJA 3GOXA 4IUTA 2Y4YA 4TTVA 4C0GA 4ELZC 5GAOq 1NPPA 4YRFA 4O6JA 4TQFA 4HCCA 2A3LA 4YRRA 1HK9A 5GAN2 4ZTZB 2CIMA 2ZPEB 3OQ5A 2JTFA 2DVEA 4PJOD 4P74C 4M75C 2ZZGA 5GANe 4BY6C 4P71C 1ASYA 3G71T 1VQ9A 4YDQA 4PJOB 1YFRA 3CCLA 4M7DG 1I5LA 2ZIMA 2JZ2A 2PVOB 1ZBXA 2F5TX 1BIAA 2HAXA 2MWOA 4Q5WA 2KDSA 1BI3A 5D6XA 1NJ6A 1GGMA 1U1SA 4UC4A 3HFZB 1YITA 1Y7XA 4M78B 5F5WA 5GMKe 1LYLA 4J7FA 1VQ7A 5GMKj 5GAN5 3RACA 3C12A 3DB3A 3E9IA 1K73U 3O8VA 3I56A 1KC8C 1NJIC 2CJ9A 2QQSA 3ICAA 4PNOA 2QQBA 4BD3A 4YCUA 3CCMT 2QA4A 2RA2A 5GANj 2D9TA 4RMOA 2PUOB 2E64A 4KQEA 2CZ0B 3FJPA 5IT9E 3L2QA 1X2GA 4LD9K 4H2XA 1EFWA 3MEYA 4XU2A 1JJCB 3L4GA 3FB9A 1WPYA 3DKMA 3CCRA 4PKCC 1I8FA 2CGHA 3VKIA 2Y4XA 5LJ5d 1PYSA 4V2SA 4NOYA 4M7AE 5AYFA 3UT1A 3A32A 1M4ZA 3MF1A 1YCYA 1BBWA 5D6WA 5L8RE 4C0FA 1RIQA 1LOJA 4C92A 4M77E 2ZIOA 2C06A 3M55A 3BFMA 5CKDA 2DTOA 4M7AA 2AMCB 4K87A 2ZGWA 2KMTA 4C5EA 1YGBA 1QW1A 3JCMb 3QTCA 2RHZA 1EQRA 1G5HA 4PG3A 3GP8A 1KQ2A 1BIBA 2ZXFA 3LC0A 4M75F 3CCUT 4X9DA 4YRNA 3Q1JA 2EJGA 4E7KA 1Q82C 4Q15A 4HWOA 5GAMh 4J6YA 3OB9A 3BY7A 2LCCA 2F5KA 3CBMA 3C4SA 4II1A 4LDWA 1WGSA 3OMGA 4M77C 4RMFA 4J8OA 3ER0A 3QUIA 5GMKi 4TQDA 4UP7A 2EIFA 1Q81U 4A54A 4H2SA 4HT4A 3JCMf 3ZFJA 2QI2A 2RD1A 5LJ3e 4C5GA 1MGQA 2E41A 4M75D 1NJ5A 5FU6C 4PJOC 3HKSA 4A4KA 2DIGA 2Q5HA 3NTKA 4LVJA 2YHTA 1FXXA 3E9GA 5LJ5j 2ZT5A 5ELOA 4G84A 3OYFA 4J7IA 4YCWA 4EMKC 3CCVT 2E5AA 4EMGA 3OSSC 2RK1A 5DY9A 1G3WA 1OZ3A 4AH6A 4OP0A 2VXFA 1K73C 1KQSS 3T9NA 4JJNK 5LJ5g 1WLEA 2A8EA 4C92D 2ZCFB 4E7IA 1SSFA 2O4XB 5CQYA 5CR2A 5HK0A 2LTOA 2L3RA 4XTXA 5GAN8 3OS0A 3WVEB 1N8RC 1KMMA 5GAOr 3M53A 1B8AA 1UGQB 2K5LA 5CKBA 4YRJA 1Y96A 4OB2B 4XAXB 2ALYB 2RHQA 3I7FA 3JB9G 2RHUA 3A5ZB 3RKWA 1FWZA 4BDZA 2FB7A 4M78C 5GAOp 3LWHA 5C0MA 3HXZA 2HQXA 1VQ7T 2AHJB 3OS5A 2VV5A 2EJFA 1N9SA 2VGMA 5M9OA 5J39A 1YITT 4TVAB 4HCBA 3QSUA 2DXCA 2ZPHB 4TWAA 3UWNA 4J83A 3A5YA 1B34A 4ATOA 4P3PA 1M1KU 4C8QF 1YJNA 3MHXA 3JSCA 3I56T 1DJ7B 3GF5A 4M78D 3CMEA 4J15A 1AHJB 3ASKA 2AKWA 5CVIA 1VQ4A 3L4GB 1G51A 3M4YA 2M9UA 2E3CA 2DU5A 2ZPBB 1W2BA 4Y91A 1ZQ1A 2O01E 4RKUE 5CKHA 1Y96B 4DPGA 4M7AG 2KSSA 3A5ZA 2XDBA 4IUQA 2VC8A 3VJPA 4C92F 4XEOA 3FLGA 3OYAA 1RI0A 2Q7GA 2EQJA 3CMET 2DZ9A 3CCRT 4TVAA 2AMCA 1X75C 4PLLA 3GIBA 3PCOA 3RERA 3QG1A 5HY6A 4DOWA 3I55A 3HHTB 2FVUA 3JAME 4M7AF 1KC8U 5I2MA 3A8MB 1EIYA 4NCXA 3LLRA 2I4LA 2QXFA 3RGLA 1FYFA 2JUFA 4ZTFA 1X56A 4X9CA 1VQ6A 2QQAA 5GAMg 1Q86C 3HY1A 3TEHA 5FRMA 3NEMA 3JB9F 2DJZA 2J3LA 3VUZA 1M5Q1 4ZGEB 2ARSA 5E3IA 2XHCA 4C5HA 2DK3A 5GAN3 1M90U 3QJ6A 1JRIA 2VGNA 5I21A 4JRIA 4XQ3A 4YREA 3CCQT 2PMFA 3A8OB 3WQZA 2LRQA 4DOVA 5LJ5f 4M7AB 2QQRA 3G4ST 2XICA 2Q7EA 2XD0A 5KE3A 4FT4A 4RCBA 1ATIA 1VQKT 4WF2A 2WSEE 2BKDN 2RI5A 2GFUA 2JOYA 3IALA 4F7UE 4M7DA 2XGTA 2DD5A 1X2HA 5KCOA 1BKBA 2ZT8A 4OF1A 2ZINA 1BI1A 3JCMW 3VQWA 3HTZA 4KUDK 3CCST 4QVCA 2FHDA 3I55T 1R8OB 2E5QA 3OYMA 3EFSA 1WU7A 1XTDA 3OBWA 3C94A 2WSCE 1P92A 2PUKB 4M7AD 4YRLA 4YRIA 5GAMj 3TUPA 3OYLA 2DEQA 5C52B 4C92E 4M77F 4R55A 4H02A 1YJNT 3KUFA 4F7UB 2K4YA 1D3BA 3LGFA 3L2WA 1LNXA 1KOGA 4KT0E 2ZCEA 3MCAB 4FL6A 4N0AC 3TEGA 1QVPA 4OB3B 5LJ5e 1VQ4T 2P0PA 1OI1A 5GAOn 1PSFA 2KQWA 5GAMf 4L87A 4M75B 4YRTA 1IL2A 1M90C 2ZNJA 3MEVA 3LWIA 2OTLA 2K3YA 4BI3A 3V8JA 5LJ3h 5LJ3j 2QEXT 3VU3C 2EKOA 3OYNA 1YIJT 2LQKA 5GAMd 2DXTA 2OTJA 3V8KA 4H2YA 3DLLA 1G5VA 2E12A 1QVGS 1YB3A 3V8LA 5LL6S 2XG8D 4QQGA 1Q81C 2I4MA 4M77B 4M7DD 3CEYA 11ASA 1TH7A 4YRMA 5LJ3g 4FU6A 2AKWB 1WQWA 4YRQA 12ASA 3JCMP 4NL3A 4O5VA 4JS5A 1ADJA 1VQ6T 3HRIA 4N4GA 4P75A 3CPFA 1K9MU 3VYGA 3IKMB 4JLGA 5GANg 2EQMA 4YYEA 4DA4A 3CCVA 3PFSA 2RM4A 3CC4T 1B76A 4YP0A 3UPUA 1EOVA 1RL2A 3MEUA 5GANh 4TVWA 2QHVA 3OW2A 2X4YA 3OYEA 3JCMd 1M1GA 4P73C 3X20B 3QIIA 1OZ2A 4ZGDB 5CO7A 1WJRA 2CKKA 4CRIA 1VUBA 4M78E 3SWNC 2EQKA 5FU7C 4DQ2A 1H641 4E7JA 3META 4X34A 2K57A 2MI6A 3HRSA 2DQ3A 4CI0C 1YJWA 3RF1A 1B7YB 3EAEA 1VQ5A 2KK4A 4BI4A 4PHCA 4XTVA 4MMKA 3HFVA 3PIPA 1YIJA 4BDYA 3REUA 2ARUA 2MMPA 4PJOF 3CMAT 2G3RA 2NS6A 4QQDA 4KR3A 2Q7HA 1N6AA 2L5QA 3FC3A 4RDXA 1WYDA 4QVZA 1YFSA 2F69A 1QP3A 1NJIU 4M77D 3A7AA 4LDXA 4C92B 1L0WA 3OYGA 4M7DB 5A0LA 1YHQA 4LDYA 5GAOm 1KD1U 1X55A 1VQOA 1K9MC 2D0QB 4CS4A 4A4EA 4E47A 3DSQA 2XDDA 1WNLA 4OGCA 3CBPA 3QJYA 3QYGB 3JB9I 4EMKA 2H3JA 3S3OA 5FRNA 1VQZA 3H8ZA 5CAIA 3OYKA 5IN1A 3P8YA 2RB6A 3SWNA 3HXVA 1H4VB 4PJOA 3QHSA 3MEAA 3CCQA 3G1ZA 4XU0A 4EDUA 5HGQA 2QHSA 2QA4T 3RUXA 1Q82U 4GY5A 4M7DF 4P72A 4C92G 3CXCS 3VQYA 4KR2A 4HWRA 3OS2A 3JB9H 4IUVA 3RMSA 4C8QE 3CBOA 2I4NA 4C8QC 2Y90A 2I2LA 2WSFE 4HA8A 1BYMA 1SERA 1G3YA 3HRKA 4QVDA 2C7IA 4C0DB 2IY5B 3MEWA 3R6OA 4P73A 4IUUA 2DQ0A 3OYYA 4R56A 3VQXA 2KVQG 4G85A 1YI2A 1X54A 3CC7T 4M77A 1NJ2A 3SFMA 3LSSA 2EYQA 3LGLA 3MQZA 3RMQA 5D6YA 2GQVA 4YRKA 4M78F 2QTXA 4BWAA 4A4HA 1YJ9A 1W4SA 4BE0A 4E7LA 3CCUA 1HTTA 1KG1A 2YLBA 3PZCA 4CH3A 5CCAA 4M78A 4EO4A 2LVMA 4KULA 1M1FA 2BUDA 2ZR2A 3E9HA 3PTAA 2C8MA 2EAYA 5C6SA 3NELA 1IREB 1YJ9T 2XIDA 4H2VA 2ZT7A 3URGA 5FROA 1PSEA 2CYZB 3V7CA 4XU3A 1EVLA 1M1KC 2ZPFB 3X25B 3QYHB 3CMAA 3CC7A 2DU7A 3M58A 3M54A 3OYDA 1E1OA 4BW9A 2R5AA 5CKEA 4P71A 1G3TA 4L59A 2BIVA 5GAN7 3P8TA 4XTZA 1Q7YC 4JRQA 4D6WA 5A2QE 4N0AA 2JTMA 5FLXE 1VQ8A 3H6ZA 4HWTA 4BY6B 1O9SA 1YJWT 4LVKA 1Z7NA 1H3ZA 2CS7A 3CD6T 3LH0A 5GAN4 5CIUA 3OA6A 3V7RA 2RI3A 4RQFA 3M4GA 2DKGA 2Q5IA 1XOVA 4XU1A 3HPWA 4WJ4A 3GPLA 3L42A 4HVCA 3P8VA 3MP8A 3PIOA 1VQPA 3FEOA 3G6EA 3L1AA 3RKYA 3FDRA 3JCMQ 4OVAA 5J3BA 2KY9A 4FSXA 3LW5E 1QVGA 1Q7YU 4M78G 4A4GA 4M75A 1VIFA 1ZHIA 4P74A 1XQHA 2P4TA 3S3MA 3OYJA 3GNFB 2EL9A 2R58A 3C95A 1YFTA 5GAOl 3AHUA 3PNWC 4YROA 3TREA 4A4FA 1SETA 4XTYA 3KXTA 4ZGJB 5LJ3f 2PU9B 2IG0A 2R5MA 4ZN1A 2CZ1B 2X35A 1QE0A 2CJBA 2XK0A 2VUBA 2PVGB 3LX7A 3RIRA 3WXMB 2RHYA 4UPAA 5CKFA 3JB9D 2L89A 2X4JA 4PLIA 1VQMT 1M8VA 3DB4A 1X6OA 4C92C 3VBBA 2QEXA 1PYSB 3JCMV 3JCMc 2E10A 5CQXA 2ALYA 2RHQB 3BDLA 4LVIA 2MF2A 2FL7A 2DD4A 2E70A 1UGRB 3OYIA 1VQNT 1VQ5T 1NNHA 4YRGA 5HKCA 3JCMe 5GAMe 3M9QA 5HK3A 2J3MA 2G4CA 2RI2A 2V8JA 1WJQA 2RJFA 3PT9A 2HQEA 4EMKB 2RK2A 3QPHA 1EVKA 2JN0A 4CH5A 3UGQA 1NE8A 1Q86U 1YBYA 1K8AU 3BDUA 3QO8A 4EX5A 1SRYA 4IURA 4XTUA 2XTIA 2RJCA 5LJ5h 2LT1A 1NYQA 2VYTA 2ZZDA 3P8BB 5A0GA 2RO0A 3OW2S 2YLCA 4M7DC 1WQ7A 2E65A 1VQKA 1ASZA 4LVLA 2RHIA 2X4XA 1N9WA 3OY9A 3UH0A 2NLUA 1ADYA 1JBMA 3QZ9B 3OMCA 3HFZA 3MP6A 4C5IA 4LD6A 4YRSA 1KD1C 4YRPA 1VIEA 3OYBA 4OLFA 2QQ9A 3PGGA 4X5OA 4B9XA 1W2BS 4EMHA 1FX7A 1USYA 1YHQT 3SB2A 3SD4A 2OTLT 4IUPA 2DDZA 3CC2A 2E1HA 4HT8A 4F7UA 4M7DE 1GXIE 3MP1A 2P0LA 2ZT6A 3UGTA 5EG2A 3JB9J 1JJ2S 3CCMA 3M56A 2MWPA 5DLQE 1C0AA 4BI8B 4ZIBA 4PJOE 4HWPA 4C0DC 4YRCA 3A31A 1N9RA 3S3NA 3INZA 3G71A 1VQ9T 4IKFA 3M4PA 3REXA 2FYKA 3PCOB 1OYXA 3TEEA 1VQNA 1HXDA 3RKXA 2GF7A 3HL8A 4XEMA 3L2ZA 1Y71A 1E24A 2DO3A 4BE1A 4H2WA 3FRNA 3QDRB 4MDWA 3JCMX 3A74A 4LVMA 1USYC 4E7HA 3OBYA 2IVWA 2DTIA 2M0OA 5J26A 3HXUA 1HC7A 5GANf 3JCMJ 4MZMA 4KBMB 3CPWS 4BB7A 4NL2A 4M75G 4L6V5 2PQWA 1QVFS 4HWSA 2RHSB 3L2RA 3M4QA 2RH2A 3X28B 1YI2T 3G6ET 1JJ2A 1VQPT 4C8QB 4HT9A 3JRZA 2DXUA 3X24B 3A8HB 5FU7B 4OB1B 4BUGA 1S72T 1VQLT 3HSBA 4M77G 4JRKA 1X01A 3CC2T 1O75A 3FIFA 2QDYB 2LC4A 4A53A 2LDMA 3CD6A 2D6FA 3QKJA 3NETA 2EJ9A 3HXYA 3WVDB 4OMFB 5GAN6 4O2DA 3OYCA 1B70A 4JDSA 2M1HA 1VQLA 3BW1A 2QHUA 3LYIA 1U8RA 1G3SA 2OTJT 2CZ7B 4RG2A 4BE2A 3JCMg 3J7AF 2HBPA 4Z02A 2ZPGB 4F7UG 4Y28E 2ZZEA 2DAQA 3ZBDA 4C8QG 4P72C 3X26B 4J6WA 1H4QA 3E19A 3MO8A 2KAFA 3UDCA 3BJUA 3JCMh 5C53B 3HFOA 1KMNA 4JLIA 3HY0A 4P5NA 4P75C 1UGPB 3GLXA 4P3OA 4K86A 3OS1A 2DXBA 2ODRC 3L2UA 2LQ8A 2XKOC 2LT4A 3P8DA 2P0QA 1J5WA 2YRVA 2R57A 2E6ZA 4H2TA 1SESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XU1 A;  4YRL A;  4YRI A;  2RA2 A;  4WJ4 A;  5GAN j;  5GAM j;  1BBU A;  2E64 A;  3TUP A;  4KQE A;  3FJP A;  2DEQ A;  4HVC A;  5C52 B;  1X2G A;  4C92 E;  3P8V A;  4H2X A;  4M77 F;  1EFW A;  4H02 A;  3RES A;  1G5I A;  3L1A A;  3RKY A;  3MEY A;  4H2U A;  4XU2 A;  1JJC B;  3L4G A;  3EFR A;  3JCM Q;  3FB9 A;  4F7U B;  1WPY A;  1I8F A;  1D3B A;  1LNX A;  1KOG A;  2CGH A;  5C51 B;  5LJ5 d;  4M78 G;  3SWN B;  4M75 A;  2ZCE A;  4N0A C;  1PYS A;  4P74 A;  2QHT A;  4V2S A;  4NOY A;  4CH4 A;  4M7A E;  2EL9 A;  2PME A;  3TEG A;  1Z7M A;  5LJ5 e;  3A32 A;  1YFT A;  5GAO n;  2CJA A;  5GAM f;  5GAO l;  4L87 A;  4M75 B;  5ELN A;  3AHU A;  1YCY A;  3MF1 A;  4YRO A;  1BBW A;  4YRT A;  1IL2 A;  1H4T A;  2ZNJ A;  1SET A;  4XTY A;  3V8J A;  5LJ3 f;  5LJ3 h;  2ODR D;  1RIQ A;  4XTW A;  1LOJ A;  4C92 A;  5LJ3 j;  3VU3 C;  4M77 E;  5GAM d;  2DXT A;  4H2Y A;  3V8K A;  2ZIO A;  1QE0 A;  2CJB A;  3ERR A;  4P3N A;  1YB3 A;  4M7A C;  3RIR A;  1I4K 1;  3BFM A;  3V8L A;  4YPF A;  2DTO A;  4UPA A;  4M7A A;  2AMC B;  2I4M A;  5KNN A;  3JB9 D;  4M77 B;  4K87 A;  3IKL A;  4M7D D;  2EWN A;  2ZGW A;  11AS A;  1YGB A;  1TH7 A;  3A7U A;  4YRM A;  5LJ3 g;  1M8V A;  2AKW B;  3V7S A;  1WQW A;  3QO3 A;  4PJO G;  4YRQ A;  4C92 C;  12AS A;  3JCM b;  3QTC A;  3VBB A;  1EQR A;  3JCM P;  1PYS B;  3JCM V;  4NL3 A;  1G5H A;  4PG3 A;  3JCM c;  1KQ2 A;  1BIB A;  2ZXF A;  1ADJ A;  3LC0 A;  4RCC A;  2E10 A;  4M75 F;  1U1T A;  4X9D A;  4YRN A;  2ALY A;  2RHQ B;  2DTH A;  3QO7 A;  2EJG A;  3HRI A;  4P75 A;  4Q15 A;  3IKM B;  4HWO A;  5GAM h;  5GAN g;  3RL6 A;  3QNE A;  1NNH A;  4K88 A;  4YRG A;  4YYE A;  4J6Y A;  1B7Y A;  3JCM e;  5GAM e;  2RM4 A;  2J3M A;  1QF6 A;  3BY7 A;  1B76 A;  3QO5 A;  4YP0 A;  4M77 C;  2G4C A;  4RMF A;  4RQE A;  1EOV A;  4EMK B;  5GAN h;  3QUI A;  1EVK A;  2QHV A;  4TVW A;  4YCV A;  5GMK i;  4TQD A;  2JN0 A;  4UP7 A;  4CH5 A;  2DZC A;  4A54 A;  3JCM d;  2ART A;  4H2S A;  3UGQ A;  3JCM f;  1JJC A;  4P73 C;  4JUV A;  2RD1 A;  3TEH B;  5LJ3 e;  3BDU A;  3QO8 A;  1MGQ A;  2E41 A;  4M75 D;  1NJ5 A;  4EX5 A;  1D3B B;  1SRY A;  4PJO C;  4M78 E;  4XTU A;  2Q5H A;  3SWN C;  2XTI A;  4DQ2 A;  1H64 1;  2K57 A;  2YHT A;  5LJ5 h;  2DQ3 A;  5LJ5 j;  2ZT5 A;  5ELO A;  4G84 A;  1NYQ A;  3RF1 A;  2VXE A;  1B7Y B;  4YCW A;  1E22 A;  4EMK C;  2E5A A;  4EMG A;  2YLC A;  5DY9 A;  3A7R A;  4M7D C;  4AH6 A;  1WQ7 A;  4OP0 A;  2VXF A;  4PHC A;  1EIY B;  2E65 A;  4XTV A;  4MMK A;  3VQV A;  3HFV A;  1ASZ A;  5LJ5 g;  1WLE A;  4C92 D;  1N9W A;  4LNS A;  3REU A;  4UP8 A;  2ARU A;  3UH0 A;  4PJO F;  1ADY A;  3HXW A;  1JBM A;  2P5I A;  3HFZ A;  4YRS A;  4J5Y A;  2Q7H A;  4KR3 A;  4YRP A;  4H2X B;  4XTX A;  5GAN 8;  1LJO A;  5K1P A;  4RDX A;  4OLF A;  1WYD A;  3PGG A;  1KMM A;  4CS2 A;  1YFS A;  5GAO r;  4X5O A;  3IG2 A;  1B8A A;  4YRJ A;  4C8Q A;  4EMH A;  1Y96 A;  2ALY B;  2RHQ A;  4M77 D;  3A7A A;  3I7F A;  3JB9 G;  4C92 B;  1USY A;  3RKW A;  1L0W A;  5K1X A;  4M7D B;  5GAO m;  2FB7 A;  4M78 C;  3SB2 A;  5GAO p;  4F7U F;  1X55 A;  2ZZF A;  2DDZ A;  2ZTG A;  2E1H A;  3HXZ A;  4HT8 A;  4CS4 A;  4F7U A;  4M7D E;  2P0L A;  3DSQ A;  1W66 A;  2EJF A;  2ZT6 A;  3UGT A;  1N9S A;  1WNL A;  3JB9 J;  4TVA B;  5GMK l;  3QSU A;  3OD1 A;  1NJ1 A;  1C0A A;  4TWA A;  4TVY A;  3JB9 I;  3R07 A;  4EMK A;  3A5Y A;  1B34 A;  4ZIB A;  4P3P A;  4PJO E;  1VQZ A;  4HWP A;  2IY5 A;  1B70 B;  4YRC A;  3A31 A;  5CAI A;  1N9R A;  5GMK m;  4C8Q F;  2ZR3 A;  1B34 B;  3INZ A;  1KQ1 A;  2RB6 A;  3SWN A;  3HXV A;  3P8Y A;  1H4V B;  4M78 D;  4J15 A;  4PJO A;  3QHS A;  4WI1 A;  2ZNI A;  3M4P A;  2AKW A;  3REX A;  3KFU A;  3G1Z A;  2FYK A;  5LJ3 d;  1NYR A;  3L4G B;  4XU0 A;  1G51 A;  5HGQ A;  3PCO B;  2QHS A;  3NEN A;  1HXD A;  3RKX A;  4XEM A;  3L2Z A;  3RUX A;  2E3C A;  4UP9 A;  4M7D F;  4P72 A;  1E24 A;  4C92 G;  1I81 A;  3UFG A;  3VQY A;  4KR2 A;  2DU5 A;  4HWR A;  2I4O A;  4H2W A;  3LSQ A;  4Y91 A;  3JB9 H;  3JCM X;  3CMQ A;  3A74 A;  1USY C;  1Y96 B;  4DPG A;  4C8Q E;  5GMK h;  5GAN d;  4M7A G;  2DTI A;  3A5Z A;  2I4N A;  4C8Q C;  2Y90 A;  2I2L A;  4HA8 A;  1SER A;  2VC8 A;  3HXU A;  3HRK A;  4C92 F;  4QVD A;  2C7I A;  1HC7 A;  4XEO A;  5GAN f;  3JCM J;  2IY5 B;  4P73 A;  2RHS A;  2DQ0 A;  4NL2 A;  3W3S A;  4MML A;  4M75 G;  2Q7G A;  3VQX A;  2DZ9 A;  4HWS A;  2RHS B;  4G85 A;  4TVA A;  1X54 A;  3M4Q A;  2AMC A;  4M77 A;  3GIB A;  3PCO A;  3RER A;  1NJ2 A;  1NJ8 A;  4CH6 A;  3LSS A;  1E1T A;  4M7A F;  4C8Q B;  4HT9 A;  3HXX A;  4YRK A;  4M78 F;  2HNI A;  4WJ3 M;  3HFN A;  1EIY A;  4NCX A;  2QTX A;  2I4L A;  4BWA A;  2DXU A;  4J6X A;  3MF2 A;  3RGL A;  4C8Q D;  4Q6G A;  1FYF A;  3HSB A;  4CS3 A;  4M77 G;  1X56 A;  4X9C A;  4JRK A;  4E51 A;  1HTT A;  5GAM g;  4ZTU B;  4M75 E;  2YLB A;  3HY1 A;  1H4S A;  1X01 A;  3TEH A;  3PZC A;  3FIF A;  3NEM A;  4CH3 A;  4M78 A;  4EO4 A;  3JB9 F;  4A53 A;  4TTV A;  2DJZ A;  2J3L A;  2ZR2 A;  3E9H A;  5GAO q;  4YRF A;  2C8M A;  3NET A;  2EJ9 A;  3HXY A;  2EAY A;  4TQF A;  3NEL A;  1M5Q 1;  2ARS A;  4YRR A;  1HK9 A;  5GAN 6;  5E3I A;  5GAN 2;  4O2D A;  4H2V A;  1B70 A;  4ZTZ B;  2CIM A;  3BW1 A;  5GAN 3;  2ZT7 A;  2DVE A;  2QHU A;  4PJO D;  4P74 C;  1JRI A;  5I21 A;  4JRI A;  4XQ3 A;  4YRE A;  4M75 C;  2ZZG A;  5GAN e;  4P71 C;  1ASY A;  2PMF A;  3V7C A;  4XU3 A;  4YDQ A;  3JCM g;  1EVL A;  4PJO B;  1YFR A;  3WQZ A;  4M7D G;  1I5L A;  5LJ5 f;  4M7A B;  4F7U G;  2Q7E A;  2ZIM A;  2DU7 A;  2ZZE A;  4C8Q G;  4P72 C;  1E1O A;  1BIA A;  4J6W A;  4RCB A;  1H4Q A;  4BW9 A;  1ATI A;  4P71 A;  1NJ6 A;  4WF2 A;  1U1S A;  1GGM A;  5GAN 7;  3HFZ B;  3IAL A;  3BJU A;  3P8T A;  4M78 B;  4XTZ A;  5F5W A;  4F7U E;  4M7D A;  2XGT A;  3JCM h;  1X2H A;  5GMK e;  5C53 B;  4N0A A;  3HFO A;  1KMN A;  4JLI A;  2ZT8 A;  3HY0 A;  1LYL A;  2ZIN A;  5GMK j;  3JCM W;  5GAN 5;  3HTZ A;  4HWT A;  4P75 C;  3RAC A;  3VQW A;  3E9I A;  4P3O A;  4QVC A;  4K86 A;  1Z7N A;  2ODR C;  3EFS A;  5GAN 4;  1WU7 A;  3V7R A;  4RQF A;  1J5W A;  2CJ9 A;  3M4G A;  3ICA A;  4PNO A;  4H2T A;  2DKG A;  2Q5I A;  4M7A D;  1SES A;  4YCU A; 
#chains in the Genus database with same CATH topology
 2SEM A;  3GNG A;  5KCH A;  4LUE A;  1BBU A;  5I2S A;  1N27 A;  1UB4 A;  3REA B;  2VB6 A;  1UG1 A;  3TU4 K;  5FU6 B;  1Y07 A;  4HKE A;  1K9M R;  1W70 A;  2M0Y A;  4PJL A;  3RES A;  1G5I A;  4GLM A;  4H2U A;  3G6E Q;  1YJ9 Q;  3EFR A;  4N4I A;  3CME Q;  3LH5 A;  2CP2 A;  3J81 E;  4HVW A;  2J6K A;  2DPP B;  3OSV A;  2BZX A;  3PVL A;  5C51 B;  3SWN B;  1QCN A;  1NYF A;  2QHT A;  5KH6 A;  1RAF B;  5GJV B;  4CH4 A;  2PME A;  1Z7M A;  1N8R R;  1E7O A;  3M5A A;  2CJA A;  1BCO A;  5ELN A;  5ECA A;  1YWP A;  3N5B B;  3EGX A;  1V29 B;  1H4T A;  4LDV A;  1JB0 E;  1T0J A;  1M9S A;  2DMO A;  2ODR D;  1X6B A;  3P8H A;  1WXT A;  4XTW A;  2L2P A;  5KYY A;  1Z9Z A;  2ROT A;  1N8R U;  2XDP A;  3S6W A;  2RJD A;  4WTO B;  4RG8 A;  1VQM A;  2RHX A;  3ERR A;  2QGG A;  2K3B A;  2EPD A;  3CC7 Q;  1IXD A;  4P3N A;  4DBR A;  4M7A C;  2CP5 A;  1I4K 1;  4YPF A;  1K73 R;  5FWC A;  5KNN A;  1QP2 A;  3IKL A;  1NZ9 A;  2EWN A;  3A7U A;  1W1F A;  2HL3 A;  3V7S A;  4FM4 B;  3ME9 A;  4B9W A;  3CCE A;  2RJE A;  3QO3 A;  4PJO G;  4OB0 B;  2E3I A;  5AT1 B;  3DLM A;  2CZ6 B;  4ORZ A;  4HCZ A;  4CC2 A;  4C0Z A;  4ZN3 A;  1VQK Q;  4RCC A;  4BAC A;  1U1T A;  2PTK A;  1KHI A;  4KH0 B;  2COW A;  2DTH A;  1YIJ Q;  3ZL7 C;  1EIF A;  3QO7 A;  5IAY A;  3M57 A;  3NTH A;  1D0X A;  1ZA1 B;  2KRO A;  3RL6 A;  3QNE A;  3QZ5 B;  4K88 A;  2KRN A;  4Y92 A;  1OU8 A;  1B7Y A;  2V8I A;  1QF6 A;  1ARK A;  3VUB A;  2HEQ A;  1U3O A;  3QO5 A;  2O88 A;  2JNG A;  2MPX C;  4EPC A;  2DIQ A;  3UA6 A;  1KQS A;  3CC4 A;  4GLK A;  4RQE A;  1K0X A;  1NM7 A;  3VYH B;  5KE2 A;  4YCV A;  5KYX A;  4TVR A;  2HZY A;  1JXM A;  2DZC A;  2YUN A;  1ZSZ C;  4L5G A;  2ART A;  1JJC A;  4JUV A;  2EFI A;  4J9C A;  2COZ A;  3TEH B;  4DBF A;  1Q95 G;  4RTW A;  1K9A A;  2WAC A;  1RLQ C;  3M0P A;  1D3B B;  4J9B A;  2YUQ A;  4FT2 A;  2RQU A;  2JS2 A;  3NFC A;  2K79 A;  2DL4 A;  2PVD B;  2J6O A;  4QQ6 A;  1K0S A;  3CCE T;  2VXE A;  1IO6 A;  1AVZ C;  4DEX A;  3HP9 A;  1E22 A;  4ZTJ A;  1UJ0 A;  2XI9 A;  4DBH A;  1V76 A;  2K5I A;  3A7R A;  3NTI A;  2JVV A;  1EIY B;  4JJC A;  2EYZ A;  3VQV A;  3QXE B;  3M59 A;  2LP5 A;  2V1R A;  2M16 A;  2GTO A;  4LNS A;  3F70 A;  1VQ9 Q;  4UP8 A;  3SDZ A;  3HXW A;  2P5I A;  2KXD A;  5D7U A;  2HKQ B;  4J5Y A;  2LNV A;  4H2X B;  2HBW A;  5HCK A;  1LJO A;  2XMF A;  5K1P A;  4JS4 A;  2O4X A;  4CS2 A;  3PMI A;  1Y57 A;  3IG2 A;  2E6N A;  3A1P A;  2B8A A;  2FPF A;  3E1S A;  4C8Q A;  2JS0 A;  1YN8 A;  1M3C A;  1IRX A;  1D0Y A;  3MPU B;  2K3X A;  5K1X A;  1KHC A;  3VS3 A;  1UJY A;  3A8G B;  3G7Z A;  2M02 A;  2GFA A;  4F7U F;  1G83 A;  2ZZF A;  1MHN A;  1RAA B;  2PZ1 A;  1VA7 A;  2K2M A;  2ZTG A;  2FZC B;  1TS9 A;  2E3H A;  1W66 A;  3VV0 A;  3I9Q A;  3CCJ T;  4FIB A;  5GMK l;  3OD1 A;  3OYH A;  1NJ1 A;  2P0K A;  2XU8 A;  4TVY A;  2ZPI B;  3R07 A;  4XK8 E;  4N4H A;  4ANJ A;  1NJI R;  3QBY A;  2HCK A;  2IY5 A;  1B70 B;  1ZSZ B;  5GMK m;  3KBG A;  4PL6 A;  2ZR3 A;  1B34 B;  3CCS A;  1KQ1 A;  2KEA A;  2HD0 A;  1HD3 A;  1WDX A;  4OGE A;  4WI1 A;  2ZNI A;  4E7S A;  1BI2 A;  2K5F A;  1TSF A;  1UEB A;  2AZV A;  3KFU A;  3A8L B;  5LJ3 d;  5DM7 R;  1NYR A;  4MDX A;  2X51 A;  4HVV A;  1BI0 A;  3NEN A;  1JO8 A;  1YFN A;  3L2V A;  2V8K A;  1WHH A;  2FZG B;  4MZT A;  4UP9 A;  4ELY C;  5CK9 A;  4VUB A;  1I81 A;  3UFG A;  2FRW A;  2CH4 W;  2I4O A;  1C0M A;  4FYV B;  3LSQ A;  3CXC A;  1AWJ A;  3G4S A;  2JMC A;  2L8D A;  3CMQ A;  1MMG A;  2D8J A;  2NUP B;  1Y0M A;  2SRC A;  2K2V A;  1M90 R;  3HRT A;  5GMK h;  1D0Z A;  5GAN d;  2LX9 A;  5A0D A;  1SKU B;  3PMT A;  1CSK A;  4FSS A;  1IZ6 A;  1NPR A;  2RHS A;  1KFZ A;  3W3S A;  4MML A;  4E6R A;  2EQU A;  5EC7 A;  2OAW A;  1K4U S;  3EG0 A;  3HRU A;  1YIT Q;  4JRP A;  2DYI A;  3UA7 A;  3REB B;  3UAT A;  1QQJ A;  4CH6 A;  3I5S A;  4MZP A;  1NJ8 A;  3CCL T;  3E9F A;  4QW2 A;  2YRD A;  1QMC A;  2IIM A;  3M0U A;  1E1T A;  4YTL A;  5DLO A;  3HXX A;  2P84 A;  2HNI A;  4WJ3 M;  3HFN A;  1K8A C;  1VQ8 T;  5IHN A;  3I56 Q;  2MAM A;  1FMV A;  2OAU A;  4J6X A;  3MF2 A;  4C8Q D;  4LDU A;  4Q6G A;  1S72 A;  2A7Y A;  3CCJ A;  4CS3 A;  1S1N A;  3J80 E;  3CPW A;  2FPE A;  4ME7 A;  4E51 A;  4RTX A;  2X4W A;  2HDA A;  1RAB B;  4ZTU B;  3C0C A;  4M75 E;  2DER A;  1UGS B;  1H4S A;  3ZEH A;  1QVF A;  1VQO T;  4KUI A;  1XNI A;  1WJS A;  2GCX A;  4E2F B;  3U23 A;  4NS5 A;  2LCL A;  3TCJ A;  3GOX A;  4IUT A;  2Y4Y A;  4TTV A;  4C0G A;  4ELZ C;  5GAO q;  1NPP A;  1OEB A;  4YRF A;  4O6J A;  5IHK A;  4TQF A;  2G6F X;  2FZK B;  4HCC A;  2A08 A;  2A3L A;  2CP3 A;  4YRR A;  1HK9 A;  3CC4 Q;  1YJN Q;  2D8H A;  5GAN 2;  1B3Q A;  1ABQ A;  2JXB A;  4ZTZ B;  2CIM A;  2ZPE B;  5KYU B;  3OQ5 A;  2JTF A;  2DVE A;  1QCF A;  4PJO D;  4P74 C;  1WIE A;  4M75 C;  2ZZG A;  5GAN e;  4BY6 C;  4P71 C;  1ASY A;  3G71 T;  1VQ9 A;  4YDQ A;  2JW4 A;  4PJO B;  1YFR A;  1KQS P;  2JM8 A;  4JZ4 A;  3CCL A;  1VQM Q;  1I5L A;  4M7D G;  1ZUY A;  2ZIM A;  3SHW A;  1HSQ A;  2JZ2 A;  2PVO B;  1RAH B;  1ZBX A;  2F5T X;  1BIA A;  2HAX A;  2MWO A;  4Q5W A;  2KDS A;  1BI3 A;  5D6X A;  1NJ6 A;  1U1S A;  4UC4 A;  1GGM A;  3HFZ B;  1YIT A;  1Y7X A;  4M78 B;  5F5W A;  1QLY A;  5GMK e;  1LYL A;  4J7F A;  1VQ7 A;  5GMK j;  5GAN 5;  3RAC A;  3C12 A;  3DB3 A;  2NWM A;  2KRS A;  3E9I A;  1VQ7 Q;  1K73 U;  3O8V A;  1R77 A;  3I56 A;  1KC8 C;  1RAI B;  1V1C A;  1S72 Q;  1NJI C;  1GL5 A;  2CJ9 A;  2QQS A;  3ICA A;  4PNO A;  1UUE A;  3EFO A;  2QQB A;  4BD3 A;  4YCU A;  3CCM T;  2EGE A;  2QA4 A;  2RA2 A;  5GAN j;  2D9T A;  4RMO A;  2ESW A;  2PUO B;  3VS5 A;  2E64 A;  1M3A A;  4KQE A;  2CZ0 B;  3FJP A;  5IT9 E;  3L2Q A;  1SRM A;  1X2G A;  2ZAE A;  4LD9 K;  4H2X A;  1EFW A;  4PFZ A;  2GNC A;  3MEY A;  3VRY A;  4XU2 A;  1JJC B;  3L4G A;  3FB9 A;  1WPY A;  3DKM A;  5L23 A;  3CCR A;  4PKC C;  1I8F A;  2CGH A;  3VKI A;  2Y4X A;  5LJ5 d;  2AT1 B;  1PYS A;  3UF4 A;  2ED0 A;  4V2S A;  4NOY A;  4RTZ A;  4M7A E;  3KFV A;  5AYF A;  3UT1 A;  2LJ0 A;  1GBR A;  3A32 A;  1TUC A;  1IHW A;  1M4Z A;  3MF1 A;  1YCY A;  1BBW A;  5D6W A;  2NYS A;  1TWB A;  5L8R E;  4C0F A;  2JTE A;  2VAS A;  1RIQ A;  1BU1 A;  1LOJ A;  2CSI A;  4C92 A;  4M77 E;  2ZIO A;  2C06 A;  3M55 A;  2JMA A;  2F2X A;  2O2O A;  2RQW A;  4Z89 A;  2RN8 A;  3BFM A;  5CKD A;  2DTO A;  4M7A A;  2AMC B;  2RMO A;  4K87 A;  2KMT A;  2ZGW A;  4C5E A;  1YGB A;  1IB8 A;  1QW1 A;  4HXJ A;  1OX9 A;  1M2V A;  1I07 A;  2M51 A;  4CC3 A;  3EGD A;  1NYG A;  2HQH A;  3CCE Q;  3JCM b;  2VWF A;  3QTC A;  2RHZ A;  1EQR A;  1G5H A;  4PG3 A;  3GP8 A;  1KQ2 A;  1BIB A;  2ZXF A;  2D1X A;  3LC0 A;  4M75 F;  3CCU T;  4X9D A;  4YRN A;  3IQL A;  3Q1J A;  2EJG A;  1WHM A;  4E7K A;  1Q82 C;  3H0I A;  4Q15 A;  2DIL A;  4HWO A;  5GAM h;  1WYX A;  1TG0 A;  1QKX A;  1YNZ A;  4J6Y A;  1ACM B;  1Z9Q A;  3OB9 A;  3BY7 A;  2LCC A;  4WCI A;  2F5K A;  3CBM A;  1OUL A;  3C4S A;  4II1 A;  4LDW A;  1WGS A;  3OMG A;  1SEM A;  4M77 C;  3HTR A;  4RMF A;  4J8O A;  4LXC A;  3QWY A;  4OMM A;  3CCM Q;  3ER0 A;  1GCQ C;  3QUI A;  5GMK i;  4TQD A;  4UP7 A;  2EIF A;  1UGV A;  1Q81 U;  2OTL Q;  4A54 A;  4H2S A;  2CRE A;  4HT4 A;  3JCM f;  3ZFJ A;  1PKT A;  2E5K A;  2QI2 A;  2RD1 A;  1Q82 R;  5LJ3 e;  4C5G A;  1MGQ A;  2J7I A;  2E41 A;  4M75 D;  4RTU A;  1NJ5 A;  5FU6 C;  4JZ3 A;  4PJO C;  8ATC B;  3HKS A;  4OMO A;  4A4K A;  2DIG A;  2Q5H A;  4OML A;  2ATC B;  3NTK A;  1X2Q A;  4LVJ A;  2YHT A;  1FXX A;  3EHQ A;  1M2V B;  3E9G A;  5LJ5 j;  2ZT5 A;  5ELO A;  3EGD B;  4G84 A;  3TVT A;  3OYF A;  4J7I A;  1RAG B;  2QGF B;  4YCW A;  4EMK C;  3CCV T;  2E5A A;  4EMG A;  3OSS C;  2RK1 A;  4FYX B;  5DY9 A;  1G3W A;  1OZ3 A;  4AH6 A;  4OP0 A;  2VXF A;  1NLO C;  1K73 C;  2NUP A;  2JJ9 A;  1KQS S;  4IIM A;  1E6H A;  2QAZ A;  3JV3 A;  3T9N A;  4JJN K;  5LJ5 g;  1WLE A;  2A8E A;  4C92 D;  2ZCF B;  4E7I A;  1AD5 A;  1FMK A;  1SSF A;  1SF9 A;  2L0A A;  2O4X B;  5CQY A;  5CR2 A;  3VRZ A;  5HK0 A;  4JPB W;  5KYN A;  2LTO A;  2L3R A;  2O9V A;  4XTX A;  5GAN 8;  2KRM A;  3OS0 A;  2I0N A;  3VS7 A;  3O5Z A;  3WVE B;  2MCN A;  1N8R C;  1KMM A;  1J3T A;  2F2W A;  1EX4 A;  5GAO r;  3M53 A;  2KNB B;  4OMP A;  3RDV A;  1B8A A;  1UGQ B;  2K5L A;  5CKB A;  4YRJ A;  4KGX B;  3FJ5 A;  1Y96 A;  4OB2 B;  4XAX B;  2ALY B;  2RHQ A;  3I7F A;  3JB9 G;  1FYN A;  5KYY B;  1PRL C;  2RHU A;  3A5Z B;  4LNP A;  3RKW A;  1FWZ A;  4BDZ A;  2FB7 A;  4M78 C;  5GAO p;  4EIK A;  3AT1 B;  3LWH A;  5C0M A;  2A28 A;  3HXZ A;  1WXB A;  2HQX A;  3EH2 A;  1VQ7 T;  2AHJ B;  2YRC A;  3OS5 A;  2VV5 A;  2EJF A;  1N9S A;  1B07 A;  2VGM A;  4RTY A;  5M9O A;  5J39 A;  1YIT T;  4TVA B;  4HCB A;  3QSU A;  2DXC A;  2ZPH B;  4TWA A;  3UWN A;  1SHG A;  4J83 A;  3A5Y A;  1B34 A;  2DL5 A;  4ATO A;  4P3P A;  1M1K U;  2ABL A;  4C8Q F;  2KT8 A;  1YJN A;  2YWW A;  3JSC A;  3MHX A;  3I56 T;  1PD1 A;  1DJ7 B;  3GF5 A;  4M78 D;  3CME A;  1XJW B;  4J15 A;  2EKH A;  4J9E A;  1AHJ B;  3ASK A;  2AKW A;  5CVI A;  1VQ4 A;  3L4G B;  1G51 A;  1Q81 R;  4FYW B;  4LUD A;  3M4Y A;  3CMA Q;  2M9U A;  2E3C A;  2NUT B;  2DU5 A;  2ZPB B;  1W2B A;  4Y91 A;  1ZQ1 A;  2O01 E;  4RKU E;  5CKH A;  1Y96 B;  4DPG A;  1GCP A;  4M7A G;  2KSS A;  3A5Z A;  2XDB A;  4IUQ A;  2VC8 A;  3VJP A;  2BZY A;  4C92 F;  4XEO A;  5FW9 A;  3FLG A;  3OYA A;  1RI0 A;  1PHT A;  1NEG A;  1AWO A;  2Q7G A;  1T3L A;  2EQJ A;  3CME T;  2DZ9 A;  3CCR T;  4TVA A;  2CP6 A;  2AMC A;  1X75 C;  4PLL A;  3GIB A;  3PCO A;  3RER A;  3QG1 A;  2W10 A;  5HY6 A;  4DOW A;  3I55 A;  5IHI A;  3HHT B;  2FVU A;  3JAM E;  3I55 Q;  1KC8 U;  4M7A F;  5I2M A;  2HSE B;  3EG9 B;  3A8M B;  1EIY A;  4NCX A;  3LLR A;  2I4L A;  2QXF A;  2H3E B;  3RGL A;  2KYM A;  1FYF A;  1BCM A;  2JUF A;  4ZTF A;  1X56 A;  4X9C A;  1K8A R;  1VQ6 A;  2QQA A;  2L3S A;  5GAM g;  2LZ6 B;  1Q86 C;  4FW1 A;  3HY1 A;  2ROL A;  3TEH A;  2BZ8 A;  2QA4 Q;  5FRM A;  3NEM A;  3JB9 F;  1KC8 R;  2PNI A;  2DJZ A;  2J3L A;  1AWW A;  2EGA A;  3VUZ A;  1VQP Q;  1M5Q 1;  4ZGE B;  2ARS A;  4OMN A;  1UFF A;  5E3I A;  2VKN A;  2XHC A;  4C5H A;  2DK3 A;  5GAN 3;  1M90 U;  3QJ6 A;  1JRI A;  2VGN A;  5I21 A;  4JRI A;  4XQ3 A;  4YRE A;  3CCQ T;  2PMF A;  3A8O B;  3NMZ C;  3WQZ A;  2LRQ A;  4DOV A;  3A98 A;  4M7A B;  5LJ5 f;  2QQR A;  3G4S T;  2XIC A;  2Q7E A;  1R0C B;  3G1J A;  1PD0 A;  2XD0 A;  5KE3 A;  2LJ1 A;  1OPK A;  4FT4 A;  4RCB A;  1ATI A;  1VQK T;  4WF2 A;  2WSE E;  1CKB A;  2BKD N;  2RI5 A;  1PG5 B;  2GFU A;  2JOY A;  3IAL A;  2VVK A;  4ZNX A;  4F7U E;  4M7D A;  2XGT A;  2DD5 A;  1X2H A;  2DE0 X;  5KCO A;  1BKB A;  2ZT8 A;  4OF1 A;  1VQ5 Q;  2ZIN A;  1BI1 A;  2DFU A;  2F1L A;  3JCM W;  3HTZ A;  3VQW A;  1X6G A;  4KUD K;  4AG2 C;  3CCS T;  4QVC A;  2FHD A;  2KYB A;  3I55 T;  1LVK A;  1R8O B;  2E5Q A;  2YUO A;  3OYM A;  3EFS A;  1WU7 A;  4DEY A;  1XTD A;  1ZUU A;  3OBW A;  3C94 A;  2WSC E;  1K1Z A;  1NLP C;  1P92 A;  2JT4 A;  2PUK B;  4M7A D;  3EGU A;  4YRL A;  1W6X A;  4YRI A;  2FO0 A;  1RUW A;  1QWE A;  5GAM j;  3TUP A;  1SG5 A;  1B7T A;  3OYL A;  2CP0 A;  2DEQ A;  5C52 B;  4C92 E;  4M77 F;  4R55 A;  4H02 A;  2CUB A;  2OX7 A;  2DL7 A;  3CCS Q;  1HYO A;  1NEB A;  1YJN T;  3KUF A;  3G71 Q;  4PFP A;  4F7U B;  2K4Y A;  1D3B A;  3LGF A;  3L2W A;  1LNX A;  1YCS B;  2KGT A;  1KOG A;  4KT0 E;  2K6D A;  2ZCE A;  3MCA B;  4FL6 A;  4N0A C;  2CSQ A;  3TEG A;  1QVP A;  4OB3 B;  5LJ5 e;  1VQ4 T;  2P0P A;  1OI1 A;  2C0O A;  4RTT A;  2A0F B;  5GAO n;  1PSF A;  2KQW A;  5GAM f;  4L87 A;  4M75 B;  1KD1 R;  4YRT A;  4PK4 A;  4B6M A;  1IL2 A;  1WA7 A;  3RR6 A;  1M90 C;  2ZNJ A;  3MEV A;  3LWI A;  2OTL A;  2K3Y A;  4BI3 A;  3V8J A;  5LJ3 h;  1X43 A;  5LJ3 j;  2QEX T;  3VU3 C;  2EKO A;  3OYN A;  1YIJ T;  2LQK A;  5GAM d;  2DXT A;  2OTJ A;  3V8K A;  4H2Y A;  1BK2 A;  3DLL A;  1G5V A;  2E12 A;  1QVG S;  1YB3 A;  3ULR B;  3V8L A;  3I5R A;  2DRM A;  5LL6 S;  2XG8 D;  3CCQ Q;  4QQG A;  1Q81 C;  2I4M A;  1C6V X;  4M77 B;  1JQQ A;  2OI3 A;  1ZX6 A;  4M7D D;  3CEY A;  11AS A;  1TH7 A;  3EHR A;  4YRM A;  5LJ3 g;  4FU6 A;  2AKW B;  1WQW A;  2EYX A;  2DRK A;  4YRQ A;  1WHL A;  12AS A;  1MMA A;  1IHV A;  3JCM P;  1OV3 A;  4NL3 A;  4O5V A;  4JS5 A;  1QVF P;  1ADJ A;  1KIK A;  3G4S Q;  1VQ6 T;  2DA9 A;  3CCJ Q;  1UDL A;  4N4G A;  3HRI A;  4P75 A;  3CPF A;  1K9M U;  1WFW A;  3VYG A;  3IKM B;  1RAD B;  1VYU A;  4JLG A;  5GAN g;  2EQM A;  4YYE A;  1LCK A;  4DA4 A;  3CXC P;  3CCV A;  1JEG A;  4F16 A;  3PFS A;  2RM4 A;  3CC4 T;  3R6N A;  4HCK A;  2L3Q A;  1B76 A;  1GBQ A;  3H9N A;  4YP0 A;  3VS2 A;  1FMW A;  4J9D A;  1AZG B;  5FWB A;  1AT1 B;  3UPU A;  1EOV A;  1RL2 A;  3MEU A;  5GAN h;  2RQT A;  2QHV A;  4TVW A;  3OW2 A;  2X4Y A;  4K11 A;  4F14 A;  3OYE A;  2Z0W A;  1YHQ Q;  3JCM d;  1M1G A;  3CCR Q;  2YSQ A;  4FCY A;  4P73 C;  4AFZ C;  3X20 B;  3QII A;  1OZ2 A;  6AT1 B;  4ZGD B;  1OX8 A;  5CO7 A;  4PJN A;  3D7S B;  1WJR A;  2FPD A;  2CKK A;  4CRI A;  1VUB A;  2YUP A;  4J9I A;  1TXQ A;  4M78 E;  3M0S A;  3SWN C;  2EQK A;  5FU7 C;  2DBM A;  1H64 1;  4DQ2 A;  4E7J A;  4PJM A;  4KGV B;  3MET A;  4X34 A;  2K57 A;  2MI6 A;  3HRS A;  1ZLM A;  1PCX A;  2DQ3 A;  1OPL A;  4CI0 C;  1YJW A;  2F2V A;  3RF1 A;  1B7Y B;  1YJW Q;  2DBK A;  3EAE A;  2H8H A;  1VQ5 A;  2KK4 A;  4BI4 A;  4PHC A;  1LPL A;  1WLP B;  1WI7 A;  3EG3 A;  4XTV A;  4MMK A;  3HFV A;  2DL8 A;  2NUZ A;  3PIP A;  1MMD A;  3M0T A;  1YIJ A;  1VQ4 Q;  1F1B B;  4BDY A;  2QTV A;  1G8X A;  3REU A;  4LE9 A;  2ARU A;  2YXY A;  2MMP A;  4PJO F;  3CMA T;  3H0H A;  2G3R A;  1BBZ A;  1UHC A;  2NS6 A;  4QQD A;  2QEX Q;  2Q7H A;  4KR3 A;  2P4R A;  1N6A A;  1WHG A;  2L5Q A;  3FC3 A;  4RDX A;  1WYD A;  4QVZ A;  1YFS A;  2F69 A;  3RBB B;  1QP3 A;  3VS1 A;  1GCQ A;  1NJI U;  4M77 D;  3A7A A;  4LDX A;  4C92 B;  1L0W A;  3OYG A;  4M7D B;  5A0L A;  1YHQ A;  1TOV A;  4LDY A;  5GAO m;  1VQO Q;  1AWX A;  1KD1 U;  1X55 A;  1VQO A;  1K9M C;  2D0Q B;  4CS4 A;  4A4E A;  1OU9 A;  2CDT A;  4E47 A;  3DSQ A;  2AKL A;  2XDD A;  1WNL A;  4OGC A;  3CBP A;  2EYW A;  2GBQ A;  2YDL A;  2MK5 A;  3QJY A;  4AG1 C;  3QYG B;  3JB9 I;  4EMK A;  2H3J A;  3S3O A;  5FRN A;  1U5S A;  1VQZ A;  3H8Z A;  1WX6 A;  5KYU A;  2FG0 A;  1PWT A;  5CAI A;  3OYK A;  5IN1 A;  3P8Y A;  2RB6 A;  3SWN A;  3HXV A;  1VQL Q;  1H4V B;  1CKA A;  4PJO A;  3QHS A;  3MEA A;  3CCQ A;  3G1Z A;  4XU0 A;  2DEU A;  4EDU A;  5HGQ A;  2QHS A;  2QA4 T;  2QDL A;  1M3B A;  3RUX A;  1Q82 U;  4GY5 A;  4CC7 A;  4M7D F;  4P72 A;  4C92 G;  3CXC S;  2LCS A;  3VQY A;  1M27 C;  4KR2 A;  1PKS A;  4HWR A;  3OS2 A;  2EBP A;  3JB9 H;  1A0N B;  1PM3 A;  4IUV A;  3RMS A;  2BE7 D;  2DLP A;  4C8Q E;  1HJD A;  3CBO A;  2I4N A;  1VQ8 Q;  4C8Q C;  1RAE B;  2GTJ A;  2I2L A;  2WSF E;  2Y90 A;  4HA8 A;  1BYM A;  1SER A;  1G3Y A;  3HRK A;  4QVD A;  2C7I A;  1T0H A;  4C0D B;  1UHF A;  2IY5 B;  3MEW A;  3R6O A;  4P73 A;  4IUU A;  2DQ0 A;  3OYY A;  4R56 A;  3VQX A;  2KVQ G;  3QDF A;  4G85 A;  1YI2 A;  1X54 A;  1NBE B;  1WXU A;  3CC7 T;  4M77 A;  2LMJ A;  1NJ2 A;  3SFM A;  3LSS A;  2EYQ A;  5KYW A;  2CT3 A;  3LGL A;  3MQZ A;  5IXB A;  3RMQ A;  5D6Y A;  4J9H A;  2GQV A;  1X2K A;  4YRK A;  3M0Q A;  2GQI A;  4M78 F;  2QTX A;  4BWA A;  4GBQ A;  4A4H A;  1YJ9 A;  1W4S A;  4BE0 A;  4E7L A;  4JJB A;  3CCU A;  1HTT A;  1KG1 A;  2COY A;  2YLB A;  1VQ6 Q;  3PZC A;  4X1V A;  4HVU A;  4CH3 A;  5CCA A;  4Z8A A;  4M78 A;  4EO4 A;  1UEC A;  2LVM A;  4KUL A;  1M1F A;  2BUD A;  2ZR2 A;  3E9H A;  3PTA A;  2C8M A;  2EAY A;  2ENM A;  5C6S A;  3NEL A;  1IRE B;  1YJ9 T;  2XID A;  4H2V A;  2RF0 A;  1ZSZ A;  2ZT7 A;  5I11 A;  3URG A;  5FRO A;  1PSE A;  3BE3 A;  2CYZ B;  3V7C A;  4XU3 A;  3EFO B;  1EVL A;  1M1K C;  4KGZ B;  2FEI A;  2QG9 B;  4AFU C;  1AEY A;  2ZPF B;  3X25 B;  3QYH B;  2QAS A;  3CMA A;  3NGP A;  2DYB A;  3CC7 A;  2DU7 A;  4AFS C;  3M58 A;  3GBQ A;  3M54 A;  3OYD A;  1E1O A;  1YWO A;  4BW9 A;  2R5A A;  5CKE A;  1I5O B;  4P71 A;  1G3T A;  4L59 A;  2BIV A;  5GAN 7;  3P8T A;  4XTZ A;  1Q7Y C;  4JRQ A;  1AOJ A;  4D6W A;  5A2Q E;  1M8M A;  1TU0 B;  4N0A A;  1U06 A;  2JTM A;  5FLX E;  1VQ8 A;  3H6Z A;  4HWT A;  1VOM A;  4BY6 B;  5IH2 A;  1O9S A;  1YJW T;  4LVK A;  1Z7N A;  1H3Z A;  2CS7 A;  3CD6 T;  3LH0 A;  5GAN 4;  5CIU A;  3OA6 A;  4E7Z A;  3V7R A;  2RI3 A;  4RQF A;  1KJW A;  2J6F A;  4IIO A;  3M4G A;  2RPN A;  2DKG A;  1XOV A;  2Q5I A;  4XU1 A;  2KXC A;  3HPW A;  4WJ4 A;  3GPL A;  1SRL A;  3L42 A;  4HVC A;  1N5Z A;  3P8V A;  4J9F A;  3MP8 A;  3PIO A;  1VQP A;  3FEO A;  3G6E A;  1MMN A;  3M0R A;  3E2U A;  3L1A A;  3RKY A;  1RLP C;  3FDR A;  2W0Z A;  2HKN A;  3JCM Q;  4OVA A;  5J3B A;  3CCV Q;  2KY9 A;  4FSX A;  3LW5 E;  2KE9 A;  2QYZ A;  1QVG A;  1Q7Y U;  4M78 G;  1OOT A;  4RTV A;  4M75 A;  4A4G A;  1VIF A;  1ZHI A;  2O31 A;  4P74 A;  1XQH A;  2P4T A;  2YT6 A;  3S3M A;  2DL3 A;  3OYJ A;  3GNF B;  2CH4 A;  2EL9 A;  2R58 A;  4KRT A;  3C95 A;  1YFT A;  5GAO l;  3AHU A;  3PNW C;  4YRO A;  3TRE A;  3I35 A;  2A37 A;  3QWX X;  4A4F A;  3EG2 A;  1SET A;  4XTY A;  3KXT A;  4ZGJ B;  1GFC A;  2PU9 B;  5LJ3 f;  1T3S A;  2KR3 A;  2IG0 A;  2R5M A;  3EGX B;  4ZN1 A;  2CZ1 B;  2X35 A;  1QE0 A;  2CJB A;  1WHJ A;  1TUD A;  4FYY B;  2MIO A;  2XK0 A;  2VUB A;  2PVG B;  3LX7 A;  3RIR A;  3WXM B;  1JJ2 P;  1MND A;  2RHY A;  1SPK A;  4UPA A;  5CKF A;  1PC0 A;  2X9H A;  3JB9 D;  3EH1 A;  2RQR A;  1D1C A;  2L89 A;  2X4J A;  4PLI A;  1VQM T;  1M8V A;  3DB4 A;  1SSH A;  3RNJ A;  1X6O A;  3CPW P;  4C92 C;  4A63 B;  3VBB A;  2QEX A;  1PYS B;  3JCM V;  2CT4 A;  3JCM c;  2BE9 B;  2E10 A;  5CQX A;  2ALY A;  2RHQ B;  1D1B A;  3BDL A;  4AT1 B;  2MF2 A;  4LVI A;  2FL7 A;  2DD4 A;  2E70 A;  1M30 A;  1MUZ A;  1UGR B;  3TSW A;  3OYI A;  1NG2 A;  1VQN T;  4ESR A;  1VQ5 T;  1NNH A;  4YRG A;  4FW2 A;  1W2B P;  5HKC A;  3JCM e;  5GAM e;  3M9Q A;  5HK3 A;  2J3M A;  3CD6 Q;  4CC4 B;  1X69 A;  2EYY A;  2L3P A;  2G4C A;  2RI2 A;  2V8J A;  1WJQ A;  2RJF A;  2QK0 A;  1ZA2 B;  3PT9 A;  2K9G A;  9ATC B;  2AZS A;  2HQE A;  2HMA A;  4EMK B;  2RK2 A;  3QPH A;  1EVK A;  2JN0 A;  4CH5 A;  3TQ7 P;  4OMQ A;  1R0B G;  3UGQ A;  1NE8 A;  5KYW B;  1Q86 U;  1YBY A;  1X27 A;  1K8A U;  5KYX B;  3BDU A;  3QO8 A;  1WZO A;  2J06 A;  2HSP A;  2ECZ A;  4EX5 A;  1SRY A;  4IUR A;  1YP5 A;  4QKU A;  2V26 A;  4XTU A;  2CUD A;  1G2B A;  2XTI A;  3NHN A;  1D09 B;  4JJD A;  2RJC A;  2EQI A;  5LJ5 h;  2EVR A;  2LQN A;  2LT1 A;  1NYQ A;  2VYT A;  2ZZD A;  1IGU A;  3P8B B;  5A0G A;  2E4H A;  3H41 A;  2RO0 A;  3OW2 S;  2KI7 A;  1IGQ A;  2YLC A;  2B86 A;  4M7D C;  1TTH B;  1WQ7 A;  1GFD A;  2MYS A;  1MV3 A;  2EGC A;  2E65 A;  1VQK A;  1ASZ A;  4LVL A;  2RHI A;  2DX1 A;  2X4X A;  1N9W A;  1QCO A;  3MJX A;  1TUG B;  3OY9 A;  3UH0 A;  2GGR A;  2NLU A;  1C1A A;  1ADY A;  4PFO A;  1JBM A;  3QZ9 B;  3CCL Q;  1QKW A;  3VS6 A;  3OMC A;  2DVJ A;  3HFZ A;  3MP6 A;  4C5I A;  4LD6 A;  4YRS A;  4M4Z A;  1KD1 C;  4YRP A;  1VIE A;  3OYB A;  4OLF A;  2QQ9 A;  2ED1 A;  3PGG A;  1H92 A;  2X3W D;  1KK7 A;  5GJW B;  4X5O A;  2LNH B;  4B9X A;  1W2B S;  3EG9 A;  4EMH A;  1FX7 A;  1USY A;  1QWF A;  1JU5 C;  2LX7 A;  1YHQ T;  2MOX A;  3SB2 A;  4D8D A;  2LQW A;  4R0K A;  3SD4 A;  2OTL T;  4IUP A;  3MKD A;  2DDZ A;  3CC2 A;  2E1H A;  4HT8 A;  4F7U A;  4M7D E;  1GXI E;  3MP1 A;  2P0L A;  2J05 A;  1YI2 Q;  3CCU Q;  2ZT6 A;  3UGT A;  5EG2 A;  2DM1 A;  1K76 A;  4F04 B;  3JB9 J;  1JJ2 S;  3CCM A;  3H0F A;  3M56 A;  2X3X D;  2MWP A;  4AFQ C;  4D8K A;  5DLQ E;  1C0A A;  4PJJ A;  4BI8 B;  4ZIB A;  4PJO E;  4HWP A;  4C0D C;  4YRC A;  2OTJ Q;  3A31 A;  1KSW A;  1N9R A;  2OJ2 A;  3S3N A;  3INZ A;  1RI9 A;  1H8K A;  1UTI A;  3G71 A;  1VQ9 T;  4IKF A;  2RNA A;  3M4P A;  3REX A;  2C0T A;  1H3H A;  2C0I A;  2FYK A;  1MV0 B;  4AMC A;  1ABO A;  2IPO B;  1ZSG A;  3PCO B;  1OYX A;  3TEE A;  1VQN A;  1HXD A;  3RKX A;  3THK A;  2GF7 A;  1VYT A;  3HL8 A;  1EFN A;  3L2Z A;  4XEM A;  1Y71 A;  1E24 A;  1SHF A;  2DO3 A;  1BB9 A;  4BE1 A;  2HL5 C;  4H2W A;  3FRN A;  3NPF A;  3QDR B;  4MDW A;  3JCM X;  3A74 A;  1QVG P;  4LVM A;  1USY C;  2RQV A;  3TSZ A;  3OBY A;  4E7H A;  2AIR B;  2IVW A;  1M1K R;  2DTI A;  2M0O A;  5J26 A;  3HXU A;  1HC7 A;  2O9S A;  5GAN f;  3JCM J;  4MZM A;  4KBM B;  3CPW S;  4BB7 A;  4NL2 A;  7AT1 B;  4M75 G;  2AK5 A;  3CC2 Q;  2FRY A;  3VS0 A;  4L6V 5;  2PQW A;  5I22 A;  1QVF S;  4HWS A;  2RHS B;  3L2R A;  3M4Q A;  2RH2 A;  3X28 B;  2KBT A;  2KT1 A;  1YI2 T;  3EG1 A;  4QT7 A;  3G6E T;  1JJ2 A;  1VQP T;  2DET A;  1Q86 R;  4C8Q B;  4HT9 A;  1VYV A;  3JRZ A;  1E6G A;  2DXU A;  3X24 B;  3A8H B;  5FU7 B;  4OB1 B;  4BUG A;  2DJQ A;  1S72 T;  1VQL T;  4KH1 B;  3HSB A;  1M2O A;  4M77 G;  2EW3 A;  4JRK A;  1X01 A;  3CC2 T;  1O75 A;  3FIF A;  1I1J A;  4F17 A;  2QDY B;  2LC4 A;  4A53 A;  2LDM A;  4RUG A;  3CD6 A;  1VQN Q;  1UE9 A;  2D6F A;  1WHK A;  3QKJ A;  3NET A;  2EJ9 A;  3HXY A;  2D0N A;  3WVD B;  1GRI A;  3VS4 A;  4OMF B;  5GAN 6;  4O2D A;  2K7A A;  1Q7Y R;  2BTT A;  3PE0 A;  3OYC A;  1B70 A;  4JDS A;  2M1H A;  1VQL A;  3BW1 A;  2QHU A;  2DNU A;  3LYI A;  1ZUK A;  1EZZ B;  1U8R A;  1SES A;  1PNJ A;  1G3S A;  1PRM C;  2OTJ T;  2CZ7 B;  2DF6 A;  4RG2 A;  3JCM g;  4BE2 A;  1ZBJ A;  3J7A F;  2HBP A;  2A36 A;  4Z02 A;  2ZPG B;  4F7U G;  1D1A A;  4Y28 E;  3OW2 P;  2ZZE A;  2DAQ A;  3ZBD A;  4C8Q G;  2JM9 A;  4P72 C;  3X26 B;  4J6W A;  3SEM A;  1H4Q A;  5IXF A;  3E19 A;  1OQK A;  2NUT A;  3MO8 A;  2KAF A;  3UDC A;  3BJU A;  3JCM h;  2AKK A;  1AZE A;  5C53 B;  3HFO A;  2V1Q A;  1KMN A;  4JLI A;  3HY0 A;  8AT1 B;  4P5N A;  4P75 C;  1UGP B;  3GLX A;  4P3O A;  3PVQ A;  2LJ3 A;  4Z88 A;  4K86 A;  3OS1 A;  2DXB A;  4DBQ A;  2ODR C;  3L2U A;  2LQ8 A;  4LN2 A;  2XKO C;  1MNE A;  2LT4 A;  3CQT A;  4J9G A;  1RAC B;  3P8D A;  2P0Q A;  1J5W A;  2YRV A;  2R57 A;  1JXO A;  2E6Z A;  4H2T A;  1I0C A;  2CP7 A; 
#chains in the Genus database with same CATH homology
 3GNG A;  5KCH A;  1BBU A;  5I2S A;  1N27 A;  1UB4 A;  3TU4 K;  5FU6 B;  1Y07 A;  4HKE A;  3RES A;  1G5I A;  4H2U A;  3EFR A;  4N4I A;  3J81 E;  2DPP B;  3OSV A;  5C51 B;  3SWN B;  2QHT A;  5KH6 A;  4CH4 A;  2PME A;  1Z7M A;  3M5A A;  2CJA A;  5ELN A;  3N5B B;  1V29 B;  1H4T A;  4LDV A;  1JB0 E;  1M9S A;  2ODR D;  3P8H A;  4XTW A;  1N8R U;  2XDP A;  3S6W A;  2RJD A;  4RG8 A;  1VQM A;  2RHX A;  3ERR A;  4P3N A;  4M7A C;  4YPF A;  1I4K 1;  5KNN A;  1QP2 A;  3IKL A;  1NZ9 A;  2EWN A;  3A7U A;  3V7S A;  4FM4 B;  3ME9 A;  4B9W A;  3CCE A;  2RJE A;  3QO3 A;  4PJO G;  4OB0 B;  3DLM A;  2CZ6 B;  4HCZ A;  4C0Z A;  4ZN3 A;  4RCC A;  4BAC A;  1U1T A;  1KHI A;  2DTH A;  3QO7 A;  1EIF A;  5IAY A;  3M57 A;  3NTH A;  3RL6 A;  3QNE A;  3QZ5 B;  4K88 A;  1B7Y A;  2V8I A;  1QF6 A;  3VUB A;  3QO5 A;  2JNG A;  4EPC A;  2DIQ A;  1KQS A;  3CC4 A;  4GLK A;  4RQE A;  3VYH B;  5KE2 A;  4YCV A;  4TVR A;  2DZC A;  4L5G A;  2ART A;  1JJC A;  4JUV A;  2EFI A;  3TEH B;  2WAC A;  1D3B B;  4FT2 A;  3NFC A;  2PVD B;  4QQ6 A;  3CCE T;  2VXE A;  3HP9 A;  1E22 A;  4ZTJ A;  2XI9 A;  2K5I A;  3A7R A;  3NTI A;  2JVV A;  1EIY B;  3VQV A;  3QXE B;  3M59 A;  2M16 A;  4LNS A;  3F70 A;  4UP8 A;  3SDZ A;  3HXW A;  2P5I A;  4J5Y A;  4H2X B;  2LNV A;  1LJO A;  5K1P A;  4JS4 A;  2O4X A;  4CS2 A;  3PMI A;  3IG2 A;  2E6N A;  2B8A A;  3E1S A;  4C8Q A;  2K3X A;  5K1X A;  1KHC A;  3A8G B;  3G7Z A;  2GFA A;  4F7U F;  2ZZF A;  1MHN A;  2ZTG A;  1W66 A;  3VV0 A;  3CCJ T;  4FIB A;  5GMK l;  3OD1 A;  3OYH A;  1NJ1 A;  2P0K A;  2XU8 A;  4TVY A;  2ZPI B;  3R07 A;  4XK8 E;  4N4H A;  3QBY A;  2IY5 A;  1B70 B;  5GMK m;  3KBG A;  4PL6 A;  2ZR3 A;  1B34 B;  3CCS A;  1KQ1 A;  2HD0 A;  4OGE A;  4WI1 A;  2ZNI A;  1BI2 A;  2K5F A;  1UEB A;  3KFU A;  3A8L B;  5LJ3 d;  5DM7 R;  1NYR A;  4MDX A;  3NEN A;  1BI0 A;  3L2V A;  2V8K A;  4MZT A;  4UP9 A;  4ELY C;  5CK9 A;  4VUB A;  1I81 A;  3UFG A;  2I4O A;  3LSQ A;  3CXC A;  3G4S A;  2L8D A;  3CMQ A;  2K2V A;  3HRT A;  5GMK h;  5GAN d;  2LX9 A;  5A0D A;  3PMT A;  1IZ6 A;  1NPR A;  2RHS A;  3W3S A;  4MML A;  2EQU A;  3HRU A;  4JRP A;  4CH6 A;  4MZP A;  1NJ8 A;  3CCL T;  3E9F A;  4QW2 A;  1E1T A;  4YTL A;  5DLO A;  3HXX A;  2HNI A;  4WJ3 M;  3HFN A;  1K8A C;  1VQ8 T;  2MAM A;  2OAU A;  4J6X A;  3MF2 A;  4C8Q D;  4LDU A;  4Q6G A;  1S72 A;  2A7Y A;  3CCJ A;  4CS3 A;  3J80 E;  3CPW A;  4ME7 A;  4E51 A;  2X4W A;  4ZTU B;  4M75 E;  1UGS B;  1H4S A;  3ZEH A;  1QVF A;  1VQO T;  4KUI A;  1XNI A;  1WJS A;  2GCX A;  4NS5 A;  2LCL A;  3TCJ A;  3GOX A;  4IUT A;  2Y4Y A;  4TTV A;  4C0G A;  4ELZ C;  5GAO q;  1NPP A;  4YRF A;  4O6J A;  4TQF A;  4HCC A;  2A3L A;  4YRR A;  1HK9 A;  5GAN 2;  4ZTZ B;  2CIM A;  2ZPE B;  3OQ5 A;  2JTF A;  2DVE A;  4PJO D;  4P74 C;  4M75 C;  2ZZG A;  5GAN e;  4BY6 C;  4P71 C;  1ASY A;  3G71 T;  1VQ9 A;  4YDQ A;  4PJO B;  1YFR A;  3CCL A;  4M7D G;  1I5L A;  2ZIM A;  2JZ2 A;  2PVO B;  1ZBX A;  2F5T X;  1BIA A;  2HAX A;  2MWO A;  4Q5W A;  2KDS A;  1BI3 A;  5D6X A;  1NJ6 A;  1GGM A;  1U1S A;  4UC4 A;  3HFZ B;  1YIT A;  1Y7X A;  4M78 B;  5F5W A;  5GMK e;  1LYL A;  4J7F A;  1VQ7 A;  5GMK j;  5GAN 5;  3RAC A;  3C12 A;  3DB3 A;  3E9I A;  1K73 U;  3O8V A;  3I56 A;  1KC8 C;  1NJI C;  2CJ9 A;  2QQS A;  3ICA A;  4PNO A;  2QQB A;  4BD3 A;  4YCU A;  3CCM T;  2QA4 A;  2RA2 A;  5GAN j;  2D9T A;  4RMO A;  2PUO B;  2E64 A;  4KQE A;  2CZ0 B;  3FJP A;  5IT9 E;  3L2Q A;  1X2G A;  4LD9 K;  4H2X A;  1EFW A;  3MEY A;  4XU2 A;  1JJC B;  3L4G A;  3FB9 A;  1WPY A;  3DKM A;  3CCR A;  4PKC C;  1I8F A;  2CGH A;  3VKI A;  2Y4X A;  5LJ5 d;  1PYS A;  4V2S A;  4NOY A;  4M7A E;  5AYF A;  3UT1 A;  3A32 A;  1M4Z A;  3MF1 A;  1YCY A;  1BBW A;  5D6W A;  5L8R E;  4C0F A;  1RIQ A;  1LOJ A;  4C92 A;  4M77 E;  2ZIO A;  2C06 A;  3M55 A;  3BFM A;  5CKD A;  2DTO A;  4M7A A;  2AMC B;  4K87 A;  2ZGW A;  2KMT A;  4C5E A;  1YGB A;  1QW1 A;  3JCM b;  3QTC A;  2RHZ A;  1EQR A;  1G5H A;  4PG3 A;  3GP8 A;  1KQ2 A;  1BIB A;  2ZXF A;  3LC0 A;  4M75 F;  3CCU T;  4X9D A;  4YRN A;  3Q1J A;  2EJG A;  4E7K A;  1Q82 C;  4Q15 A;  4HWO A;  5GAM h;  4J6Y A;  3OB9 A;  3BY7 A;  2LCC A;  2F5K A;  3CBM A;  3C4S A;  4II1 A;  4LDW A;  1WGS A;  3OMG A;  4M77 C;  4RMF A;  4J8O A;  3ER0 A;  3QUI A;  5GMK i;  4TQD A;  4UP7 A;  2EIF A;  1Q81 U;  4A54 A;  4H2S A;  4HT4 A;  3JCM f;  3ZFJ A;  2QI2 A;  2RD1 A;  5LJ3 e;  4C5G A;  1MGQ A;  2E41 A;  4M75 D;  1NJ5 A;  5FU6 C;  4PJO C;  3HKS A;  4A4K A;  2DIG A;  2Q5H A;  3NTK A;  4LVJ A;  2YHT A;  1FXX A;  3E9G A;  5LJ5 j;  2ZT5 A;  5ELO A;  4G84 A;  3OYF A;  4J7I A;  4YCW A;  4EMK C;  3CCV T;  2E5A A;  4EMG A;  3OSS C;  2RK1 A;  5DY9 A;  1G3W A;  1OZ3 A;  4AH6 A;  4OP0 A;  2VXF A;  1K73 C;  1KQS S;  3T9N A;  4JJN K;  5LJ5 g;  1WLE A;  2A8E A;  4C92 D;  2ZCF B;  4E7I A;  1SSF A;  2O4X B;  5CQY A;  5CR2 A;  5HK0 A;  2LTO A;  2L3R A;  4XTX A;  5GAN 8;  3OS0 A;  3WVE B;  1N8R C;  1KMM A;  5GAO r;  3M53 A;  1B8A A;  1UGQ B;  2K5L A;  5CKB A;  4YRJ A;  1Y96 A;  4OB2 B;  4XAX B;  2ALY B;  2RHQ A;  3I7F A;  3JB9 G;  2RHU A;  3A5Z B;  3RKW A;  1FWZ A;  4BDZ A;  2FB7 A;  4M78 C;  5GAO p;  3LWH A;  5C0M A;  3HXZ A;  2HQX A;  1VQ7 T;  2AHJ B;  3OS5 A;  2VV5 A;  2EJF A;  1N9S A;  2VGM A;  5M9O A;  5J39 A;  1YIT T;  4TVA B;  4HCB A;  3QSU A;  2DXC A;  2ZPH B;  4TWA A;  3UWN A;  4J83 A;  3A5Y A;  1B34 A;  4ATO A;  4P3P A;  1M1K U;  4C8Q F;  1YJN A;  3MHX A;  3JSC A;  3I56 T;  1DJ7 B;  3GF5 A;  4M78 D;  3CME A;  4J15 A;  1AHJ B;  3ASK A;  2AKW A;  5CVI A;  1VQ4 A;  3L4G B;  1G51 A;  3M4Y A;  2M9U A;  2E3C A;  2DU5 A;  2ZPB B;  1W2B A;  4Y91 A;  1ZQ1 A;  2O01 E;  4RKU E;  5CKH A;  1Y96 B;  4DPG A;  4M7A G;  2KSS A;  3A5Z A;  2XDB A;  4IUQ A;  2VC8 A;  3VJP A;  4C92 F;  4XEO A;  3FLG A;  3OYA A;  1RI0 A;  2Q7G A;  2EQJ A;  3CME T;  2DZ9 A;  3CCR T;  4TVA A;  2AMC A;  1X75 C;  4PLL A;  3GIB A;  3PCO A;  3RER A;  3QG1 A;  5HY6 A;  4DOW A;  3I55 A;  3HHT B;  2FVU A;  3JAM E;  4M7A F;  1KC8 U;  5I2M A;  3A8M B;  1EIY A;  4NCX A;  3LLR A;  2I4L A;  2QXF A;  3RGL A;  1FYF A;  2JUF A;  4ZTF A;  1X56 A;  4X9C A;  1VQ6 A;  2QQA A;  5GAM g;  1Q86 C;  3HY1 A;  3TEH A;  5FRM A;  3NEM A;  3JB9 F;  2DJZ A;  2J3L A;  3VUZ A;  1M5Q 1;  4ZGE B;  2ARS A;  5E3I A;  2XHC A;  4C5H A;  2DK3 A;  5GAN 3;  1M90 U;  3QJ6 A;  1JRI A;  2VGN A;  5I21 A;  4JRI A;  4XQ3 A;  4YRE A;  3CCQ T;  2PMF A;  3A8O B;  3WQZ A;  2LRQ A;  4DOV A;  5LJ5 f;  4M7A B;  2QQR A;  3G4S T;  2XIC A;  2Q7E A;  2XD0 A;  5KE3 A;  4FT4 A;  4RCB A;  1ATI A;  1VQK T;  4WF2 A;  2WSE E;  2BKD N;  2RI5 A;  2GFU A;  2JOY A;  3IAL A;  4F7U E;  4M7D A;  2XGT A;  2DD5 A;  1X2H A;  5KCO A;  1BKB A;  2ZT8 A;  4OF1 A;  2ZIN A;  1BI1 A;  3JCM W;  3VQW A;  3HTZ A;  4KUD K;  3CCS T;  4QVC A;  2FHD A;  3I55 T;  1R8O B;  2E5Q A;  3OYM A;  3EFS A;  1WU7 A;  1XTD A;  3OBW A;  3C94 A;  2WSC E;  1P92 A;  2PUK B;  4M7A D;  4YRL A;  4YRI A;  5GAM j;  3TUP A;  3OYL A;  2DEQ A;  5C52 B;  4C92 E;  4M77 F;  4R55 A;  4H02 A;  1YJN T;  3KUF A;  4F7U B;  2K4Y A;  1D3B A;  3LGF A;  3L2W A;  1LNX A;  1KOG A;  4KT0 E;  2ZCE A;  3MCA B;  4FL6 A;  4N0A C;  3TEG A;  1QVP A;  4OB3 B;  5LJ5 e;  1VQ4 T;  2P0P A;  1OI1 A;  5GAO n;  1PSF A;  2KQW A;  5GAM f;  4L87 A;  4M75 B;  4YRT A;  1IL2 A;  1M90 C;  2ZNJ A;  3MEV A;  3LWI A;  2OTL A;  2K3Y A;  4BI3 A;  3V8J A;  5LJ3 h;  5LJ3 j;  2QEX T;  3VU3 C;  2EKO A;  3OYN A;  1YIJ T;  2LQK A;  5GAM d;  2DXT A;  2OTJ A;  3V8K A;  4H2Y A;  3DLL A;  1G5V A;  2E12 A;  1QVG S;  1YB3 A;  3V8L A;  5LL6 S;  2XG8 D;  4QQG A;  1Q81 C;  2I4M A;  4M77 B;  4M7D D;  3CEY A;  11AS A;  1TH7 A;  4YRM A;  5LJ3 g;  4FU6 A;  2AKW B;  1WQW A;  4YRQ A;  12AS A;  3JCM P;  4NL3 A;  4O5V A;  4JS5 A;  1ADJ A;  1VQ6 T;  3HRI A;  4N4G A;  4P75 A;  3CPF A;  1K9M U;  3VYG A;  3IKM B;  4JLG A;  5GAN g;  2EQM A;  4YYE A;  4DA4 A;  3CCV A;  3PFS A;  2RM4 A;  3CC4 T;  1B76 A;  4YP0 A;  3UPU A;  1EOV A;  1RL2 A;  3MEU A;  5GAN h;  4TVW A;  2QHV A;  3OW2 A;  2X4Y A;  3OYE A;  3JCM d;  1M1G A;  4P73 C;  3X20 B;  3QII A;  1OZ2 A;  4ZGD B;  5CO7 A;  1WJR A;  2CKK A;  4CRI A;  1VUB A;  4M78 E;  3SWN C;  2EQK A;  5FU7 C;  4DQ2 A;  1H64 1;  4E7J A;  3MET A;  4X34 A;  2K57 A;  2MI6 A;  3HRS A;  2DQ3 A;  4CI0 C;  1YJW A;  3RF1 A;  1B7Y B;  3EAE A;  1VQ5 A;  2KK4 A;  4BI4 A;  4PHC A;  4XTV A;  4MMK A;  3HFV A;  3PIP A;  1YIJ A;  4BDY A;  3REU A;  2ARU A;  2MMP A;  4PJO F;  3CMA T;  2G3R A;  2NS6 A;  4QQD A;  4KR3 A;  2Q7H A;  1N6A A;  2L5Q A;  3FC3 A;  4RDX A;  1WYD A;  4QVZ A;  1YFS A;  2F69 A;  1QP3 A;  1NJI U;  4M77 D;  3A7A A;  4LDX A;  4C92 B;  1L0W A;  3OYG A;  4M7D B;  5A0L A;  1YHQ A;  4LDY A;  5GAO m;  1KD1 U;  1X55 A;  1VQO A;  1K9M C;  2D0Q B;  4CS4 A;  4A4E A;  4E47 A;  3DSQ A;  2XDD A;  1WNL A;  4OGC A;  3CBP A;  3QJY A;  3QYG B;  3JB9 I;  4EMK A;  2H3J A;  3S3O A;  5FRN A;  1VQZ A;  3H8Z A;  5CAI A;  3OYK A;  5IN1 A;  3P8Y A;  2RB6 A;  3SWN A;  3HXV A;  1H4V B;  4PJO A;  3QHS A;  3MEA A;  3CCQ A;  3G1Z A;  4XU0 A;  4EDU A;  5HGQ A;  2QHS A;  2QA4 T;  3RUX A;  1Q82 U;  4GY5 A;  4M7D F;  4P72 A;  4C92 G;  3CXC S;  3VQY A;  4KR2 A;  4HWR A;  3OS2 A;  3JB9 H;  4IUV A;  3RMS A;  4C8Q E;  3CBO A;  2I4N A;  4C8Q C;  2Y90 A;  2I2L A;  2WSF E;  4HA8 A;  1BYM A;  1SER A;  1G3Y A;  3HRK A;  4QVD A;  2C7I A;  4C0D B;  2IY5 B;  3MEW A;  3R6O A;  4P73 A;  4IUU A;  2DQ0 A;  3OYY A;  4R56 A;  3VQX A;  2KVQ G;  4G85 A;  1YI2 A;  1X54 A;  3CC7 T;  4M77 A;  1NJ2 A;  3SFM A;  3LSS A;  2EYQ A;  3LGL A;  3MQZ A;  3RMQ A;  5D6Y A;  2GQV A;  4YRK A;  4M78 F;  2QTX A;  4BWA A;  4A4H A;  1YJ9 A;  1W4S A;  4BE0 A;  4E7L A;  3CCU A;  1HTT A;  1KG1 A;  2YLB A;  3PZC A;  4CH3 A;  5CCA A;  4M78 A;  4EO4 A;  2LVM A;  4KUL A;  1M1F A;  2BUD A;  2ZR2 A;  3E9H A;  3PTA A;  2C8M A;  2EAY A;  5C6S A;  3NEL A;  1IRE B;  1YJ9 T;  2XID A;  4H2V A;  2ZT7 A;  3URG A;  5FRO A;  1PSE A;  2CYZ B;  3V7C A;  4XU3 A;  1EVL A;  1M1K C;  2ZPF B;  3X25 B;  3QYH B;  3CMA A;  3CC7 A;  2DU7 A;  3M58 A;  3M54 A;  3OYD A;  1E1O A;  4BW9 A;  2R5A A;  5CKE A;  4P71 A;  1G3T A;  4L59 A;  2BIV A;  5GAN 7;  3P8T A;  4XTZ A;  1Q7Y C;  4JRQ A;  4D6W A;  5A2Q E;  4N0A A;  2JTM A;  5FLX E;  1VQ8 A;  3H6Z A;  4HWT A;  4BY6 B;  1O9S A;  1YJW T;  4LVK A;  1Z7N A;  1H3Z A;  2CS7 A;  3CD6 T;  3LH0 A;  5GAN 4;  5CIU A;  3OA6 A;  3V7R A;  2RI3 A;  4RQF A;  3M4G A;  2DKG A;  2Q5I A;  1XOV A;  4XU1 A;  3HPW A;  4WJ4 A;  3GPL A;  3L42 A;  4HVC A;  3P8V A;  3MP8 A;  3PIO A;  1VQP A;  3FEO A;  3G6E A;  3L1A A;  3RKY A;  3FDR A;  3JCM Q;  4OVA A;  5J3B A;  2KY9 A;  4FSX A;  3LW5 E;  1QVG A;  1Q7Y U;  4M78 G;  4A4G A;  4M75 A;  1VIF A;  1ZHI A;  4P74 A;  1XQH A;  2P4T A;  3S3M A;  3OYJ A;  3GNF B;  2EL9 A;  2R58 A;  3C95 A;  1YFT A;  5GAO l;  3AHU A;  3PNW C;  4YRO A;  3TRE A;  4A4F A;  1SET A;  4XTY A;  3KXT A;  4ZGJ B;  5LJ3 f;  2PU9 B;  2IG0 A;  2R5M A;  4ZN1 A;  2CZ1 B;  2X35 A;  1QE0 A;  2CJB A;  2XK0 A;  2VUB A;  2PVG B;  3LX7 A;  3RIR A;  3WXM B;  2RHY A;  4UPA A;  5CKF A;  3JB9 D;  2L89 A;  2X4J A;  4PLI A;  1VQM T;  1M8V A;  3DB4 A;  1X6O A;  4C92 C;  3VBB A;  2QEX A;  1PYS B;  3JCM V;  3JCM c;  2E10 A;  5CQX A;  2ALY A;  2RHQ B;  3BDL A;  4LVI A;  2MF2 A;  2FL7 A;  2DD4 A;  2E70 A;  1UGR B;  3OYI A;  1VQN T;  1VQ5 T;  1NNH A;  4YRG A;  5HKC A;  3JCM e;  5GAM e;  3M9Q A;  5HK3 A;  2J3M A;  2G4C A;  2RI2 A;  2V8J A;  1WJQ A;  2RJF A;  3PT9 A;  2HQE A;  4EMK B;  2RK2 A;  3QPH A;  1EVK A;  2JN0 A;  4CH5 A;  3UGQ A;  1NE8 A;  1Q86 U;  1YBY A;  1K8A U;  3BDU A;  3QO8 A;  4EX5 A;  1SRY A;  4IUR A;  4XTU A;  2XTI A;  2RJC A;  5LJ5 h;  2LT1 A;  1NYQ A;  2VYT A;  2ZZD A;  3P8B B;  5A0G A;  2RO0 A;  3OW2 S;  2YLC A;  4M7D C;  1WQ7 A;  2E65 A;  1VQK A;  1ASZ A;  4LVL A;  2RHI A;  2X4X A;  1N9W A;  3OY9 A;  3UH0 A;  2NLU A;  1ADY A;  1JBM A;  3QZ9 B;  3OMC A;  3HFZ A;  3MP6 A;  4C5I A;  4LD6 A;  4YRS A;  1KD1 C;  4YRP A;  1VIE A;  3OYB A;  4OLF A;  2QQ9 A;  3PGG A;  4X5O A;  4B9X A;  1W2B S;  4EMH A;  1FX7 A;  1USY A;  1YHQ T;  3SB2 A;  3SD4 A;  2OTL T;  4IUP A;  2DDZ A;  3CC2 A;  2E1H A;  4HT8 A;  4F7U A;  4M7D E;  1GXI E;  3MP1 A;  2P0L A;  2ZT6 A;  3UGT A;  5EG2 A;  3JB9 J;  1JJ2 S;  3CCM A;  3M56 A;  2MWP A;  5DLQ E;  1C0A A;  4BI8 B;  4ZIB A;  4PJO E;  4HWP A;  4C0D C;  4YRC A;  3A31 A;  1N9R A;  3S3N A;  3INZ A;  3G71 A;  1VQ9 T;  4IKF A;  3M4P A;  3REX A;  2FYK A;  3PCO B;  1OYX A;  3TEE A;  1VQN A;  1HXD A;  3RKX A;  2GF7 A;  3HL8 A;  4XEM A;  3L2Z A;  1Y71 A;  1E24 A;  2DO3 A;  4BE1 A;  4H2W A;  3FRN A;  3QDR B;  4MDW A;  3JCM X;  3A74 A;  4LVM A;  1USY C;  4E7H A;  3OBY A;  2IVW A;  2DTI A;  2M0O A;  5J26 A;  3HXU A;  1HC7 A;  5GAN f;  3JCM J;  4MZM A;  4KBM B;  3CPW S;  4BB7 A;  4NL2 A;  4M75 G;  4L6V 5;  2PQW A;  1QVF S;  4HWS A;  2RHS B;  3L2R A;  3M4Q A;  2RH2 A;  3X28 B;  1YI2 T;  3G6E T;  1JJ2 A;  1VQP T;  4C8Q B;  4HT9 A;  3JRZ A;  2DXU A;  3X24 B;  3A8H B;  5FU7 B;  4OB1 B;  4BUG A;  1S72 T;  1VQL T;  3HSB A;  4M77 G;  4JRK A;  1X01 A;  3CC2 T;  1O75 A;  3FIF A;  2QDY B;  2LC4 A;  4A53 A;  2LDM A;  3CD6 A;  2D6F A;  3QKJ A;  3NET A;  2EJ9 A;  3HXY A;  3WVD B;  4OMF B;  5GAN 6;  4O2D A;  3OYC A;  1B70 A;  4JDS A;  2M1H A;  1VQL A;  3BW1 A;  2QHU A;  3LYI A;  1U8R A;  1G3S A;  2OTJ T;  2CZ7 B;  4RG2 A;  4BE2 A;  3JCM g;  3J7A F;  2HBP A;  4Z02 A;  2ZPG B;  4F7U G;  4Y28 E;  2ZZE A;  2DAQ A;  3ZBD A;  4C8Q G;  4P72 C;  3X26 B;  4J6W A;  1H4Q A;  3E19 A;  3MO8 A;  2KAF A;  3UDC A;  3BJU A;  3JCM h;  5C53 B;  3HFO A;  1KMN A;  4JLI A;  3HY0 A;  4P5N A;  4P75 C;  1UGP B;  3GLX A;  4P3O A;  4K86 A;  3OS1 A;  2DXB A;  2ODR C;  3L2U A;  2LQ8 A;  2XKO C;  2LT4 A;  3P8D A;  2P0Q A;  1J5W A;  2YRV A;  2R57 A;  2E6Z A;  4H2T A;  1SES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...