3L1AA

Structural ordering of disordered ligand binding loops of biotin protein ligase into active conformations as a consequence of dehydration
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
264
structure length
264
Chain Sequence
b'DRDRLRPPLDERSLRDQLIGAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQPFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEARIIQWRNANPQLAADYRARSLTIGSRVRVELPGGQDVVGIARDIDDQGRLCLDVGGRTVVVSAGDVVHLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BirA bifunctional protein
publication title Structural ordering of disordered ligand-binding loops of biotin protein ligase into active conformations as a consequence of dehydration.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 83
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature ec 6.3.4.15: Biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02237 BPL_C Biotin protein ligase C terminal domain
A PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l1aA02
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3l1aA01
5GAN3 4F7UE 2EWNA 4UP9A 3BW1A 1Y96A 4XTWA 2ZTGA 4N0AC 4C92E 1J5WA 2ALYA 2ZNJA 4LNSA 1B70A 2QHTA 4EX5A 3REXA 4CS4A 4M77C 3JB9F 1C0AA 1G51A 4YRFA 2ZGWA 4JLIA 4YRTA 2RB6A 4XU2A 3QTCA 3A74A 1ATIA 3RGLA 5K1XA 1M5Q1 4P3NA 2ODRD 4UP7A 4X9DA 4H2VA 3SWNB 5GMKl 3JCMd 3V8JA 5GAN5 2G4CA 3ERRA 4YRKA 1B76A 4ZTZB 2ARSA 3HXZA 4M7DE 3PGGA 4M7AF 5GANg 2RHQB 1H4QA 3M4PA 2PMFA 1W66A 2E3CA 4A53A 1WLEA 2EAYA 1YCYA 2DTIA 1SRYA 3BJUA 3TEHB 1RIQA 4C92D 4YRIA 4K86A 4F7UB 4YRPA 3SWNA 2ZZEA 5GAN6 3VQYA 4C92B 3WQZA 4YRGA 3NEMA 4P3OA 4M78B 4NOYA 1WPYA 3JCMf 1EOVA 4WJ3M 4XQ3A 3G1ZA 4HWPA 4P73A 4YCVA 4KR2A 2RHQA 5LJ3e 1NNHA 4C8QG 2Y90A 3IG2A 4Q15A 1H641 4HT8A 2XTIA 2ZR3A 2Q7EA 3E9HA 1YGBA 1B7YB 3TEHA 4CS2A 5GANj 4MMKA 2ZT6A 4G84A 1N9RA 1SESA 4QVCA 2ZZFA 4F7UA 3JCMb 1EIYA 4P71A 2P0LA 4JUVA 1LJOA 4YRSA 4TVWA 4XEMA 4P74C 3VQVA 4M78A 2ZT8A 4QVDA 4NL3A 3LSSA 3JCMQ 4M7DD 3HXWA 2IY5B 4K87A 3PCOB 3VU3C 5GAOr 2Q5IA 5GAOl 4M7AC 1KMMA 3JCMX 1BIBA 1B7YA 2J3MA 3FB9A 1SETA 2ZR2A 1BBWA 3A31A 2K57A 2RHSB 4EO4A 1YFRA 3REUA 4EMKB 4M77F 4N0AA 1H4TA 4XTVA 3HTZA 3RKWA 3ICAA 2DJZA 5GMKm 2YLBA 3VBBA 3HFOA 2IY5A 4M75F 4XTUA 3PCOA 5LJ3d 3L4GB 4PHCA 2RA2A 3TEGA 3NENA 4YRJA 1Y96B 2HNIA 4EMGA 4PJOG 1WU7A 3HXXA 4PJOB 2DEQA 1BBUA 4L87A 4H02A 1B34B 2DXUA 1U1SA 4M7DF 4YRLA 4X9CA 1ADJA 3QO8A 3A7RA 3VQXA 4YRQA 4XU3A 2YHTA 4WF2A 1U1TA 5GAN2 3JCMP 1ASZA 3MEYA 3QUIA 2DTOA 4YYEA 3L4GA 5LJ5j 5ELNA 1EFWA 5LJ3f 5C52B 4CH6A 4H2WA 4PJOA 5GAMj 1NJ2A 4M78E 1B34A 5LJ3g 1HK9A 1EQRA 1ASYA 3JB9G 4ZTUB 3QNEA 3INZA 3E9IA 1G5IA 5I21A 1HTTA 3L2ZA 1WQWA 1WYDA 1IL2A 2C7IA 4HT9A 4HWTA 4M75C 2QHVA 1YB3A 2ZZGA 4CH3A 3JCMc 1JRIA 2I4NA 3BY7A 3M4QA 4J6WA 2ARUA 3HRIA 2I2LA 2VXFA 4Q6GA 4DQ2A 4M7AG 2I4MA 3V7RA 1KQ2A 2ZIOA 5GAN4 4CH5A 5CAIA 4UP8A 1X2GA 4M7DC 2CJ9A 3SB2A 1X2HA 3HRKA 1I81A 3EFSA 5GANh 1G5HA 4OP0A 3JB9H 1QF6A 5HGQA 4KQEA 1LYLA 4YRCA 1X56A 2DU5A 2VXEA 3RF1A 3CMQA 4M78D 1EIYB 4WJ4A 1JBMA 4A54A 1M8VA 4YCWA 4M7AA 4YRRA 4CS3A 3MF2A 3A5YA 2ARTA 2Q7HA 2DU7A 4YROA 4RCCA 1ADYA 3JCMg 4PJOE 1NJ1A 4BWAA 4C8QB 2QHUA 1LOJA 1H4SA 4JRKA 5GMKj 3RKXA 2XGTA 2QTXA 2E10A 4YRMA 3V8LA 4PNOA 4K88A 3HFVA 3RACA 2E5AA 4RDXA 1WNLA 2RD1A 2ZIMA 4F7UF 1D3BB 3LC0A 3VQWA 2EJ9A 2ZCEA 4C92F 1I4K1 4C8QA 4P72A 3OD1A 4M78F 3UFGA 4XU0A 4HWOA 3PZCA 2EL9A 4M77G 4DPGA 4M77B 1MGQA 4ZIBA 2I4OA 4TWAA 5C53B 3RUXA 1PYSB 4M75G 2YLCA 4XTYA 3UH0A 4J6XA 1D3BA 5DY9A 4TTVA 3W3SA 1EVKA 4TQFA 5LJ5h 3P8TA 4J6YA 4PJOD 3SWNC 5GMKi 3M4GA 1H4VB 1TH7A 4M7DG 5GAMh 2ODRC 4M77A 4M7AE 3P8YA 1QE0A 4P73C 2DKGA 5GANe 4XEOA 1PYSA 3QSUA 4XTZA 4M75A 1NJ8A 2CJBA 3RESA 2DQ0A 3AHUA 3BFMA 11ASA 3GIBA 3V7CA 4C92C 1YFSA 4M78C 4WI1A 4AH6A 1WQ7A 3KFUA 4YRNA 2FYKA 2DZCA 2I4LA 3R07A 3A5ZA 4C8QE 4V2SA 4HA8A 2ZT5A 2CGHA 1USYC 3FJPA 2RM4A 1L0WA 4J5YA 5GAOq 4JRIA 4HWSA 2QHSA 4HVCA 1JJCA 4M7AD 5KNNA 5GAOm 4YDQA 1VQZA 5GANd 4TVAA 5GAN7 2Q5HA 4H2TA 4M7AB 1X55A 1EVLA 3HFNA 5GAOn 2AKWA 3QO7A 3DSQA 4UPAA 4P75C 5LJ3j 1FYFA 3A7UA 2E65A 4M77E 3HY0A 1BIAA 5GMKh 4H2YA 2AMCA 2E64A 3LSQA 4XTXA 4EMKC 4P74A 4H2XB 4PG3A 5ELOA 3IKLA 5LJ5e 2DXTA 5C51B 4M75E 3RERA 2DDZA 1HXDA 3JCMJ 5F5WA 5GAMe 3NETA 4MMLA 3RKYA 1YFTA 1KOGA 2ZXFA 4J15A 1NJ5A 5GANf 4C8QD 1E24A 2DQ3A 4H2UA 4PJOC 3NELA 1NJ6A 3RIRA 1NYRA 4H2XA 4YPFA 3QO3A 1KQ1A 4BW9A 3JCMh 4E51A 4RCBA 1HC7A 4NCXA 1E1TA 1I8FA 3HXYA 4X5OA 4F7UG 2ZT7A 2EJGA 4O2DA 2ZNIA 3UGTA 5E3IA 4C92G 4TQDA 3JCMV 4M78G 4G85A 3HXVA 2JN0A 3FIFA 1Z7MA 4EMHA 4M77D 4TVYA 4NL2A 2Q7GA 4CH4A 2FB7A 4P3PA 4C8QF 3BDUA 1LNXA 2E41A 5LJ5d 2VC8A 4M75D 3QO5A 4Y91A 2EJFA 1GGMA 3V7SA 4YCUA 4YP0A 3UGQA 1N9SA 5GAMd 2CIMA 4C92A 3EFRA 4M75B 4XU1A 4RQFA 3HFZB 2E1HA 3I7FA 5GAN8 1B8AA 2DVEA 5K1PA 2DZ9A 2J3LA 3IKMB 4YREA 4RQEA 3RL6A 1E1OA 1NYQA 1I5LA 3IALA 3L1AA 1USYA 4M7DB 1Z7NA 5GMKe 3HSBA 12ASA 1X54A 1E22A 3QHSA 5LJ5f 2DTHA 4H2SA 3HY1A 3V8KA 2CJAA 3TUPA 3HFZA 5LJ5g 5GAMf 3JB9I 4KR3A 1SERA 5GAMg 2ZINA 4P71C 4M7DA 3A7AA 4P75A 2PMEA 3MF1A 3HXUA 3JB9D 2ALYB 1JJCB 2P5IA 2RHSA 1B70B 3JCMe 3A32A 4EMKA 4HWRA 4OLFA 4C8QC 4P72C 4TVAB 4PJOF 3JB9J 1N9WA 3P8VA 5LJ3h 2C8MA 2AKWB 4RMFA 1X01A 1KMNA 5GAOp 3JCMW 2AMCB
chains in the Genus database with same CATH superfamily
3SHWA 3KBGA 3CD6A 4XTWA 2ZTGA 1SSHA 1W2BA 4LDXA 1EZZB 2H3EB 4LNSA 1D1BA 2EQKA 1QKWA 3M0UA 4CS4A 4M77C 1DJ7B 4CC3A 1C0AA 3NMZC 2ZGWA 4YRTA 1I5OB 3U23A 1M8MA 1UGRB 3CMET 2EQMA 3RGLA 5K1XA 4IUQA 3LGFA 1BI0A 3JCMd 2RO0A 4YRKA 3CMEQ 2ARSA 2DE0X 2JS2A 5GANg 2RHQB 5J3BA 3SD4A 2V8IA 1W66A 1D0ZA 1PD0A 2DTIA 1SRYA 3VYGA 4QKUA 2KRSA 4C92D 4YRIA 3G71A 3H0FA 1W70A 4ZN3A 1Y0MA 2X3WD 5GAN6 2DXBA 1Q82U 3WQZA 4YRGA 2EKOA 4WJ3M 4NOYA 3MJXA 3URGA 2OAWA 1M90C 2GBQA 4RTYA 1BB9A 2CS7A 2QGGA 1NE8A 2RHXA 4HT8A 2XTIA 2ZR3A 2CP6A 2Q7EA 2JJ9A 2RJEA 3TEHA 4CS2A 2JTMA 4MMKA 2ZT6A 1TS9A 1OEBA 5IXFA 2ZZFA 2VUBA 2Y4XA 1GBRA 4LDWA 3CCMT 1B3QA 1M1KC 4TVWA 4P74C 2KI7A 4LVMA 2V8JA 3LSSA 1BCOA 2IY5B 4FYVB 4L6V5 2QQRA 3VU3C 2XU8A 5GAOr 1YFNA 2HBWA 2DRKA 5GAOl 2LCSA 1B7YA 2J3MA 1ZSZC 2LNVA 4Z02A 4RTXA 1T0HA 2ZR2A 1BBWA 2K57A 1E7OA 2IPOB 3CCJQ 4C5EA 2V1RA 4JS4A 3HTZA 2DJZA 5GMKm 4FSSA 1WZOA 1ZUUA 2K3BA 2R5AA 4J9FA 1M4ZA 4XTUA 5LJ3d 3L4GB 1YNZA 4YRJA 3HXXA 2HCKA 1V29B 5KE3A 3UATA 3OBYA 2DEQA 2QEXT 1K73U 1KG1A 4H02A 1B34B 1MMNA 1YWPA 1U1SA 4YRLA 1G8XA 1H92A 4X9CA 3M58A 3VQXA 1JU5C 4YRQA 2QEXQ 2NS6A 1GBQA 3VKIA 1U1TA 4J9EA 3EFOB 1PHTA 1KSWA 5D7UA 2P84A 3OA6A 2OTLA 3MEAA 4PJOA 4P5NA 5GAMj 2HL5C 4M78E 3L2WA 3OYNA 3QNEA 2KY9A 2HMAA 3IQLA 1Y57A 4O5VA 3OYMA 3L2ZA 3PNWC 1IREB 1VQ6T 4B9XA 1AWOA 2FPDA 3L2VA 2K79A 1Q7YC 4HWTA 1YB3A 1GFCA 1AEYA 3JCMc 3QG1A 3CCQA 2ARUA 4OGEA 3HRIA 2E4HA 1VQ6Q 2VGMA 4BY6B 4DQ2A 4M7AG 2QQAA 4LN2A 2VV5A 5GAN4 5CAIA 1YI2A 1AZEA 1N8RC 3VUZA 2OAUA 3F70A 2DEUA 3I56T 1OPLA 3C94A 3OS0A 2ZPFB 3GF5A 1QLYA 2VXEA 8ATCB 5IXBA 1JBMA 3OYDA 3MF2A 2CH4W 1JJ2P 2RN8A 3I56Q 2Q7HA 3LX7A 4AG2C 4IUUA 4RCCA 1NJ1A 1VQ9A 2ECZA 4IUTA 1GCQA 1LOJA 4JRKA 8AT1B 2QTXA 1YWOA 4ZN1A 3G71T 2M02A 1YIJA 3OYLA 4K88A 4OB0B 2DPPB 5IH2A 4RDXA 2GTOA 1M3AA 2ZIMA 4F7UF 2R58A 3LGLA 3PTAA 2EGAA 2ZCEA 4C8QA 4M78F 2FRYA 4FT2A 1BYMA 2RQWA 1UJYA 1JB0E 3QBYA 4DPGA 1ZUYA 1R0BG 2I4OA 4TWAA 4Z8AA 1D0XA 2YT6A 2QG9B 1GRIA 1K9MR 2HKNA 2C06A 5FWCA 1D3BA 2DA9A 5DY9A 1KC8R 4C0FA 3HRSA 3M0RA 2F69A 4ZTJA 1FMVA 2Y4YA 1H4VB 2MPXC 5GAMh 2EYQA 2KQWA 4M77A 2L3PA 1ABQA 2QAZA 2DKGA 2F1LA 4F16A 2KT1A 1X69A 3OYBA 4M75A 1PCXA 3EHRA 2CJBA 2M0YA 3RESA 1NLPC 2VWFA 1VQOA 3A8GB 1PD1A 4HCBA 2DL8A 1U5SA 3BFMA 4A4HA 2KGTA 1EX4A 4M78C 1KQSS 1WQ7A 3HTRA 4E7SA 1VQNQ 4YRNA 4BUGA 2L5QA 2DZCA 2NWMA 1MMGA 4HA8A 4L5GA 1QP3A 3DLMA 3FJPA 2GNCA 1QCFA 4RG2A 2FZGB 2GF7A 4JRIA 2OTLT 4RTWA 1T3LA 2QHSA 3UA7A 4M7AD 2D0QB 5FLXE 1M3BA 4OVAA 4BE0A 5GANd 4XAXB 2EW3A 1BU1A 2OTLQ 1AOJA 1WI7A 4AFZC 5LJ3j 2DBKA 1FYFA 4N4HA 3HY0A 2DYIA 1EFNA 1AZGB 4XTXA 4P74A 2RK1A 2DXTA 5DLOA 3RERA 2CZ1B 1SPKA 3CCQT 3T9NA 2EIFA 3CCET 2ENMA 2FEIA 3OYYA 4MMLA 3RKYA 1KOGA 3CXCS 2CT4A 1ZSZA 2RI3A 4J9GA 1NG2A 1RAIB 1D09B 2DQ3A 3CCQQ 1YI2T 3O5ZA 2GFAA 3CCEQ 3MQZA 4ESRA 1Y7XA 2M1HA 3VS7A 1YP5A 3REBB 4H2XA 2WSFE 3JCMh 1AT1B 1ZX6A 1K0SA 4OMNA 2XDPA 2H8HA 4KRTA 2RHYA 3CCST 5A0DA 4C0DB 2NUZA 3DB3A 4LVIA 2JN0A 2ZCFB 4A4EA 2KROA 4Y28E 3AT1B 3CCSQ 4E7IA 4ZTFA 2C0IA 5KE2A 4NL2A 3G4SA 1WDXA 2DIQA 2VC8A 2K5FA 5LJ5d 1YITT 1ZBJA 4Y91A 3TQ7P 1GGMA 3V7SA 1TUGB 3ME9A 1KD1C 1N9SA 4KH0B 4RQFA 5IHKA 2LJ3A 2E1HA 4J7FA 5GAN8 3NPFA 1YITQ 1K73R 4YREA 2LCLA 2LVMA 3OS5A 2HZYA 3RL6A 2E6ZA 3SDZA 1IRXA 1E1OA 1M3CA 4M7DB 2VGNA 3N5BB 1IGUA 1RAEB 3OYAA 3MP6A 1OQKA 4PLLA 1VQ5A 2RF0A 2AT1B 2F5KA 4CI0C 3HY1A 2BE9B 3HFZA 4Q5WA 3MP1A 5GAMf 2MOXA 3JB9I 5D6WA 1SERA 1SRMA 2DLPA 2E5KA 3G7ZA 3UF4A 2LQNA 1UDLA 4YTLA 5IHIA 3FEOA 3A7AA 2KNBB 4P75A 4FYWB 3MF1A 2PMEA 5I2MA 2ALYB 3QZ5B 1YHQQ 2KBTA 4AMCA 3H6ZA 2ZPBB 4A4FA 4HWRA 4OLFA 2L3RA 1ZQ1A 3PIOA 4PJOF 1X2QA 3JB9J 3P8VA 5LJ3h 5CK9A 2QQSA 3M56A 2DXCA 5GAOp 2YUOA 4GLMA 3HRTA 5HY6A 2K5IA 4FIBA 2FVUA 1VQ4A 3CMAQ 5FRNA 4C92E 2QQBA 1B70A 3NFCA 3I9QA 4EX5A 2IVWA 2K3XA 2P4RA 3JB9F 1G51A 2LMJA 4JLIA 1M2VB 4IUPA 2KE9A 1X6GA 3MEUA 1ATIA 1TXQA 2ODRD 2EVRA 4UP7A 1SKUB 1VQKQ 4OMFB 3SWNB 4GLKA 3CPWS 2D8HA 4OMOA 5GAN5 2G4CA 4ZTZB 2FO0A 1M1GA 2VVKA 3ER0A 1C1AA 1H4QA 3CCRA 5AYFA 2AKLA 4OMLA 4CC4B 2QYZA 1JQQA 2HQXA 4DA4A 1VQMT 3EGXB 4ZGJB 4YRPA 2PNIA 4HCCA 2ZZEA 1C6VX 4C92B 2QDLA 2LZ6B 3NEMA 4P3OA 3JCMf 1WPYA 1UEBA 1VQMQ 2DILA 3GLXA 1YJ9A 1IGQA 4C8QG 3OYIA 3CC7Q 2J05A 4J9BA 1YGBA 2A7YA 1K8AR 1KJWA 5GANj 2RNAA 2A0FB 4F7UA 1WHGA 2P0LA 4MDXA 1LJOA 5KYXA 4M78A 3VQVA 3E9GA 4BACA 3JCMQ 4M7DD 1MMDA 4N4GA 3C0CA 1UHFA 3G4ST 4ORZA 1SEMA 2QASA 3OMGA 3CXCP 1RI0A 1VQPA 3LLRA 1UECA 1X2KA 4EO4A 2EYZA 3M0PA 3REUA 2JM9A 4LUDA 4KGXB 4EMKB 4M77F 2FRWA 4LDYA 1WXBA 4N0AA 2X9HA 4A4GA 4ME7A 3ZFJA 2ZPHB 2AZVA 1Q86U 2EQUA 2HBPA 2JMAA 1K9MU 4M75F 3NHNA 3PCOA 5A2QE 1QP2A 3EGDB 2LQWA 2RA2A 3TEGA 2W0ZA 1MUZA 1WU7A 3EG9A 3M55A 3R6NA 4L87A 1NYGA 1D1AA 2NUTB 1VQ5T 2SEMA 1Z9QA 5FU7B 1QVPA 4Y92A 2GFUA 1VYVA 3JCMP 3KUFA 4YYEA 1RACB 1AWJA 5LJ5j 1S72A 1EFWA 2WSEE 5LJ3f 2KXCA 1UE9A 1NJ2A 1EQRA 1ASYA 2MYSA 2K5LA 2DERA 3INZA 1BI2A 7AT1B 4LDVA 1PNJA 4J9DA 1HTTA 2X51A 2K7AA 3OW2A 3TVTA 3VS5A 1VQ7T 3D7SB 4PL6A 4GBQA 3MO8A 4HT9A 1M2OA 4ZGDB 3QJYA 1W2BS 4M75C 1VQ4T 2QHVA 2XI9A 2ZZGA 1JRIA 2I4NA 4J6WA 5KYUB 1VQ7Q 2VXFA 3OYKA 3PE0A 2E3IA 4CH5A 4UP8A 1VQ4Q 1X2GA 1M1FA 1M30A 2CJ9A 1BKBA 3SB2A 5HCKA 2C0OA 3HRKA 1Y71A 4XK8E 4KULA 2YUNA 5GANh 1G5HA 1R77A 1VQLA 3EH2A 4Z88A 1CKAA 2MIOA 1IXDA 4A54A 4YRRA 1WLPB 1UJ0A 5CVIA 1OYXA 2QHUA 2YUQA 4FYYB 4VUBA 3HL8A 5GMKj 1ZA2B 2DD4A 2E10A 5A0GA 9ATCB 3V8LA 1RABB 2PU9B 2XG8D 4PNOA 3HFVA 1WX6A 2RQUA 2CP7A 3LC0A 3M59A 3VQWA 1YJ9T 1I4K1 3OD1A 3UFGA 1TU0B 2DVJA 4XU0A 3CCMQ 1HSQA 2EL9A 2DO3A 1MGQA 4J9IA 1EIFA 1WIEA 2K3YA 1AD5A 1FX7A 2L8DA 2MK5A 6AT1B 2YLCA 3RR6A 3E9FA 3H8ZA 2XKOC 4J6XA 3I35A 4RTUA 1GCPA 1EVKA 4LD6A 5LJ5h 4OGCA 1CSKA 2JVVA 4PK4A 2J7IA 2QQ9A 1IHVA 4M7AE 5FRMA 3P8YA 3PMTA 2KR3A 4P73C 4OB1B 5KYWB 1W4SA 1PYSA 2QTVA 3QSUA 4EDUA 4PFOA 2IG0A 1NJ8A 2OX7A 2I0NA 2JUFA 3AHUA 3MKDA 4OMMA 3GIBA 11ASA 4LVLA 3E19A 5CKEA 3NTIA 3V7CA 3MP8A 1SHFA 3P8HA 3ASKA 5CKFA 4WI1A 4AH6A 2O4XB 2RK2A 4TVRA 1R8OB 1VIFA 1VQ8A 1B07A 2ZT5A 5FW9A 2CGHA 4NS5A 3CCVA 3JRZA 2RM4A 3CC2A 1ACMB 2P0PA 2KMTA 3E2UA 3P8BB 1S72T 3QIIA 3OYGA 3CD6T 1QVFP 4HVCA 4YDQA 2NUPB 5CIUA 4M7AB 1S72Q 3CD6Q 3A8HB 3BDLA 2BUDA 4KGVB 1C0MA 2LCCA 1PWTA 4P75C 1OPKA 2D0NA 3A7UA 3GP8A 5GMKh 4H2YA 3LSQA 3R6OA 2LP5A 5DLQE 2RPNA 4PG3A 1QW1A 3EG1A 5C51B 4II1A 1ZBXA 2DDZA 3O8VA 2RI2A 1D0YA 3L42A 3VS2A 1SHGA 2XICA 3NETA 3MHXA 4BDZA 2WACA 5GANf 4FT4A 2P0QA 1IB8A 1YN8A 5EC7A 3I5RA 3ZL7C 3GOXA 1T0JA 1KC8C 1TOVA 1TWBA 4JDSA 1LPLA 4E51A 1K4US 5CKBA 4RCBA 1HC7A 4PJJA 4LNPA 1I8FA 4LUEA 4X5OA 2YRDA 2DL5A 4F7UG 2ZT7A 1NJIC 3MPUB 2GGRA 5E3IA 4B6MA 4M78G 4G85A 1NLOC 3FIFA 3G71Q 1Q7YR 2M51A 2GTJA 1BI3A 3VRZA 1G5VA 4CH4A 2FB7A 3BDUA 3VUBA 1LNXA 1WHLA 2EJFA 1PSFA 3TU4K 1Q86R 4YCUA 2HKQB 3QYHB 4C92A 1K8AU 2FHDA 3I7FA 5K1PA 2DZ9A 1N8RR 2YSQA 1LCKA 3JAME 4BY6C 1TTHB 2FG0A 2PVGB 3KFVA 1U8RA 3X24B 2BKDN 4OB2B 4RTZA 1E22A 4FCYA 1QQJA 5LJ5f 1YJWA 1RLQC 2CP3A 2DTHA 3A5ZB 2CJAA 3TUPA 1HD3A 2D6FA 3EGUA 1FYNA 2RJFA 4KGZB 4ZGEB 5GAMg 1Q81U 2ZINA 1WHHA 3EG3A 5KCOA 4KUDK 3WVDB 3CCUA 1JJCB 2QXFA 1FXXA 2D8JA 3NTHA 2RQTA 4EMKA 1Q82C 2MWOA 5KYYA 2JOYA 4P72C 1VYTA 1G83A 4RMFA 1X75C 4HVUA 4J9CA 1BK2A 3FLGA 3EGDA 4DOWA 2AMCB 2EWNA 1ZHIA 4E6RA 3BW1A 1PRMC 2F2WA 4N0AC 4KUIA 1UFFA 1J5WA 2ZNJA 5HKCA 5FWBA 2ESWA 2EBPA 2NUTA 2PQWA 3ZEHA 2CZ0B 2KRNA 2MAMA 4OMPA 3REXA 3M5AA 3CCVT 2DK3A 3QZ9B 4FYXB 1D1CA 1QMCA 2BE7D 3OMCA 4ELZC 2RB6A 3QTCA 3X20B 3A74A 2PTKA 3CCVQ 3TSWA 1M5Q1 4P3NA 1RUWA 4X9DA 4KH1B 3X25B 3H0HA 3HXZA 1NEBA 2CDTA 4M7DE 3M4PA 2PMFA 3L2RA 3WVEB 1LVKA 1WLEA 2EAYA 2CZ7B 1K73C 2CUBA 3BJUA 3TEHB 1RIQA 2COWA 5ECAA 1UG1A 3M4YA 1E6HA 1XOVA 2K4YA 1YI2Q 3VS6A 2YRCA 1U3OA 2H3JA 5CKDA 2O01E 4HWPA 4P73A 4KR2A 1QWFA 2RHQA 1VQ9T 3H9NA 1MV0B 2Y90A 1OU9A 2R57A 4IIOA 1QVGA 1OZ3A 1B7YB 1NPRA 1PC0A 4G84A 2JM8A 1Z9ZA 3QWXX 1VQ9Q 2QI2A 1BI1A 2YDLA 1YIJT 2DIGA 3UT1A 4YRSA 4XEMA 1RADB 2MWPA 2QA4A 2ZT8A 4QVDA 2LRQA 2ZPEB 3VS3A 2DL7A 3X28B 1OX9A 4K87A 2K2VA 2O2OA 4C5HA 1BCMA 1YIJQ 2Q5IA 2J6FA 5J39A 3EHQA 1KMMA 1BIBA 3OS1A 3FB9A 3L2QA 1QWEA 1SETA 2CREA 3A31A 3QKJA 3PMIA 1X27A 1H4TA 2DJQA 3PT9A 4AFUC 3RKWA 5KH6A 2IY5A 1QCOA 1KK7A 2R5MA 2XMFA 3A8OB 4PHCA 3VRYA 2DETA 1Y96B 2HNIA 3DLLA 1WJSA 3HP9A 4PJOG 3QXEB 4PJOB 2VYTA 4FW1A 2DXUA 4M7DF 1YJWT 2GQVA 3QO8A 1YJNA 4BI4A 3C12A 4JZ3A 2M0OA 4KBMB 2YHTA 4WF2A 1VQOT 3OQ5A 4QQ6A 5GAN2 1ASZA 5M9OA 1M90U 3QUIA 1YJWQ 2DTOA 2KYMA 3L4GA 3L2UA 1X6OA 5ELNA 1ZSGA 4C0DC 2XIDA 2E5QA 4CH6A 4H2WA 2JXBA 3CCUT 1VQOQ 1KD1R 4DOVA 1F1BB 1B34A 5LJ3g 1IZ6A 1OZ2A 2LDMA 1RAAB 3JB9G 1TUDA 2PZ1A 3E9IA 1SG5A 2J6OA 1G5IA 4FL6A 5I21A 1M1KU 3M0QA 1S1NA 1RLPC 3EFOA 5FU6B 1PRLC 1H8KA 3X26B 3CMEA 2CT3A 3M4QA 3BY7A 3QDFA 4LDUA 2FPEA 4PLIA 2I2LA 4DEXA 2RQVA 2O4XA 1NBEB 4Q6GA 2OJ2A 3V7RA 1KQ2A 2I4MA 4DBRA 2AKKA 4M7DC 1V76A 1W6XA 3G6EA 4RTTA 1KQSP 4OF1A 4X34A 1I81A 2CP0A 4OP0A 3JB9H 2A37A 1QF6A 2NLUA 5HGQA 4KQEA 2RJCA 1X56A 3M0SA 2YXYA 2LX9A 1EIYB 5D6XA 4JS5A 1M8VA 2EQIA 4YCWA 4LVKA 4M7AA 2BZYA 4CS3A 2NYSA 1WFWA 2DNUA 3QJ6A 3UDCA 2DU7A 3I5SA 1OV3A 4C8QB 1H4SA 1QKXA 4BD3A 3DKMA 2XGTA 4YRMA 4C5IA 2DX1A 3QYGB 3S3OA 3RACA 3M57A 1B7TA 3MEWA 2AZSA 5IN1A 1D3BB 4C92F 2JS0A 4P72A 2ABLA 1O75A 3J7AF 5CO7A 3PZCA 3EG2A 3CCJA 4M77G 1RAFB 2GCXA 4M77B 1OULA 4ZIBA 3UWNA 1Q7YU 5C53B 2BZ8A 2LTOA 2JZ2A 2KXDA 3OYJA 3RUXA 1Q81R 4M75G 3G4SQ 3HHTB 4XTYA 1QVFA 1N5ZA 1G3SA 2QA4T 1RL2A 4TTVA 5D6YA 3W3SA 3P8TA 4PJOD 3SWNC 1H3ZA 2CKKA 2KEAA 3E1SA 3I55A 1N8RU 2FZKB 2ZPIB 1WGSA 3CBPA 2CSQA 2QEXA 1QE0A 3LWIA 4EPCA 1JO8A 5CQYA 2DRMA 1AHJB 4XEOA 4XTZA 1JXMA 4WTOB 1OI1A 4QVZA 2D9TA 1VQ5Q 1UGPB 5I22A 1JJ2A 1V1CA 4C92C 2EYYA 1FMKA 2JNGA 2CP2A 4E7LA 3OSVA 3A5ZA 4JRQA 4LXCA 1YJNT 4V2SA 3M9QA 1WJRA 4CC2A 2Z0WA 4F04B 2JW4A 5A0LA 4CC7A 2LT1A 1ZUKA 4L59A 5I11A 1YJNQ 5GAOq 4HWSA 2YUPA 2IIMA 1PG5B 1JJCA 1MNEA 5GAOm 2JTFA 1VQZA 2HQHA 2LJ0A 5GAN7 3OYFA 4H2TA 3HFNA 5GAOn 1ZSZB 2RJDA 3OW2S 4UPAA 1U06A 3QDRB 4BE2A 5C6SA 1A0NB 1OOTA 2E65A 2F2VA 1BIAA 4E7KA 2AMCA 2E64A 4DBQA 4EMKC 4QT7A 4H2XB 3I56A 4JJCA 5ELOA 3IKLA 2EKHA 1G3TA 1UB4A 3PVLA 1MNDA 3MCAB 2BTTA 3JCMJ 5GAMe 2V1QA 1YFTA 4R0KA 3S6WA 1J3TA 3M0TA 2ZXFA 4ANJA 1NJ5A 4C8QD 1E24A 3G1JA 4UC4A 4H2UA 3G6ET 3PIPA 2ATCB 3RIRA 3CCRT 1R0CB 2VKNA 4BW9A 3QO3A 5FU7C 3HRUA 5FROA 3HXYA 2OI3A 3CQTA 3G6EQ 4O2DA 2ZNIA 3CCRQ 2ROTA 1TSFA 4E2FB 4TQDA 2LX7A 3HXVA 1G3YA 2DMOA 4M77D 3DB4A 1FWZA 4FW2A 2SRCA 2Q7GA 4P3PA 3CPWP 3P8DA 2E41A 4M75D 3QO5A 1YJ9Q 3VV0A 2EYWA 5GJVB 2X4XA 3EFRA 4IUVA 4XU1A 5HK3A 3HFZB 1B8AA 2DVEA 2MF2A 4HCKA 4RQEA 1NYQA 1I5LA 3IALA 1VIEA 3CCJT 1USYA 1Z7NA 3TCJA 3HSBA 1XNIA 1VQPT 12ASA 3C95A 3QHSA 3EH1A 1OU8A 1M90R 4H2SA 3WXMB 3V8KA 5LJ5g 1XTDA 3TEEA 1VQPQ 2JMCA 1VQNA 2HQEA 2HL3A 2O9VA 3A8LB 1WA7A 4RMOA 3I55T 4M7DA 2P5IA 1UTIA 3JCMe 1M1KR 1B70B 2RHUA 4PJNA 4TVAB 4DBFA 3I55Q 3VS1A 2AIRB 5LL6S 2AKWB 1FMWA 1NPPA 2XD0A 2V26A 5I2SA 1WXTA 4HKEA 4A63B 1GFDA 2AK5A 1PSEA 5GAN3 2FZCB 4F7UE 4UP9A 1Y96A 4DBHA 3H41A 2QGFB 2ALYA 2L0AA 2EQJA 4C0ZA 4ELYC 2CZ6B 1VYUA 4KT0E 4J83A 4CRIA 1KD1U 2QHTA 4BB7A 2A8EA 4JJBA 1XQHA 2DL4A 2DYBA 4YRFA 2E3HA 4J8OA 3HPWA 3OBWA 4XU2A 2LNHB 4QW2A 1H3HA 2BZXA 1NEGA 3M53A 1TUCA 4PFPA 1Q95G 4H2VA 3CCEA 1MV3A 5GMKl 3V8JA 1AWXA 3ERRA 1B76A 3C4SA 2VASA 1Q86C 4BI8B 1K9MC 4ZNXA 4A4KA 2XHCA 3PGGA 4M7AF 2M16A 1WXUA 2PUKB 2RMOA 3H0IA 4HXJA 1TG0A 4A53A 1M2VA 2E3CA 1YCYA 1VQLT 4ATOA 3GNGA 1SSFA 3S3MA 1K0XA 2MMPA 3LWHA 1RAHB 4K86A 4F7UB 3CCSA 3Q1JA 4MZMA 2X4YA 3SWNA 3VJPA 4LVJA 2LT4A 1ZA1B 1I0CA 5KYNA 1XJWB 3M54A 3VQYA 1VQLQ 5KYXB 4M78B 1RAGB 1EOVA 4XQ3A 3TSZA 4QQDA 3G1ZA 4YCVA 3RNJA 1W2BP 5LJ3e 1NNHA 3IG2A 4Q15A 1H641 4RUGA 3E9HA 1N27A 3QWYA 1KIKA 4LE9A 1QCNA 1YITA 3EGXA 1N9RA 1SESA 4QVCA 3OW2P 3JCMb 1EIYA 4P71A 2L3SA 4JUVA 2XDDA 1I07A 4NL3A 2DAQA 3HXWA 3PCOB 2XK0A 2PVDB 4M7AC 3JCMX 3BE3A 3SFMA 1VOMA 4IKFA 3EG9B 1N6AA 4MZTA 3UPUA 2RHSB 4AG1C 1YFRA 1GL5A 2HDAA 4XTVA 3ICAA 1AVZC 2M9UA 1Y07A 1YHQA 2YLBA 3VBBA 3HFOA 4E47A 2QDYB 2W10A 2YWWA 4RG8A 2DL3A 4IURA 3NENA 2L2PA 1MMAA 1UUEA 4EMGA 2CYZB 1HJDA 1NJIR 1BBUA 2A36A 2EYXA 4RKUE 4AT1B 2HD0A 3CCLA 1KQSA 4JZ4A 1ADJA 1KFZA 3A7RA 3CMAA 3PFSA 2HSEB 4XU3A 1VQNT 3MEYA 2DD5A 1PKSA 2E6NA 2E70A 4BI3A 5C52B 5IT9E 1BBZA 2GQIA 4M4ZA 2ED0A 4PJLA 1HK9A 4HVVA 4D8DA 4JJNK 4ZTUB 3GNFB 3PVQA 1VQ8T 3SEMA 2VB6A 2XDBA 2KRMA 2CSIA 4X1VA 3CC2T 2J6KA 1WQWA 1VQKA 1WYDA 1IL2A 2C7IA 2COZA 1GXIE 2B8AA 1VQ8Q 1SF9A 3RDVA 4BE1A 2MCNA 4CH3A 3CC4A 5L23A 3CC2Q 1T3SA 1WJQA 3OYEA 4PJMA 5GJWB 4F17A 3FJ5A 3JSCA 2ZIOA 4JPBW 1M9SA 2KAFA 2X4JA 3CXCA 2KK4A 2HEQA 1K1ZA 1X2HA 2RHIA 3QPHA 1PM3A 1SRLA 3EFSA 3ZBDA 2C0TA 2COYA 1M27C 4YRCA 1LYLA 1Q82R 2DU5A 2KYBA 2D1XA 1VQMA 2EGEA 2HSPA 3OS2A 3CMQA 3RF1A 5KYUA 4M78D 4WJ4A 5DM7R 1NZ9A 3CC7A 1JEGA 4K11A 5L8RE 2EFIA 3A5YA 2ARTA 4YROA 1G2BA 2JT4A 1ADYA 3JCMg 4PJOE 4BWAA 4BDYA 2ZAEA 4R55A 1KHIA 3JV3A 2K6DA 3RKXA 3OYCA 3CEYA 4N4IA 2F5TX 2BIVA 4JJDA 1OX8A 3GBQA 2DF6A 4F14A 1G3WA 4LD9K 4C0GA 2F2XA 2E5AA 1WNLA 3MEVA 2RD1A 3ULRB 1UGSB 1ABOA 1WHKA 2EJ9A 5HK0A 1QVGS 4HWOA 2PVOB 2AHJB 1WHMA 4FU6A 2FL7A 5C0MA 3RBBB 1E6GA 1X6BA 2EPDA 4HCZA 1PYSB 1W1FA 5CR2A 3UH0A 3UA6A 4TQFA 3NGPA 4AFSC 4J6YA 3LH5A 5GMKi 3M4GA 2L3QA 1UGVA 1TH7A 3THKA 4J7IA 4M7DG 2OTJA 2ODRC 2G3RA 1WHJA 1VA7A 5GANe 4E7ZA 3CBOA 3S3NA 2A3LA 2KDSA 2JTEA 1VUBA 1YHQT 2DQ0A 1UGQB 3EG0A 5IHNA 2YRVA 3CPFA 1NM7A 2P4TA 3A1PA 1YFSA 2RI5A 3REAB 2P0KA 4IIMA 2CP5A 3KFUA 1KHCA 4JLGA 4Z89A 5KYWA 2FYKA 3CCLT 1AWWA 2I4LA 3A8MB 3R07A 2V8KA 4C8QE 1HYOA 2DFUA 2X3XD 3CMAT 1USYC 4B9WA 3CCUQ 4PKCC 1ARKA 4D6WA 4MDWA 3J81E 1L0WA 3CCLQ 1VQ7A 4J5YA 2RHZA 1I1JA 4E7JA 5KNNA 1K8AC 4C5GA 5AT1B 4TVAA 2Q5HA 3FRNA 1X55A 2EGCA 1EVLA 2L89A 2AKWA 3QO7A 3CPWA 2LC4A 3DSQA 4J9HA 1CKBA 2CUDA 4M77E 1VQKT 3KXTA 1K76A 1WYXA 3RMQA 3TREA 2KT8A 2A28A 3LYIA 5LJ5e 2E12A 2HAXA 4M75E 1MHNA 1YBYA 3CC4T 2DBMA 1HXDA 5F5WA 2NUPA 2J06A 3OB9A 4J15A 1Q81C 2O88A 4WCIA 4PJOC 3CC4Q 3NELA 1NJ6A 3A98A 3OSSC 1PKTA 2LJ1A 2K2MA 2LQ8A 4PFZA 1NYRA 4YPFA 4O6JA 1KQ1A 5CQXA 3META 4HVWA 3GPLA 1E1TA 4NCXA 5KCHA 2EJGA 3UGTA 3VS4A 3CC7T 3CCMA 4C92G 3JCMV 3FC3A 3VYHB 2ED1A 1NYFA 4R56A 2X4WA 1Z7MA 2FPFA 4EMHA 1YCSB 2RH2A 4TVYA 4D8KA 2PUOB 4C8QF 5EG2A 3J80E 4OB3B 2RQRA 1UHCA 2O9SA 3LW5E 3CBMA 5FU6C 3UGQA 4YP0A 5GAMd 2CIMA 3OY9A 2KSSA 4M75B 5CCAA 4DEYA 4OMQA 3NTKA 2J3LA 3IKMB 4EIKA 4MZPA 1P92A 2ROLA 4RTVA 3L1AA 1ZLMA 2WSCE 3LH0A 2QA4Q 5GMKe 2K9GA 2G6FX 3VS0A 1JXOA 2ZPGB 4GY5A 1X54A 4FSXA 2LQKA 2KVQG 1QVFS 1IO6A 5J26A 5KYYB 1GCQC 1RI9A 2O31A 2QK0A 3RMSA 3FDRA 2A08A 5CKHA 4HT4A 4KR3A 4JRPA 2B86A 2CH4A 4AFQC 4E7HA 4P71C 1KC8U 2OTJT 4FM4B 3HKSA 2DM1A 1IHWA 3HXUA 2MI6A 3JB9D 2RHSA 1X43A 2X35A 4QQGA 3A32A 4C8QC 3OYHA 1N9WA 2OTJQ 2C8MA 1NJIU 1O9SA 5IAYA 1QVGP 1K9AA 1X01A 2ZZDA 1KMNA 3EAEA 1VQ6A 1JJ2S 3JCMW
chains in the Genus database with same CATH topology
3KBGA 3CD6A 4XTWA 2ZTGA 1W2BA 4LDXA 4LNSA 2EQKA 4CS4A 4M77C 1DJ7B 1C0AA 2ZGWA 4YRTA 1UGRB 3CMET 2EQMA 3RGLA 5K1XA 4IUQA 3LGFA 1BI0A 3JCMd 2RO0A 4YRKA 2ARSA 5GANg 2RHQB 5J3BA 3SD4A 2V8IA 1W66A 2DTIA 1SRYA 3VYGA 4C92D 4YRIA 3G71A 4ZN3A 5GAN6 2DXBA 1Q82U 3WQZA 4YRGA 2EKOA 4WJ3M 4NOYA 3URGA 1M90C 2CS7A 1NE8A 2RHXA 4HT8A 2XTIA 2ZR3A 2Q7EA 2RJEA 3TEHA 4CS2A 2JTMA 4MMKA 2ZT6A 2ZZFA 2VUBA 2Y4XA 4LDWA 3CCMT 1M1KC 4TVWA 4P74C 4LVMA 2V8JA 3LSSA 2IY5B 4L6V5 2QQRA 3VU3C 2XU8A 5GAOr 5GAOl 1B7YA 2J3MA 2LNVA 4Z02A 2ZR2A 1BBWA 2K57A 4C5EA 4JS4A 3HTZA 2DJZA 5GMKm 2R5AA 1M4ZA 4XTUA 5LJ3d 3L4GB 4YRJA 3HXXA 2QEXT 1V29B 5KE3A 1K73U 3OBYA 2DEQA 1KG1A 4H02A 1B34B 1U1SA 4YRLA 4X9CA 3M58A 3VQXA 4YRQA 2NS6A 3VKIA 1U1TA 3OA6A 2OTLA 3MEAA 4PJOA 4P5NA 5GAMj 4M78E 3L2WA 3OYNA 3QNEA 2KY9A 4O5VA 3OYMA 3L2ZA 3PNWC 1IREB 1VQ6T 4B9XA 3L2VA 1Q7YC 4HWTA 1YB3A 3JCMc 3QG1A 3CCQA 2ARUA 4OGEA 3HRIA 2VGMA 4BY6B 4DQ2A 4M7AG 2QQAA 2VV5A 5GAN4 5CAIA 1YI2A 1N8RC 3VUZA 2OAUA 3F70A 3I56T 3C94A 3OS0A 2ZPFB 3GF5A 2VXEA 1JBMA 3OYDA 3MF2A 2Q7HA 3LX7A 4IUUA 4RCCA 1NJ1A 1VQ9A 4IUTA 1LOJA 4JRKA 2QTXA 4ZN1A 3G71T 1YIJA 3OYLA 4K88A 4OB0B 2DPPB 4RDXA 2ZIMA 4F7UF 2R58A 3LGLA 3PTAA 2ZCEA 4C8QA 4M78F 4FT2A 1BYMA 1JB0E 3QBYA 4DPGA 2I4OA 4TWAA 2C06A 1D3BA 5DY9A 4C0FA 3HRSA 2F69A 4ZTJA 2Y4YA 1H4VB 5GAMh 2EYQA 2KQWA 4M77A 2DKGA 3OYBA 4M75A 2CJBA 3RESA 1VQOA 3A8GB 4HCBA 3BFMA 4A4HA 4M78C 1KQSS 1WQ7A 4YRNA 4BUGA 2L5QA 2DZCA 4HA8A 4L5GA 1QP3A 3DLMA 3FJPA 4RG2A 2GF7A 4JRIA 2OTLT 2QHSA 4M7AD 2D0QB 5FLXE 4OVAA 4BE0A 5GANd 4XAXB 5LJ3j 1FYFA 4N4HA 3HY0A 4XTXA 4P74A 2RK1A 2DXTA 5DLOA 3RERA 2CZ1B 3CCQT 3T9NA 2EIFA 3CCET 4MMLA 3RKYA 3OYYA 1KOGA 3CXCS 2RI3A 2DQ3A 1YI2T 3MQZA 2GFAA 1Y7XA 2M1HA 4H2XA 2WSFE 3JCMh 2XDPA 2RHYA 3CCST 5A0DA 4C0DB 3DB3A 4LVIA 2JN0A 2ZCFB 4A4EA 4Y28E 4E7IA 4ZTFA 5KE2A 4NL2A 3G4SA 2DIQA 2VC8A 2K5FA 5LJ5d 1YITT 4Y91A 1GGMA 3V7SA 3ME9A 1KD1C 1N9SA 4RQFA 2E1HA 4J7FA 5GAN8 4YREA 2LCLA 2LVMA 3OS5A 3RL6A 2E6ZA 3SDZA 1E1OA 4M7DB 2VGNA 3N5BB 3OYAA 3MP6A 4PLLA 1VQ5A 2F5KA 4CI0C 3HY1A 3HFZA 4Q5WA 3MP1A 5GAMf 3JB9I 5D6WA 1SERA 3G7ZA 4YTLA 3FEOA 3A7AA 4P75A 2PMEA 3MF1A 5I2MA 2ALYB 3QZ5B 3H6ZA 2ZPBB 4A4FA 4HWRA 4OLFA 2L3RA 1ZQ1A 3PIOA 4PJOF 3JB9J 3P8VA 5LJ3h 5CK9A 2QQSA 3M56A 2DXCA 5GAOp 5HY6A 3HRTA 2K5IA 4FIBA 2FVUA 1VQ4A 5FRNA 4C92E 2QQBA 1B70A 3NFCA 4EX5A 2IVWA 2K3XA 3JB9F 1G51A 4JLIA 4IUPA 3MEUA 1ATIA 2ODRD 4UP7A 4OMFB 3SWNB 4GLKA 3CPWS 5GAN5 2G4CA 4ZTZB 1M1GA 3ER0A 1H4QA 3CCRA 5AYFA 2HQXA 4DA4A 1VQMT 4ZGJB 4YRPA 4HCCA 2ZZEA 4C92B 3NEMA 4P3OA 3JCMf 1WPYA 1UEBA 3GLXA 1YJ9A 4C8QG 3OYIA 1YGBA 2A7YA 5GANj 4F7UA 2P0LA 4MDXA 1LJOA 3VQVA 4M78A 3E9GA 4BACA 3JCMQ 4M7DD 4N4GA 3G4ST 3OMGA 1RI0A 1VQPA 3LLRA 4EO4A 3REUA 4EMKB 4M77F 4LDYA 4N0AA 4A4GA 4ME7A 3ZFJA 2ZPHB 1Q86U 2EQUA 2HBPA 1K9MU 4M75F 3PCOA 5A2QE 1QP2A 2RA2A 3TEGA 1WU7A 3M55A 4L87A 1VQ5T 5FU7B 1QVPA 2GFUA 3JCMP 3KUFA 4YYEA 5LJ5j 1S72A 1EFWA 2WSEE 5LJ3f 1NJ2A 1EQRA 1ASYA 2K5LA 3INZA 1BI2A 4LDVA 1HTTA 3OW2A 1VQ7T 4PL6A 4HT9A 3MO8A 4ZGDB 3QJYA 1W2BS 4M75C 1VQ4T 2QHVA 2XI9A 2ZZGA 1JRIA 2I4NA 4J6WA 2VXFA 3OYKA 4CH5A 4UP8A 1X2GA 1M1FA 2CJ9A 1BKBA 3SB2A 3HRKA 1Y71A 4XK8E 4KULA 5GANh 1G5HA 1VQLA 4A54A 4YRRA 5CVIA 1OYXA 2QHUA 4VUBA 3HL8A 5GMKj 2DD4A 2E10A 5A0GA 3V8LA 2PU9B 2XG8D 4PNOA 3HFVA 3LC0A 3M59A 3VQWA 1YJ9T 1I4K1 3OD1A 3UFGA 4XU0A 2EL9A 2DO3A 1MGQA 1EIFA 2K3YA 1FX7A 2L8DA 2YLCA 3E9FA 3H8ZA 2XKOC 4J6XA 1EVKA 4LD6A 5LJ5h 4OGCA 2JVVA 2QQ9A 4M7AE 5FRMA 3P8YA 3PMTA 4P73C 4OB1B 1W4SA 1PYSA 3QSUA 4EDUA 2IG0A 1NJ8A 2JUFA 3AHUA 11ASA 3GIBA 4LVLA 3E19A 5CKEA 3NTIA 3V7CA 3MP8A 3P8HA 3ASKA 5CKFA 4WI1A 4AH6A 2O4XB 2RK2A 4TVRA 1R8OB 1VIFA 1VQ8A 2ZT5A 2CGHA 4NS5A 3CCVA 3JRZA 2RM4A 3CC2A 2P0PA 2KMTA 3P8BB 1S72T 3QIIA 3OYGA 3CD6T 4HVCA 4YDQA 5CIUA 4M7AB 3A8HB 3BDLA 2BUDA 2LCCA 4P75C 3A7UA 3GP8A 5GMKh 4H2YA 3LSQA 3R6OA 5DLQE 4PG3A 1QW1A 5C51B 4II1A 1ZBXA 2DDZA 3O8VA 2RI2A 3L42A 2XICA 3NETA 3MHXA 4BDZA 2WACA 5GANf 4FT4A 2P0QA 3GOXA 1KC8C 4JDSA 4E51A 5CKBA 4RCBA 1HC7A 1I8FA 4X5OA 4F7UG 2ZT7A 1NJIC 5E3IA 4M78G 4G85A 3FIFA 1BI3A 1G5VA 4CH4A 2FB7A 3BDUA 3VUBA 1LNXA 2EJFA 1PSFA 3TU4K 4YCUA 3QYHB 4C92A 1K8AU 2FHDA 3I7FA 5K1PA 2DZ9A 3JAME 4BY6C 2PVGB 1U8RA 3X24B 2BKDN 4OB2B 1E22A 5LJ5f 1YJWA 2DTHA 3A5ZB 2CJAA 3TUPA 2D6FA 4ZGEB 2RJFA 5GAMg 1Q81U 2ZINA 5KCOA 4KUDK 3WVDB 3CCUA 1JJCB 2QXFA 1FXXA 3NTHA 4EMKA 1Q82C 2MWOA 2JOYA 4P72C 4RMFA 1X75C 3FLGA 4DOWA 2AMCB 2EWNA 1ZHIA 3BW1A 4N0AC 4KUIA 1J5WA 2ZNJA 5HKCA 2PQWA 3ZEHA 2CZ0B 2MAMA 3REXA 3M5AA 3CCVT 2DK3A 3QZ9B 3OMCA 4ELZC 2RB6A 3QTCA 3X20B 3A74A 1M5Q1 4P3NA 4X9DA 3X25B 3HXZA 4M7DE 3M4PA 2PMFA 3L2RA 3WVEB 1WLEA 2EAYA 2CZ7B 1K73C 3BJUA 3TEHB 1RIQA 3M4YA 1XOVA 2K4YA 2H3JA 5CKDA 2O01E 4HWPA 4P73A 4KR2A 2RHQA 1VQ9T 2Y90A 2R57A 1QVGA 1OZ3A 1B7YB 1NPRA 4G84A 2QI2A 1BI1A 1YIJT 2DIGA 3UT1A 4YRSA 4XEMA 2MWPA 2QA4A 2ZT8A 4QVDA 2LRQA 2ZPEB 3X28B 4K87A 2K2VA 4C5HA 2Q5IA 5J39A 1KMMA 1BIBA 3OS1A 3FB9A 3L2QA 1SETA 3A31A 3QKJA 3PMIA 1H4TA 3PT9A 3RKWA 5KH6A 2IY5A 2R5MA 3A8OB 4PHCA 1Y96B 2HNIA 3DLLA 1WJSA 3HP9A 4PJOG 3QXEB 4PJOB 2VYTA 2DXUA 4M7DF 1YJWT 2GQVA 3QO8A 1YJNA 4BI4A 3C12A 2M0OA 4KBMB 2YHTA 4WF2A 1VQOT 3OQ5A 4QQ6A 5GAN2 1ASZA 5M9OA 1M90U 3QUIA 2DTOA 3L4GA 3L2UA 1X6OA 5ELNA 4C0DC 2XIDA 2E5QA 4CH6A 4H2WA 3CCUT 4DOVA 1B34A 5LJ3g 1IZ6A 1OZ2A 2LDMA 3JB9G 3E9IA 1G5IA 4FL6A 5I21A 1M1KU 5FU6B 3X26B 3CMEA 3M4QA 3BY7A 4LDUA 4PLIA 2I2LA 2O4XA 4Q6GA 2I4MA 3V7RA 1KQ2A 4M7DC 3G6EA 4OF1A 4X34A 1I81A 4OP0A 3JB9H 1QF6A 2NLUA 5HGQA 4KQEA 2RJCA 1X56A 2LX9A 1EIYB 5D6XA 4JS5A 1M8VA 4YCWA 4LVKA 4CS3A 4M7AA 3QJ6A 3UDCA 2DU7A 4C8QB 1H4SA 4BD3A 3DKMA 2XGTA 4YRMA 4C5IA 3QYGB 3S3OA 3RACA 3M57A 3MEWA 5IN1A 1D3BB 4C92F 4P72A 1O75A 3J7AF 5CO7A 3PZCA 3CCJA 4M77G 2GCXA 4M77B 4ZIBA 3UWNA 1Q7YU 5C53B 2LTOA 2JZ2A 3OYJA 3RUXA 4M75G 3HHTB 4XTYA 1QVFA 1G3SA 2QA4T 1RL2A 4TTVA 5D6YA 3W3SA 3P8TA 4PJOD 3SWNC 1H3ZA 2CKKA 3E1SA 3I55A 1N8RU 2ZPIB 1WGSA 3CBPA 2QEXA 1QE0A 3LWIA 4EPCA 5CQYA 1AHJB 4XEOA 4XTZA 1OI1A 4QVZA 2D9TA 1UGPB 1JJ2A 4C92C 2JNGA 4E7LA 3OSVA 3A5ZA 4JRQA 1YJNT 4V2SA 3M9QA 1WJRA 5A0LA 2LT1A 4L59A 5GAOq 4HWSA 1JJCA 5GAOm 2JTFA 1VQZA 5GAN7 3OYFA 4H2TA 3HFNA 5GAOn 2RJDA 3OW2S 4UPAA 3QDRB 4BE2A 5C6SA 2E65A 1BIAA 4E7KA 2AMCA 2E64A 4EMKC 4H2XB 3I56A 5ELOA 3IKLA 1G3TA 1UB4A 3MCAB 3JCMJ 5GAMe 1YFTA 3S6WA 2ZXFA 1NJ5A 4C8QD 1E24A 4UC4A 4H2UA 3G6ET 3PIPA 3RIRA 3CCRT 4BW9A 3QO3A 5FU7C 3HRUA 5FROA 3HXYA 4O2DA 2ZNIA 4TQDA 3HXVA 1G3YA 4M77D 3DB4A 1FWZA 2Q7GA 4P3PA 3P8DA 2E41A 4M75D 3QO5A 3VV0A 2X4XA 3EFRA 4IUVA 4XU1A 5HK3A 3HFZB 1B8AA 2DVEA 2MF2A 4RQEA 1NYQA 1I5LA 3IALA 1VIEA 3CCJT 1USYA 1Z7NA 3TCJA 3HSBA 1XNIA 1VQPT 12ASA 3C95A 3QHSA 4H2SA 3WXMB 3V8KA 5LJ5g 1XTDA 3TEEA 1VQNA 2HQEA 3A8LB 4RMOA 3I55T 4M7DA 2P5IA 1B70B 3JCMe 2RHUA 4TVAB 5LL6S 2AKWB 1NPPA 2XD0A 5I2SA 4HKEA 1PSEA 5GAN3 4F7UE 4UP9A 1Y96A 2ALYA 2EQJA 4C0ZA 4ELYC 2CZ6B 4KT0E 4J83A 4CRIA 1KD1U 2QHTA 4BB7A 2A8EA 1XQHA 4YRFA 4J8OA 3HPWA 3OBWA 4XU2A 4QW2A 3M53A 4H2VA 3CCEA 5GMKl 3V8JA 3ERRA 1B76A 3C4SA 1Q86C 4BI8B 1K9MC 4A4KA 2XHCA 3PGGA 4M7AF 2M16A 2PUKB 2E3CA 4A53A 1YCYA 1VQLT 4ATOA 3GNGA 1SSFA 3S3MA 2MMPA 3LWHA 4K86A 4F7UB 3CCSA 3Q1JA 4MZMA 2X4YA 3SWNA 3VJPA 4LVJA 2LT4A 3VQYA 3M54A 4M78B 1EOVA 4XQ3A 4QQDA 3G1ZA 4YCVA 5LJ3e 1NNHA 3IG2A 4Q15A 1H641 3E9HA 1N27A 1YITA 1N9RA 1SESA 4QVCA 3JCMb 1EIYA 4P71A 4JUVA 2XDDA 4NL3A 2DAQA 3HXWA 3PCOB 2XK0A 2PVDB 4M7AC 3JCMX 3SFMA 4IKFA 1N6AA 4MZTA 3UPUA 2RHSB 1YFRA 4XTVA 3ICAA 2M9UA 1YHQA 1Y07A 2YLBA 3VBBA 3HFOA 4E47A 2QDYB 4RG8A 4IURA 3NENA 4EMGA 2CYZB 1BBUA 4RKUE 2HD0A 3CCLA 1KQSA 1ADJA 3A7RA 3CMAA 3PFSA 4XU3A 1VQNT 3MEYA 2DD5A 2E6NA 2E70A 4BI3A 5C52B 5IT9E 1HK9A 4JJNK 4ZTUB 3GNFB 1VQ8T 2XDBA 3CC2T 1VQKA 1WQWA 1WYDA 1IL2A 2C7IA 1GXIE 2B8AA 4BE1A 4CH3A 3CC4A 3OYEA 1WJQA 3JSCA 2ZIOA 1M9SA 2KAFA 2X4JA 3CXCA 2KK4A 1X2HA 2RHIA 3QPHA 3EFSA 3ZBDA 4YRCA 1LYLA 2DU5A 1VQMA 3RF1A 3CMQA 3OS2A 4M78D 4WJ4A 5DM7R 1NZ9A 3CC7A 5L8RE 2EFIA 3A5YA 2ARTA 4YROA 1ADYA 3JCMg 4PJOE 4BWAA 4BDYA 4R55A 1KHIA 3RKXA 3OYCA 3CEYA 4N4IA 2F5TX 2BIVA 1G3WA 4LD9K 4C0GA 2E5AA 1WNLA 3MEVA 2RD1A 1UGSB 2EJ9A 5HK0A 1QVGS 4HWOA 2PVOB 2AHJB 4FU6A 2FL7A 5C0MA 4HCZA 1PYSB 5CR2A 3UH0A 4TQFA 4J6YA 5GMKi 3M4GA 1TH7A 4J7IA 4M7DG 2OTJA 2ODRC 2G3RA 5GANe 3CBOA 3S3NA 2A3LA 2KDSA 1VUBA 1YHQT 2DQ0A 1UGQB 2YRVA 3CPFA 2P4TA 1YFSA 2RI5A 2P0KA 3KFUA 1KHCA 4JLGA 2FYKA 3CCLT 2I4LA 3A8MB 3R07A 2V8KA 4C8QE 1USYC 3CMAT 4B9WA 4PKCC 4D6WA 4MDWA 3J81E 1L0WA 1VQ7A 4J5YA 2RHZA 4E7JA 5KNNA 1K8AC 4C5GA 4TVAA 2Q5HA 3FRNA 1X55A 1EVLA 2L89A 2AKWA 3QO7A 3CPWA 2LC4A 3DSQA 4M77E 1VQKT 3KXTA 3RMQA 3TREA 3LYIA 5LJ5e 2E12A 2HAXA 4M75E 1MHNA 1YBYA 3CC4T 1HXDA 5F5WA 3OB9A 4J15A 1Q81C 4PJOC 3NELA 1NJ6A 3OSSC 2LQ8A 1NYRA 4YPFA 4O6JA 1KQ1A 5CQXA 3META 4NCXA 3GPLA 1E1TA 5KCHA 2EJGA 3UGTA 3CC7T 3CCMA 4C92G 3JCMV 3FC3A 3VYHB 4R56A 2X4WA 1Z7MA 4EMHA 2RH2A 4TVYA 2PUOB 4C8QF 5EG2A 3J80E 4OB3B 3LW5E 3CBMA 5FU6C 3UGQA 4YP0A 5GAMd 2CIMA 3OY9A 2KSSA 4M75B 5CCAA 3NTKA 2J3LA 3IKMB 4MZPA 1P92A 3L1AA 2WSCE 3LH0A 5GMKe 2ZPGB 4GY5A 1X54A 4FSXA 2LQKA 2KVQG 1QVFS 5J26A 3RMSA 3FDRA 5CKHA 4HT4A 4KR3A 4JRPA 4E7HA 4P71C 1KC8U 2OTJT 4FM4B 3HKSA 3HXUA 2MI6A 3JB9D 2RHSA 2X35A 4QQGA 3A32A 4C8QC 3OYHA 1N9WA 2C8MA 1NJIU 1O9SA 5IAYA 1X01A 2ZZDA 1KMNA 3EAEA 1VQ6A 1JJ2S 3JCMW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 3;  4F7U E;  2EWN A;  4UP9 A;  3BW1 A;  1Y96 A;  4XTW A;  2ZTG A;  4N0A C;  4C92 E;  1J5W A;  2ALY A;  2ZNJ A;  4LNS A;  1B70 A;  2QHT A;  4EX5 A;  3REX A;  4CS4 A;  4M77 C;  3JB9 F;  1C0A A;  1G51 A;  4YRF A;  2ZGW A;  4JLI A;  4YRT A;  2RB6 A;  4XU2 A;  3QTC A;  3A74 A;  1ATI A;  3RGL A;  5K1X A;  1M5Q 1;  4P3N A;  2ODR D;  4UP7 A;  4X9D A;  4H2V A;  3SWN B;  5GMK l;  3JCM d;  3V8J A;  5GAN 5;  2G4C A;  3ERR A;  4YRK A;  1B76 A;  4ZTZ B;  2ARS A;  3HXZ A;  4M7D E;  3PGG A;  4M7A F;  5GAN g;  2RHQ B;  1H4Q A;  3M4P A;  2PMF A;  1W66 A;  2E3C A;  4A53 A;  1WLE A;  2EAY A;  1YCY A;  2DTI A;  1SRY A;  3BJU A;  3TEH B;  1RIQ A;  4C92 D;  4YRI A;  4K86 A;  4F7U B;  4YRP A;  3SWN A;  2ZZE A;  5GAN 6;  3VQY A;  4C92 B;  3WQZ A;  4YRG A;  3NEM A;  4P3O A;  4M78 B;  4NOY A;  1WPY A;  3JCM f;  1EOV A;  4WJ3 M;  4XQ3 A;  3G1Z A;  4HWP A;  4P73 A;  4YCV A;  4KR2 A;  2RHQ A;  5LJ3 e;  1NNH A;  4C8Q G;  2Y90 A;  3IG2 A;  4Q15 A;  1H64 1;  4HT8 A;  2XTI A;  2ZR3 A;  2Q7E A;  3E9H A;  1YGB A;  1B7Y B;  3TEH A;  4CS2 A;  5GAN j;  4MMK A;  2ZT6 A;  4G84 A;  1N9R A;  1SES A;  4QVC A;  2ZZF A;  4F7U A;  3JCM b;  1EIY A;  4P71 A;  2P0L A;  4JUV A;  1LJO A;  4YRS A;  4TVW A;  4XEM A;  4P74 C;  3VQV A;  4M78 A;  2ZT8 A;  4QVD A;  4NL3 A;  3LSS A;  3JCM Q;  4M7D D;  3HXW A;  2IY5 B;  4K87 A;  3PCO B;  3VU3 C;  5GAO r;  2Q5I A;  5GAO l;  4M7A C;  1KMM A;  3JCM X;  1BIB A;  1B7Y A;  2J3M A;  3FB9 A;  1SET A;  2ZR2 A;  1BBW A;  3A31 A;  2K57 A;  2RHS B;  4EO4 A;  1YFR A;  3REU A;  4EMK B;  4M77 F;  4N0A A;  1H4T A;  4XTV A;  3HTZ A;  3RKW A;  3ICA A;  2DJZ A;  5GMK m;  2YLB A;  3VBB A;  3HFO A;  2IY5 A;  4M75 F;  4XTU A;  3PCO A;  5LJ3 d;  3L4G B;  4PHC A;  2RA2 A;  3TEG A;  3NEN A;  4YRJ A;  1Y96 B;  2HNI A;  4EMG A;  4PJO G;  1WU7 A;  3HXX A;  4PJO B;  2DEQ A;  1BBU A;  4L87 A;  4H02 A;  1B34 B;  2DXU A;  1U1S A;  4M7D F;  4YRL A;  4X9C A;  1ADJ A;  3QO8 A;  3A7R A;  3VQX A;  4YRQ A;  4XU3 A;  2YHT A;  4WF2 A;  1U1T A;  5GAN 2;  3JCM P;  1ASZ A;  3MEY A;  3QUI A;  2DTO A;  4YYE A;  3L4G A;  5LJ5 j;  5ELN A;  1EFW A;  5LJ3 f;  5C52 B;  4CH6 A;  4H2W A;  4PJO A;  5GAM j;  1NJ2 A;  4M78 E;  1B34 A;  5LJ3 g;  1HK9 A;  1EQR A;  1ASY A;  3JB9 G;  4ZTU B;  3QNE A;  3INZ A;  3E9I A;  1G5I A;  5I21 A;  1HTT A;  3L2Z A;  1WQW A;  1WYD A;  1IL2 A;  2C7I A;  4HT9 A;  4HWT A;  4M75 C;  2QHV A;  1YB3 A;  2ZZG A;  4CH3 A;  3JCM c;  1JRI A;  2I4N A;  3BY7 A;  3M4Q A;  4J6W A;  2ARU A;  3HRI A;  2I2L A;  2VXF A;  4Q6G A;  4DQ2 A;  4M7A G;  2I4M A;  3V7R A;  1KQ2 A;  2ZIO A;  5GAN 4;  4CH5 A;  5CAI A;  4UP8 A;  1X2G A;  4M7D C;  2CJ9 A;  3SB2 A;  1X2H A;  3HRK A;  1I81 A;  3EFS A;  5GAN h;  1G5H A;  4OP0 A;  3JB9 H;  1QF6 A;  5HGQ A;  4KQE A;  1LYL A;  4YRC A;  1X56 A;  2DU5 A;  2VXE A;  3RF1 A;  3CMQ A;  4M78 D;  1EIY B;  4WJ4 A;  1JBM A;  4A54 A;  1M8V A;  4YCW A;  4M7A A;  4YRR A;  4CS3 A;  3MF2 A;  3A5Y A;  2ART A;  2Q7H A;  2DU7 A;  4YRO A;  4RCC A;  1ADY A;  3JCM g;  4PJO E;  1NJ1 A;  4BWA A;  4C8Q B;  2QHU A;  1LOJ A;  1H4S A;  4JRK A;  5GMK j;  3RKX A;  2XGT A;  2QTX A;  2E10 A;  4YRM A;  3V8L A;  4PNO A;  4K88 A;  3HFV A;  3RAC A;  2E5A A;  4RDX A;  1WNL A;  2RD1 A;  2ZIM A;  4F7U F;  1D3B B;  3LC0 A;  3VQW A;  2EJ9 A;  2ZCE A;  4C92 F;  1I4K 1;  4C8Q A;  4P72 A;  3OD1 A;  4M78 F;  3UFG A;  4XU0 A;  4HWO A;  3PZC A;  2EL9 A;  4M77 G;  4DPG A;  4M77 B;  1MGQ A;  4ZIB A;  2I4O A;  4TWA A;  5C53 B;  3RUX A;  1PYS B;  4M75 G;  2YLC A;  4XTY A;  3UH0 A;  4J6X A;  1D3B A;  5DY9 A;  4TTV A;  3W3S A;  1EVK A;  4TQF A;  5LJ5 h;  3P8T A;  4J6Y A;  4PJO D;  3SWN C;  5GMK i;  3M4G A;  1H4V B;  1TH7 A;  4M7D G;  5GAM h;  2ODR C;  4M77 A;  4M7A E;  3P8Y A;  1QE0 A;  4P73 C;  2DKG A;  5GAN e;  4XEO A;  1PYS A;  3QSU A;  4XTZ A;  4M75 A;  1NJ8 A;  2CJB A;  3RES A;  2DQ0 A;  3AHU A;  3BFM A;  11AS A;  3GIB A;  3V7C A;  4C92 C;  1YFS A;  4M78 C;  4WI1 A;  4AH6 A;  1WQ7 A;  3KFU A;  4YRN A;  2FYK A;  2DZC A;  2I4L A;  3R07 A;  3A5Z A;  4C8Q E;  4V2S A;  4HA8 A;  2ZT5 A;  2CGH A;  1USY C;  3FJP A;  2RM4 A;  1L0W A;  4J5Y A;  5GAO q;  4JRI A;  4HWS A;  2QHS A;  4HVC A;  1JJC A;  4M7A D;  5KNN A;  5GAO m;  4YDQ A;  1VQZ A;  5GAN d;  4TVA A;  5GAN 7;  2Q5H A;  4H2T A;  4M7A B;  1X55 A;  1EVL A;  3HFN A;  5GAO n;  2AKW A;  3QO7 A;  3DSQ A;  4UPA A;  4P75 C;  5LJ3 j;  1FYF A;  3A7U A;  2E65 A;  4M77 E;  3HY0 A;  1BIA A;  5GMK h;  4H2Y A;  2AMC A;  2E64 A;  3LSQ A;  4XTX A;  4EMK C;  4P74 A;  4H2X B;  4PG3 A;  5ELO A;  3IKL A;  5LJ5 e;  2DXT A;  5C51 B;  4M75 E;  3RER A;  2DDZ A;  1HXD A;  3JCM J;  5F5W A;  5GAM e;  3NET A;  4MML A;  3RKY A;  1YFT A;  1KOG A;  2ZXF A;  4J15 A;  1NJ5 A;  5GAN f;  4C8Q D;  1E24 A;  2DQ3 A;  4H2U A;  4PJO C;  3NEL A;  1NJ6 A;  3RIR A;  1NYR A;  4H2X A;  4YPF A;  3QO3 A;  1KQ1 A;  4BW9 A;  3JCM h;  4E51 A;  4RCB A;  1HC7 A;  4NCX A;  1E1T A;  1I8F A;  3HXY A;  4X5O A;  4F7U G;  2ZT7 A;  2EJG A;  4O2D A;  2ZNI A;  3UGT A;  5E3I A;  4C92 G;  4TQD A;  3JCM V;  4M78 G;  4G85 A;  3HXV A;  2JN0 A;  3FIF A;  1Z7M A;  4EMH A;  4M77 D;  4TVY A;  4NL2 A;  2Q7G A;  4CH4 A;  2FB7 A;  4P3P A;  4C8Q F;  3BDU A;  1LNX A;  2E41 A;  5LJ5 d;  2VC8 A;  4M75 D;  3QO5 A;  4Y91 A;  2EJF A;  1GGM A;  3V7S A;  4YCU A;  4YP0 A;  3UGQ A;  1N9S A;  5GAM d;  2CIM A;  4C92 A;  3EFR A;  4M75 B;  4XU1 A;  4RQF A;  3HFZ B;  2E1H A;  3I7F A;  5GAN 8;  1B8A A;  2DVE A;  5K1P A;  2DZ9 A;  2J3L A;  3IKM B;  4YRE A;  4RQE A;  3RL6 A;  1E1O A;  1NYQ A;  1I5L A;  3IAL A;  3L1A A;  1USY A;  4M7D B;  1Z7N A;  5GMK e;  3HSB A;  12AS A;  1X54 A;  1E22 A;  3QHS A;  5LJ5 f;  2DTH A;  4H2S A;  3HY1 A;  3V8K A;  2CJA A;  3TUP A;  3HFZ A;  5LJ5 g;  5GAM f;  3JB9 I;  4KR3 A;  1SER A;  5GAM g;  2ZIN A;  4P71 C;  4M7D A;  3A7A A;  4P75 A;  2PME A;  3MF1 A;  3HXU A;  3JB9 D;  2ALY B;  1JJC B;  2P5I A;  2RHS A;  1B70 B;  3JCM e;  3A32 A;  4EMK A;  4HWR A;  4OLF A;  4C8Q C;  4P72 C;  4TVA B;  4PJO F;  3JB9 J;  1N9W A;  3P8V A;  5LJ3 h;  2C8M A;  2AKW B;  4RMF A;  1X01 A;  1KMN A;  5GAO p;  3JCM W;  2AMC B; 
#chains in the Genus database with same CATH topology
 3SHW A;  3KBG A;  3CD6 A;  4XTW A;  2ZTG A;  1SSH A;  1W2B A;  4LDX A;  1EZZ B;  2H3E B;  4LNS A;  1D1B A;  2EQK A;  1QKW A;  3M0U A;  4CS4 A;  4M77 C;  1DJ7 B;  4CC3 A;  1C0A A;  3NMZ C;  2ZGW A;  4YRT A;  1I5O B;  3U23 A;  1M8M A;  1UGR B;  3CME T;  2EQM A;  3RGL A;  5K1X A;  4IUQ A;  3LGF A;  1BI0 A;  3JCM d;  2RO0 A;  4YRK A;  3CME Q;  2ARS A;  2DE0 X;  2JS2 A;  5GAN g;  2RHQ B;  5J3B A;  3SD4 A;  2V8I A;  1W66 A;  1D0Z A;  1PD0 A;  2DTI A;  1SRY A;  3VYG A;  4QKU A;  2KRS A;  4C92 D;  4YRI A;  3G71 A;  3H0F A;  1W70 A;  4ZN3 A;  1Y0M A;  2X3W D;  5GAN 6;  2DXB A;  1Q82 U;  3WQZ A;  4YRG A;  2EKO A;  4WJ3 M;  4NOY A;  3MJX A;  3URG A;  2OAW A;  1M90 C;  2GBQ A;  4RTY A;  1BB9 A;  2CS7 A;  2QGG A;  1NE8 A;  2RHX A;  4HT8 A;  2XTI A;  2ZR3 A;  2CP6 A;  2Q7E A;  2JJ9 A;  2RJE A;  3TEH A;  4CS2 A;  2JTM A;  4MMK A;  2ZT6 A;  1TS9 A;  1OEB A;  5IXF A;  2ZZF A;  2VUB A;  2Y4X A;  1GBR A;  4LDW A;  3CCM T;  1B3Q A;  1M1K C;  4TVW A;  4P74 C;  2KI7 A;  4LVM A;  2V8J A;  3LSS A;  1BCO A;  2IY5 B;  4FYV B;  4L6V 5;  2QQR A;  3VU3 C;  2XU8 A;  5GAO r;  1YFN A;  2HBW A;  2DRK A;  5GAO l;  2LCS A;  1B7Y A;  2J3M A;  1ZSZ C;  2LNV A;  4Z02 A;  4RTX A;  1T0H A;  2ZR2 A;  1BBW A;  2K57 A;  1E7O A;  2IPO B;  3CCJ Q;  4C5E A;  2V1R A;  4JS4 A;  3HTZ A;  2DJZ A;  5GMK m;  4FSS A;  1WZO A;  1ZUU A;  2K3B A;  2R5A A;  4J9F A;  1M4Z A;  4XTU A;  5LJ3 d;  3L4G B;  1YNZ A;  4YRJ A;  3HXX A;  2HCK A;  1V29 B;  5KE3 A;  3UAT A;  3OBY A;  2DEQ A;  2QEX T;  1K73 U;  1KG1 A;  4H02 A;  1B34 B;  1MMN A;  1YWP A;  1U1S A;  4YRL A;  1G8X A;  1H92 A;  4X9C A;  3M58 A;  3VQX A;  1JU5 C;  4YRQ A;  2QEX Q;  2NS6 A;  1GBQ A;  3VKI A;  1U1T A;  4J9E A;  3EFO B;  1PHT A;  1KSW A;  5D7U A;  2P84 A;  3OA6 A;  2OTL A;  3MEA A;  4PJO A;  4P5N A;  5GAM j;  2HL5 C;  4M78 E;  3L2W A;  3OYN A;  3QNE A;  2KY9 A;  2HMA A;  3IQL A;  1Y57 A;  4O5V A;  3OYM A;  3L2Z A;  3PNW C;  1IRE B;  1VQ6 T;  4B9X A;  1AWO A;  2FPD A;  3L2V A;  2K79 A;  1Q7Y C;  4HWT A;  1YB3 A;  1GFC A;  1AEY A;  3JCM c;  3QG1 A;  3CCQ A;  2ARU A;  4OGE A;  3HRI A;  2E4H A;  1VQ6 Q;  2VGM A;  4BY6 B;  4DQ2 A;  4M7A G;  2QQA A;  4LN2 A;  2VV5 A;  5GAN 4;  5CAI A;  1YI2 A;  1AZE A;  1N8R C;  3VUZ A;  2OAU A;  3F70 A;  2DEU A;  3I56 T;  1OPL A;  3C94 A;  3OS0 A;  2ZPF B;  3GF5 A;  1QLY A;  2VXE A;  8ATC B;  5IXB A;  1JBM A;  3OYD A;  3MF2 A;  2CH4 W;  1JJ2 P;  2RN8 A;  3I56 Q;  2Q7H A;  3LX7 A;  4AG2 C;  4IUU A;  4RCC A;  1NJ1 A;  1VQ9 A;  2ECZ A;  4IUT A;  1GCQ A;  1LOJ A;  4JRK A;  8AT1 B;  2QTX A;  1YWO A;  4ZN1 A;  3G71 T;  2M02 A;  1YIJ A;  3OYL A;  4K88 A;  4OB0 B;  2DPP B;  5IH2 A;  4RDX A;  2GTO A;  1M3A A;  2ZIM A;  4F7U F;  2R58 A;  3LGL A;  3PTA A;  2EGA A;  2ZCE A;  4C8Q A;  4M78 F;  2FRY A;  4FT2 A;  1BYM A;  2RQW A;  1UJY A;  1JB0 E;  3QBY A;  4DPG A;  1ZUY A;  1R0B G;  2I4O A;  4TWA A;  4Z8A A;  1D0X A;  2YT6 A;  2QG9 B;  1GRI A;  1K9M R;  2HKN A;  2C06 A;  5FWC A;  1D3B A;  2DA9 A;  5DY9 A;  1KC8 R;  4C0F A;  3HRS A;  3M0R A;  2F69 A;  4ZTJ A;  1FMV A;  2Y4Y A;  1H4V B;  2MPX C;  5GAM h;  2EYQ A;  2KQW A;  4M77 A;  2L3P A;  1ABQ A;  2QAZ A;  2DKG A;  2F1L A;  4F16 A;  2KT1 A;  1X69 A;  3OYB A;  4M75 A;  1PCX A;  3EHR A;  2CJB A;  2M0Y A;  3RES A;  1NLP C;  2VWF A;  1VQO A;  3A8G B;  1PD1 A;  4HCB A;  2DL8 A;  1U5S A;  3BFM A;  4A4H A;  2KGT A;  1EX4 A;  4M78 C;  1KQS S;  1WQ7 A;  3HTR A;  4E7S A;  1VQN Q;  4YRN A;  4BUG A;  2L5Q A;  2DZC A;  2NWM A;  1MMG A;  4HA8 A;  4L5G A;  1QP3 A;  3DLM A;  3FJP A;  2GNC A;  1QCF A;  4RG2 A;  2FZG B;  2GF7 A;  4JRI A;  2OTL T;  4RTW A;  1T3L A;  2QHS A;  3UA7 A;  4M7A D;  2D0Q B;  5FLX E;  1M3B A;  4OVA A;  4BE0 A;  5GAN d;  4XAX B;  2EW3 A;  1BU1 A;  2OTL Q;  1AOJ A;  1WI7 A;  4AFZ C;  5LJ3 j;  2DBK A;  1FYF A;  4N4H A;  3HY0 A;  2DYI A;  1EFN A;  1AZG B;  4XTX A;  4P74 A;  2RK1 A;  2DXT A;  5DLO A;  3RER A;  2CZ1 B;  1SPK A;  3CCQ T;  3T9N A;  2EIF A;  3CCE T;  2ENM A;  2FEI A;  3OYY A;  4MML A;  3RKY A;  1KOG A;  3CXC S;  2CT4 A;  1ZSZ A;  2RI3 A;  4J9G A;  1NG2 A;  1RAI B;  1D09 B;  2DQ3 A;  3CCQ Q;  1YI2 T;  3O5Z A;  2GFA A;  3CCE Q;  3MQZ A;  4ESR A;  1Y7X A;  2M1H A;  3VS7 A;  1YP5 A;  3REB B;  4H2X A;  2WSF E;  3JCM h;  1AT1 B;  1ZX6 A;  1K0S A;  4OMN A;  2XDP A;  2H8H A;  4KRT A;  2RHY A;  3CCS T;  5A0D A;  4C0D B;  2NUZ A;  3DB3 A;  4LVI A;  2JN0 A;  2ZCF B;  4A4E A;  2KRO A;  4Y28 E;  3AT1 B;  3CCS Q;  4E7I A;  4ZTF A;  2C0I A;  5KE2 A;  4NL2 A;  3G4S A;  1WDX A;  2DIQ A;  2VC8 A;  2K5F A;  5LJ5 d;  1YIT T;  1ZBJ A;  4Y91 A;  3TQ7 P;  1GGM A;  3V7S A;  1TUG B;  3ME9 A;  1KD1 C;  1N9S A;  4KH0 B;  4RQF A;  5IHK A;  2LJ3 A;  2E1H A;  4J7F A;  5GAN 8;  3NPF A;  1YIT Q;  1K73 R;  4YRE A;  2LCL A;  2LVM A;  3OS5 A;  2HZY A;  3RL6 A;  2E6Z A;  3SDZ A;  1IRX A;  1E1O A;  1M3C A;  4M7D B;  2VGN A;  3N5B B;  1IGU A;  1RAE B;  3OYA A;  3MP6 A;  1OQK A;  4PLL A;  1VQ5 A;  2RF0 A;  2AT1 B;  2F5K A;  4CI0 C;  3HY1 A;  2BE9 B;  3HFZ A;  4Q5W A;  3MP1 A;  5GAM f;  2MOX A;  3JB9 I;  5D6W A;  1SER A;  1SRM A;  2DLP A;  2E5K A;  3G7Z A;  3UF4 A;  2LQN A;  1UDL A;  4YTL A;  5IHI A;  3FEO A;  3A7A A;  2KNB B;  4P75 A;  4FYW B;  3MF1 A;  2PME A;  5I2M A;  2ALY B;  3QZ5 B;  1YHQ Q;  2KBT A;  4AMC A;  3H6Z A;  2ZPB B;  4A4F A;  4HWR A;  4OLF A;  2L3R A;  1ZQ1 A;  3PIO A;  4PJO F;  1X2Q A;  3JB9 J;  3P8V A;  5LJ3 h;  5CK9 A;  2QQS A;  3M56 A;  2DXC A;  5GAO p;  2YUO A;  4GLM A;  3HRT A;  5HY6 A;  2K5I A;  4FIB A;  2FVU A;  1VQ4 A;  3CMA Q;  5FRN A;  4C92 E;  2QQB A;  1B70 A;  3NFC A;  3I9Q A;  4EX5 A;  2IVW A;  2K3X A;  2P4R A;  3JB9 F;  1G51 A;  2LMJ A;  4JLI A;  1M2V B;  4IUP A;  2KE9 A;  1X6G A;  3MEU A;  1ATI A;  1TXQ A;  2ODR D;  2EVR A;  4UP7 A;  1SKU B;  1VQK Q;  4OMF B;  3SWN B;  4GLK A;  3CPW S;  2D8H A;  4OMO A;  5GAN 5;  2G4C A;  4ZTZ B;  2FO0 A;  1M1G A;  2VVK A;  3ER0 A;  1C1A A;  1H4Q A;  3CCR A;  5AYF A;  2AKL A;  4OML A;  4CC4 B;  2QYZ A;  1JQQ A;  2HQX A;  4DA4 A;  1VQM T;  3EGX B;  4ZGJ B;  4YRP A;  2PNI A;  4HCC A;  2ZZE A;  1C6V X;  4C92 B;  2QDL A;  2LZ6 B;  3NEM A;  4P3O A;  3JCM f;  1WPY A;  1UEB A;  1VQM Q;  2DIL A;  3GLX A;  1YJ9 A;  1IGQ A;  4C8Q G;  3OYI A;  3CC7 Q;  2J05 A;  4J9B A;  1YGB A;  2A7Y A;  1K8A R;  1KJW A;  5GAN j;  2RNA A;  2A0F B;  4F7U A;  1WHG A;  2P0L A;  4MDX A;  1LJO A;  5KYX A;  4M78 A;  3VQV A;  3E9G A;  4BAC A;  3JCM Q;  4M7D D;  1MMD A;  4N4G A;  3C0C A;  1UHF A;  3G4S T;  4ORZ A;  1SEM A;  2QAS A;  3OMG A;  3CXC P;  1RI0 A;  1VQP A;  3LLR A;  1UEC A;  1X2K A;  4EO4 A;  2EYZ A;  3M0P A;  3REU A;  2JM9 A;  4LUD A;  4KGX B;  4EMK B;  4M77 F;  2FRW A;  4LDY A;  1WXB A;  4N0A A;  2X9H A;  4A4G A;  4ME7 A;  3ZFJ A;  2ZPH B;  2AZV A;  1Q86 U;  2EQU A;  2HBP A;  2JMA A;  1K9M U;  4M75 F;  3NHN A;  3PCO A;  5A2Q E;  1QP2 A;  3EGD B;  2LQW A;  2RA2 A;  3TEG A;  2W0Z A;  1MUZ A;  1WU7 A;  3EG9 A;  3M55 A;  3R6N A;  4L87 A;  1NYG A;  1D1A A;  2NUT B;  1VQ5 T;  2SEM A;  1Z9Q A;  5FU7 B;  1QVP A;  4Y92 A;  2GFU A;  1VYV A;  3JCM P;  3KUF A;  4YYE A;  1RAC B;  1AWJ A;  5LJ5 j;  1S72 A;  1EFW A;  2WSE E;  5LJ3 f;  2KXC A;  1UE9 A;  1NJ2 A;  1EQR A;  1ASY A;  2MYS A;  2K5L A;  2DER A;  3INZ A;  1BI2 A;  7AT1 B;  4LDV A;  1PNJ A;  4J9D A;  1HTT A;  2X51 A;  2K7A A;  3OW2 A;  3TVT A;  3VS5 A;  1VQ7 T;  3D7S B;  4PL6 A;  4GBQ A;  3MO8 A;  4HT9 A;  1M2O A;  4ZGD B;  3QJY A;  1W2B S;  4M75 C;  1VQ4 T;  2QHV A;  2XI9 A;  2ZZG A;  1JRI A;  2I4N A;  4J6W A;  5KYU B;  1VQ7 Q;  2VXF A;  3OYK A;  3PE0 A;  2E3I A;  4CH5 A;  4UP8 A;  1VQ4 Q;  1X2G A;  1M1F A;  1M30 A;  2CJ9 A;  1BKB A;  3SB2 A;  5HCK A;  2C0O A;  3HRK A;  1Y71 A;  4XK8 E;  4KUL A;  2YUN A;  5GAN h;  1G5H A;  1R77 A;  1VQL A;  3EH2 A;  4Z88 A;  1CKA A;  2MIO A;  1IXD A;  4A54 A;  4YRR A;  1WLP B;  1UJ0 A;  5CVI A;  1OYX A;  2QHU A;  2YUQ A;  4FYY B;  4VUB A;  3HL8 A;  5GMK j;  1ZA2 B;  2DD4 A;  2E10 A;  5A0G A;  9ATC B;  3V8L A;  1RAB B;  2PU9 B;  2XG8 D;  4PNO A;  3HFV A;  1WX6 A;  2RQU A;  2CP7 A;  3LC0 A;  3M59 A;  3VQW A;  1YJ9 T;  1I4K 1;  3OD1 A;  3UFG A;  1TU0 B;  2DVJ A;  4XU0 A;  3CCM Q;  1HSQ A;  2EL9 A;  2DO3 A;  1MGQ A;  4J9I A;  1EIF A;  1WIE A;  2K3Y A;  1AD5 A;  1FX7 A;  2L8D A;  2MK5 A;  6AT1 B;  2YLC A;  3RR6 A;  3E9F A;  3H8Z A;  2XKO C;  4J6X A;  3I35 A;  4RTU A;  1GCP A;  1EVK A;  4LD6 A;  5LJ5 h;  4OGC A;  1CSK A;  2JVV A;  4PK4 A;  2J7I A;  2QQ9 A;  1IHV A;  4M7A E;  5FRM A;  3P8Y A;  3PMT A;  2KR3 A;  4P73 C;  4OB1 B;  5KYW B;  1W4S A;  1PYS A;  2QTV A;  3QSU A;  4EDU A;  4PFO A;  2IG0 A;  1NJ8 A;  2OX7 A;  2I0N A;  2JUF A;  3AHU A;  3MKD A;  4OMM A;  3GIB A;  11AS A;  4LVL A;  3E19 A;  5CKE A;  3NTI A;  3V7C A;  3MP8 A;  1SHF A;  3P8H A;  3ASK A;  5CKF A;  4WI1 A;  4AH6 A;  2O4X B;  2RK2 A;  4TVR A;  1R8O B;  1VIF A;  1VQ8 A;  1B07 A;  2ZT5 A;  5FW9 A;  2CGH A;  4NS5 A;  3CCV A;  3JRZ A;  2RM4 A;  3CC2 A;  1ACM B;  2P0P A;  2KMT A;  3E2U A;  3P8B B;  1S72 T;  3QII A;  3OYG A;  3CD6 T;  1QVF P;  4HVC A;  4YDQ A;  2NUP B;  5CIU A;  4M7A B;  1S72 Q;  3CD6 Q;  3A8H B;  3BDL A;  2BUD A;  4KGV B;  1C0M A;  2LCC A;  1PWT A;  4P75 C;  1OPK A;  2D0N A;  3A7U A;  3GP8 A;  5GMK h;  4H2Y A;  3LSQ A;  3R6O A;  2LP5 A;  5DLQ E;  2RPN A;  4PG3 A;  1QW1 A;  3EG1 A;  5C51 B;  4II1 A;  1ZBX A;  2DDZ A;  3O8V A;  2RI2 A;  1D0Y A;  3L42 A;  3VS2 A;  1SHG A;  2XIC A;  3NET A;  3MHX A;  4BDZ A;  2WAC A;  5GAN f;  4FT4 A;  2P0Q A;  1IB8 A;  1YN8 A;  5EC7 A;  3I5R A;  3ZL7 C;  3GOX A;  1T0J A;  1KC8 C;  1TOV A;  1TWB A;  4JDS A;  1LPL A;  4E51 A;  1K4U S;  5CKB A;  4RCB A;  1HC7 A;  4PJJ A;  4LNP A;  1I8F A;  4LUE A;  4X5O A;  2YRD A;  2DL5 A;  4F7U G;  2ZT7 A;  1NJI C;  3MPU B;  2GGR A;  5E3I A;  4B6M A;  4M78 G;  4G85 A;  1NLO C;  3FIF A;  3G71 Q;  1Q7Y R;  2M51 A;  2GTJ A;  1BI3 A;  3VRZ A;  1G5V A;  4CH4 A;  2FB7 A;  3BDU A;  3VUB A;  1LNX A;  1WHL A;  2EJF A;  1PSF A;  3TU4 K;  1Q86 R;  4YCU A;  2HKQ B;  3QYH B;  4C92 A;  1K8A U;  2FHD A;  3I7F A;  5K1P A;  2DZ9 A;  1N8R R;  2YSQ A;  1LCK A;  3JAM E;  4BY6 C;  1TTH B;  2FG0 A;  2PVG B;  3KFV A;  1U8R A;  3X24 B;  2BKD N;  4OB2 B;  4RTZ A;  1E22 A;  4FCY A;  1QQJ A;  5LJ5 f;  1YJW A;  1RLQ C;  2CP3 A;  2DTH A;  3A5Z B;  2CJA A;  3TUP A;  1HD3 A;  2D6F A;  3EGU A;  1FYN A;  2RJF A;  4KGZ B;  4ZGE B;  5GAM g;  1Q81 U;  2ZIN A;  1WHH A;  3EG3 A;  5KCO A;  4KUD K;  3WVD B;  3CCU A;  1JJC B;  2QXF A;  1FXX A;  2D8J A;  3NTH A;  2RQT A;  4EMK A;  1Q82 C;  2MWO A;  5KYY A;  2JOY A;  4P72 C;  1VYT A;  1G83 A;  4RMF A;  1X75 C;  4HVU A;  4J9C A;  1BK2 A;  3FLG A;  3EGD A;  4DOW A;  2AMC B;  2EWN A;  1ZHI A;  4E6R A;  3BW1 A;  1PRM C;  2F2W A;  4N0A C;  4KUI A;  1UFF A;  1J5W A;  2ZNJ A;  5HKC A;  5FWB A;  2ESW A;  2EBP A;  2NUT A;  2PQW A;  3ZEH A;  2CZ0 B;  2KRN A;  2MAM A;  4OMP A;  3REX A;  3M5A A;  3CCV T;  2DK3 A;  3QZ9 B;  4FYX B;  1D1C A;  1QMC A;  2BE7 D;  3OMC A;  4ELZ C;  2RB6 A;  3QTC A;  3X20 B;  3A74 A;  2PTK A;  3CCV Q;  3TSW A;  1M5Q 1;  4P3N A;  1RUW A;  4X9D A;  4KH1 B;  3X25 B;  3H0H A;  3HXZ A;  1NEB A;  2CDT A;  4M7D E;  3M4P A;  2PMF A;  3L2R A;  3WVE B;  1LVK A;  1WLE A;  2EAY A;  2CZ7 B;  1K73 C;  2CUB A;  3BJU A;  3TEH B;  1RIQ A;  2COW A;  5ECA A;  1UG1 A;  3M4Y A;  1E6H A;  1XOV A;  2K4Y A;  1YI2 Q;  3VS6 A;  2YRC A;  1U3O A;  2H3J A;  5CKD A;  2O01 E;  4HWP A;  4P73 A;  4KR2 A;  1QWF A;  2RHQ A;  1VQ9 T;  3H9N A;  1MV0 B;  2Y90 A;  1OU9 A;  2R57 A;  4IIO A;  1QVG A;  1OZ3 A;  1B7Y B;  1NPR A;  1PC0 A;  4G84 A;  2JM8 A;  1Z9Z A;  3QWX X;  1VQ9 Q;  2QI2 A;  1BI1 A;  2YDL A;  1YIJ T;  2DIG A;  3UT1 A;  4YRS A;  4XEM A;  1RAD B;  2MWP A;  2QA4 A;  2ZT8 A;  4QVD A;  2LRQ A;  2ZPE B;  3VS3 A;  2DL7 A;  3X28 B;  1OX9 A;  4K87 A;  2K2V A;  2O2O A;  4C5H A;  1BCM A;  1YIJ Q;  2Q5I A;  2J6F A;  5J39 A;  3EHQ A;  1KMM A;  1BIB A;  3OS1 A;  3FB9 A;  3L2Q A;  1QWE A;  1SET A;  2CRE A;  3A31 A;  3QKJ A;  3PMI A;  1X27 A;  1H4T A;  2DJQ A;  3PT9 A;  4AFU C;  3RKW A;  5KH6 A;  2IY5 A;  1QCO A;  1KK7 A;  2R5M A;  2XMF A;  3A8O B;  4PHC A;  3VRY A;  2DET A;  1Y96 B;  2HNI A;  3DLL A;  1WJS A;  3HP9 A;  4PJO G;  3QXE B;  4PJO B;  2VYT A;  4FW1 A;  2DXU A;  4M7D F;  1YJW T;  2GQV A;  3QO8 A;  1YJN A;  4BI4 A;  3C12 A;  4JZ3 A;  2M0O A;  4KBM B;  2YHT A;  4WF2 A;  1VQO T;  3OQ5 A;  4QQ6 A;  5GAN 2;  1ASZ A;  5M9O A;  1M90 U;  3QUI A;  1YJW Q;  2DTO A;  2KYM A;  3L4G A;  3L2U A;  1X6O A;  5ELN A;  1ZSG A;  4C0D C;  2XID A;  2E5Q A;  4CH6 A;  4H2W A;  2JXB A;  3CCU T;  1VQO Q;  1KD1 R;  4DOV A;  1F1B B;  1B34 A;  5LJ3 g;  1IZ6 A;  1OZ2 A;  2LDM A;  1RAA B;  3JB9 G;  1TUD A;  2PZ1 A;  3E9I A;  1SG5 A;  2J6O A;  1G5I A;  4FL6 A;  5I21 A;  1M1K U;  3M0Q A;  1S1N A;  1RLP C;  3EFO A;  5FU6 B;  1PRL C;  1H8K A;  3X26 B;  3CME A;  2CT3 A;  3M4Q A;  3BY7 A;  3QDF A;  4LDU A;  2FPE A;  4PLI A;  2I2L A;  4DEX A;  2RQV A;  2O4X A;  1NBE B;  4Q6G A;  2OJ2 A;  3V7R A;  1KQ2 A;  2I4M A;  4DBR A;  2AKK A;  4M7D C;  1V76 A;  1W6X A;  3G6E A;  4RTT A;  1KQS P;  4OF1 A;  4X34 A;  1I81 A;  2CP0 A;  4OP0 A;  3JB9 H;  2A37 A;  1QF6 A;  2NLU A;  5HGQ A;  4KQE A;  2RJC A;  1X56 A;  3M0S A;  2YXY A;  2LX9 A;  1EIY B;  5D6X A;  4JS5 A;  1M8V A;  2EQI A;  4YCW A;  4LVK A;  4M7A A;  2BZY A;  4CS3 A;  2NYS A;  1WFW A;  2DNU A;  3QJ6 A;  3UDC A;  2DU7 A;  3I5S A;  1OV3 A;  4C8Q B;  1H4S A;  1QKX A;  4BD3 A;  3DKM A;  2XGT A;  4YRM A;  4C5I A;  2DX1 A;  3QYG B;  3S3O A;  3RAC A;  3M57 A;  1B7T A;  3MEW A;  2AZS A;  5IN1 A;  1D3B B;  4C92 F;  2JS0 A;  4P72 A;  2ABL A;  1O75 A;  3J7A F;  5CO7 A;  3PZC A;  3EG2 A;  3CCJ A;  4M77 G;  1RAF B;  2GCX A;  4M77 B;  1OUL A;  4ZIB A;  3UWN A;  1Q7Y U;  5C53 B;  2BZ8 A;  2LTO A;  2JZ2 A;  2KXD A;  3OYJ A;  3RUX A;  1Q81 R;  4M75 G;  3G4S Q;  3HHT B;  4XTY A;  1QVF A;  1N5Z A;  1G3S A;  2QA4 T;  1RL2 A;  4TTV A;  5D6Y A;  3W3S A;  3P8T A;  4PJO D;  3SWN C;  1H3Z A;  2CKK A;  2KEA A;  3E1S A;  3I55 A;  1N8R U;  2FZK B;  2ZPI B;  1WGS A;  3CBP A;  2CSQ A;  2QEX A;  1QE0 A;  3LWI A;  4EPC A;  1JO8 A;  5CQY A;  2DRM A;  1AHJ B;  4XEO A;  4XTZ A;  1JXM A;  4WTO B;  1OI1 A;  4QVZ A;  2D9T A;  1VQ5 Q;  1UGP B;  5I22 A;  1JJ2 A;  1V1C A;  4C92 C;  2EYY A;  1FMK A;  2JNG A;  2CP2 A;  4E7L A;  3OSV A;  3A5Z A;  4JRQ A;  4LXC A;  1YJN T;  4V2S A;  3M9Q A;  1WJR A;  4CC2 A;  2Z0W A;  4F04 B;  2JW4 A;  5A0L A;  4CC7 A;  2LT1 A;  1ZUK A;  4L59 A;  5I11 A;  1YJN Q;  5GAO q;  4HWS A;  2YUP A;  2IIM A;  1PG5 B;  1JJC A;  1MNE A;  5GAO m;  2JTF A;  1VQZ A;  2HQH A;  2LJ0 A;  5GAN 7;  3OYF A;  4H2T A;  3HFN A;  5GAO n;  1ZSZ B;  2RJD A;  3OW2 S;  4UPA A;  1U06 A;  3QDR B;  4BE2 A;  5C6S A;  1A0N B;  1OOT A;  2E65 A;  2F2V A;  1BIA A;  4E7K A;  2AMC A;  2E64 A;  4DBQ A;  4EMK C;  4QT7 A;  4H2X B;  3I56 A;  4JJC A;  5ELO A;  3IKL A;  2EKH A;  1G3T A;  1UB4 A;  3PVL A;  1MND A;  3MCA B;  2BTT A;  3JCM J;  5GAM e;  2V1Q A;  1YFT A;  4R0K A;  3S6W A;  1J3T A;  3M0T A;  2ZXF A;  4ANJ A;  1NJ5 A;  4C8Q D;  1E24 A;  3G1J A;  4UC4 A;  4H2U A;  3G6E T;  3PIP A;  2ATC B;  3RIR A;  3CCR T;  1R0C B;  2VKN A;  4BW9 A;  3QO3 A;  5FU7 C;  3HRU A;  5FRO A;  3HXY A;  2OI3 A;  3CQT A;  3G6E Q;  4O2D A;  2ZNI A;  3CCR Q;  2ROT A;  1TSF A;  4E2F B;  4TQD A;  2LX7 A;  3HXV A;  1G3Y A;  2DMO A;  4M77 D;  3DB4 A;  1FWZ A;  4FW2 A;  2SRC A;  2Q7G A;  4P3P A;  3CPW P;  3P8D A;  2E41 A;  4M75 D;  3QO5 A;  1YJ9 Q;  3VV0 A;  2EYW A;  5GJV B;  2X4X A;  3EFR A;  4IUV A;  4XU1 A;  5HK3 A;  3HFZ B;  1B8A A;  2DVE A;  2MF2 A;  4HCK A;  4RQE A;  1NYQ A;  1I5L A;  3IAL A;  1VIE A;  3CCJ T;  1USY A;  1Z7N A;  3TCJ A;  3HSB A;  1XNI A;  1VQP T;  12AS A;  3C95 A;  3QHS A;  3EH1 A;  1OU8 A;  1M90 R;  4H2S A;  3WXM B;  3V8K A;  5LJ5 g;  1XTD A;  3TEE A;  1VQP Q;  2JMC A;  1VQN A;  2HQE A;  2HL3 A;  2O9V A;  3A8L B;  1WA7 A;  4RMO A;  3I55 T;  4M7D A;  2P5I A;  1UTI A;  3JCM e;  1M1K R;  1B70 B;  2RHU A;  4PJN A;  4TVA B;  4DBF A;  3I55 Q;  3VS1 A;  2AIR B;  5LL6 S;  2AKW B;  1FMW A;  1NPP A;  2XD0 A;  2V26 A;  5I2S A;  1WXT A;  4HKE A;  4A63 B;  1GFD A;  2AK5 A;  1PSE A;  5GAN 3;  2FZC B;  4F7U E;  4UP9 A;  1Y96 A;  4DBH A;  3H41 A;  2QGF B;  2ALY A;  2L0A A;  2EQJ A;  4C0Z A;  4ELY C;  2CZ6 B;  1VYU A;  4KT0 E;  4J83 A;  4CRI A;  1KD1 U;  2QHT A;  4BB7 A;  2A8E A;  4JJB A;  1XQH A;  2DL4 A;  2DYB A;  4YRF A;  2E3H A;  4J8O A;  3HPW A;  3OBW A;  4XU2 A;  2LNH B;  4QW2 A;  1H3H A;  2BZX A;  1NEG A;  3M53 A;  1TUC A;  4PFP A;  1Q95 G;  4H2V A;  3CCE A;  1MV3 A;  5GMK l;  3V8J A;  1AWX A;  3ERR A;  1B76 A;  3C4S A;  2VAS A;  1Q86 C;  4BI8 B;  1K9M C;  4ZNX A;  4A4K A;  2XHC A;  3PGG A;  4M7A F;  2M16 A;  1WXU A;  2PUK B;  2RMO A;  3H0I A;  4HXJ A;  1TG0 A;  4A53 A;  1M2V A;  2E3C A;  1YCY A;  1VQL T;  4ATO A;  3GNG A;  1SSF A;  3S3M A;  1K0X A;  2MMP A;  3LWH A;  1RAH B;  4K86 A;  4F7U B;  3CCS A;  3Q1J A;  4MZM A;  2X4Y A;  3SWN A;  3VJP A;  4LVJ A;  2LT4 A;  1ZA1 B;  1I0C A;  5KYN A;  1XJW B;  3M54 A;  3VQY A;  1VQL Q;  5KYX B;  4M78 B;  1RAG B;  1EOV A;  4XQ3 A;  3TSZ A;  4QQD A;  3G1Z A;  4YCV A;  3RNJ A;  1W2B P;  5LJ3 e;  1NNH A;  3IG2 A;  4Q15 A;  1H64 1;  4RUG A;  3E9H A;  1N27 A;  3QWY A;  1KIK A;  4LE9 A;  1QCN A;  1YIT A;  3EGX A;  1N9R A;  1SES A;  4QVC A;  3OW2 P;  3JCM b;  1EIY A;  4P71 A;  2L3S A;  4JUV A;  2XDD A;  1I07 A;  4NL3 A;  2DAQ A;  3HXW A;  3PCO B;  2XK0 A;  2PVD B;  4M7A C;  3JCM X;  3BE3 A;  3SFM A;  1VOM A;  4IKF A;  3EG9 B;  1N6A A;  4MZT A;  3UPU A;  2RHS B;  4AG1 C;  1YFR A;  1GL5 A;  2HDA A;  4XTV A;  3ICA A;  1AVZ C;  2M9U A;  1Y07 A;  1YHQ A;  2YLB A;  3VBB A;  3HFO A;  4E47 A;  2QDY B;  2W10 A;  2YWW A;  4RG8 A;  2DL3 A;  4IUR A;  3NEN A;  2L2P A;  1MMA A;  1UUE A;  4EMG A;  2CYZ B;  1HJD A;  1NJI R;  1BBU A;  2A36 A;  2EYX A;  4RKU E;  4AT1 B;  2HD0 A;  3CCL A;  1KQS A;  4JZ4 A;  1ADJ A;  1KFZ A;  3A7R A;  3CMA A;  3PFS A;  2HSE B;  4XU3 A;  1VQN T;  3MEY A;  2DD5 A;  1PKS A;  2E6N A;  2E70 A;  4BI3 A;  5C52 B;  5IT9 E;  1BBZ A;  2GQI A;  4M4Z A;  2ED0 A;  4PJL A;  1HK9 A;  4HVV A;  4D8D A;  4JJN K;  4ZTU B;  3GNF B;  3PVQ A;  1VQ8 T;  3SEM A;  2VB6 A;  2XDB A;  2KRM A;  2CSI A;  4X1V A;  3CC2 T;  2J6K A;  1WQW A;  1VQK A;  1WYD A;  1IL2 A;  2C7I A;  2COZ A;  1GXI E;  2B8A A;  1VQ8 Q;  1SF9 A;  3RDV A;  4BE1 A;  2MCN A;  4CH3 A;  3CC4 A;  5L23 A;  3CC2 Q;  1T3S A;  1WJQ A;  3OYE A;  4PJM A;  5GJW B;  4F17 A;  3FJ5 A;  3JSC A;  2ZIO A;  4JPB W;  1M9S A;  2KAF A;  2X4J A;  3CXC A;  2KK4 A;  2HEQ A;  1K1Z A;  1X2H A;  2RHI A;  3QPH A;  1PM3 A;  1SRL A;  3EFS A;  3ZBD A;  2C0T A;  2COY A;  1M27 C;  4YRC A;  1LYL A;  1Q82 R;  2DU5 A;  2KYB A;  2D1X A;  1VQM A;  2EGE A;  2HSP A;  3OS2 A;  3CMQ A;  3RF1 A;  5KYU A;  4M78 D;  4WJ4 A;  5DM7 R;  1NZ9 A;  3CC7 A;  1JEG A;  4K11 A;  5L8R E;  2EFI A;  3A5Y A;  2ART A;  4YRO A;  1G2B A;  2JT4 A;  1ADY A;  3JCM g;  4PJO E;  4BWA A;  4BDY A;  2ZAE A;  4R55 A;  1KHI A;  3JV3 A;  2K6D A;  3RKX A;  3OYC A;  3CEY A;  4N4I A;  2F5T X;  2BIV A;  4JJD A;  1OX8 A;  3GBQ A;  2DF6 A;  4F14 A;  1G3W A;  4LD9 K;  4C0G A;  2F2X A;  2E5A A;  1WNL A;  3MEV A;  2RD1 A;  3ULR B;  1UGS B;  1ABO A;  1WHK A;  2EJ9 A;  5HK0 A;  1QVG S;  4HWO A;  2PVO B;  2AHJ B;  1WHM A;  4FU6 A;  2FL7 A;  5C0M A;  3RBB B;  1E6G A;  1X6B A;  2EPD A;  4HCZ A;  1PYS B;  1W1F A;  5CR2 A;  3UH0 A;  3UA6 A;  4TQF A;  3NGP A;  4AFS C;  4J6Y A;  3LH5 A;  5GMK i;  3M4G A;  2L3Q A;  1UGV A;  1TH7 A;  3THK A;  4J7I A;  4M7D G;  2OTJ A;  2ODR C;  2G3R A;  1WHJ A;  1VA7 A;  5GAN e;  4E7Z A;  3CBO A;  3S3N A;  2A3L A;  2KDS A;  2JTE A;  1VUB A;  1YHQ T;  2DQ0 A;  1UGQ B;  3EG0 A;  5IHN A;  2YRV A;  3CPF A;  1NM7 A;  2P4T A;  3A1P A;  1YFS A;  2RI5 A;  3REA B;  2P0K A;  4IIM A;  2CP5 A;  3KFU A;  1KHC A;  4JLG A;  4Z89 A;  5KYW A;  2FYK A;  3CCL T;  1AWW A;  2I4L A;  3A8M B;  3R07 A;  2V8K A;  4C8Q E;  1HYO A;  2DFU A;  2X3X D;  3CMA T;  1USY C;  4B9W A;  3CCU Q;  4PKC C;  1ARK A;  4D6W A;  4MDW A;  3J81 E;  1L0W A;  3CCL Q;  1VQ7 A;  4J5Y A;  2RHZ A;  1I1J A;  4E7J A;  5KNN A;  1K8A C;  4C5G A;  5AT1 B;  4TVA A;  2Q5H A;  3FRN A;  1X55 A;  2EGC A;  1EVL A;  2L89 A;  2AKW A;  3QO7 A;  3CPW A;  2LC4 A;  3DSQ A;  4J9H A;  1CKB A;  2CUD A;  4M77 E;  1VQK T;  3KXT A;  1K76 A;  1WYX A;  3RMQ A;  3TRE A;  2KT8 A;  2A28 A;  3LYI A;  5LJ5 e;  2E12 A;  2HAX A;  4M75 E;  1MHN A;  1YBY A;  3CC4 T;  2DBM A;  1HXD A;  5F5W A;  2NUP A;  2J06 A;  3OB9 A;  4J15 A;  1Q81 C;  2O88 A;  4WCI A;  4PJO C;  3CC4 Q;  3NEL A;  1NJ6 A;  3A98 A;  3OSS C;  1PKT A;  2LJ1 A;  2K2M A;  2LQ8 A;  4PFZ A;  1NYR A;  4YPF A;  4O6J A;  1KQ1 A;  5CQX A;  3MET A;  4HVW A;  3GPL A;  1E1T A;  4NCX A;  5KCH A;  2EJG A;  3UGT A;  3VS4 A;  3CC7 T;  3CCM A;  4C92 G;  3JCM V;  3FC3 A;  3VYH B;  2ED1 A;  1NYF A;  4R56 A;  2X4W A;  1Z7M A;  2FPF A;  4EMH A;  1YCS B;  2RH2 A;  4TVY A;  4D8K A;  2PUO B;  4C8Q F;  5EG2 A;  3J80 E;  4OB3 B;  2RQR A;  1UHC A;  2O9S A;  3LW5 E;  3CBM A;  5FU6 C;  3UGQ A;  4YP0 A;  5GAM d;  2CIM A;  3OY9 A;  2KSS A;  4M75 B;  5CCA A;  4DEY A;  4OMQ A;  3NTK A;  2J3L A;  3IKM B;  4EIK A;  4MZP A;  1P92 A;  2ROL A;  4RTV A;  3L1A A;  1ZLM A;  2WSC E;  3LH0 A;  2QA4 Q;  5GMK e;  2K9G A;  2G6F X;  3VS0 A;  1JXO A;  2ZPG B;  4GY5 A;  1X54 A;  4FSX A;  2LQK A;  2KVQ G;  1QVF S;  1IO6 A;  5J26 A;  5KYY B;  1GCQ C;  1RI9 A;  2O31 A;  2QK0 A;  3RMS A;  3FDR A;  2A08 A;  5CKH A;  4HT4 A;  4KR3 A;  4JRP A;  2B86 A;  2CH4 A;  4AFQ C;  4E7H A;  4P71 C;  1KC8 U;  2OTJ T;  4FM4 B;  3HKS A;  2DM1 A;  1IHW A;  3HXU A;  2MI6 A;  3JB9 D;  2RHS A;  1X43 A;  2X35 A;  4QQG A;  3A32 A;  4C8Q C;  3OYH A;  1N9W A;  2OTJ Q;  2C8M A;  1NJI U;  1O9S A;  5IAY A;  1QVG P;  1K9A A;  1X01 A;  2ZZD A;  1KMN A;  3EAE A;  1VQ6 A;  1JJ2 S;  3JCM W; 
#chains in the Genus database with same CATH homology
 3KBG A;  3CD6 A;  4XTW A;  2ZTG A;  1W2B A;  4LDX A;  4LNS A;  2EQK A;  4CS4 A;  4M77 C;  1DJ7 B;  1C0A A;  2ZGW A;  4YRT A;  1UGR B;  3CME T;  2EQM A;  3RGL A;  5K1X A;  4IUQ A;  3LGF A;  1BI0 A;  3JCM d;  2RO0 A;  4YRK A;  2ARS A;  5GAN g;  2RHQ B;  5J3B A;  3SD4 A;  2V8I A;  1W66 A;  2DTI A;  1SRY A;  3VYG A;  4C92 D;  4YRI A;  3G71 A;  4ZN3 A;  5GAN 6;  2DXB A;  1Q82 U;  3WQZ A;  4YRG A;  2EKO A;  4WJ3 M;  4NOY A;  3URG A;  1M90 C;  2CS7 A;  1NE8 A;  2RHX A;  4HT8 A;  2XTI A;  2ZR3 A;  2Q7E A;  2RJE A;  3TEH A;  4CS2 A;  2JTM A;  4MMK A;  2ZT6 A;  2ZZF A;  2VUB A;  2Y4X A;  4LDW A;  3CCM T;  1M1K C;  4TVW A;  4P74 C;  4LVM A;  2V8J A;  3LSS A;  2IY5 B;  4L6V 5;  2QQR A;  3VU3 C;  2XU8 A;  5GAO r;  5GAO l;  1B7Y A;  2J3M A;  2LNV A;  4Z02 A;  2ZR2 A;  1BBW A;  2K57 A;  4C5E A;  4JS4 A;  3HTZ A;  2DJZ A;  5GMK m;  2R5A A;  1M4Z A;  4XTU A;  5LJ3 d;  3L4G B;  4YRJ A;  3HXX A;  2QEX T;  1V29 B;  5KE3 A;  1K73 U;  3OBY A;  2DEQ A;  1KG1 A;  4H02 A;  1B34 B;  1U1S A;  4YRL A;  4X9C A;  3M58 A;  3VQX A;  4YRQ A;  2NS6 A;  3VKI A;  1U1T A;  3OA6 A;  2OTL A;  3MEA A;  4PJO A;  4P5N A;  5GAM j;  4M78 E;  3L2W A;  3OYN A;  3QNE A;  2KY9 A;  4O5V A;  3OYM A;  3L2Z A;  3PNW C;  1IRE B;  1VQ6 T;  4B9X A;  3L2V A;  1Q7Y C;  4HWT A;  1YB3 A;  3JCM c;  3QG1 A;  3CCQ A;  2ARU A;  4OGE A;  3HRI A;  2VGM A;  4BY6 B;  4DQ2 A;  4M7A G;  2QQA A;  2VV5 A;  5GAN 4;  5CAI A;  1YI2 A;  1N8R C;  3VUZ A;  2OAU A;  3F70 A;  3I56 T;  3C94 A;  3OS0 A;  2ZPF B;  3GF5 A;  2VXE A;  1JBM A;  3OYD A;  3MF2 A;  2Q7H A;  3LX7 A;  4IUU A;  4RCC A;  1NJ1 A;  1VQ9 A;  4IUT A;  1LOJ A;  4JRK A;  2QTX A;  4ZN1 A;  3G71 T;  1YIJ A;  3OYL A;  4K88 A;  4OB0 B;  2DPP B;  4RDX A;  2ZIM A;  4F7U F;  2R58 A;  3LGL A;  3PTA A;  2ZCE A;  4C8Q A;  4M78 F;  4FT2 A;  1BYM A;  1JB0 E;  3QBY A;  4DPG A;  2I4O A;  4TWA A;  2C06 A;  1D3B A;  5DY9 A;  4C0F A;  3HRS A;  2F69 A;  4ZTJ A;  2Y4Y A;  1H4V B;  5GAM h;  2EYQ A;  2KQW A;  4M77 A;  2DKG A;  3OYB A;  4M75 A;  2CJB A;  3RES A;  1VQO A;  3A8G B;  4HCB A;  3BFM A;  4A4H A;  4M78 C;  1KQS S;  1WQ7 A;  4YRN A;  4BUG A;  2L5Q A;  2DZC A;  4HA8 A;  4L5G A;  1QP3 A;  3DLM A;  3FJP A;  4RG2 A;  2GF7 A;  4JRI A;  2OTL T;  2QHS A;  4M7A D;  2D0Q B;  5FLX E;  4OVA A;  4BE0 A;  5GAN d;  4XAX B;  5LJ3 j;  1FYF A;  4N4H A;  3HY0 A;  4XTX A;  4P74 A;  2RK1 A;  2DXT A;  5DLO A;  3RER A;  2CZ1 B;  3CCQ T;  3T9N A;  2EIF A;  3CCE T;  4MML A;  3RKY A;  3OYY A;  1KOG A;  3CXC S;  2RI3 A;  2DQ3 A;  1YI2 T;  3MQZ A;  2GFA A;  1Y7X A;  2M1H A;  4H2X A;  2WSF E;  3JCM h;  2XDP A;  2RHY A;  3CCS T;  5A0D A;  4C0D B;  3DB3 A;  4LVI A;  2JN0 A;  2ZCF B;  4A4E A;  4Y28 E;  4E7I A;  4ZTF A;  5KE2 A;  4NL2 A;  3G4S A;  2DIQ A;  2VC8 A;  2K5F A;  5LJ5 d;  1YIT T;  4Y91 A;  1GGM A;  3V7S A;  3ME9 A;  1KD1 C;  1N9S A;  4RQF A;  2E1H A;  4J7F A;  5GAN 8;  4YRE A;  2LCL A;  2LVM A;  3OS5 A;  3RL6 A;  2E6Z A;  3SDZ A;  1E1O A;  4M7D B;  2VGN A;  3N5B B;  3OYA A;  3MP6 A;  4PLL A;  1VQ5 A;  2F5K A;  4CI0 C;  3HY1 A;  3HFZ A;  4Q5W A;  3MP1 A;  5GAM f;  3JB9 I;  5D6W A;  1SER A;  3G7Z A;  4YTL A;  3FEO A;  3A7A A;  4P75 A;  2PME A;  3MF1 A;  5I2M A;  2ALY B;  3QZ5 B;  3H6Z A;  2ZPB B;  4A4F A;  4HWR A;  4OLF A;  2L3R A;  1ZQ1 A;  3PIO A;  4PJO F;  3JB9 J;  3P8V A;  5LJ3 h;  5CK9 A;  2QQS A;  3M56 A;  2DXC A;  5GAO p;  5HY6 A;  3HRT A;  2K5I A;  4FIB A;  2FVU A;  1VQ4 A;  5FRN A;  4C92 E;  2QQB A;  1B70 A;  3NFC A;  4EX5 A;  2IVW A;  2K3X A;  3JB9 F;  1G51 A;  4JLI A;  4IUP A;  3MEU A;  1ATI A;  2ODR D;  4UP7 A;  4OMF B;  3SWN B;  4GLK A;  3CPW S;  5GAN 5;  2G4C A;  4ZTZ B;  1M1G A;  3ER0 A;  1H4Q A;  3CCR A;  5AYF A;  2HQX A;  4DA4 A;  1VQM T;  4ZGJ B;  4YRP A;  4HCC A;  2ZZE A;  4C92 B;  3NEM A;  4P3O A;  3JCM f;  1WPY A;  1UEB A;  3GLX A;  1YJ9 A;  4C8Q G;  3OYI A;  1YGB A;  2A7Y A;  5GAN j;  4F7U A;  2P0L A;  4MDX A;  1LJO A;  3VQV A;  4M78 A;  3E9G A;  4BAC A;  3JCM Q;  4M7D D;  4N4G A;  3G4S T;  3OMG A;  1RI0 A;  1VQP A;  3LLR A;  4EO4 A;  3REU A;  4EMK B;  4M77 F;  4LDY A;  4N0A A;  4A4G A;  4ME7 A;  3ZFJ A;  2ZPH B;  1Q86 U;  2EQU A;  2HBP A;  1K9M U;  4M75 F;  3PCO A;  5A2Q E;  1QP2 A;  2RA2 A;  3TEG A;  1WU7 A;  3M55 A;  4L87 A;  1VQ5 T;  5FU7 B;  1QVP A;  2GFU A;  3JCM P;  3KUF A;  4YYE A;  5LJ5 j;  1S72 A;  1EFW A;  2WSE E;  5LJ3 f;  1NJ2 A;  1EQR A;  1ASY A;  2K5L A;  3INZ A;  1BI2 A;  4LDV A;  1HTT A;  3OW2 A;  1VQ7 T;  4PL6 A;  4HT9 A;  3MO8 A;  4ZGD B;  3QJY A;  1W2B S;  4M75 C;  1VQ4 T;  2QHV A;  2XI9 A;  2ZZG A;  1JRI A;  2I4N A;  4J6W A;  2VXF A;  3OYK A;  4CH5 A;  4UP8 A;  1X2G A;  1M1F A;  2CJ9 A;  1BKB A;  3SB2 A;  3HRK A;  1Y71 A;  4XK8 E;  4KUL A;  5GAN h;  1G5H A;  1VQL A;  4A54 A;  4YRR A;  5CVI A;  1OYX A;  2QHU A;  4VUB A;  3HL8 A;  5GMK j;  2DD4 A;  2E10 A;  5A0G A;  3V8L A;  2PU9 B;  2XG8 D;  4PNO A;  3HFV A;  3LC0 A;  3M59 A;  3VQW A;  1YJ9 T;  1I4K 1;  3OD1 A;  3UFG A;  4XU0 A;  2EL9 A;  2DO3 A;  1MGQ A;  1EIF A;  2K3Y A;  1FX7 A;  2L8D A;  2YLC A;  3E9F A;  3H8Z A;  2XKO C;  4J6X A;  1EVK A;  4LD6 A;  5LJ5 h;  4OGC A;  2JVV A;  2QQ9 A;  4M7A E;  5FRM A;  3P8Y A;  3PMT A;  4P73 C;  4OB1 B;  1W4S A;  1PYS A;  3QSU A;  4EDU A;  2IG0 A;  1NJ8 A;  2JUF A;  3AHU A;  11AS A;  3GIB A;  4LVL A;  3E19 A;  5CKE A;  3NTI A;  3V7C A;  3MP8 A;  3P8H A;  3ASK A;  5CKF A;  4WI1 A;  4AH6 A;  2O4X B;  2RK2 A;  4TVR A;  1R8O B;  1VIF A;  1VQ8 A;  2ZT5 A;  2CGH A;  4NS5 A;  3CCV A;  3JRZ A;  2RM4 A;  3CC2 A;  2P0P A;  2KMT A;  3P8B B;  1S72 T;  3QII A;  3OYG A;  3CD6 T;  4HVC A;  4YDQ A;  5CIU A;  4M7A B;  3A8H B;  3BDL A;  2BUD A;  2LCC A;  4P75 C;  3A7U A;  3GP8 A;  5GMK h;  4H2Y A;  3LSQ A;  3R6O A;  5DLQ E;  4PG3 A;  1QW1 A;  5C51 B;  4II1 A;  1ZBX A;  2DDZ A;  3O8V A;  2RI2 A;  3L42 A;  2XIC A;  3NET A;  3MHX A;  4BDZ A;  2WAC A;  5GAN f;  4FT4 A;  2P0Q A;  3GOX A;  1KC8 C;  4JDS A;  4E51 A;  5CKB A;  4RCB A;  1HC7 A;  1I8F A;  4X5O A;  4F7U G;  2ZT7 A;  1NJI C;  5E3I A;  4M78 G;  4G85 A;  3FIF A;  1BI3 A;  1G5V A;  4CH4 A;  2FB7 A;  3BDU A;  3VUB A;  1LNX A;  2EJF A;  1PSF A;  3TU4 K;  4YCU A;  3QYH B;  4C92 A;  1K8A U;  2FHD A;  3I7F A;  5K1P A;  2DZ9 A;  3JAM E;  4BY6 C;  2PVG B;  1U8R A;  3X24 B;  2BKD N;  4OB2 B;  1E22 A;  5LJ5 f;  1YJW A;  2DTH A;  3A5Z B;  2CJA A;  3TUP A;  2D6F A;  4ZGE B;  2RJF A;  5GAM g;  1Q81 U;  2ZIN A;  5KCO A;  4KUD K;  3WVD B;  3CCU A;  1JJC B;  2QXF A;  1FXX A;  3NTH A;  4EMK A;  1Q82 C;  2MWO A;  2JOY A;  4P72 C;  4RMF A;  1X75 C;  3FLG A;  4DOW A;  2AMC B;  2EWN A;  1ZHI A;  3BW1 A;  4N0A C;  4KUI A;  1J5W A;  2ZNJ A;  5HKC A;  2PQW A;  3ZEH A;  2CZ0 B;  2MAM A;  3REX A;  3M5A A;  3CCV T;  2DK3 A;  3QZ9 B;  3OMC A;  4ELZ C;  2RB6 A;  3QTC A;  3X20 B;  3A74 A;  1M5Q 1;  4P3N A;  4X9D A;  3X25 B;  3HXZ A;  4M7D E;  3M4P A;  2PMF A;  3L2R A;  3WVE B;  1WLE A;  2EAY A;  2CZ7 B;  1K73 C;  3BJU A;  3TEH B;  1RIQ A;  3M4Y A;  1XOV A;  2K4Y A;  2H3J A;  5CKD A;  2O01 E;  4HWP A;  4P73 A;  4KR2 A;  2RHQ A;  1VQ9 T;  2Y90 A;  2R57 A;  1QVG A;  1OZ3 A;  1B7Y B;  1NPR A;  4G84 A;  2QI2 A;  1BI1 A;  1YIJ T;  2DIG A;  3UT1 A;  4YRS A;  4XEM A;  2MWP A;  2QA4 A;  2ZT8 A;  4QVD A;  2LRQ A;  2ZPE B;  3X28 B;  4K87 A;  2K2V A;  4C5H A;  2Q5I A;  5J39 A;  1KMM A;  1BIB A;  3OS1 A;  3FB9 A;  3L2Q A;  1SET A;  3A31 A;  3QKJ A;  3PMI A;  1H4T A;  3PT9 A;  3RKW A;  5KH6 A;  2IY5 A;  2R5M A;  3A8O B;  4PHC A;  1Y96 B;  2HNI A;  3DLL A;  1WJS A;  3HP9 A;  4PJO G;  3QXE B;  4PJO B;  2VYT A;  2DXU A;  4M7D F;  1YJW T;  2GQV A;  3QO8 A;  1YJN A;  4BI4 A;  3C12 A;  2M0O A;  4KBM B;  2YHT A;  4WF2 A;  1VQO T;  3OQ5 A;  4QQ6 A;  5GAN 2;  1ASZ A;  5M9O A;  1M90 U;  3QUI A;  2DTO A;  3L4G A;  3L2U A;  1X6O A;  5ELN A;  4C0D C;  2XID A;  2E5Q A;  4CH6 A;  4H2W A;  3CCU T;  4DOV A;  1B34 A;  5LJ3 g;  1IZ6 A;  1OZ2 A;  2LDM A;  3JB9 G;  3E9I A;  1G5I A;  4FL6 A;  5I21 A;  1M1K U;  5FU6 B;  3X26 B;  3CME A;  3M4Q A;  3BY7 A;  4LDU A;  4PLI A;  2I2L A;  2O4X A;  4Q6G A;  2I4M A;  3V7R A;  1KQ2 A;  4M7D C;  3G6E A;  4OF1 A;  4X34 A;  1I81 A;  4OP0 A;  3JB9 H;  1QF6 A;  2NLU A;  5HGQ A;  4KQE A;  2RJC A;  1X56 A;  2LX9 A;  1EIY B;  5D6X A;  4JS5 A;  1M8V A;  4YCW A;  4LVK A;  4CS3 A;  4M7A A;  3QJ6 A;  3UDC A;  2DU7 A;  4C8Q B;  1H4S A;  4BD3 A;  3DKM A;  2XGT A;  4YRM A;  4C5I A;  3QYG B;  3S3O A;  3RAC A;  3M57 A;  3MEW A;  5IN1 A;  1D3B B;  4C92 F;  4P72 A;  1O75 A;  3J7A F;  5CO7 A;  3PZC A;  3CCJ A;  4M77 G;  2GCX A;  4M77 B;  4ZIB A;  3UWN A;  1Q7Y U;  5C53 B;  2LTO A;  2JZ2 A;  3OYJ A;  3RUX A;  4M75 G;  3HHT B;  4XTY A;  1QVF A;  1G3S A;  2QA4 T;  1RL2 A;  4TTV A;  5D6Y A;  3W3S A;  3P8T A;  4PJO D;  3SWN C;  1H3Z A;  2CKK A;  3E1S A;  3I55 A;  1N8R U;  2ZPI B;  1WGS A;  3CBP A;  2QEX A;  1QE0 A;  3LWI A;  4EPC A;  5CQY A;  1AHJ B;  4XEO A;  4XTZ A;  1OI1 A;  4QVZ A;  2D9T A;  1UGP B;  1JJ2 A;  4C92 C;  2JNG A;  4E7L A;  3OSV A;  3A5Z A;  4JRQ A;  1YJN T;  4V2S A;  3M9Q A;  1WJR A;  5A0L A;  2LT1 A;  4L59 A;  5GAO q;  4HWS A;  1JJC A;  5GAO m;  2JTF A;  1VQZ A;  5GAN 7;  3OYF A;  4H2T A;  3HFN A;  5GAO n;  2RJD A;  3OW2 S;  4UPA A;  3QDR B;  4BE2 A;  5C6S A;  2E65 A;  1BIA A;  4E7K A;  2AMC A;  2E64 A;  4EMK C;  4H2X B;  3I56 A;  5ELO A;  3IKL A;  1G3T A;  1UB4 A;  3MCA B;  3JCM J;  5GAM e;  1YFT A;  3S6W A;  2ZXF A;  1NJ5 A;  4C8Q D;  1E24 A;  4UC4 A;  4H2U A;  3G6E T;  3PIP A;  3RIR A;  3CCR T;  4BW9 A;  3QO3 A;  5FU7 C;  3HRU A;  5FRO A;  3HXY A;  4O2D A;  2ZNI A;  4TQD A;  3HXV A;  1G3Y A;  4M77 D;  3DB4 A;  1FWZ A;  2Q7G A;  4P3P A;  3P8D A;  2E41 A;  4M75 D;  3QO5 A;  3VV0 A;  2X4X A;  3EFR A;  4IUV A;  4XU1 A;  5HK3 A;  3HFZ B;  1B8A A;  2DVE A;  2MF2 A;  4RQE A;  1NYQ A;  1I5L A;  3IAL A;  1VIE A;  3CCJ T;  1USY A;  1Z7N A;  3TCJ A;  3HSB A;  1XNI A;  1VQP T;  12AS A;  3C95 A;  3QHS A;  4H2S A;  3WXM B;  3V8K A;  5LJ5 g;  1XTD A;  3TEE A;  1VQN A;  2HQE A;  3A8L B;  4RMO A;  3I55 T;  4M7D A;  2P5I A;  1B70 B;  3JCM e;  2RHU A;  4TVA B;  5LL6 S;  2AKW B;  1NPP A;  2XD0 A;  5I2S A;  4HKE A;  1PSE A;  5GAN 3;  4F7U E;  4UP9 A;  1Y96 A;  2ALY A;  2EQJ A;  4C0Z A;  4ELY C;  2CZ6 B;  4KT0 E;  4J83 A;  4CRI A;  1KD1 U;  2QHT A;  4BB7 A;  2A8E A;  1XQH A;  4YRF A;  4J8O A;  3HPW A;  3OBW A;  4XU2 A;  4QW2 A;  3M53 A;  4H2V A;  3CCE A;  5GMK l;  3V8J A;  3ERR A;  1B76 A;  3C4S A;  1Q86 C;  4BI8 B;  1K9M C;  4A4K A;  2XHC A;  3PGG A;  4M7A F;  2M16 A;  2PUK B;  2E3C A;  4A53 A;  1YCY A;  1VQL T;  4ATO A;  3GNG A;  1SSF A;  3S3M A;  2MMP A;  3LWH A;  4K86 A;  4F7U B;  3CCS A;  3Q1J A;  4MZM A;  2X4Y A;  3SWN A;  3VJP A;  4LVJ A;  2LT4 A;  3VQY A;  3M54 A;  4M78 B;  1EOV A;  4XQ3 A;  4QQD A;  3G1Z A;  4YCV A;  5LJ3 e;  1NNH A;  3IG2 A;  4Q15 A;  1H64 1;  3E9H A;  1N27 A;  1YIT A;  1N9R A;  1SES A;  4QVC A;  3JCM b;  1EIY A;  4P71 A;  4JUV A;  2XDD A;  4NL3 A;  2DAQ A;  3HXW A;  3PCO B;  2XK0 A;  2PVD B;  4M7A C;  3JCM X;  3SFM A;  4IKF A;  1N6A A;  4MZT A;  3UPU A;  2RHS B;  1YFR A;  4XTV A;  3ICA A;  2M9U A;  1YHQ A;  1Y07 A;  2YLB A;  3VBB A;  3HFO A;  4E47 A;  2QDY B;  4RG8 A;  4IUR A;  3NEN A;  4EMG A;  2CYZ B;  1BBU A;  4RKU E;  2HD0 A;  3CCL A;  1KQS A;  1ADJ A;  3A7R A;  3CMA A;  3PFS A;  4XU3 A;  1VQN T;  3MEY A;  2DD5 A;  2E6N A;  2E70 A;  4BI3 A;  5C52 B;  5IT9 E;  1HK9 A;  4JJN K;  4ZTU B;  3GNF B;  1VQ8 T;  2XDB A;  3CC2 T;  1VQK A;  1WQW A;  1WYD A;  1IL2 A;  2C7I A;  1GXI E;  2B8A A;  4BE1 A;  4CH3 A;  3CC4 A;  3OYE A;  1WJQ A;  3JSC A;  2ZIO A;  1M9S A;  2KAF A;  2X4J A;  3CXC A;  2KK4 A;  1X2H A;  2RHI A;  3QPH A;  3EFS A;  3ZBD A;  4YRC A;  1LYL A;  2DU5 A;  1VQM A;  3RF1 A;  3CMQ A;  3OS2 A;  4M78 D;  4WJ4 A;  5DM7 R;  1NZ9 A;  3CC7 A;  5L8R E;  2EFI A;  3A5Y A;  2ART A;  4YRO A;  1ADY A;  3JCM g;  4PJO E;  4BWA A;  4BDY A;  4R55 A;  1KHI A;  3RKX A;  3OYC A;  3CEY A;  4N4I A;  2F5T X;  2BIV A;  1G3W A;  4LD9 K;  4C0G A;  2E5A A;  1WNL A;  3MEV A;  2RD1 A;  1UGS B;  2EJ9 A;  5HK0 A;  1QVG S;  4HWO A;  2PVO B;  2AHJ B;  4FU6 A;  2FL7 A;  5C0M A;  4HCZ A;  1PYS B;  5CR2 A;  3UH0 A;  4TQF A;  4J6Y A;  5GMK i;  3M4G A;  1TH7 A;  4J7I A;  4M7D G;  2OTJ A;  2ODR C;  2G3R A;  5GAN e;  3CBO A;  3S3N A;  2A3L A;  2KDS A;  1VUB A;  1YHQ T;  2DQ0 A;  1UGQ B;  2YRV A;  3CPF A;  2P4T A;  1YFS A;  2RI5 A;  2P0K A;  3KFU A;  1KHC A;  4JLG A;  2FYK A;  3CCL T;  2I4L A;  3A8M B;  3R07 A;  2V8K A;  4C8Q E;  1USY C;  3CMA T;  4B9W A;  4PKC C;  4D6W A;  4MDW A;  3J81 E;  1L0W A;  1VQ7 A;  4J5Y A;  2RHZ A;  4E7J A;  5KNN A;  1K8A C;  4C5G A;  4TVA A;  2Q5H A;  3FRN A;  1X55 A;  1EVL A;  2L89 A;  2AKW A;  3QO7 A;  3CPW A;  2LC4 A;  3DSQ A;  4M77 E;  1VQK T;  3KXT A;  3RMQ A;  3TRE A;  3LYI A;  5LJ5 e;  2E12 A;  2HAX A;  4M75 E;  1MHN A;  1YBY A;  3CC4 T;  1HXD A;  5F5W A;  3OB9 A;  4J15 A;  1Q81 C;  4PJO C;  3NEL A;  1NJ6 A;  3OSS C;  2LQ8 A;  1NYR A;  4YPF A;  4O6J A;  1KQ1 A;  5CQX A;  3MET A;  4NCX A;  3GPL A;  1E1T A;  5KCH A;  2EJG A;  3UGT A;  3CC7 T;  3CCM A;  4C92 G;  3JCM V;  3FC3 A;  3VYH B;  4R56 A;  2X4W A;  1Z7M A;  4EMH A;  2RH2 A;  4TVY A;  2PUO B;  4C8Q F;  5EG2 A;  3J80 E;  4OB3 B;  3LW5 E;  3CBM A;  5FU6 C;  3UGQ A;  4YP0 A;  5GAM d;  2CIM A;  3OY9 A;  2KSS A;  4M75 B;  5CCA A;  3NTK A;  2J3L A;  3IKM B;  4MZP A;  1P92 A;  3L1A A;  2WSC E;  3LH0 A;  5GMK e;  2ZPG B;  4GY5 A;  1X54 A;  4FSX A;  2LQK A;  2KVQ G;  1QVF S;  5J26 A;  3RMS A;  3FDR A;  5CKH A;  4HT4 A;  4KR3 A;  4JRP A;  4E7H A;  4P71 C;  1KC8 U;  2OTJ T;  4FM4 B;  3HKS A;  3HXU A;  2MI6 A;  3JB9 D;  2RHS A;  2X35 A;  4QQG A;  3A32 A;  4C8Q C;  3OYH A;  1N9W A;  2C8M A;  1NJI U;  1O9S A;  5IAY A;  1X01 A;  2ZZD A;  1KMN A;  3EAE A;  1VQ6 A;  1JJ2 S;  3JCM W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...