3L1JA

Crystal structure of este5, was soaked by znso4
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
297
structure length
294
Chain Sequence
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVTVAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAAALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLVLAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMGGINKMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAKAKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the noninvasive inhibition of HSL-homolog EstE5 by organic solvents and metal ions
rcsb
source organism Uncultured bacterium
molecule tags Hydrolase
molecule keywords Esterase/lipase
total genus 104
structure length 294
sequence length 297
ec nomenclature ec 3.1.1.-:
pdb deposition date 2009-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07859 Abhydrolase_3 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3l1jA00
4ROTA 5A2GA 2OCLA 3PICA 1QO9A 1QIEA 4Y2JA 1YAJA 4IH4A 4U2FA 3HC7A 3LIPA 2ONCA 5BWBA 5AK4A 5ALUA 3F67A 2J4CA 4OU4A 5ALWA 4MXDA 2J3QA 4UPDA 1XRRA 4PNZA 4B6GA 5IKXA 3GZJA 5FUMA 3H18A 3JYHA 1P0IA 1XZHA 4N5IX 2DR0A 1QTRA 4Y2UA 3VDXA 4G4GA 5ALGA 5DJ5A 2HU5A 5AK6A 2EDAA 1FFBA 2OAEA 4BAGA 3D7RA 4C4ZA 1U4NA 5AO9A 1CQZA 3G9UA 4LKOA 1DX6A 2QVBA 3STWA 4X00A 1MTZA 5HQ3B 3G9XA 5HKBA 3FWHA 1LBTA 1VE7A 2DHEA 2HFKA 3ICWA 2I3DA 5ALTA 5AOBA 5AI9A 4F21A 4QDOA 1K4YA 5HF9A 4NZZA 4RE5A 2ES4A 3ESAA 4OYLA 5EI5A 4HRYA 4GECA 4PSUA 3V1KA 3YASA 2C7BA 4WFJA 3V9AA 2XB6A 3U0VA 1M33A 5IVKA 5AKLA 3QPCA 4B9AA 5A71A 4HAIA 4EY4A 3QH4A 4PSCA 1XZLA 4P9NA 2WHRA 5EHNA 4WJLA 5JD6A 5CURA 3N2ZB 4DLNA 3I6MA 1CUJA 5ALDA 3ESDA 3FLAA 1UKAA 2HA3A 2GBCA 1THTA 3W04A 4GLBA 2RONA 1JMKC 1IMJA 5EIHA 1O6FA 4JYPA 2J3DA 1LGYA 3FSGA 2XUFA 1A8SA 4YASA 3MUOA 2FX5A 1CUUA 4G4IA 3GROA 1TAHA 1E3QA 1XZCA 2WIKA 4RPCA 3C70A 5HF6A 3H1AA 4DNFA 2EEPA 2FJ0A 5HQ3A 2HA5A 4WDRA 1LPSA 1YA8A 3F97A 1QLWA 2CUTA 1BCSA 5CBKA 4C6HA 1IUPA 2XQKA 4OB7A 4BCCA 2Z8ZA 1T2NA 1DWOA 4OB6A 4Q34A 1AUOA 4HXEB 3JW8A 2RHWA 4ZI5A 4LYDA 2Q0XA 3DD5A 2GYVA 3OTQA 5JZBA 1GGVA 2O7RA 3WYDA 4LIPD 4A23A 1AZWA 2HDWA 2CKMA 3I2FA 5AM5A 1QZ3A 4OSEA 3W06A 4QWMA 2HRQA 2HHAA 4UHBA 4BZZA 1I6WA 2QJRA 1LPNA 4DTCA 4L3WA 3I6ZA 1XLVA 2I3ZA 4QDUA 5JAUA 2JBWA 4BVJA 5A7GA 4D9JA 4BBZA 4BATA 5AKGA 5HKAA 3F98A 1CUCA 5IH7A 1QIJA 2B20A 2WUDA 4GWLA 1GQSA 4UHFA 2VAXA 2WFMA 3V1NA 4DSAA 4ZXFA 2H7XA 2ACEA 4TPKA 3ESBA 5AKZA 3G02A 3WK4A 4OD0A 5HK8A 2WLSA 3WKBA 4AN0A 3CCCA 5D6OA 4J0HA 3GBSA 4J03A 4Y2PA 4G4JA 1W75A 3WYNA 4V2IA 4IH9A 2O2HA 2WFLA 4KE9A 3L1IA 5DLPA 1XQWA 2BGRA 5SYNA 3PI6A 4IO0A 4BCBA 5ALQA 4FFWA 1GKLA 2BCEA 2DFPA 2HIHA 3I6YA 2QRUA 3OPMA 3MUNA 1CUZA 3BXPA 1FFAA 3BIXA 3WA7A 5JAOA 1QFMA 2Z8XA 1YS2X 5AM2A 1XRPA 1VLQA 4AO8A 2XUGA 2PU7A 1ZIYA 5CMLA 4W1QA 1USWA 1U2EA 1J2EA 1QONA 3UMJA 1UXOA 3AZPA 3OC0A 3IUJA 3E4DA 3PFCA 2VAVA 5DYWA 1IZ7A 2WHQA 4Y2VA 4OUKX 4NMWA 4HRXA 4G8DA 2WJ3A 3FNBA 3VVMA 1W6RA 2X76A 2ZVDA 4DNPA 4BP9A 2O7VA 1G42A 2JGFA 1H2ZA 3GELA 3NGMA 1T4MA 1UK7A 1QO7A 4BB0A 3DOIA 1MX5A 2QMQA 4ARBA 5J3JA 3FBWA 4QA9A 4UBMA 1NX9A 1N5RA 5AM3A 4GXNA 3IBTA 5ALIA 1JJFA 2GYUA 3Q8WA 3AINA 3VKFA 1ODSA 2PL5A 1QFSA 4XIIA 1G66A 1OCEA 1ZGCA 5YASA 1TCCA 4WFKA 1XZJA 2VJCA 4QZVA 3WWEA 1Q0RA 4E15A 1KU6A 4XX1A 5ALKA 4AZ3A 3G9TA 1EXWA 4FMPA 1TCAA 2AJDA 3SWWA 3ZV7A 2XUAA 3AIMA 5ESRA 1H2WA 5AK5A 3WL5A 1VA4A 3PFBA 1OXMA 2HU8A 2DHCA 1QJ4A 3R3UA 4MYSA 4X94A 1XRLA 1FJ2A 2FUKA 3R40A 3M81A 4AQDA 1WPXA 5AM4A 4X6YA 5K3AA 1MJ5A 4A5SA 1YA4A 2GBFA 2ZYRA 2XT0A 4KAJA 4Q3LA 5LIPA 5JIBA 2QUAA 5AOCA 4AO6A 2OXEA 2WHPA 4I19A 3ESCA 3TRDA 3SC2A 5C81A 4DSZA 4K6KA 3V48A 5AK3A 4W63A 3QPAA 3ZI7A 1G4HA 3C6BA 3I2JA 3R3YA 1JJIA 3PUHA 4CFSA 3CCBA 4FTWA 1SCIA 1DWQA 3D2CA 2WUFA 4KEAA 4DNQA 5DNWA 1CUFA 2ACKA 1X2BA 4AMYA 2JGKA 3LS2A 3O95A 1PFQA 2VQ6A 4Y2TA 5T4FA 1ZIXA 4HS9A 5JZ9A 3RM3A 4X6XA 2QJWA 3I1YA 3DYIA 4DIUA 4DNOA 4Q3OA 3LLCA 2WSLA 3I2GA 2WM2A 4L72A 3IUNA 4LXGA 1YB6A 5E4TA 1R9MA 3QMWA 2XDWA 5JAHA 1LLFA 4OCZA 4YPVA 3I28A 1W1IA 5HCUA 2V97A 1CIJA 4U2DA 4HTAA 3FYUB 3FVTA 4FFVA 1KU0A 1CLEA 4KAAA 2P8SA 4S0XA 5CT4A 4UFPA 2JGLA 5ALOA 4J3JA 1N1MA 4ZGBA 2H7YA 4X97A 3C5VA 1ZJ4A 5C8VA 4QNNA 5DTIA 4B83A 2AJLI 1DWPA 5EHQA 1BN6A 5AHXA 1HDEA 2R8BA 4H7FA 1E5TA 4EY7A 1WHSA 4A16A 4C4XA 4Z49A 1K63A 3X3HA 4W1SA 5JASA 2ECFA 3G0DA 3A2NA 5E2IA 4CCYA 5JALA 2R11A 3WKAA 3BJRA 1AQLA 2AJBA 4IHAA 5K3EA 4B0PA 3G0CA 5LKRA 4JUIA 2PSFA 2XMQA 3WWOA 3O4HA 3QBJA 2Y6VA 1UOQA 1BCRA 2I78A 3PDCA 4BP8A 5ALMA 3GA7A 3M3DA 3FOBA 1SC9A 3O9VA 3KDAA 4CG3A 2C4HA 1LPPA 5ALPA 4NVRA 5ALYA 4UBKA 1JFRA 5EHXA 2PSJA 1P0MA 4DGQA 4L9AA 3WKCA 1HBJA 1DINA 1LPAB 2B61A 5FP0A 4HZGA 2ROQA 2WU4A 1QIIA 4BC1A 2VJDA 1BE0A 2XMZA 4P93A 5HF5A 5EHZA 2WFZA 5AI5A 2B9VA 2ZJFA 4BC0A 3B12A 1VXOA 2I03A 5A6VA 4WY8A 2WUGA 3T52A 4B84A 1WOMA 3TJMA 1VOTA 4ZRDA 1MNQA 4BVKA 2GYWA 4MQMA 1THGA 3STUA 4XJVA 2OQVA 4J0GA 3WKEA 1K5PA 2IITA 2HA2A 3C87A 4CG2A 1UOPA 3WL8A 3K9BA 2OAGA 2WQZA 3WZLA 3C6XA 3FSGD 1UT6A 2G63A 2G4LA 3R3WA 3O4JA 2WIFA 4K6GA 5CT6A 3G0GA 1GT6A 2K2QB 2Y2UA 4ARAA 5FPPA 5AI6A 4ZV7A 1SOMA 3HSSA 4H35A 3F8SA 2AJ8A 3R41A 4DMHA 1ZD2P 4EA6A 1FFDA 4BTVA 5JADA 4MWSA 1LPOA 1D07A 1EDDA 1IUOA 3C43A 3HEAA 3RK4A 1XRNA 2XMSA 1UOOA 3PE6A 1Z68A 4QE3A 1QIFA 3O4GA 5DYTA 1VJ5A 1CR6A 4U2BA 1A7UA 4X6UA 3FCXA 5I7UA 3WL7A 2XMGA 4H0CA 2V98A 3QPDA 3WI7A 2JGEA 4AB1A 2CBGA 2H1IA 4XWGA 3JWEA 1L7RA 2VJBA 4C4YA 4KE8A 1TCBA 1SFRA 3HI4A 2OPHA 1RP1A 3TGLA 5ALVA 4I4CA 3O9MA 3D5EA 5FKJA 1C4XA 3IULA 2BKLA 4FOLA 3VJMA 4BZWA 2QS9A 2HU7A 5ALEA 1HLGA 1MU0A 1XZAA 3WZMA 4Q3KA 3PF8A 3D59A 2XUOA 4G5XA 2JEYA 1F8UA 1TRHA 4GW3A 4UBLA 1YAHA 1CPYA 1YASA 1CEXA 1BROA 3ICVA 4BE9A 5CH5A 5CT8A 1JT2A 2H9YA 4E11A 1J07A 4KJXA 1ISPA 4Y2XA 3EQ8A 4H7KA 5LZ5A 4PF1A 4BAUA 3BF7A 4P08A 2QXUA 2OLEA 4TGLA 2JEZA 5BWCA 5AIAA 3ED1A 3AIOA 5KWJA 5EIEA 3AILA 1EH5A 1X70A 3IA2A 3DDUA 3P2MA 2GZRA 4X91A 3DKKA 5DWDA 3NWOA 4F0JA 1CUXA 5CXXA 4ZWNA 1LBSA 2PBLA 5CXUA 4C88A 3DEAA 3HZOA 4M0MA 5D3KA 5LLSA 1LZLA 3R3XA 1NU8A 4JYMA 1MO2A 3EQ7A 4FLFA 3F9CA 1R88A 3H2GA 1UKCA 5AKHA 4Y2RA 1QIHA 3QMVA 1EVEA 3ANSA 2E3JA 3KWJA 3DL4A 2X5XA 2WHPB 1IVYA 1R9NA 4FNGA 4M0FA 4HXGA 5AI0A 2RHTA 2CZQA 1XZKA 2PSDA 5T4BA 3A70A 4EUSA 3G9ZA 4BE4A 1GPNA 2BUBA 4K5QA 3BWXA 1J1IA 3B5EA 4J0DA 4H7HA 2HFJA 1E8NA 4UHCA 5LZ2A 3RKSA 5I9IA 3H04A 3QMMA 3ZLTA 4J0CA 2FJPA 5DTJA 2VATA 4BTLA 5AH0A 1JU4A 1F0NA 5IVDA 5HF8A 1G5FA 1MN6A 5ISMA 1DTEA 4DM7A 3VXKA 4J0IA 1CQWA 1R4ZA 4CCWA 1CUWA 4C87A 3BIWA 3WLAA 4EY5A 5AIBA 1CUYA 4Y7DA 5IVIA 4BDTA 3H2JA 1ODCA 2Z5GA 4F60A 4FKBA 5A7FA 4ETWA 1ZICA 3FYUA 1BS9A 2PX6A 4YX9A 1QTIA 2XUQA 3FLEA 5LZ9A 1UZAA 2XMCA 4H7IA 4PSDA 2JF0A 3HACA 5LZ4A 1DU4A 5AKXA 5AKYA 5CH8A 1UKBA 1L7QA 1AGYA 5ALLA 1BEEA 1CUGA 4LXHA 2YH2A 1VE6A 1E8DA 2HA7A 1B6GA 3DNMA 3EIOA 4X90A 3M83A 4FDMA 3FVRA 3EQ9A 4CCYB 1GPKA 1R1DA 4J0KA 1Q84A 3LCRA 1LZKA 1ZGBA 4O08A 1C7JA 4H7EA 3S2ZA 2YXPX 5FV4A 3KD2A 1JJBA 1TK3A 1ZOIA 1QIMA 3OG9A 1QIKA 1HQDA 2CJPA 2RIPA 4H77A 4E14A 4Q1VA 3ZWQA 7YASA 3QM1A 2JGIA 2W6CX 1QE3A 1VA5A 1QOZA 3E0XA 3HXKA 3W05A 1GKKA 3IB3A 2XE4A 4INZA 2D0DA 1VKHA 1U8EA 3WWCA 4C89A 1WHTA 4WDQA 2ZSHA 1CUEA 2OGTA 4B7ZA 1HKHA 1EDBA 3AZQA 2XLCA 4QLAA 1QGED 4FWBA 1WB6A 5DYYA 3BDIA 5JANA 2VSQA 2GZSA 1RYYA 2G5PA 3WJ1A 3W2TA 5K3DA 6YASA 4EY8A 1ORVA 3A2LA 4GDMA 2RAUA 5CT9A 3VJKA 4N8SA 2XQFA 3VISA 1XZDA 1E8MA 1EK1A 3QYJA 4J7AA 5CH3A 4OPMA 2G5TA 1CV2A 1LPMA 1ZI8A 5ALXA 4UHHA 4KE6A 5C8XA 3TEJA 1A8QA 5BOVA 1AKNA 3DQZA 4Y2QA 3RARA 5KWIA 1EHYA 2PPLA 1IZ8A 2VA9A 3EBLA 3C8DA 3WK6A 2LIPA 4Y2YA 1JMYA 1EINA 2WJ4A 5CT5A 2JGMA 2C0QA 1IUNA 3HYSA 5HK9A 2XLBA 1CFJA 3SK0A 4BYMA 2V9ZA 2QOEA 3E1GA 1CVLA 4ITVA 3DYVA 4N8EA 1DQYA 4FBLA 2DCMA 2WUEA 5EIAA 5AJHA 2XUIA 5LZ8A 3GFFA 3IDAA 3AUKA 2XUPA 3DKRA 2QKYA 3C8HA 2HADA 5F4ZA 1J06A 4KYVA 1F0PA 2ZSIA 2HA0A 2QM0A 5JYCA 2YYSA 3WK7A 4M0EA 3KWFA 3OM8A 3B3QA 2WG0A 3CXUA 4QEKA 5FOQA 4FHZA 1XQXA 4DMCA 1K8QA 3H17A 1B41A 2C5GA 2EDCA 1GPLA 4WCVA 1EB8A 3K2IA 4G9GA 1PJAA 1XRQA 1TQHA 3UUFA 2XI4A 1MNAA 1XQVA 4H7JA 2JIDA 2Y1KA 2DSNA 3HLKA 5LP1A 5ALFA 5EGNA 2OCGA 1JKMA 2ZYSA 1ORWA 4PO3X 3FYTA 1RWQA 1XKTA 3DJYA 1BEZA 1CRLA 4X71A 3WQHA 1DT5A 3E3AA 2B4KA 4LHEA 3I1IA 3MGAA 3FAKA 3STVA 3K6KA 4QDTA 1F6WA 3LP5A 5ALRA 1U65A 3WA6A 4X7BA 2PUJA 3STXA 3AIKA 4B80A 1AMNA 2VF2A 1OILA 2WTNA 4I3FA 1UFOA 2RGUA 2V96A 4Y9SA 3I2IA 1MX1A 1XKLA 2W22A 4AO7A 1MPXA 2HL6A 5AI4A 4X93A 2OCIA 2J4FA 4N8DA 1EI9A 5KBYA 3IURA 1ZI6A 1XZBA 2WFLB 4CIAA 3ANTA 5FDFA 3QZUA 1CUHA 1GZ7A 4AZ0A 1HPLA 1GXSA 1P0QA 2Y6UA 4G8BA 1VZ2A 4P92A 3D0KA 2XUKA 4KR0A 3H0CA 4GEGA 2WTMA 2PVSA 3AFIA 5ALJA 4EBBA 1LPBB 3DOHA 2AJCA 1UK6A 1R3DA 4BDSA 1LNSA 5KREA 1H2XA 1GQRA 2C58A 5K3BA 1FFCA 4Q82A 3BJMA 3WKDA 4B9EA 2CMFA 4U2CA 5AICA 1VXRA 4UBOA 5A7HA 3H1BA 4BAZA 1TKRA 2XMRA 4PQEA 3QVMA 3H2IA 4AX4A 1Q0ZA 1HL7A 5CTAA 2BUAA 1SCQA 5AKIA 5FPQA 1KEZA 4UBIA 1H22A 3HJUA 2VTVA 1CUSA 4C01A 1CUDA 1SCKA 1ETHA 2VEOA 4AN1A 1Y7HA 4GI1A 1YSCA 1E66A 2WKWA 4YK7A 4Q05A 3F96A 5ALNA 1MAHA 3NUZA 1XZEA 4B82A 3PUIA 4U2EA 5DNUA 1CUBA 2XUJA 3OURA 4EY6A 3BF8A 4QDXA 4N5HX 1EX9A 4X92A 1EK2A 5AP9A 1XZGA 1N5MA 2C0PA 5CW2A 4B81A 2PU5A 3DS8A 1ODTC 2XUHA 2BAGA 3HABA 5LYYA 2PSEA 5LZ7A 3R3VA 4CI9A 2WIGA 2Y2VA 3IUQA 4U2GA 3G0IA 1PV1A 1W52X 3D2AA 3WIOA 4AXBA 3WK5A 3IUMA 4QDZA 1S8OA 2O2GA 3C6ZA 2XMDA 2JGJA 5K5EA 4Y2SA 2XQGA 2VT6A 1XZFA 4CG1A 5JD5A 2HA4A 1XZMA 4MEBA 5C8ZA 1EB9A 1JI3A 3LIIA 4X95A 3STTA 1W76A 1XROA 4G9EA 3D3NA 3ZLUA 2WG2A 3WJ2A 4KAFA 4MQLA 1XFDA 5T4EA 1C7IA 2GBIA 1WCYA 3V1MA 4K6HA 4WY5A 2QTBA 2PM8A 1R50A 3T4UA 2AXEA 3AZOA 3DLTA 3PF9A 3WMRA 5ALHA 3D2BA 4OU5A 2BFNA 3I2KA 1H2YA 5HZGA 1XLWA 1VZ3A 2X8BA 4FNMA 3U1TA 3Q0TA 3DL7A 2ORYA 1ZD4A 3S8YA 1DX4A 3GUUA 1BN7A 4UHDA 2PKYX 4HXFB 2QUBA 4WFIA 2Z3ZA 5E4JA 4ZREA 3N0TA 5ALZA 4UHEA 1ZI9A 2HM7A 4BRSA 3CN7A 3MVEA 3WK8A 5D3ZA 1TIBA 4QWWA 3W9BA 5CRIA 3G7NA 2WIJA 4CIBA 3WWDA 1XRMA 4MJ3A 5HFAA 4OYYA 4BRZA 4RE6A 1MAAA 3VJLA 4FBMA 2XUDA 3WWPA 4LYEA 1CUAA 1YCDA 4IQ4A 1MX9A 1WB5A 5E4YA 5DNVA 1E89A 2DHDA 5H3HA 4B85A 5FRDA 1A8UA 3O4IA 3NOXA 1FFEA 4FLMA 4GBGA 2H7CA 2O2IA 2UZ0A 1JU3A 1K6EA 1ACLA 2PSHA 3W9UA 1EVQA 3FYUC 5LKAA 1X2EA 1BRTA 4ZV9A 2WG1A 1ACJA 2OG1A 5JAPA 1XQYA 4E46A 2YASA 4QLOA 3QITA 2D5LA 5JD4A 4W1RA 4KE7A 3HRHA 5I8PA 1BU8A 1ZD3A 2DQYA 2IIVA 2VT7A 5AM1A 1QIDA 2OCKA 4NS4A 2XMBA 2HA6A 1H23A 4PV7A 2OGZA 1FSSA 1AX9A 5K3FA 1WB4A 4PW0A 4UFOA 3L1HA 4EHBA 3V1LA 4EB0A 4X85A 4DMFA 4G8CA 4MEAA 3I2HA 4UBNA 2QXTA 4DYHA 4IH1A 3G8YA 1MT3A 4DMKA 3H19A 2ZJ7A 3G0BA 5C7YA 3IVMA 5HFNA 2NW6A 1P0PA 4HVTA 2XQIA 4W1PA 3DCNA 2GBGA 3D4LA 4EZIA 2IX9A 3EF3A 5JZSA 4X3CA 1O6GA 4JEIA 1YS1X 5T4HA 5K3FB 4LXIA 3L1JA 1DQZA 2WJ6A 3CN9A 1AURA 1L7AA 2CEKA 4J0JA 2OQIA 2XQJA 2QT9A 3H2KA 3ZLVA 3C45A 1AC5A 4KRXA 3IIIA 5AKJA 1NU6A 2OGSA 3WIBA 4F5ZA 3BE8A 4TVKA 5JATA 2ZYIA 1CUVA 5EFZA 3WK9A 1Q83A 3AJAA 5K3CA 4KRYA 2BGNA 3H2HA 2WILA 1Y7IA 5JARA 1WPRA 3FCYA 1UK8A 2QR5A 3C6YA 3RLIA 3SX4A 4RGYA 3KXPA 3UUEA 1UWCA 4AMZA 2ZYHA 2BUCA 4XVCA 3ILSA 2WU3A 3VVLA 4L0CA 4GHWA 1YB7A 3FLBA 4MYDA 4FLEA 1UK9A 2CB9A 2RI6A 2Z3WA 4BVLA 4UUQA 3STYA 3ZPXA 4G1FA 3OOSA 4W9RA 2WIDA 1XLUA 2ZJ6A 4H7DA 5AI8A 5D7BA 3A2MA 1Y37A 5FXMA 1EDEA 3O0DA 5AKEA 4MWTA 1XZIA 3KOOA 4RNCA 2QZPA 2VJAA 4UFNA 2PUHA 2C5FA 1QIGA 2DQZA 3KSRA 3R3ZA 5BV7A 3C5WP 4KACA 5AKKA 1YR2A 3M82A 1DT3A 4K2AA 3BL8A 4UBJA 1ZD5A 1CUIA 5A62A 5IVHA 1N8SA 3BDVA 3A6ZA 5AM0A 1WM1A 4JNCA 1W4LA 4OB8A 4B0OA 5ALSA 3WL6A 3R0VA 4JH0A 4BCDA 5AOAA 2BJHA 4H18A 1ZJ5A 2HRRA 5SYMA 1A88A 1EA5A 5FLKA
chains in the Genus database with same CATH superfamily
1M7BA 1TOAA 1G0OA 1JLSA 1Z2DA 4HF7A 3LK6A 1H42A 4QTZA 3BORA 5A2GA 2OCLA 1GLGA 3PICA 1QO9A 5IM4F 4Y2JA 4X61A 4U2FA 1X15A 2W48A 4F5EA 1QF7A 2J5BA 2QR3A 1MOQA 1XTKA 5BSFA 3LIPA 3JYQA 4O2AF 3ZE6A 2C99A 2XGOA 3WADA 5TXGA 4ABTA 1CIPA 3MMSA 4YCAA 5ALUA 3AF4A 4FT4A 1CULC 3REQA 3UWOA 4OU4A 1WLYA 2OAQ1 3EC2A 3VOTA 4QHYA 5E1DA 5ALWA 4H6WA 4MXDA 1YB5A 1CLUA 4FGLA 3LZDA 3NB0A 2J3QA 4AZ0B 5LOVB 5HRAA 3ZY2A 1D09A 1ZD1A 3O2QB 4B6GA 4RF5A 3O83A 1SXIA 4O59O 3VZBA 1GDHA 1LS1A 1RCFA 4TTIA 1QGDA 4RPIA 4DLLA 3JYHA 3QGMA 4D9MA 2BZGA 1RMYA 1YBMA 4I4IA 4QICA 1XZHA 5H70A 4S2EA 1UMKA 1IN8A 2AFIB 1UZNA 1AE1A 1BXGA 2B6NA 2B7BA 5EWLB 4BVGA 3D1VA 1U0HC 3AHCA 3L5KA 2IZ0A 1AXEA 3DBLB 3VNBA 1PKXA 1SKBA 4IYRA 3A26A 3LOPA 2R3SA 5G4KB 1TQ6A 3TD2A 4BVFA 4CM1A 2DPLA 1Z5OA 4XI9A 1HYHA 1A5ZA 1PQWA 2PUEA 5BT8A 3K31A 3QOXA 1V71A 2LXNA 5IXSA 1FVXA 4KTTE 3GLFA 4P0TA 3D7RA 4C4ZA 3RSHA 3ADKA 4YRFA 1U4NA 1TCUA 4PICA 1RYBA 1T36B 3KKPA 4KAXA 1B26A 1ZC3A 4RHEA 13PKA 3RV3A 2AR9A 1UC9A 4U9UA 4ZQFA 5KQGA 3IT3A 2HXYA 1CS4C 3FMGA 1XTZA 2QVBA 3STWA 3SZ3A 5FOSA 4OL9A 2RGRA 5FQOA 1SHZA 1V95A 3BMQA 3G9XA 1DRUA 5HQ3B 2ORWA 3LOUA 2PPVA 3JYNA 3ZCRA 3BMCB 4D3XA 1TAUA 4G5OA 4G8JA 1F06A 3ZK7A 4CMHA 1OFHA 1P1JA 1D0VA 3HY4A 5ALTA 1I2MA 4EENA 2QZZA 2CL0X 5AI9A 2X4GA 3MQFA 4BGEA 1ODIA 3PUYA 3WNDA 1AZTA 4BFVA 2ZVPX 1N9KA 2B2CA 2CW5A 1K4YA 5BQOA 5FI5A 5HF9A 5TQ2A 1NDQA 3K09C 4NZZA 5J40A 4I5FA 5H4GA 3QEMA 4RE5A 1WKVA 1EXMA 5IANA 3A06A 2PL9A 2MMCA 1JHZA 1UJ2A 2FH5B 3H1EA 4HRYA 4J7UA 2PYZA 4GECA 3HTXA 1P2VA 4OBEA 3GX1A 5JSZB 3Q4GA 3UXMA 3IQWA 2V03A 1ONNA 4X24A 2V45A 1OPXA 2VXYA 2XB6A 1OBCA 3VPSA 1M33A 2VHVA 1A5TA 2YRXA 4OHKA 5HSGA 3Q8LA 2J09A 2WU1A 4JY7A 1AGRA 1LW7A 3GEGA 3A1DA 3C14C 2F8TA 2HIAA 2ZXEA 5CXSA 4WACA 3JR7A 1VYHA 1T9HA 3AEKB 3GLQA 4HAWA 1YE8A 4FFSA 4EY4A 5SZHB 4E4YA 2R25B 4CQMB 1GZDA 4BQEA 1C7QA 3RVMA 2H18A 2Q0HA 1DX9A 4F6RB 2JCGA 4RTMA 5ETJA 5DISB 3N7AA 4EWLA 2WNIA 4GX0A 4IGFA 3V6MA 1UODA 2WPDD 3QBEA 1V41E 3SEZA 1H6BA 4MUHA 4TZ0A 2H0RA 3NCHA 1M2FA 2E0IA 4XOUA 4WJLA 4I1PA 4U00A 2SKEA 3QEMB 2XCIA 1ESMA 1YQGA 2VXBA 1GGJA 5CURA 3R5KA 1RM4A 3WB2A 1OROA 1X8LA 2YBDA 1SBHA 1Y4UA 2CCGA 2OD7A 4RVUA 3K5WA 4B6JA 1F17A 2QQGA 4D42A 2HA3A 3NRBA 4NBTA 4B33A 4ZYTA 1M0WA 5CFQA 5JSZA 1MORA 3DDSA 1I1OA 3W04A 4GLBA 4D98A 2JNWA 5LQUA 1EFHA 3QU9A 1MQAA 4F3CA 2EZTA 2GEUA 1JMKC 1O7JA 2WV9A 3U13A 1XVLA 3D6NB 2PD4A 1I5EA 3PHCA 1M0SA 3SZGA 2Q49A 4DOMA 2V8OA 5HQJA 4B87A 2AEEA 2IIBA 1LGYA 1JDZA 2IHZA 3FSGA 4PTZA 2P9ZA 2NPFA 3X44A 3KQNA 1BVRA 4CM5A 4CQMA 1W0JD 4Z7QB 4DEYA 3VA7A 1ZBQA 2AZXA 3LM8A 1MO4A 2CDBA 1ZIOA 2PGNA 3G49A 3AW9A 1JYSA 4IIDA 3F6RA 4DDKA 3N3BC 4UVGA 3B7WA 3SBDA 4YLGA 1PZFA 1KYTA 5COBA 3DLCA 4ESOA 5IYZF 2BH2A 1P91A 1ZDMA 2FMTA 4KQEA 1RYDA 3MSCA 2PLWA 4RJKA 1SU4A 4BGDA 1EX1A 1AJEA 2WIKA 1JWBB 1VBMA 4G0OA 1FYEA 1II8B 5KDDA 3EG5A 4QPJC 3ITEA 1MEOA 4I1OA 3V2UA 4CM8B 1JKFA 1GL7A 2X0NA 3AU9A 1RYMA 4JBWA 1U5BB 2CXSA 3E9NA 3UAYA 4QSHA 1ADYA 1UMCB 3F97A 3BGIA 3GRFA 4JJFA 4HMOA 2QV0A 3C6KA 3IQGX 3OP1A 4EHIA 3T1HB 2P68A 4D92A 1O5IA 2JAUA 1C9EA 4CJXA 3EAFA 3SLGA 4IIXA 5JXGA 1NF2A 2VI5A 1I3KA 4OEHA 4AT1A 1RIFA 3TSZA 3E7FA 3HKDA 2HDHA 2YYAA 1ZMOA 5FWAA 3QELA 3TIGA 1DWOA 2I1VB 5B4UA 3WV4A 3EWNA 5CVUA 3WFZA 1TUIA 1ECBA 4ON9A 5FLYA 1EGAA 2QN2A 2X4DA 5AW2A 3VNRA 4MVJH 4WK2B 1EQAA 4FW9A 2PE5A 4UTVA 5MGBA 2RHWA 1Z6ZA 3DDHA 3R24A 4ZI5A 3RDPA 4DIMA 2WTUA 4B6RA 2Y68A 1SR8A 4ZVNA 2CBZA 1E5VA 4KXWA 1SKMA 3TBFA 1I2AA 1RAFA 2GYVA 2V0CA 1T24A 3OTQA 4A8JC 2YJ3A 4CIYA 1T0PA 2LP4Y 3FVVA 1QKIA 1PBTA 1PVDA 4LIPD 1LD3A 4A23A 1CJUC 3A4MA 3KOYA 2CDCA 1W44A 2CKMA 1QZ3A 5AM5A 4LF5B 2EBFX 5A6SA 1MGOA 3RQSA 1WULS 3RODA 1DBVO 3P27A 2IDZA 1GYQA 2K6GA 4UHBA 4QRDA 4Q7QA 3V6LA 4BZZA 4DEVA 1A4RA 2QJRA 4GX5A 2CWDA 4TKVA 4TXLA 5EJ5A 3KB1A 5B7PA 4CEIA 3E82A 4XTCS 3MRVA 2X1VA 4ID9A 1FZQA 3VR1A 2LCIA 1PR4A 1M72A 2XPCA 4D6XA 4BVAA 1GQ2A 3I6ZA 4M21A 3RVQA 1UBRS 1NFQA 4MQEA 5KOJB 1NATA 4LDPA 5FD8A 1L3IA 1NA5A 4EFDA 2WNHA 2O7SA 1H0KA 2HDNB 2WF7A 3GQBB 3NQ41 1O96B 3HJFA 2QVCA 3MT0A 2YUTA 1ULHA 3L6RA 4MVJF 1MZVA 3PC7A 1GTZA 3RI3A 4BBZA 3IPYA 2BFAA 4MWDA 4FGJA 5CB4B 1AK1A 4D96A 3MBKA 3AEQB 3IV9A 4WNAB 4WAUA 2VRBA 1OC4A 2B20A 3OLYA 5IG2A 3HNPA 3C3KA 1L1EA 2PFSA 3GZ4A 4ZHQA 2PT7A 3RNOA 4RH1A 5E9WA 1DUIA 3QA9A 4D80A 3CVVA 1QRTA 4NU5A 3V1NA 3A9RA 1YF3A 3AT1A 1J00A 4KN6A 1IBRA 2FFQA 1MPTA 2D0IA 5CVEA 5EMLA 2H7XA 4B4DA 2A5JA 5B3LA 1SC4A 3EDRA 2ACEA 2ZETA 5JVDA 2WZCA 1A96A 3DPIA 1SBZA 3ESBA 3KUKA 3H4TA 4PS0A 3ZQ6A 4GRAA 3DZBA 1VMEA 2VHUA 2FPIB 2QTAA 3V9PA 4OQNA 4G5FA 2D3WA 4LX0A 3ETGA 1P9OA 3P8ZA 1DFIA 3ZGLA 3NFRA 2VBFA 4B6QA 2HNKA 2Y9MB 4B32A 2ZUFA 2W6QA 2JLBA 5D6OA 4DIFA 4FYIA 3GBSA 4UATA 5I47A 1WZ2A 2PX3A 2VK1A 1TIKA 1VPLA 3SHQA 3K1YA 3L93A 1NF9A 3ZBUA 4RD6A 5HCNA 3WYNA 4V2IA 4JJAA 3MTBA 1KNQA 3U7QB 1NONA 3PENA 1U31A 3LXRA 1IRXA 3H3JA 2BGRA 1KTVA 1WEHA 2JCYA 3TTUA 3PI6A 4BNZA 4IO0A 2RH5A 4RL6A 4BCBA 2JFZA 3B8HA 1Z0KA 2Q6OA 2ZJBA 5ALQA 1JSLA 4FFWA 5HKLA 1W0JA 2J67A 2QL6A 4EA7A 1GKLA 5KS2A 2ET6A 3I6YA 1HQKA 5JRZA 2DVMA 3MUNA 3LHIA 2VDWA 3MEQA 4EMTA 4G0UA 1GPBA 1L5OA 1VSTA 1CUZA 2ODBA 1KQFA 3F0TA 1DKUA 1P9WA 1P0CA 1V8ZA 3WA7A 1EM8A 2OZEA 1R16A 4ND4A 3RS4A 4BMPB 1U5CA 3AR6A 1VLMA 2CLDX 2JI9A 3LHSA 3SHFA 4E13A 3ME5A 1NXSA 4C4AA 2YWJA 4MVJP 4TRRA 3DTYA 3N7UA 4QODA 4X1IB 1OYVA 5CBKA 2J5KA 3TL3A 4AO8A 1E96A 1ZUIA 2PU7A 2BGLA 1IHUA 5SYAA 1L7VC 4B35A 8GPBA 4JUAA 4FZJA 4PIVA 4UPEA 3RS9A 3B3FA 5DHAA 4MGIR 3TNLA 1U2EA 1EFLA 1VJRA 3RRNA 3RVKA 1QRDA 3RUCA 3WR5A 5DMHA 1VJ0A 4P86A 3SVLA 1VP9A 1MRZA 4C78A 3FNEA 3AZPA 1N78A 1PW5A 1YZTA 2KBEA 1NLFA 3IUJA 1MJNA 5IH3A 2ZFUA 3LY7A 4MRNA 1C9MA 3OZRA 1Y9DA 1EJBA 4I6JA 2QG9A 2EKZA 3LVRE 3RHFA 4FMCB 5FUQA 2FEAA 2HJSA 2VAVA 3EEBA 4ENQA 1PT8A 4PC1A 1KIMA 2YJ5A 5AD1A 3KEOA 4YHBA 1FMFA 3O1HB 4MKRA 3SD7A 4Z3OA 4WLUA 4DQKA 3VJRA 3QY0A 3HNRA 4UC0A 2HLHA 4HRXA 4AZTA 3JQ7A 1W6RA 2V7VA 3QIVA 4QQRA 4BQSA 4E5NA 3U48A 3ZHBA 4RTQA 1EJ2A 1C50A 2X76A 3BWBA 3DM9B 2ZVDA 3HSYA 3ASYA 1KO4A 4QUEA 3L1VA 3WYAA 4DNPA 5DI9A 3DVAA 2ZIGA 2FE4A 4MUMA 1CRPA 3CRMA 3WHPA 1NLUA 3H86A 3H84A 3AEKA 2NTEA 3NAMA 3CRW1 4MTLA 3QW4B 3NVDA 3NGMA 5EJAA 2BT4A 1M1NA 9GPBA 1RE1A 2XCSB 2C4VA 2L0XA 4G5YA 4WJZA 2J0UB 4G37A 3EGOA 2CLIB 3TX2A 5J3JA 1M2VB 2O5CA 3GLFB 4QA9A 1RJFA 3ON5A 5CDSA 3K0HA 5F5LA 1PNOA 3UJCA 4OGFA 3S28A 3ECCA 3UWDA 5JE8A 1RYNA 5DMXA 3BC1A 4OHOA 4JP3A 1DJLA 2AC4A 1JYEA 1RLJA 3OX3A 4XX0A 4YGXB 5JS1A 4JC0A 3VR2D 3QYFA 4GXNA 4B7UA 5AM3A 3M5DA 4IDCA 5F4BA 1XELA 3Q8WA 2C9MA 4KU4A 3EUWA 1L4YA 2OBBA 3G85A 3D1JA 2ZQYA 2FEPA 4WOBA 4L2IB 2R7LA 5F35A 4UDOA 2CV2A 1AT1A 4Q4AA 3SMQA 3LQ1A 5LP6C 3HO8A 1E5XA 1OWLA 3FPAA 3TR0A 4L9WA 3AFOA 2PVCA 3KJEA 4EEKA 1EFVB 5IT9A 2IHNA 4M7PA 5CDYA 1IEQA 1FNMA 3KT3A 4KHZA 2NV6A 2OKGA 2FU5C 3QBTA 1YBVA 4CTOA 3QX3A 2CL6X 2EQAA 5E2AA 1UBEA 5EPOA 4GZ6A 4EABA 2HQBA 3BGDA 5DH9A 3N2GB 2LKCA 3TB6A 3BFPA 1JG3A 2O9JA 3EDOA 1R6XA 3ROKA 1ZS9A 4JI5B 2ZJ5A 4FDLA 3G9TA 4DJAA 2DC1A 4XM0A 3DGEC 1VSBA 3IHWA 5A0FA 3VKHA 1GRCA 4LPSA 3DVRX 3UK0A 3CGGA 3MHPA 2CHEA 4J1SA 1SOVA 5DM1A 5KNBA 4PO1A 3WL5A 3PFBA 3B6ZA 3PJRA 1OXMA 3AB8A 3GGOA 3GYGA 3HVHA 3OUUA 2WJYA 1ANKA 1NIJA 1YR6A 3OJXA 2VTBA 2X2FA 3AG5A 1WY7A 1UC4B 3DWIA 1NURA 1C0LA 3LP6A 3UAWA 3L8MA 2W2MA 5JNTA 1TLLA 1RZUA 3EDQA 2XCOA 2AMYA 4BASA 2YFYA 4LE1A 3WGGA 1B76A 1W47A 3M81A 2PS9A 4F86A 2PWBA 3R23A 3EXFA 3AETB 2BLLA 1QYDA 2QUJA 1NOIA 1GPAA 2WYOA 2ZSEA 1BJKA 3IEUA 3EXHB 1ZWLA 4A5SA 4D8YA 4ARUA 3IAUA 2IXEA 3OZGA 4BV9A 1OFGA 2ZAOA 3KALA 4KAJA 3GEDA 4Q3LA 5PNTA 3QLUA 2GEDA 1KI9A 3ZU4A 1FTYA 3RLFA 5JIBA 5LIPA 4NCIA 4AO6A 3W2GA 4P84A 4QDKA 4I19A 3LCMA 5T41A 4G9BA 4WFQA 1MJFA 4QL3A 2FVYA 4UEJA 3UJDA 4NOKA 3TNYA 1IPFA 3SC2A 4WOJA 2OV8A 1UJCA 3AI7A 3TNJA 3TFWA 4EJSA 1E1YA 2ZVJA 2HYIC 1Y3AA 3GDOA 4EF5A 1NGSA 1Q21A 2AHRA 4K6KA 2GM4A 2ZYUX 4G1MB 2FWNA 4G4SP 4K0KB 3GI1A 3PUWA 5LU9A 2PTGA 1SCAA 5HOQA 1G4HA 4NQRA 3L82B 3B1YA 1OBVA 3C6BA 3I5YA 1H1DA 3I2JA 4P80A 3R3YA 1JHVA 1L4FA 5L4LA 2GF9A 1MW9X 3MWJA 4YT2A 4E5PA 4R5MA 3IXQA 3JWIA 1QPZA 1B16A 1X39A 3KOWA 4Y6PA 2GF2A 3SIXA 1ZBDA 4BVHA 1O1YA 4P4NA 1TTTA 1N0WA 2Y92A 2YW2A 2HMVA 2YHIB 4KREA 2G71A 3PI7A 1TVKB 2WUFA 1RQRA 3FPCA 4QQ8A 3RUHA 3K9NA 1A71A 1NR1A 3PFIA 4UDNA 2VHZA 3LQRA 5DNWA 1AV7A 1X2BA 1GGHA 1RLOA 4AMYA 4ETIA 1XWIA 1QQ7A 1EZ1A 5FR2A 1MABB 1JLKA 1PFQA 1ZRMA 3DUWA 3B13B 4OXYA 3IMFA 5T4FA 4YT8A 2HZBA 1Y8AA 5EWLA 2GN2A 5JZ9A 1KETA 4JUBA 2MSLA 3E3OA 3RM3A 3VKGA 1GG9A 5C9ZA 4PLPA 1ZM3A 2CNNA 2M32A 2OP1A 1V2GA 1BMTA 4B46A 1Y6GA 2GSDA 2Z4TA 5BV8A 1H93A 3SSNA 2D62A 1KAEA 1KMCA 4DNOA 4AY6A 1CQPA 5DXFA 3T6KA 4Z4HA 2J07A 5KVVA 3AVXA 3UWPA 2DUNA 2QEQA 1R4NA 2C9YA 2ODPA 4YAKA 2WM2A 1JPUA 2I8LA 2ODWA 2ORVA 3GZNA 3IUNA 4AJKA 4ENRA 5LMCA 4C0JA 3N0XA 1Y81A 5B4TA 3CUUA 5FLEX 1MB0A 4MRAA 3IAAA 4RKYA 5G1PA 4REQA 2IWHA 5E6UB 2WA1A 3C3DA 3SXPA 2V1XA 3EVFA 5BQXA 4D7AA 3IP7A 4YPVA 2RAPA 1WUJS 5THKA 3B51X 3U0BA 5HCUA 1ITZA 2IVZA 3BJIC 1CIJA 2YN0A 5FBQB 1QF6A 3BB4A 4U2DA 3ESXA 4GT1A 4HTAA 1BHO1 3FYUB 1HV8A 3FVTA 3R6TA 4I1RA 1G6KA 1DKRA 1CLEA 1KU0A 5A5GA 4KAAA 2Q45A 4CBVA 5DT2A 1AK9A 1VFPA 1KMHA 3G9QA 4S0XA 1J9ZA 4UHJA 4KVFA 4UFPA 3HS3A 2ODTX 2ISQA 4RVSA 1N1MA 2F3SA 1I6KA 2XQVA 4HGZA 3M4XA 1VE1A 1ZJ6A 1V25A 1L9XA 2HREA 2H7YA 2GJ8A 2MSEB 3AWDA 4LHWA 4LRSB 3TW8B 5FI0B 4N0DA 2PJRA 1I6LA 1I1NA 3C5VA 3KQOA 3MTEA 1P2FA 4NR0A 3AFMA 3CRVA 4JXZA 3EMKA 4HDSB 5ED4A 1U8ZA 4KFSA 3WQBA 3W5AA 5TQ0A 5BP7A 4AVYA 2I2BA 4B83A 2AJLI 5LWHA 4PPNA 4ESEA 4Z1MD 5AUNB 3BQ9A 3IIJA 4DMGA 4S1VA 3A3KA 3DB1A 5CYFA 4D82A 3P4YA 3HXTA 2XEXA 4TV9F 4QJ5A 1RQXA 3RJ9A 3GZNB 4DUGD 1GFIA 4II7A 1ZM2A 4WN3A 1Y1LA 1TD9A 5BYJA 4Z49A 2GEVA 4YR9A 1P2UA 1NXPA 3N8KA 2ECFA 3ZGZA 3X1WA 4HEQA 1JT9A 4ER6A 2QLLA 4CCYA 3C7TA 1GT91 4X41A 1HSOA 5DHPA 1NPTO 2R11A 4BUZA 4FD2A 3V8BA 1ML3A 1TTHA 4U7TB 1IN5A 5B3AA 5C2JB 5K3EA 1OYWA 1XZPA 2IXDA 2P9HA 3I5AA 3THSA 1W25A 1TLFA 1GYRA 4L95C 2QTRA 3FZYA 4D4MA 2GEBA 1I4LD 4YQYA 5EXDA 4ER5A 3JQDA 2SCUB 1VLJA 2YHBA 3TZ6A 2XZPA 5KHOC 2V0GA 2J6CA 1PE0A 4ALJA 1GTSA 4GI5A 4PG7A 3O4HA 1R18A 4DKXA 2QU8A 2ZRDA 2REQB 1ISGA 3R2JA 2FDCA 5KOHB 2PY6A 3Q3GE 4P5EA 4WXPA 4ND1A 3C3BA 1P6QA 3PP8A 1KR5A 4PG4A 4V0LA 5A4JA 2I2FA 1HEIA 3IOCA 1XJCA 3PNBA 1J33A 4FGKA 1LX6A 5DLYA 1XR3A 2O0JA 1NBME 3ENNA 3ND6A 4DIBA 1PHRA 2WM8A 3HJBA 1A2BA 4MLPA 3HNOA 3DBHA 3EVZA 4G5RA 4HGRA 4Q03A 1BWQA 5CVVA 1X14A 2HH9A 1HE3A 2QQ0A 5HX7A 3II6X 2B3TA 4R1SA 1E6LA 1F38A 4YRPA 3M0EA 4B09A 2JCXA 1LPPA 1YUNA 2PNFA 5DHTA 2E48A 1VI5A 5DCYA 4U5XA 3RSLA 4LVCA 1AHIA 2PLRA 3GWGA 2REXB 1XLTA 2E89A 3QMPA 3QXHA 4QYIB 5E95A 1R0BA 4K9KA 4AG5A 1RZRA 3NLLA 2DUWA 3OECA 4Q7KA 2PSJA 2DBVO 3IUEA 5IDVA 3D6MA 3ZHXA 4YV2A 4RTJA 1KOGA 1KZYC 2QZ4A 4DGQA 2UZ3A 4HN2A 2BFPA 4CF3A 2ZRLA 1KSFX 2V7TA 1AKEA 3AI1A 3RFFA 1R6AA 1XDZA 1XOIA 2A9OA 4BYGA 1DINA 4EPTA 5EZYA 4BEBA 1QZUA 2HX1A 1SD1A 2WYVA 4ZT6A 3MTQA 4ZYWA 2VCHA 3BZWA 1NUHA 2D3TA 5LQRA 1QIIA 1S7GA 4OUDB 4QREA 1R12A 2VJDA 3OF2A 1K3UB 1BCRB 1KMHB 2XMZA 1CVRA 4NSNA 2BEUB 2AXQA 2IUUA 1T26A 7MDHA 1ENZA 2EWMA 3AL2A 2GGSA 1Y1TA 3KPYA 1Q2XA 2R8EA 2B9VA 3H7AA 2RI0A 2BMAA 3FMFA 2IA5A 2NT4A 3ETJA 3OEHD 4P3NA 4Q3AA 4YIHA 3IHTA 4TXJA 3VSBA 1UDCA 4BC0A 3MB8A 2P6UA 4GUAA 4BNMA 2G6BA 2GCOB 1OZFA 4FW8A 4RXTA 4UPVA 4K9LA 1VXOA 1Z5UA 2EU8A 1GTMA 2X13A 1YC5A 3K1TA 1Q0QA 4TWZA 3K1AA 3CF6R 3VTFA 1C0PA 2M6SA 1BMQA 3W7VA 4UE6A 1RYZA 5CAEB 3T52A 3NHMA 2I8AA 4LECA 4N4AA 2CHFA 3B3GA 4GR4A 2FEMA 5BW5A 3OU7A 2O3QA 1I7NA 2A3RA 4KZPA 1VL2A 4M9QA 2GYWA 4BVKA 2OWEA 2WE7A 2NACA 2AVNA 4N7JA 5K01A 1P17A 1DLIA 1NXOA 4Q4DA 4Q4JB 4JYAB 4GOMD 4IIYA 4ASUA 3STUA 3O91A 4QC2A 2P67A 3RRXA 3SEFA 4ZJUA 3IDOA 3AEUA 3HJGA 2KLBA 2CFTA 3B9QA 3AOGA 4FFNA 4I8DA 4DJTA 1WP9A 1B6RA 3V4LA 1H2FA 5A3QA 2QYSA 4D57A 3P20A 4DB4A 2NZUG 3F3MA 1V6SA 4HQKA 4JSYA 4CEIB 2PANA 2CK3A 4F8EA 5JW6A 4QOHA 1MV5A 1X1RA 3WKEA 1ZJWA 5EE3A 2QAIA 5EEGA 1K5PA 4BRWA 4BLSA 2D54A 2HA2A 2ASEA 3N7TA 2AK2A 4QG3A 3F2VA 3LUHA 3KQVA 1RI2A 3B2NA 5DOZA 1ZH0A 4OXRA 5FTLA 1W1WA 1Q1BA 3WL8A 3EE6A 4PRZA 4E2XA 3HE3A 2OEPA 2WQZA 1JUDA 3PQ5A 4UUPA 5EEHA 1C1YA 3FYSA 5DHRA 2ZPAA 4FE3A 3SSAA 2FZVA 3D6VA 1P31A 5E1MA 3ZWNA 4A73A 4M8KA 2YS7A 1UT6A 3UTDA 4KX5A 5ECWA 4JOCA 1KQ3A 4MRSA 4RY9A 5HJEA 3CEMA 3OZCA 2WIFA 4K6GA 4TT8A 2CLEB 4NQZA 2XGJA 1Z38A 3O6VA 2BJWA 4J16A 4BX0A 5BV1A 5FBVB 1OXXK 3O0TA 2O8CA 3OJOA 3MWFA 3F6PA 1NLMA 1FEZA 1PJLA 2IYWA 3DNPA 1E69A 4DA0A 4LNHA 4URUR 5AI6A 4DJJA 3GNLA 4AYXA 1E79D 3EUFA 3KHUA 4L8GA 4OQZA 2IEDA 1SOMA 4HX5A 3TTSA 1REQA 3HM2A 1XV5A 3T4XA 2FW1A 1E6CA 3O1LA 3ZD8A 4DMHA 1ZM7A 1PG2A 1ZD2P 2Q3LA 4DY4A 5F98A 3F5SA 3B6IA 3IKVA 2P4QA 3RVNA 4EO7A 5JADA 5JVDF 5AW6A 1D07A 4RTNA 4GKJB 4QD3A 1TVCA 1WCWA 3EPLA 1AXGA 4MIKA 3SQXA 2GPJA 2OL4A 2H8KA 2V58A 3AHHA 3IVRA 5FNVA 5EJFA 1XP5A 4JUCA 3ZWOA 3DHYA 4PCLA 2P2ZA 1IUOA 2ZROA 1P6XA 5BN5A 3AVPA 4FOSA 4UE3S 3KQLA 2DB3A 2RHLA 3ER8A 4K28A 4D97A 2RGWA 2OOKA 1OAKA 3SLKA 2A67A 3DA8A 1U81A 2BI4A 4Q1CA 1UOOA 1QU3A 4B2YA 3OOEA 5FBKA 1Q5PA 1WOYA 3R6WA 4M0UA 5BPHA 4U2BA 5CDUA 3ET4A 2XA1A 3NJRA 3FCXA 4X6UA 5D7NA 4PLZA 4EEXA 2GDJA 4L57A 2G4VA 2ERYA 3WL7A 1T0IA 3PXXA 2UZ1B 3ES9A 4CV0A 3QPDA 5AVTA 1OOEA 2JGEA 3I9OA 4MI6A 5BUSA 1C3OA 2D4AA 3LZCA 2FWAA 2H1IA 3K1ZA 2WTXA 4KH0A 4E1AA 4D8XA 1L7RA 4C4YA 4KE8A 3GRCA 1TCBA 4WOCA 4MDFA 1T5HX 1PD0A 3A4TA 1X42A 3AM5A 5FYDA 4CUKA 4A9AA 4F9EA 1NP7A 5I7AA 3GNSA 4JCCA 4XSHA 5TGTA 3NHFA 3HI4A 3PIDA 5T6BA 3I72A 4IXDA 1ECPA 4N5DA 3L4JA 5CDTA 2IDMA 5IK2A 3HGTA 3TMKA 5KPJA 1KEEA 2V3CC 1U8AA 1RP1A 3TGLA 1G98A 4V02A 2CLCX 1XHLA 5ALVA 1E94E 2IX3A 2VPZA 4I4CA 2I9KA 721PA 2W2LA 3D4BA 5FKJA 4DV5B 4RAQA 1GG8A 1C4XA 2ZIUB 2CXHA 3LLVA 4WOPA 4ZC8A 2KE5A 2HNBA 4A0HA 3LC2O 3VJMA 4DA7A 3DPSA 1LSOA 3AR2A 4TVBA 1RHMA 5CEEA 3OZSA 4RQTA 3U19A 3JQ7B 3UICA 5EJEA 2QS9A 1AO3A 1U28A 3EUEA 4DDMA 3OETA 3IP6A 2IZ5A 1ZHFA 4MR7A 4U6NA 1LBIA 1XVTA 2Q4TA 3IPRA 3T5CA 3WICA 2PGIA 4BX2A 2OZPA 2B6HA 3UWKA 3HR4A 1TQ4A 3SR4A 1F8UA 2Z6VA 2NM0A 5EIOA 4PINA 3SVTA 1D1TA 4AF8A 1E9AA 1QV6A 1TGVA 3BILA 3AP3A 5LP6A 3ND7A 3W5HA 5J1SB 4ZOBA 1EQUA 2CXXA 5EVJA 1MRNA 2GAJA 3I5UA 4ND3A 4U7WA 4I3GA 4WLEA 3RG2A 2XCTB 4FWIB 4HFMA 3NHJA 4URVR 1UEJA 2F7SA 2J5RA 1BE8A 4JI6B 5JMPA 3RG8A 2HCJB 2DZDA 2RJNA 3O94A 4BE9A 5CB0A 1OE0A 3GLHA 3ZNNA 2B5WA 3PR3A 2FZ4A 2H9YA 4E11A 1QS0A 2OCPA 1ENYA 4TV8A 1ISPA 1Y1SA 4TQ9A 1UKEA 4Y2XA 2F00A 3PC3A 2H9AA 4P5PA 2OXRA 3JY6A 5DHSA 4RM2A 5I9TA 4ZCLA 3HY6A 3V00A 4CUZA 4XX0B 1YB1A 3BF7A 1OA0A 4P08A 5LVAA 3RF6A 1JQBA 1YBHA 1D2MA 1QZTA 3IO3A 2FP3A 1JHPA 3HJCA 3KT6A 4IIVA 3RYHB 5BWCA 5K3OA 3WDKA 3ED1A 2AT1A 5G0WA 3PC8A 4BNJA 5JDIA 2O8DA 1PV4A 4P22A 2HEIA 3K0BA 5G41A 4ZHQB 3QTBA 1NQ5A 2Z09A 2HMYB 1RADA 1GSOA 2G1KA 2JI4A 2KB0A 1X70A 4O4HB 3IA2A 2B1QA 3S1AB 3PT5A 5IJ0B 4KYIB 3P2MA 2I9PA 3DT9A 4D2IA 5L3VA 1BJTA 3BMXA 1N1EA 3CINA 1O95D 2CHVA 2JA2A 3BXFA 4IDOA 5TX7A 3BB3A 3DKKA 4A2WA 1V0JA 4DQ0A 1DC7A 3GEEA 2VNAA 4F0JA 4ENUA 1JIJA 4JELA 5CXXA 4J2TA 4DA8A 1I2DA 1JPJA 3OY2A 4PAOA 1MZPA 3UKJA 4R8SA 3UWSA 1Q19A 1Q74A 5IYZB 2SHKA 1M6VA 1WXXA 4YJGB 5GTDA 1KO1A 2B7CA 3E8XA 4BMZA 5JSFA 5EPEA 4MTCA 5BSKA 2I7DA 4RA6A 4XQEA 1QAOA 5LLSA 1SBTA 1JAYA 3AVTA 3OJEA 2P1RA 4JC8A 2HUPA 1MO2A 2FZCA 2MR5A 2P69A 3CKKA 1MQSA 2ZW9A 4FLFA 4GF5A 2EJUA 4AX8A 2A0UA 1R88A 5JEDA 1XF9A 4J7XA 1RJ9A 3MMPA 1YVUA 4TLCA 3BGSA 1KEUA 5FPKA 4FI3F 5K0JA 2IYVA 3GA5A 4UNSA 2QYHA 4B3JA 5TT1A 4ZOQI 1Q0LA 1Y3HA 1BW9B 3C8ZA 3GHHA 2W4QA 3M6VA 1PR2A 2QTCA 3FR8A 3QMVA 2X8LA 3PNPA 1TQDA 2EQ5A 3TPZA 1JDBC 1Y89A 3KWJA 3DL4A 2X5XA 3I76A 2D1FA 3TQHA 2CLHB 4FNGA 1L4BA 2EARA 4Q21A 4HXGA 4BMVA 2GBLA 4TKMA 1U1DA 2CZQA 1QC5A 4OGGA 3W1VA 3NMUF 3V55A 5JRDS 2Q5IA 1WLSA 1LW6E 2GCIA 3CMCO 4ZT7A 4PQRA 4LRYA 4LMBA 4U2KA 2VF4X 3GT7A 2X6RA 4MWBA 3SAJA 1XTBA 1GPNA 4NBNA 3OZEA 1ZMXA 4EYEA 1WDWB 3NAZA 1JZTA 4IX9A 3B5EA 3T7EA 1OHHA 2ZJ1A 3NHWA 1E64A 2I4RA 5TGDA 4CKWA 1JE1A 1HSZA 3D3JA 3HR7A 5EINA 4E03A 4CXMA 1U80A 4DF3A 1G7CA 1GSHA 1KJ9A 3D81A 3EW9A 3JQRA 3RFCA 4JITA 4DA4A 3DULA 3JALB 1J23A 5BQFA 5EFOA 1TUEA 1E2UA 1VQ1A 4TTSA 2FSGA 3V8RA 4HOYA 1Y6JA 1RM3A 2X42A 2ZUUA 4KWIA 1L5KA 2X0FA 2D5CA 5K45A 2YDXA 1QORA 5CFZA 3RSCA 2ZYTX 4R68A 4RPGA 2DFKB 1P8AA 4I4LA 4NECA 1T2AA 4R2XA 1J42A 3H16A 5IVDA 5HF8A 5A0VA 1DGQA 4F3TA 4NPHA 5LNK1 4GGOA 4MW7A 3OKCA 4LQLA 1HLPA 1RYHA 3LDHA 3NATA 4AYTA 4XVUA 1DTEA 4DM7A 1GA1A 2MYPA 2QXYA 4B7AA 3WL4A 3ZBQA 2W71A 3VXKA 4UNPA 3ZNPA 4NABA 1CQWA 1R4ZA 1C4WA 3SQNA 3U17A 4CCWA 4QUGA 1KZ6A 5CJJA 5H8WA 1NMYA 1K7EB 3QX9A 3VZQA 3T35A 4HJXA 3BGVA 3UH1A 1YS4A 1ORHA 2R1VA 4FNAA 4WH0A 1EP2B 5IVIA 1L7XA 1HG1A 3CONA 4LGVA 2XCLA 3PYLA 3SS8A 4F8YA 5KTSA 3EUAA 2OSBA 1IHPA 2EIXA 2WYUA 3MS4A 2XVYA 2MU1A 2NU9B 3VYUB 1LF0A 3HN7A 3JALA 5JH7A 1M7GA 1ODKA 4QU0A 4WN9B 821PA 1F5NA 5IAEA 5E38A 3TLAA 4P98A 5L9AA 4NCXA 3CLUD 1LRLA 1ZICA 4CG0A 1KEPA 4W5NA 3LFUA 1OT5A 1K08A 2CUKA 1Q77A 3FLEA 2YWGA 1JB1A 4KVZA 4PSDA 3AVYA 1DMRA 1VCMA 2PGAA 4N0QA 4W6QA 3E8MA 1NVMB 2CUNA 1FXUA 4BGIA 1KDOA 4B8WA 4CM7A 5AQEA 3D8BA 5BXYA 3NEYA 1BD4A 1MEEA 1EFTA 1Z3IX 5EWMB 3PXAA 3Q87B 5CH8A 3ID6C 1AGYA 1SQ5A 4GLFA 4QYIA 5KQPA 2V5UA 4GX1A 3D7KA 1VSUA 1CUGA 3HJNA 2IV2X 2XB8A 5IS2A 3OIVA 1XDUA 2YH2A 1K98A 5DP2A 1RWOA 5KQRA 4QUKA 4EQ6B 5FWNA 4BMYA 1J97A 4X0EA 3DNMA 2OV2A 2X1LA 2MSCB 3A9WA 4BP3A 1U8TA 3EIOA 3IBCA 1DRWA 4OMCA 1D8AA 3E9QA 3LLMA 2G9RA 3DZCA 1RJDA 3M83A 4AKHA 5CEFA 5K0EA 3D7NA 1TKCA 5HWSA 2HDOA 2RKOA 3QW2A 4CCYB 3NBMA 1XEAA 2FZ5A 2C9OA 1ZRNA 4JT4A 1VB3A 2X40A 1WMEA 3C3MA 3LCRA 3RVLA 3W6PA 1KERA 3WOVA 3A6KA 3PDUA 3T3OA 3CUYA 5DM60 2Z8YM 3EGDB 5JI3E 1R4AA 4RY8A 4GLJA 4XD2A 1RBQA 2NSJA 2AZMA 3S2ZA 2AD5A 4JD5A 1E32A 4Q6WA 4GPAA 1TK3A 4MV9A 4HX2A 2AZ4A 2OGUA 1VE5A 4GZ5A 3D2LA 2F2TA 1L1RA 2C94A 3OCYA 3OHPA 2CJPA 5J4LA 4K9OA 3LX5A 1P2GA 5FA8A 3ZDYB 4C0QC 1UWVA 3QXCA 4B2LA 4F3YA 5HQTA 1HLDA 5DE3A 4YCMA 1H3FA 3ABZA 1SHKA 1VA5A 4J4BA 5GJCA 4JR1A 3JV7A 4UUNA 3W05A 3ZHZA 4I9FA 4IINA 1GKKA 3B6EA 1CHDA 2IRWA 3QVLA 4CM6A 2XE4A 3VHQA 1IXYA 1G7TA 1TC1A 5LBTA 3ZXIA 1VKHA 3OZ7A 1U8EA 4HEA1 1LF5A 1Z8FA 5FF9A 2OYCA 2HMWA 2GD0A 4S1OA 5GZ1A 1MRSA 1XAIA 1FTQA 1WHTA 2IEZA 2J87A 4I55F 2JVJA 2NTNA 2QWXA 2R1ZA 2C2XA 4EGJA 4XYLA 4B7ZA 4ZVKA 1HKHA 1EDBA 2DPMA 3OJCA 1PTJA 3AZQA 3TFOA 1E0DA 4PHFA 1QGED 3FHOA 4Q3BA 3PDIA 2QK4A 4NMMA 3VC2A 4E5MA 1L4UA 1W0KA 2YVLA 1IXSB 2R1VB 5IULC 1D2NA 3BDIA 3RSZA 1X1AA 3EZ9A 4IM7A 4CT5A 5AUPB 4H2DA 1RYYA 5KYYB 2RH8A 1FMLA 1SB9A 3PKIA 4YPOA 1ZITA 1QHYA 2DECA 3I9FA 4RSRA 1PZNA 3H5WA 4XPZA 5K3DA 3ZTWA 2BEWA 1RHRA 1OXBB 1IIBA 2R7NA 1VYTA 2NSDA 2NAPA 4KQ6A 1WG8A 4KXVA 3DO5A 4PGAA 2IUEA 5THXA 2PA0A 2H17A 1COWD 1DIBA 3QHAA 1PL6A 3H13A 1NVEA 4FYPA 4GDMA 5KMGB 2O8FA 5L7YA 2HMSA 1XEXA 1SRRA 1JLHA 4WKOA 2ZLBA 2OB2A 2J9YB 1GWNA 4PLYA 5JS8A 3V7FA 3C3WA 3CX6A 4N8SA 2JRCA 2WHXA 2XAAA 4RETA 5IBCA 2ACWA 1KJZA 3FMOB 5D1HA 2ZJ8A 1E8MA 3QYJA 2HJWA 4LX8A 3LPLA 3GLKA 2I99A 3KYBA 4OFZA 4Z53A 2VDOB 3H6HA 5JNUA 1ZI8A 1WMSA 4KE6A 5CGQB 2F3QA 2OYRA 1GU1A 2QP9X 2Y0CA 4B6OA 2GK4A 2FDRA 2QP3A 4BNWA 2JEOA 3B89A 5KWIA 4MRMB 1U8FO 2JFXA 2B1IA 2NTYC 2W00A 1EQ2A 2PPLA 3HWWA 4FGZA 3WK6A 1OFVA 1K68A 1SXGA 2AH5A 3C8DA 1D5WA 4HDOB 1ZX1A 4N40A 2W8BA 4B7XA 3KR9A 4EELA 5CT5A 2JGMA 1M10A 2Q9AA 3U44A 1H2RS 2P8JA 2V55B 2PMBA 2ZWMA 3ZD9A 1IUNA 3I6IA 2WC1A 3ZY5A 3LPMA 2K2WA 1F2UB 2CYCA 5ICGA 2I1QA 4RMIA 1Y42X 2QOEA 1CVLA 1SM4A 1PWYE 3KCQA 4U6SA 1N57A 1ID1A 1U7UA 1ZXBA 1PSWA 1QNFA 1JTVA 2CLMB 1CZNA 3OEED 3F7OA 1FDRA 3DYVA 2I65A 1DQYA 1YZYA 2DCMA 2W43A 4LQ4A 5EIAA 3Q3IA 1P73A 1S2MA 4F4FA 1XCPA 2J0QA 1RPNA 1SXJA 3NIDB 4JR2A 4XFKA 3PEVA 1EFPB 2ZB8A 1ZH8A 1P5RA 2OY0A 1B74A 1R0ZA 2ZRCA 4M1YA 4OA5A 2IYEA 4KQ1A 4QBGB 1ZC4A 2QKYA 2IUFA 1OIXA 2ZTLA 4BLPA 1GNLA 1LTHR 5F4ZA 1FDUA 2OHJA 4XWTA 3S55A 3I9MA 3V46A 1KJYA 4WINA 1PT5A 4UU0A 3O3CA 3AK4A 3IR7A 2ZRGA 1SIUA 2C0CA 4F6CA 1AS2A 1L7MA 2HA0A 5DYIA 5K0LA 4F3KA 3M6FA 4HAYA 4UM7A 4DLAA 1FBNA 1RR6A 2GTIA 4PHTA 2FW6A 3K0KA 3FCOA 3LX4A 4PRYA 1ZCJA 2H0AA 1TUBB 2WDZA 3WK7A 4BO1A 4EX7A 5K0TA 4IGIA 2B2XA 4PZYA 1NUUA 4HLUC 2BFBB 2I80A 2UVQA 3KWFA 1Y48E 3OM8A 4M0PA 1Z56C 2ATVA 2EXXA 3B3QA 4CM8A 1W36C 4F5DA 2UUBB 2FWMX 2HU2A 3T7IA 2NO4A 1SUSA 3CXUA 4NLLA 4QEKA 4Z5XA 1NXXA 2W2NA 3DE5X 3EY4A 2V6IA 3N74A 3ZZNA 3RFUA 2I7CA 3UAVA 2FW0A 4MVWA 1XQXA 1D9XA 2X4IA 2AZDA 4BFYA 1K8QA 1SUFA 3KVRA 2C04A 2O2SA 2OWDA 3SJBA 3VU1A 3H17A 3KYCB 4JC4A 2HF8A 2HMAA 1YCGA 3GLHB 1PTJC 3JYOA 3ZY6A 3BQMB 4L8YA 1MBZA 4P4SA 3EMVA 2Q4RA 3U3JA 4FDUA 3NHYA 4GDFA 3T7DA 1CW2B 4TRNA 3R75A 4PHCA 1U2PA 1AUVA 1U1CA 5FTMA 4EX6A 2GAIA 1ULAA 1COWA 3K0EA 1EB8A 5E0OA 3VBCA 4G9GA 2Y1WA 2QD5A 2VQEB 1FXWF 5KC8A 1C9JA 1WETA 3RFXA 3LUCA 3UAZA 3QUTA 2PS1A 3FFTA 1IATA 4LN1A 1MNAA 3M6MD 4XE5A 1XQVA 5D5PA 3U4DA 1RJWA 4L7VA 5IBRA 1SPBS 1Z5VA 2DSNA 8LDHA 4J94A 2XBMA 5ALFA 1EWRA 2Q8NA 4ZXPA 1T8SA 1T10A 2DYKA 2R751 3L6UA 3R3JA 5WRFA 4IMRA 3RTEA 4DZZA 3RYFA 4YP5A 3N28A 1GCOA 1XKTA 4O1MA 2E9SA 1Z4OA 3DJYA 4FB4A 2HTFA 3LL7A 2CYBA 2V8BA 3FWYA 2A88A 4R8MA 1EXVA 1MO6A 4KNYA 1CRLA 1CJMA 1DT5A 2W58A 3HSKA 3NP9A 3NG1A 3WMGA 4A7PA 1OYYA 1VL8A 4OHFA 2EG5A 4XUCA 1NVAA 1KO8A 3KVOA 3DL0A 2JD0A 3VFDA 2IGBA 5AVZA 1GUAA 1M9NA 5A5DA 4QDTA 2G9UA 3ZEIA 2I2XB 2XTJA 2O0HA 1SXPA 1XJWA 3GFSA 4OQYA 4PRKA 1BDIA 4WLVA 521PA 1U65A 2ON6A 4C14A 1WZEA 3GFVA 4BTEA 3OFNA 2EX4A 4G09A 2WF8A 4ZRNA 3EX7C 4HLQB 5DI3A 5JV5A 2YBEA 2B9EA 2RGNC 3LQFA 1RI1A 5SZKB 5J59A 4QUDA 1USUA 1KRWA 1OILA 2WTNA 2O2YA 4RVGA 4C7KA 2I7VA 4H1VA 1FE8A 1ABEA 4PYRA 1Y4SA 4RK7A 1M75A 2ZUVA 4UTXA 2JAQA 1OB5A 1R0RE 1NW9B 1U1EA 4KNWA 4M8SA 1MX1A 4AW9A 1XKLA 4B17A 1TRKA 4PSAA 1FPQA 2FXIA 1EUDA 3PQDA 2R00A 1Y9EA 1WR8A 2A1UA 2G83A 5FQNA 3VH4A 4RXUA 2Q6KA 2UYQA 1MPXA 2DQSA 4YBRA 4PYMA 1HQCA 4UASA 1JLLB 4PFKA 3T4EA 3C3PA 4PWZA 1E4EA 3H87A 2QRKA 3O03A 3IT1A 1UDWA 2AG6A 2GTHA 2UU9B 3SU8A 2OTCA 4OJQA 1AA9A 3AO0B 5IF3A 4PLTA 1EI9A 1C8LA 2OD9A 3KB8A 3KOMA 3DAPA 3IURA 4MV4A 3K8ZA 1ZI6A 1JIIA 3WGHA 2C7GA 4KDRA 3SS7X 2INGX 4BU1A 3LDFA 4LNUB 3T9EA 4B8YA 1VL5A 4JJEA 5FDFA 1H8EA 3HCBA 3JPWA 4A8HA 2WSSA 4L5JA 1YHZA 1H1TA 3KXDA 4XYMA 1U6KA 3QZUA 2I6TA 4ZVMA 1YU9A 3AQ4A 2F8LA 4G4SO 1CUHA 3W2FA 1OX5A 5BYBA 4AZ0A 2XCQA 2NXWA 4YJHB 1JXAA 3AR3A 2BFMA 2JARA 3F74A 4HDRA 1MC5A 3TS1A 4G8BA 5KCMA 4YJFB 2P2GA 3RTCA 2B2NA 4KYTA 1NZFA 1PJSA 4DGSA 1JEAA 1SZJG 4ENWA 4GI3A 1H5NA 3OZUA 4TXHA 2H5JA 3R0JA 1UC8A 4TYMA 3EAQA 1HEUA 2NLOA 1CZLA 3AFIA 2EP8A 4LJ8A 5ALJA 1XTJA 1DQPA 5KQSA 2CCJA 1Z2OX 3LRPA 3LQ2A 5E8RA 2Q1SA 3LVFO 4LQDA 1PJRA 1VIMA 2GK7A 3PCXA 4MV3A 1H85A 4ENPA 3ER9A 2I2AA 2OBMA 5K3BA 3EQZA 5EIBD 1N33B 1AKYA 4EHAA 4Q82A 2ZI7A 1PDVA 4TLDA 5DW0A 4MIOA 1UDXA 2FKNA 2C9BA 1UBMS 4RIIA 4QPCA 5IF9A 2BMJA 4G67A 2AG5A 4RY0A 5AICA 5REQB 3RD5A 2HQ1A 3TECE 2BPOA 1BU5A 1GEGA 2GA8A 2WYWA 3AHDA 4HTFA 5UKDA 4N47A 4CM9A 5C52B 1V8PA 4K86A 4CUJA 1X80B 3HZHA 1FW8A 5ICEA 3QVMA 3H2IA 5J63A 1OZGA 5CTAA 4AX4A 5AVVA 1Z29A 2NADA 2WNSA 1N6HA 3H9UA 1B15A 3C41J 1D4ZA 3P7MA 3IP1A 5FPQA 3ZDEA 1OVMA 3T3IA 4BFTA 4BQPA 4F9GA 5TQ0B 1KEZA 1SIOA 1FQOA 3E23A 1G8FA 4IOLA 2IP1A 4Y1GA 1FYXA 5F9MA 4EHKA 3NONA 4QGAA 1NV9A 4EG6A 1THZA 1Z5WA 3CSSA 2D8MA 2EWVA 2X9QA 5KYUA 1DAPA 2K7ZA 1EXDA 5GJBA 1PWHA 4FS8A 5EWJA 3AJDA 1GUFA 3MJCA 2LZ0A 2C2MA 4CNBA 1YSCA 4C7OB 2E4XA 5KJCA 1E66A 2DX7A 2LBPA 1L5ZA 2YQ5A 5DHFA 1CJSA 1LB1B 2ADFA 1WXEA 2IYOA 3T7AA 4WKBA 3PWSA 1AUQA 3G1TA 4CKWB 5B57C 3O21A 4LDZA 1IAVA 1TMKA 1WP4A 1Z4IA 3BERA 3KKOA 3TXYA 4AZVA 4B82A 5J2TF 3R4CA 4C7VA 1RI3A 3HDHA 1VDMA 2ZULA 3F5DA 2VG8A 1L9KA 3FI9A 3DBOB 2VRNA 1GUBA 3WLQA 4EY6A 2ZE5A 2Q1YA 3ETEA 3CBQA 3RAFC 3AUTA 1S2OA 5LZ9A 3B60A 1RC1A 1P72A 1WTAA 1SD5A 3PFKA 1NMEA 3ROGA 3GLIA 1XZGA 4JOSA 4AJHA 2YJNA 1FUIA 3PTZA 5KEIA 5DTQA 2C0PA 3H99A 5GGYA 5CW2A 3IP3A 3HYNA 4P8RA 5CPBA 4DW8A 2DWQA 4HQFA 1NBEA 4EG3A 4BB6A 1ISIA 2OV4A 2PSEA 4NV0A 1W36B 1RTKA 2OC4A 1XA3A 3BCHA 3FNGA 2GHRA 3NASA 3ROMA 2GPSA 8MHTA 4BQIA 1XK6A 2VYNA 4NZ9A 4PO8A 3X1ZA 2VBCA 5KMGA 2O8FB 2OM2A 1W9MA 2Y2VA 2EFDB 3JSAA 1HGXA 1JS1X 4MV7A 3MWLA 4GMKA 1K5GA 4PAWA 3ZH2A 3WGNA 1T43A 3ZDQA 3WIOA 1J8MF 2FFJA 1Z63A 3QK7A 4AS1A 4BIIA 1L7PA 1JAZA 1U9IA 4GO1A 1OIVA 4N82A 2O2GA 4ZKDA 1BXRA 2X8JB 2P5SA 4U9HS 2JGJA 3FNHA 2ETVA 4HDRB 4Y2SA 4EKNB 2E4ZA 1BXZA 1M8GA 1YZLA 2XQGA 1MFZA 4TTTS 2IZOA 3TZHA 4BO2A 1ZHHA 1UBFA 2JKVA 5JD5A 4KPYA 3D7MA 1U0JA 1SKUA 1NPYA 5FBLB 2XGMA 2YV4A 4MEBA 3SOPA 1OY1A 2PA3A 3VZPA 3WLOA 3EGEA 1PGPA 2JLCA 4PXYA 2BFDA 2WW8A 4B74A 4IJKA 4MOWA 4RZUA 1EB9A 2B82A 5LSAA 4NHOA 4O2BF 1FVOA 1N8NA 1ZSVA 2L18A 1M66A 2OHXA 1XROA 1HWYA 2EBHX 2OBYA 1G7RA 3DLPX 4XIJA 4CL8A 1NULA 3QWFA 5FAKA 3D3NA 1HO3A 3WJ2A 1NC3A 4KNVA 3AETA 3MIIA 4MYRA 2JLZA 1UKVY 2GBIA 1XNRB 1WCYA 2XBLA 2ZEJA 1UJ4A 3P2EA 4I5GA 1JDNA 4R6WA 2H4FA 3V1MA 3F4LA 7ABPA 4XXHA 1PCXA 4OF4A 1M6VB 2YMPA 4RFSA 2JBAA 5K4AA 4MV5A 5F7ZA 4PYJA 2O0LA 3L0BA 1R50A 3RK1A 4YROA 1K6XA 4N48A 2CNWD 1C9KA 1QH1B 2VZ9A 2Z2XA 4M36A 1QLJA 4H60A 2PV7A 1Z7BA 1FXWA 2JH9A 2GQ0A 3AZOA 2FWBA 3AL3A 4F6RA 3PF9A 4EECA 1SC6A 2I6QA 3U3KA 1B8PA 1SVOA 3DXXA 4FIDA 5ALHA 6NULA 2WSMA 2BFNA 3VTZA 4U5QA 1A2QA 3I2KA 3DBRB 1PR1A 4A0SA 3GLVA 1HA3A 3EGDA 2CZGA 3I1FA 2C4NA 4RH3A 5JXJA 3ZHOA 5IASA 5AW4A 1AF7A 2YMLA 1VZ3A 3O4FA 2RKBA 4KSYA 4WXMA 5GM2A 4Q3CA 4Q3EA 2CJXA 3Q0TA 1VBKA 2Q2OA 2E4YA 3MWDB 3BHNA 2NZJA 3T06B 4PRLA 2AC2A 2ORYA 1N6NA 4FJ1A 2VRCD 4P4UA 1ZD4A 2QZJA 3IQHX 5BSTA 5COAA 3SP1A 4B73A 1G3IA 2J9ZB 1FP2A 4AF6A 3OQVA 1X8XA 5FFNA 4PX9A 2CVZA 4Q1DA 3DMTC 2DPXA 4OKIA 1PWXA 2FQYA 1DO0A 2DF8A 3KZKA 1T3GA 3OHSX 4MB6A 3B7GA 2QUBA 1QGAA 2Z3ZA 4W5JA 1DCTA 5CVCA 4ZREA 2HLDD 3ZW7A 4Q9HA 5TQ2B 1ZI9A 4NHEA 4M1SA 2X2PA 3SNKA 1G55A 1JBKA 5DI3B 1E2BA 4L7QA 2IZZA 2WEKA 2IUTA 2XVXA 3R74A 4ZVVA 2PKXA 1ZWKA 2AN1A 3NVKI 2YN4A 1AU9A 4IRUB 1P7CA 1S3FA 2GI4A 4XTRA 3UV3A 5HIAA 1O0CA 3JVDA 3I9KA 5D3ZA 1G2IA 4JBYA 3OT5A 5MFPA 4UNNA 1F7VA 1TIBA 4QWWA 1H0SA 1YHNA 2FGKA 3RRZA 5IAOA 4YMSA 4N3CA 2CV1A 5DX0A 2E6UX 1HTTA 4N5MA 5JO0A 4LGMA 2XTMA 3A6JA 5CRIA 4W5RA 3ONDA 2HJVA 4M55A 3RU2A 2O8CB 3U1BA 1UQUA 3F73A 1Z3CA 4B6FA 2AQIA 5HFAA 4F71A 1LDGA 1IOWA 1SIBE 2EC5A 3AQIA 1DQRA 3KKZA 2ESRA 4MQ4A 2WT9A 4RE6A 1MAAA 3JQPA 1NE7A 1B7GO 3PE4A 4GSKA 2COEA 5LQSA 2DWCA 2JJMA 3A0UA 2IGTA 4FEYA 2XUDA 2C29D 1J8DA 2JAWA 2Q7XA 2VWQA 2VDRB 1HK7A 4GQBA 4QEZA 3NRCA 4R9UC 4IHJB 3DVSX 4UM9B 4MVJD 2BMFA 4F93B 2XRZA 1CUAA 4V2UA 4CNQA 2R8RA 2FMIA 4G1UC 1EDZA 3SSMA 5CDFA 2WWVD 1EIWA 2R8OA 3L92A 4B85A 3EOBI 3DMFA 5FRDA 2WI8A 1A8UA 1SVUA 3NOXA 3O4IA 1FFEA 4HGNA 3WNBA 3KOXA 4ZCRA 4EKDA 1Y8RA 4ZI7F 1KBOA 2ZRHA 2BRUC 4M7OA 4FLMA 4MGKR 4EEZA 3BCUA 2H7CA 1LXCA 2FPIA 3LYAA 4Y9UA 5A4FS 4EA9A 3HUEA 1ACLA 1QGUA 2P5YA 2PSHA 4MS3B 3TSWA 5LXTA 5FA5A 3EZNA 1VHLA 2QQFA 4RORA 1XKQA 2DKOA 3KHSA 2XXAB 1EVQA 4K87A 3TKAA 4BRUA 1E2EA 3O82A 1BDBA 1SGWA 3FYUC 5LKAA 1H0RA 3O8RA 1TECE 1P5JA 2N1BA 4PAMA 3H8WA 2WSBA 2NU8B 4M1MA 2YJTD 1SBCA 3CNQS 4NF2A 4JI0B 4DLWA 1XQYA 4OQEA 3M6IA 2EEZA 2PMKA 1ZK0A 4CHTA 4ILKA 1CS0A 4CF5A 4LTNA 2SKDA 1HDCA 5J2UA 4HWGA 1YRLA 1Z0FA 2SCUA 2BR4A 2EG9A 4UREA 3DLIA 1OBFO 2FP4A 1LCIA 4JA0A 2QAGC 2NUTB 4V24A 2BRUA 1U7HA 2YQZA 5GV8A 3UG7A 3W1WA 4EGQA 5IHPA 1QIDA 3TW6A 1EXNA 4GOXA 1XJQA 1GADO 1VFNA 4JOBA 2VSXA 3HL4A 2QTMA 3TJZA 4KQHA 1I80A 5BUZA 5HR5A 1I7DA 4E30A 5EMJA 2NYUA 4KZKA 3FGNA 2Y4NA 3CR7A 3NCTA 1VKZA 1G16A 2I6GA 3BGWA 3SC2B 3TYXA 4DJEC 3IQXA 4IJVA 1D03A 5TPWB 1ZNQO 3HWRA 3IEXA 1LJUA 3B3JA 1JKXA 3HVUA 1LV8A 5KNLA 1NRWA 2PKEA 3AYXB 3E3LA 3ETCA 3DOJA 4OQQA 2UXDB 2DTXA 3V1LA 1G3QA 4KO2S 3C4VA 1NIPA 2XNKA 3AVOA 3ZD6A 5EE5B 3IEVA 1QFYA 2PSSA 2QT1A 2PBRA 1G5RA 4FX2A 4AK9A 3U62A 3T9FA 3ZJUA 4F97A 2HBZA 3ZE7A 1H05A 1LVGA 2GYYA 3A9TA 3QBVA 4YRRA 3RNLA 3I42A 3E2MA 4LZNA 5CCDA 1DZ3A 4RVHA 2XZOA 1BHSA 2IYUA 2PWZA 3TCXB 4BFLA 3W9SA 5C7YA 1YMQA 2M98A 3IVMA 3QKRB 3QWIA 3PC4A 2AKYA 2HBYA 3CNBA 4YP6A 3UJPA 5MGNA 4QT0A 2O0MA 4E07A 4Z9AA 4AJ4A 3R7SA 1YVDA 1Q14A 3KD3A 3F2IA 3DWEX 3LCJA 3C3AA 2C8JA 5GONB 3HO1A 1P7ZA 3GOQA 1V6CA 2L42A 3EF3A 5JZSA 1D1PA 2GA9A 1L5RA 3NH9A 3D3WB 1PW7A 4JEIA 2P41A 4I08A 2D1YA 3GMTA 1GL3A 4TYYA 3O47A 4L5BA 5LBIA 1IJEA 3B53X 3EMDA 1M2GA 3OCXA 3C7AA 3L3BA 1ZM9A 3IH5A 3RBXA 1BSVA 2HWUA 1LDEA 3KPWA 1O94A 1PU2A 4PLCA 1IM8A 1IZ0A 4O4HA 3PIRA 1E20A 4HLNA 4YT4A 4I81A 1U2QA 3WDLA 5LN1A 3RWMB 1F2UA 1AS0A 4ALMA 4MMYB 3CN9A 4ZV4A 4EKGA 1AM4D 2ZPTX 4ZO4A 2R65A 4W5OA 2FWIA 2VJMB 1QRSA 4C5CA 1ZQ1A 4QASA 5L7WA 4HMQA 3GLSA 2Z2ZA 4URWR 1BFKA 5D2CA 4AURA 3AP1A 1U5BA 4J0JA 4K2HA 5CNKA 4DTIA 1ZU5A 2OQIA 3NBQA 3WSWA 2PRKA 2BDUA 2BEVB 3DE1X 1YR9A 1L4KA 2QV7A 2QT9A 1K86A 3H2KA 3I0MA 4JDPA 5BO5A 3HV0A 3RS5A 3TQQA 4C0HA 1R8YA 4C3OB 4JI2B 1H6DA 4R7TA 4BUJA 1AC5A 4OYRA 4DSOA 2IT1A 1Q0PA 3MD0A 4L6CA 1DC3A 3CZQA 1KK1A 1XUOA 3DF7A 2A5GA 4KRXA 4RZXA 4ETNA 5KYNA 1T4DA 1I13A 1Z28A 1II9A 2GNAA 3QELB 4GVPA 1R37A 4H16A 3AIIA 1ZJYA 1S8FA 2J3JA 3HRIA 4IF6A 3WBFA 1IZZA 1Z88A 1N2BA 1BWPA 1CVIA 4ZI2A 3TLEA 4FE4A 2F59A 4EH1A 2NU7A 2DLCX 3MW8A 2ZI9A 3EVNA 3UHPA 1GTJ1 2OK8A 1M6YA 4W9NC 1PJ8A 2V7WA 1QOQB 2M1XA 3PZBA 5EFZA 1J6UA 3SJZA 3BRQA 5K1ZA 2V1UA 1WNTA 2GR9A 3IQFA 5D5QA 1ZUHA 2TS1A 4Q7EA 1T8YA 3H2HA 3ZCVA 3EDMA 2A57A 4Y0NA 3W1EA 2Q27A 2UUPA 3EIEA 1RPAA 3BN3A 2IEAA 4IDBA 2ZI4A 3FIUA 3A3PA 1UK8A 3K0SA 3DZDA 1L4GA 1OKKA 2ECPA 1P5ZB 3EH1A 4RGYA 4FILA 4W99A 3RBAA 5JJCA 4A91A 3KXPA 2BW0A 3L8YA 1ISHA 4Z9BA 4FYJA 5FCDA 1KAGA 2ZYHA 5U1PA 2I1LA 2NQ8A 1GARA 2HQSA 3OQ1A 1KSGA 3W7AA 3ILSA 4XIGS 2OVBA 4DLYA 2WU3A 4M1EA 2Q50A 5L6MB 5IFKA 1S4MA 4E2FA 4MK4A 3K9WA 1XMQB 4H4CA 3GJ3A 1YB7A 5EL0A 3FLBA 1ZSYA 3DHWC 5JQWA 2C61A 1IOVA 4PSKA 2JGRA 1AQUA 3RSGA 2HWYA 2QX8A 3HDQA 4UUQA 4YREA 3U3DA 1MDFA 1U3FA 2FPRA 2PQ2A 1CB0A 3H0KA 3I34X 1E4EB 1MC1A 2C1EA 4ZVTA 2PXHA 1DOHA 4EP1A 1WU7A 2XRMA 3OOSA 4N5LA 4W9RA 2WIDA 3KJIA 2BM1A 3CJQA 1KSHA 4JBIA 4KI7A 4R2WA 4XARA 4XEUA 6REQB 5LUAA 4CCSA 2X9NA 2ZKIA 4H7DA 1CEEA 3E18A 5J23A