3L1NA

Crystal structure of mp1p ligand binding domain 2 complexd with palmitic acid
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
155
structure length
155
Chain Sequence
EATKVQRDISAFKKVMQNISLAVNKFNVDIERYVGGDASHLLADGNVLIKATLDGVQSLQNEPPLSSMEALALVGPVQDLSNQIMLAIQNLIDKKEPLVQAGFGGKVENNLRQQEEAAQKLSELVSTKVPHELADISRQLSDGIAAGIKKGIDAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell wall antigen
publication title Crystal structure of the Mp1p ligand binding domain 2 reveals its function as a fatty acid-binding protein.
pubmed doi rcsb
source organism Penicillium marneffei
molecule tags Lipid binding protein
total genus 56
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12296 HsbA Hydrophobic surface binding protein A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1280.140 Mainly Alpha Up-down Bundle Monooxygenase Monooxygenase 3l1nA02
3L1NA
chains in the Genus database with same CATH superfamily
1FZHE 1FZ8E 3SQ2A 2P1PB 1XU3E 3LD8A 3RMCA 2ATQA 4M3YA 3KD1E 3OGMB 3OGLB 3QEPA 4FJGA 1XVEE 3L1NA 4AI6A 4J2AA 3QEIA 3BVOA 1MHZG 2P1NB 1N1CA 4M3WA 5IREA 3CFOA 1FZ1E 3J2PA 4FVMA 2OZSA 3MKSB 4RNGA 3QEXA 1IH7A 4IT5A 2E31A 3NCIA 4KHQA 2B7MA 3C6NB 3CFRA 2PFVA 3HP9A 3LZJA 4KHNA 4KHUA 2E32A 4JRQA 3SJJA 4I9LA 1WAFA 2VJ4A 1FZ2E 3E4YA 4JS4A 2JHPA 4E4BA 4DTJA 2JPNA 2VIXA 4FJXA 4FJJA 3QEVA 3J27A 3N1BA 3LZIA 3KD5E 3L8BA 2B1EA 3N1EA 4M42A 2JHAA 4EP9A 4FJ7A 4QNCA 4M45A 3TAFA 2RKHA 1XMFE 4M3RA 3SI6A 1MTYG 1XU5E 4GAMC 1FZ4E 3QETA 3SPYA 2DTUA 3RMAA 4DTSA 1XVGE 2YB5A 4FJ5A 3SUQA 2HD0A 4RG8A 3SQ4A 4FJNA 4FJ8A 4X5NA 4DTPA 3UO2A 4FJIA 1XMGE 4FK0A 4AKGA 3NHGA 4AKIA 3UO3A 1FS1A 3TJYA 4FJKA 4DU3A 1FXXA 3NGIA 4FK4A 2LF3A 1FZ0E 2OZMA 4AKHA 1Q9YA 4KHYA 1JW2A 3C6PB 1FZIE 4ADOA 1IG9A 5IBKB 1NEXB 3SQ1A 2JH9A 3SCXA 2MMBA 3K2OA 4FJ9A 2P1OB 4M41A 3V7DB 3HL8A 3QESA 2MW2A 3SVIA 1XMHE 4EPHA 3SUNA 1FZ9E 2PFTA 3NDKA 1P22A 2JHCA 4JRPA 2K5SA 1CLQA 2B8IA 3HGKE 2P5OA 2P1QB 3SPZA 4QNDA 4DTNA 3CQ8A 3QEWA 4DTUA 3WSOA 3LDBA 4J2EA 4FK2A 3QERA 3TAEA 4M3ZA 2OVPB 4EYWA 3SUPA 4I9QA 3OGKB 1MMOG 2JH8A 2OVQB 4ADNA 2VJ5A 2FYOA 3TL8B 4B08A 1FYZE 3NE6A 4E3SA 1XL3C 4DTOA 3RMBA 1Q9XA 1LDKE 4X5MA 2OYQA 4HCCA 4KHSA 4M3UA 5H37A 1FPOA 2FW3A 3QNOA 1WAJA 3QNNA 2DY4A 3NAEA 1XVFE 4RL5A 4FJHA 2OVRB 3E4WA 4KI4A 4DU4A 3UIQA 4J2BA 3C6OB 3HGLA 3RMDA 2DEBA 2MZWB 5IZ7A 3LDSA 4DU1A 4DTRA 2H4TA 2P5GA 3C95A 3SUOA 4KHWA 3S9HA 3L0MA 1XVDE 1XVBE 4FJLA 4ICGC 4HCBA 2JQTA 4DTMA 4J2DA 4M3XA 1FZ7E 3L2OB 3RWUA 3SNNA 1MHYG 2QXFA 3TAGA 1FZ3E 4DTXA 2LF6A 3TABA 4KI6A 2P1MB 3CFPA 4FJMA 3SQ0A 4M3TA 1XVCE 4I6JB 3C94A 2RCUA 1FZ6E 1FZ5E 4JS5A
chains in the Genus database with same CATH topology
1FZHE 1FZ8E 3SQ2A 2P1PB 1XU3E 3LD8A 3RMCA 2ATQA 4M3YA 3KD1E 3OGMB 3OGLB 3QEPA 4FJGA 1XVEE 3L1NA 4AI6A 4J2AA 3QEIA 1MHZG 2P1NB 4M3WA 5IREA 3CFOA 1FZ1E 3J2PA 4FVMA 2OZSA 3MKSB 4RNGA 3QEXA 1IH7A 2E31A 3NCIA 4KHQA 2B7MA 3C6NB 3CFRA 2PFVA 3HP9A 3LZJA 4KHNA 4KHUA 2E32A 4JRQA 3SJJA 4I9LA 1WAFA 1FZ2E 2VJ4A 3E4YA 4JS4A 2JHPA 4E4BA 4DTJA 2JPNA 2VIXA 4FJXA 4FJJA 3QEVA 3J27A 3N1BA 3LZIA 3KD5E 3L8BA 2B1EA 3N1EA 4M42A 2JHAA 4EP9A 4FJ7A 4QNCA 4M45A 3TAFA 1XMFE 4M3RA 3SI6A 1MTYG 1XU5E 4GAMC 1FZ4E 3QETA 3SPYA 2DTUA 3RMAA 4DTSA 1XVGE 2YB5A 4FJ5A 3SUQA 2HD0A 4RG8A 3SQ4A 4FJNA 4FJ8A 4X5NA 4DTPA 4FJIA 4AKGA 1XMGE 4FK0A 3NHGA 4AKIA 1FS1A 3TJYA 4DU3A 1FXXA 3NGIA 4FK4A 2LF3A 1FZ0E 2OZMA 4AKHA 1Q9YA 4KHYA 3C6PB 1FZIE 4ADOA 1IG9A 5IBKB 1NEXB 3SQ1A 2JH9A 3SCXA 2MMBA 3K2OA 4FJ9A 2P1OB 4M41A 3V7DB 3HL8A 3QESA 4FJKA 3SVIA 1XMHE 4EPHA 3SUNA 1FZ9E 2PFTA 3NDKA 1P22A 2JHCA 4JRPA 1CLQA 2B8IA 3HGKE 2P5OA 2P1QB 3SPZA 4QNDA 4DTNA 3CQ8A 3QEWA 4DTUA 3WSOA 3LDBA 4J2EA 4FK2A 3QERA 3TAEA 4M3ZA 2OVPB 4EYWA 3SUPA 4I9QA 3OGKB 1MMOG 2JH8A 2OVQB 4ADNA 2VJ5A 2FYOA 3TL8B 4B08A 1FYZE 3NE6A 4E3SA 1XL3C 4DTOA 3RMBA 1Q9XA 1LDKE 4X5MA 2OYQA 4HCCA 4KHSA 4M3UA 5H37A 2FW3A 3QNOA 1WAJA 3QNNA 2DY4A 3NAEA 1XVFE 4RL5A 4FJHA 2OVRB 3E4WA 4KI4A 4DU4A 3UIQA 4J2BA 3C6OB 3HGLA 3RMDA 2DEBA 2MZWB 5IZ7A 3LDSA 4DU1A 4DTRA 2H4TA 2P5GA 3C95A 3SUOA 4KHWA 3S9HA 3L0MA 1XVDE 1XVBE 4FJLA 4HCBA 4DTMA 4J2DA 4M3XA 1FZ7E 3L2OB 3RWUA 3SNNA 1MHYG 2QXFA 3TAGA 1FZ3E 4DTXA 2LF6A 3TABA 4KI6A 2P1MB 3CFPA 4FJMA 3SQ0A 4M3TA 1XVCE 4I6JB 3C94A 2RCUA 1FZ6E 1FZ5E 4JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L1N A; 
#chains in the Genus database with same CATH topology
 1FZH E;  1FZ8 E;  3SQ2 A;  2P1P B;  1XU3 E;  3LD8 A;  3RMC A;  2ATQ A;  4M3Y A;  3KD1 E;  3OGM B;  3OGL B;  3QEP A;  4FJG A;  1XVE E;  3L1N A;  4AI6 A;  4J2A A;  3QEI A;  3BVO A;  1MHZ G;  2P1N B;  1N1C A;  4M3W A;  5IRE A;  3CFO A;  1FZ1 E;  3J2P A;  4FVM A;  2OZS A;  3MKS B;  4RNG A;  3QEX A;  1IH7 A;  4IT5 A;  2E31 A;  3NCI A;  4KHQ A;  2B7M A;  3C6N B;  3CFR A;  2PFV A;  3HP9 A;  3LZJ A;  4KHN A;  4KHU A;  2E32 A;  4JRQ A;  3SJJ A;  4I9L A;  1WAF A;  2VJ4 A;  1FZ2 E;  3E4Y A;  4JS4 A;  2JHP A;  4E4B A;  4DTJ A;  2JPN A;  2VIX A;  4FJX A;  4FJJ A;  3QEV A;  3J27 A;  3N1B A;  3LZI A;  3KD5 E;  3L8B A;  2B1E A;  3N1E A;  4M42 A;  2JHA A;  4EP9 A;  4FJ7 A;  4QNC A;  4M45 A;  3TAF A;  2RKH A;  1XMF E;  4M3R A;  3SI6 A;  1MTY G;  1XU5 E;  4GAM C;  1FZ4 E;  3QET A;  3SPY A;  2DTU A;  3RMA A;  4DTS A;  1XVG E;  2YB5 A;  4FJ5 A;  3SUQ A;  2HD0 A;  4RG8 A;  3SQ4 A;  4FJN A;  4FJ8 A;  4X5N A;  4DTP A;  3UO2 A;  4FJI A;  1XMG E;  4FK0 A;  4AKG A;  3NHG A;  4AKI A;  3UO3 A;  1FS1 A;  3TJY A;  4FJK A;  4DU3 A;  1FXX A;  3NGI A;  4FK4 A;  2LF3 A;  1FZ0 E;  2OZM A;  4AKH A;  1Q9Y A;  4KHY A;  1JW2 A;  3C6P B;  1FZI E;  4ADO A;  1IG9 A;  5IBK B;  1NEX B;  3SQ1 A;  2JH9 A;  3SCX A;  2MMB A;  3K2O A;  4FJ9 A;  2P1O B;  4M41 A;  3V7D B;  3HL8 A;  3QES A;  2MW2 A;  3SVI A;  1XMH E;  4EPH A;  3SUN A;  1FZ9 E;  2PFT A;  3NDK A;  1P22 A;  2JHC A;  4JRP A;  2K5S A;  1CLQ A;  2B8I A;  3HGK E;  2P5O A;  2P1Q B;  3SPZ A;  4QND A;  4DTN A;  3CQ8 A;  3QEW A;  4DTU A;  3WSO A;  3LDB A;  4J2E A;  4FK2 A;  3QER A;  3TAE A;  4M3Z A;  2OVP B;  4EYW A;  3SUP A;  4I9Q A;  3OGK B;  1MMO G;  2JH8 A;  2OVQ B;  4ADN A;  2VJ5 A;  2FYO A;  3TL8 B;  4B08 A;  1FYZ E;  3NE6 A;  4E3S A;  1XL3 C;  4DTO A;  3RMB A;  1Q9X A;  1LDK E;  4X5M A;  2OYQ A;  4HCC A;  4KHS A;  4M3U A;  5H37 A;  1FPO A;  2FW3 A;  3QNO A;  1WAJ A;  3QNN A;  2DY4 A;  3NAE A;  1XVF E;  4RL5 A;  4FJH A;  2OVR B;  3E4W A;  4KI4 A;  4DU4 A;  3UIQ A;  4J2B A;  3C6O B;  3HGL A;  3RMD A;  2DEB A;  2MZW B;  5IZ7 A;  3LDS A;  4DU1 A;  4DTR A;  2H4T A;  2P5G A;  3C95 A;  3SUO A;  4KHW A;  3S9H A;  3L0M A;  1XVD E;  1XVB E;  4FJL A;  4ICG C;  4HCB A;  2JQT A;  4DTM A;  4J2D A;  4M3X A;  1FZ7 E;  3L2O B;  3RWU A;  3SNN A;  1MHY G;  2QXF A;  3TAG A;  1FZ3 E;  4DTX A;  2LF6 A;  3TAB A;  4KI6 A;  2P1M B;  3CFP A;  4FJM A;  3SQ0 A;  4M3T A;  1XVC E;  4I6J B;  3C94 A;  2RCU A;  1FZ6 E;  1FZ5 E;  4JS5 A; 
#chains in the Genus database with same CATH homology
 1FZH E;  1FZ8 E;  3SQ2 A;  2P1P B;  1XU3 E;  3LD8 A;  3RMC A;  2ATQ A;  4M3Y A;  3KD1 E;  3OGM B;  3OGL B;  3QEP A;  4FJG A;  1XVE E;  3L1N A;  4AI6 A;  4J2A A;  3QEI A;  1MHZ G;  2P1N B;  4M3W A;  5IRE A;  3CFO A;  1FZ1 E;  3J2P A;  4FVM A;  2OZS A;  3MKS B;  4RNG A;  3QEX A;  1IH7 A;  2E31 A;  3NCI A;  4KHQ A;  2B7M A;  3C6N B;  3CFR A;  2PFV A;  3HP9 A;  3LZJ A;  4KHN A;  4KHU A;  2E32 A;  4JRQ A;  3SJJ A;  4I9L A;  1WAF A;  1FZ2 E;  2VJ4 A;  3E4Y A;  4JS4 A;  2JHP A;  4E4B A;  4DTJ A;  2JPN A;  2VIX A;  4FJX A;  4FJJ A;  3QEV A;  3J27 A;  3N1B A;  3LZI A;  3KD5 E;  3L8B A;  2B1E A;  3N1E A;  4M42 A;  2JHA A;  4EP9 A;  4FJ7 A;  4QNC A;  4M45 A;  3TAF A;  1XMF E;  4M3R A;  3SI6 A;  1MTY G;  1XU5 E;  4GAM C;  1FZ4 E;  3QET A;  3SPY A;  2DTU A;  3RMA A;  4DTS A;  1XVG E;  2YB5 A;  4FJ5 A;  3SUQ A;  2HD0 A;  4RG8 A;  3SQ4 A;  4FJN A;  4FJ8 A;  4X5N A;  4DTP A;  4FJI A;  4AKG A;  1XMG E;  4FK0 A;  3NHG A;  4AKI A;  1FS1 A;  3TJY A;  4DU3 A;  1FXX A;  3NGI A;  4FK4 A;  2LF3 A;  1FZ0 E;  2OZM A;  4AKH A;  1Q9Y A;  4KHY A;  3C6P B;  1FZI E;  4ADO A;  1IG9 A;  5IBK B;  1NEX B;  3SQ1 A;  2JH9 A;  3SCX A;  2MMB A;  3K2O A;  4FJ9 A;  2P1O B;  4M41 A;  3V7D B;  3HL8 A;  3QES A;  4FJK A;  3SVI A;  1XMH E;  4EPH A;  3SUN A;  1FZ9 E;  2PFT A;  3NDK A;  1P22 A;  2JHC A;  4JRP A;  1CLQ A;  2B8I A;  3HGK E;  2P5O A;  2P1Q B;  3SPZ A;  4QND A;  4DTN A;  3CQ8 A;  3QEW A;  4DTU A;  3WSO A;  3LDB A;  4J2E A;  4FK2 A;  3QER A;  3TAE A;  4M3Z A;  2OVP B;  4EYW A;  3SUP A;  4I9Q A;  3OGK B;  1MMO G;  2JH8 A;  2OVQ B;  4ADN A;  2VJ5 A;  2FYO A;  3TL8 B;  4B08 A;  1FYZ E;  3NE6 A;  4E3S A;  1XL3 C;  4DTO A;  3RMB A;  1Q9X A;  1LDK E;  4X5M A;  2OYQ A;  4HCC A;  4KHS A;  4M3U A;  5H37 A;  2FW3 A;  3QNO A;  1WAJ A;  3QNN A;  2DY4 A;  3NAE A;  1XVF E;  4RL5 A;  4FJH A;  2OVR B;  3E4W A;  4KI4 A;  4DU4 A;  3UIQ A;  4J2B A;  3C6O B;  3HGL A;  3RMD A;  2DEB A;  2MZW B;  5IZ7 A;  3LDS A;  4DU1 A;  4DTR A;  2H4T A;  2P5G A;  3C95 A;  3SUO A;  4KHW A;  3S9H A;  3L0M A;  1XVD E;  1XVB E;  4FJL A;  4HCB A;  4DTM A;  4J2D A;  4M3X A;  1FZ7 E;  3L2O B;  3RWU A;  3SNN A;  1MHY G;  2QXF A;  3TAG A;  1FZ3 E;  4DTX A;  2LF6 A;  3TAB A;  4KI6 A;  2P1M B;  3CFP A;  4FJM A;  3SQ0 A;  4M3T A;  1XVC E;  4I6J B;  3C94 A;  2RCU A;  1FZ6 E;  1FZ5 E;  4JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...