3L25A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
b'DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l25A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l25A02
4IBDA 4IBIA 4IBEA 4IBJA 4IJFA 3L28A 4GHLA 3L29A 4IBFA 4IJEA 3KS4A 3L2AA 4IBGA 4GH9A 3L26A 4IBBA 3L25A 4LG2A 3FKEA 4IBKA 4GHAA 3KS8A 5BPVA 3L27A 4IBCA
chains in the Genus database with same CATH superfamily
4G4NA 3VLFB 3H4MA 4CIZA 3SASA 1OTRA 3RFWA 3K9PA 2IOUA 2R0IA 4IBEA 2JY6B 3LVWA 3WD4A 1OFHA 2QCUA 2KA6B 1NY5A 3A45A 5BR8M 2MGWA 2WSCF 2M5ZA 4G4OA 1GJSA 1YE9A 1L8QA 3HHWA 1GL6A 2OPFA 2JZ0A 3HHYA 3GPXA 2Z7JA 4LRSA 1N78A 2LWXA 2Y2LA 3KS4A 2QNJA 4M0DA 4B3MM 1XMOM 4NSOB 1SXJC 1ZMUA 2EJSA 4UN2B 5IREB 1C7YA 5E6JA 4NZ1A 1WR1B 1R4GA 2O25A 3KDSE 3KOYE 1DV0A 3KSXA 4AG5A 1I4WA 4LJ5A 3KXEC 2OOAA 3GRYA 4GC9A 4DV2M 2ZM6M 2QZ4A 2RGOA 5IT9S 3B74A 2L2DA 3HWSA 2XSZD 2VF8A 4M9XA 2C9CA 1QAOA 1NHWC 2Z8YM 3WHKA 3HY5A 3T1HM 2CP8A 2HCBA 2XGNA 2YR0A 2MJ5B 3IHPA 4IJEA 5KPRA 2CEAA 2L09A 2RRUA 2J5YA 3M7GA 5KQDA 1QZMA 3DA1A 3ZQJA 4MH0E 3EIEA 3JAMS 2DAGA 1HNZM 3Q8GA 1SXJE 1W5SA 2YNMD 3AV0A 4NOOB 2L7HA 1DO2A 2DHYA 2F5SA 4NRWA 4NXMM 5ITQA 1IFYA 1EAKA 4Z2KA 3ILKA 3GLGE 4JI0M 2I7PA 4HL4A 4NL4H 1IBKM 2CV0A 3CF0A 3B89A 1E94E 4FW9A 4II7A 3SHGB 4JI5M 2CHGA 4L4UA 3VK7A 2QHOB 3VKHA 1OGBA 2LVPC 3FUVA 1QQWA 3PXGA 1MU5A 3HJQA 3KP1E 1SXJA 3SMPA 4DV7M 3N3FA 1QAMA 1R2YA 4JI6M 4NZ3A 4QOZC 3VDPA 2HL7A 3CGWA 2R6FA 3GLGA 3GLGB 1XC8A 1Q3BA 4JI4M 1KYIA 2M60A 2V1CA 5L8RF 2UXDM 1YU1A 1J5EM 3JR4A 1IXZA 3R9XB 2LVQD 4AG6A 2ZAMA 3UJNA 2K0BX 2XFSA 1G71A 1LV7A 5IWAM 2FS1A 3SATA 3GQ4A 1OAOC 4X62M 4KODA 1Q3CA 1EIJA 4GHAA 1NJFA 4FCWA 2AHMA 1DGBA 2MROB 2DWZB 1YSYA 5BPVA 3GLIB 4I5SA 2XD5A 4OJPA 3T1YM 2CFOA 1E9RA 3FUXA 3A42A 4GKKM 2X49A 1H8PA 4QNMA 4GHLA 3HGIA 3T15A 1QAQA 2KZSA 4R7GA 4BLCA 4X65M 3QWLA 1NVMA 3E4RA 2R45A 1QUSA 4Z2IA 2ZBKB 1Z6TA 5E26A 3SAVA 3IG5A 3KFUG 3I4VA 5GKNA 2LTUA 1MX0A 1GL7A 4JI7M 2Y20A 1OIZA 4MGHA 4WP2A 1FNNA 3EIHA 2XH9A 3GLFE 3I4YA 3TWKA 2YQZA 3LCUA 4R71A 3NBIA 4B7FA 5ITTA 3GPPA 4FCTA 4Z2GA 3I01M 1Z59A 2G5GX 3IECA 5DFLA 3GPUA 4AI6A 2W82A 1WGLA 1WIVA 3AOEC 4DR3M 4NYUA 2FFJA 3GPYA 2Z4SA 2JZ1A 3AL0C 2DAEA 2DAMA 3T38A 1TGUA 3CF6E 4PD2A 4ZPXA 1ZQ9A 5ITXE 5KQ8A 1YU0A 1E88A 2MH8A 3HHXA 3GLFA 4EIWA 2X8AA 3U61A 3SHFA 4LF6M 2EO2A 5JI2E 3U6SA 8CATA 4AW4A 2VDBB 2LVNC 1OQYA 1TH4A 3WD3A 3A98B 4DR5M 1E6PA 3AFHA 2R65A 4D81A 5F3WA 4JV5M 2BWEA 3DOAA 4L78A 4OJ6A 3VK8A 3D8BA 4GRIA 2DWMA 4MB7A 3FKEA 3FRIA 2DKLA 1IQPA 1JR3D 4DR1M 2BJWA 1L6JA 1TTEA 2DAKA 4M0WA 2K9DA 4M9ZA 1YUEA 2R44A 3E46A 2JCHA 1TH3A 2LHGA 4Q7JA 4BBAA 3LW5F 1Z5AA 4IIWA 1AUAA 5LMUM 1K3WA 1L2DA 3TQSA 1HNWM 5DYGA 1YUBA 4PDGA 5ITYA 2ZANA 3QAUA 4I81A 4R3DA 1N32M 3FUUA 1KS0A 3R8FA 2F4VM 5FTLA 3L2AA 5FSWA 5DYIA 3WD0A 3T6PA 4MB5A 1VEKA 4MM3B 2JY8A 3GRVA 1TF0B 2K47A 4W5WA 2DVWB 1NJGA 4LFAM 4IBBA 1XXHE 1W1PA 2JE5A 2L4FA 3HZJA 3K2LA 4M9SA 4LF4M 4B08A 3B7NA 4YHHM 2UXCM 3WX7A 3J27B 4B3RM 4RF1A 3KOZE 3KOXE 1DGFA 2FOIC 2A5YB 2K6BA 3QYBA 4F1IA 2WSFF 2CE7A 1I94M 2Y2JA 4MGIE 3J81S 2KNAA 1WJ7A 2N35A 2QPAA 4LZJA 4IJFA 3PNVA 1XXHA 1ZMVA 1GLNA 1YLAA 4B7HA 4PCZA 3FUTA 3KSJA 3J2PB 4DUZM 4DV4M 1WXQA 4MB3A 3JR5A 4GKJM 3HJSA 4Y28F 3C3EA 2XFTA 3CF2A 1FJGM 3FUWA 1GVNA 1EFUB 4LF9M 1OFIA 2Y21A 1OJLA 4DBGB 1NNUC 3W68A 2UWXA 1W5TA 3ZCBB 3MJ5A 4FWDA 3M6AA 4AQYM 4DR7M 3TPZA 1E15A 1X37A 2KXEA 4GITA 4XK8F 1JB0F 3U5ZA 3U5ZB 4LCBA 4P17A 5EP1A 5KPTA 3B9PA 3PVSA 2Y0QA 2P5TA 4HEOA 4L8RC 4RKUF 2ZTDA 5ITRA 4CHTB 4IBIA 1H0GA 2BG1A 5JI3E 2FFFB 4NYYA 1SXJB 3WHLA 3U6LA 3HSHA 2BWBA 2XEPA 1N77A 1DGHA 2LH0A 2L4EA 4GIPA 3RGSA 1IY0A 1UM8A 1P3QQ 5FTKA 1PM5A 3WD2A 1UFZA 4NRVA 2EKKA 4FWHA 1NV8A 3M0EA 1G8PA 2R46A 2Y2GA 2DHRA 2C98A 3HU3A 3Q8XA 3E9SA 4IBGA 4RNAA 4OX9M 2R18A 1CK7A 3L25A 2G8LA 3SMSA 3BXWA 4NY2A 3FYCA 3K92A 2HKJA 3MMPA 5C18A 3GO8A 2CRUA 2LBCA 4OJLA 2O5RA 3TE6A 1VEGA 3VKGA 4LY6A 1G41A 2F5PA 2APLA 1IXSA 2X4AA 2NQ8C 3DFZA 1A5TA 1QUTA 4QHSA 4D80A 4DV0M 1QZEA 2OO9A 2D7EA 1HQYE 4LJ7A 2UXBM 4I8OA 2H1RA 3HJ8A 1D2NA 4HMEA 2C5RA 4G3OA 2CV2A 1C1KA 2DENA 2JY5A 2FN2A 2JP7A 2XSZA 1WGNA 4CGYB 4CJ6A 1HT1E 4MGZE 4ANRA 3LVVA 4HLQA 1HNXM 2F5NA 2Y2HA 4OUIA 1G59A 1J7KA 4LJ4A 2QQ8A 2R62A 2QBYA 2LXEA 2BNKA 4NZ5A 3UGJA 3DZDA 2BJVA 4GEWA 4GH9A 4XGIA 2DZNB 3ZH9B 4LG2A 1SG9A 1QANA 4K0KM 4AKGA 1TDHA 4JN6A 3SBJA 3SYKA 1E6RA 4NXNM 1AIWA 3HX3A 3KP0E 2JXNA 2RKOA 4B7GA 1D0MA 5IZ7D 5EXTA 4PT5A 1XMQM 1IBMM 4IBJA 2C99A 4Z2HA 3FYDA 3GLFB 1O6IA 3GLHE 4BB9A 3U6MA 3MK6A 3U61B 2F5OA 2O01F 3ZC7B 2DZOB 3U60A 3AJIB 3U60B 1XNQM 4MB4A 1QVRA 5EXXA 3GRRA 4GC5A 2KNZA 4NSRA 5EXPA 5ITXA 1ORYB 4YY3M 4Z2LA 1EE8A 2MR9A 5EXSA 4LJAA 3GLHA 3L26A 1ZMWA 1Q39A 3MQLA 4IBKA 4L6V6 1N75A 1R5LA 3H4JA 1H0IA 1GO5A 4DR4M 4LJ9A 4NZ4A 1KSFX 1NHGC 3SFZA 3K9OA 2UU9M 1J7MA 4ITQA 1W1VA 1QDTA 1N34M 2DI0A 3SC3A 4TUWA 2ERCA 1IM2A 2UUAM 3SAWA 1VG5A 2V1UA 1GOIA 2ZTCA 1NNJA 1G3IA 4WW0A 2XZUA 5FLXS 4QHTA 1IN5A 3AOEA 3J80S 1L2BA 1GKIA 1Q02A 1WHCA 2G3QA 3NWLA 4LGYA 5KO3A 2JNHA 4DR6M 4NC6A 1T3TA 2KHHA 4LFBM 2C96A 2KRKA 4OJOA 1IXRC 1D0LA 1VQ1A 2FNAA 2QSFX 4KO8A 2DWNA 4Z6YA 1SXJD 4AZFA 3W0LB 3IG8A 5C1BA 3M7PA 3U6PA 1CUKA 3I04M 4CISA 4JI2M 1HJPA 1J09A 3LCVB 4IBCA 3GP1A 1V34A 4REZA 3BOSA 2JY7A 1E8BA 1DO0A 1HQCA 1IY1A 4RF0A 1L1ZA 1XWIA 3UMMA 3U6QA 4AKIA 3UZUA 4OJ5A 1TR8A 4LJ6A 1XXHB 2Q2EB 1HT2E 2Z4RA 3AKZA 3B7ZA 4DV1M 2Y2OA 2CV1A 2VQEM 1KFVA 2LVAA 1S3SA 3W0FA 2GQFA 1F4IA 3BBZA 3E21A 1GJTA 1OAIA 1CXWA 1TH2A 2VIIA 2WSEF 2DZLA 1QDRA 3SARA 2QENA 3K1JA 3FTEA 4AKHA 2V6ZM 1R2ZA 4FWGA 1PJTA 1E6ZA 4G4RA 1E32A 1JR3E 1K3XA 3THGA 3HU2A 3RE8A 3VDUA 1YU4A 1AIPC 1IN6A 1JQJC 1RU3A 2KW0A 1PGYA 4IBDA 4LZZA 2XZFA 2JWSA 4LF8M 1VEJA 3FE3A 4LFCM 5EQTA 2FH0A 3PNYA 1LTMA 3C9PA 4MGYE 4LRTA 5FTMA 1JR3A 3D8LA 3U6DA 3LQQA 1PJQA 2D49A 1DGHB 2FE8A 2XD1A 3KW6A 1XB2B 3A46A 1E6NA 2VQFM 1W1TA 4I4LA 3PFIA 1DGGA 2Y2QA 4D82A 2HAKA 1V33A 3HKPA 3TWMA 2KZUA 4LJ8A 4DUYM 3C58A 1T43A 1MN3A 4KLNA 4DR2M 4Z8XA 1N36M 1QYRA 3C3DA 1G4AE 1UR8A 3FTDA 3MHVC 2ZAOA 4TX8A 2B3TA 1R7RA 2GNOA 2Y0TA 3L27A 2D7GA 3LQRA 5EP4A 3FTCA 4KHPM 1VDDA 3FRHA 4HMDA 4G4QA 1HR0M 1IXSB 2EUCA 1YU2A 3QYEA 2UUBM 4OVZA 4OVZB 4LGMA 2HHHM 1Z5BA 3KOWE 2DXIA 5EP3A 4WURA 1E9SA 2DWLA 2Y2NA 3HHZA 3LMMA 3U6CA 1GABA 2YFQA 2LHCA 4MGKE 4S12A 3GLIE 4XBOA 4B3SM 1N33M 2DNAA 1PDCA 1MJGM 3KVWA 2CHQA 3WD1A 4Z2JA 5DNYA 5ITUA 1BVSA 4FVMA 5EJCA 3SYLA 1ZAEA 2J7OA 3FD9A 4FD2A 3RGPA 2QBYB 2Y2PA 1R6BX 4JI3M 1UR9A 4L15A 3GLIA 1ZV1A 4JI1M 1XNRM 3CTWB 2E5LM 2XLJA 4B3TM 3KS8A 3GQ5A 4KT0F 2CUZA 4JXJA 3NBXX 5EP2A 1QO6A 2H5XA 4QOSA 1ED7A 2KEBA 5FTJA 1W1YA 4PDIA 7CATA 3L28A 3V76A 3TL4X 1VDLA 4DV3M 4F2LA 5KPZA 1IN4A 1T6OA 3F92A 4X64M 4IBFA 3W67A 5A2QS 1PJJA 3AOGA 3HU1A 2EA0A 2KNVA 1IBLM 2XF3A 2CWBA 1OIPA 2C9OA 2L6OA 2VF7A 4GMQA 5LMNM 1Y8GA 2QP9X 1IN7A 2JUJA 2RGHA 3J7BA 1PJIA 4LF5M 4QNLA 2R4EA 3GLHB 4X66M 3U6OA 4LF7M 2V5OA 2CHVA 2D7HA 4FCVA 1K82A 2Y2KA 2Y2MA 3J7AS 3SAUA 2RTSA 2JA2A 1YU3A 5FTNA 2J7NA 1IN8A 2LNHC 4A3VB 1Z5CA 2Y2IA 2OOBA 2UUCM 2LVOC 4JI8M 2OQ4A 2I7NA 4OU7A 4DV6M 4JYAM 2KDLA 1XHBA 3L29A 1IY2A 3K8ZA 4DV5M 1GXDA 3TWLA 3FTFA 1NO1A 1H6UA 1NV9A 4HMCA 4QNRA 1OGGA 4L16A 1L1TA 2L7IA 4OW0A 3GRUA 1PRBA 1OKSA 1D0KA 5H37D 3OTOM 3GQ3A 2KRUA 3U6EA 1GPFA 3I51A 2DAIA 4G6ZA 3VFDA 3HONA 3UK6A 1NSFA 2HWJA 2Z3XA 3B7QA 2F5QA 2WZJA 1V92A 1L2CA 1PJSA 2EKFA 2R4JA 4P16A 1NY6A 1TDZA
chains in the Genus database with same CATH topology
4G4NA 3VLFB 3H4MA 3SASA 3RFWA 2IOUA 4IBEA 3LVWA 1OFHA 2QCUA 2KA6B 1NY5A 3A45A 5BR8M 4G4OA 2M5ZA 1YE9A 1L8QA 3HHWA 1GL6A 2OPFA 3HHYA 3GPXA 2Z7JA 4LRSA 1N78A 2LWXA 2Y2LA 3KS4A 4B3MM 4M0DA 1XMOM 4NSOB 1SXJC 5IREB 5E6JA 4NZ1A 3KDSE 3KOYE 3KSXA 4AG5A 1I4WA 4LJ5A 3KXEC 4DV2M 3GRYA 4GC9A 2ZM6M 2QZ4A 2RGOA 5IT9S 3HWSA 2XSZD 4M9XA 2C9CA 1QAOA 1NHWC 3WHKA 3T1HM 2HCBA 2XGNA 2YR0A 4IJEA 5KPRA 2CEAA 2L09A 3M7GA 5KQDA 1QZMA 3DA1A 4MH0E 3EIEA 3JAMS 1HNZM 1SXJE 1W5SA 2YNMD 3AV0A 4NOOB 2L7HA 1DO2A 2F5SA 4NRWA 4NXMM 5ITQA 3ILKA 4JI0M 2I7PA 4HL4A 4NL4H 1IBKM 2CV0A 3CF0A 4FW9A 1E94E 4II7A 3SHGB 4JI5M 2CHGA 4L4UA 3VK7A 3VKHA 4QNLA 3FUVA 1QQWA 3PXGA 1MU5A 3HJQA 3KP1E 1SXJA 3SMPA 4DV7M 3N3FA 1QAMA 1R2YA 4JI6M 4NZ3A 4QOZC 3VDPA 2HL7A 3GLGA 3GLGB 1XC8A 1Q3BA 4JI4M 1KYIA 2M60A 2V1CA 2UXDM 1YU1A 1J5EM 3JR4A 1IXZA 3R9XB 4AG6A 2ZAMA 3UJNA 2XFSA 1LV7A 5IWAM 3SATA 3GQ4A 4X62M 4KODA 1Q3CA 4GHAA 1NJFA 4FCWA 2AHMA 1DGBA 5BPVA 2DWZB 1YSYA 3GLIB 2XD5A 4I5SA 4OJPA 3T1YM 2CFOA 1E9RA 3FUXA 3A42A 4GKKM 2X49A 4QNMA 4GHLA 3HGIA 3T15A 1QAQA 2KZSA 4R7GA 4BLCA 4X65M 3QWLA 1NVMA 3E4RA 2R45A 2ZBKB 1Z6TA 5E26A 3SAVA 3IG5A 3KFUG 3I4VA 5GKNA 4JI7M 1MX0A 1GL7A 2Y20A 4MGHA 1FNNA 3EIHA 2XH9A 3I4YA 3TWKA 2YQZA 2Y2MA 3GPPA 3NBIA 4B7FA 5ITTA 4FCTA 1Z59A 2G5GX 3GPUA 4AI6A 2W82A 4DR3M 3AOEC 4NYUA 2FFJA 3GPYA 2Z4SA 3AL0C 3T38A 1TGUA 3CF6E 4PD2A 4ZPXA 1ZQ9A 5ITXE 5KQ8A 1YU0A 3GLFA 3HHXA 4EIWA 2X8AA 3U61A 3SHFA 4LF6M 2EO2A 5JI2E 3U6SA 8CATA 4AW4A 1TH4A 3A98B 4DR5M 3AFHA 2R65A 4D81A 5F3WA 4JV5M 3DOAA 4L78A 4OJ6A 3VK8A 3D8BA 4GRIA 2DWMA 4MB7A 3FKEA 1IQPA 1JR3D 4DR1M 2BJWA 4M0WA 4M9ZA 1YUEA 2JCHA 1TH3A 4BBAA 4IIWA 1Z5AA 5LMUM 1K3WA 1L2DA 1HNWM 3TQSA 5DYGA 1YUBA 4PDGA 5ITYA 2ZANA 3QAUA 4I81A 4R3DA 1N32M 3FUUA 3R8FA 2F4VM 5FTLA 3L2AA 5FSWA 5DYIA 4MM3B 3GRVA 2K47A 4W5WA 2DVWB 1NJGA 4LFAM 4IBBA 2JE5A 3K2LA 4M9SA 4LF4M 4B08A 4YHHM 2UXCM 3WX7A 3J27B 4B3RM 4RF1A 3KOZE 3KOXE 1DGFA 2FOIC 2A5YB 1I94M 2CE7A 2Y2JA 4MGIE 3J81S 2QPAA 4LZJA 4IJFA 3PNVA 1XXHA 1GLNA 4B7HA 4PCZA 3FUTA 3KSJA 3J2PB 4DUZM 4DV4M 1WXQA 3JR5A 4GKJM 3HJSA 2XFTA 3CF2A 1FJGM 3FUWA 1GVNA 4LF9M 1OFIA 2Y21A 1OJLA 1NNUC 2UWXA 1W5TA 3ZCBB 3MJ5A 4FWDA 3M6AA 4AQYM 4DR7M 3TPZA 1X37A 2KXEA 4GITA 3U5ZA 3U5ZB 4LCBA 5EP1A 5KPTA 3B9PA 3PVSA 2Y0QA 2P5TA 4L8RC 5ITRA 4CHTB 4IBIA 2BG1A 2FFFB 5JI3E 4NYYA 1SXJB 3WHLA 3U6LA 3HSHA 2XEPA 1N77A 1DGHA 2LH0A 4GIPA 3RGSA 1IY0A 1UM8A 5FTKA 1PM5A 4NRVA 4FWHA 3M0EA 1G8PA 2R46A 2Y2GA 2DHRA 2C98A 3HU3A 3Q8XA 3E9SA 4IBGA 4RNAA 4OX9M 2R18A 3L25A 2G8LA 3SMSA 4NY2A 3FYCA 3K92A 2HKJA 5C18A 3GO8A 4OJLA 2O5RA 3TE6A 3VKGA 4LY6A 1G41A 2F5PA 2X4AA 2NQ8C 3DFZA 4D80A 4QHSA 4DV0M 2D7EA 1HQYE 4LJ7A 2UXBM 4I8OA 2H1RA 3HJ8A 1D2NA 2C5RA 2CV2A 1C1KA 2XSZA 4CGYB 1HT1E 4MGZE 1HNXM 3LVVA 4HLQA 2F5NA 2Y2HA 4OUIA 1G59A 1J7KA 4LJ4A 2R62A 2QBYA 2LXEA 2BNKA 4NZ5A 3UGJA 3DZDA 2BJVA 4GH9A 4XGIA 2DZNB 3ZH9B 4LG2A 1QANA 4K0KM 4AKGA 1TDHA 4JN6A 3SBJA 3SYKA 4NXNM 3KP0E 2RKOA 4B7GA 5IZ7D 5EXTA 4PT5A 1XMQM 1IBMM 4IBJA 2C99A 3FYDA 3GLFB 4BB9A 3U6MA 3MK6A 3U61B 2F5OA 3ZC7B 2DZOB 3U60A 3AJIB 3U60B 1XNQM 1QVRA 5EXXA 3GRRA 4GC5A 4NSRA 5EXPA 5ITXA 1ORYB 4YY3M 1EE8A 5EXSA 4LJAA 3GLHA 3L26A 1Q39A 4IBKA 1N75A 4DR4M 4LJ9A 4NZ4A 1KSFX 1NHGC 3SFZA 2UU9M 4ITQA 1N34M 3SC3A 4TUWA 2ERCA 1IM2A 2UUAM 3SAWA 2V1UA 1NNJA 1G3IA 4WW0A 2XZUA 5FLXS 4QHTA 1IN5A 3AOEA 3J80S 1L2BA 1GKIA 3NWLA 4LGYA 5KO3A 4DR6M 1T3TA 4LFBM 2C96A 2KRKA 4OJOA 1IXRC 2FNAA 2DWNA 4KO8A 4Z6YA 1SXJD 4AZFA 3W0LB 3IG8A 5C1BA 3U6PA 4CISA 4JI2M 1J09A 4IBCA 3GP1A 4REZA 3BOSA 1DO0A 1HQCA 1IY1A 4RF0A 1L1ZA 1XWIA 3UMMA 3U6QA 4OJ5A 3UZUA 4LJ6A 1XXHB 2Q2EB 1HT2E 2Z4RA 3AKZA 4DV1M 2Y2OA 2CV1A 2VQEM 1KFVA 1S3SA 3W0FA 1TH2A 2VIIA 3SARA 2QENA 3K1JA 3FTEA 4AKHA 2V6ZM 1R2ZA 4FWGA 4G4RA 1E32A 1K3XA 3THGA 3HU2A 3RE8A 3VDUA 1YU4A 1IN6A 1JQJC 2KW0A 4LZZA 4IBDA 2XZFA 4LF8M 4AKIA 4LFCM 5EQTA 4MGYE 3PNYA 5FTMA 4LRTA 1JR3A 3D8LA 3U6DA 3LQQA 1DGHB 2FE8A 2XD1A 3KW6A 3A46A 2VQFM 4I4LA 3PFIA 1DGGA 2Y2QA 4D82A 3HKPA 3TWMA 2KZUA 4LJ8A 4DUYM 3C58A 4KLNA 4DR2M 4Z8XA 1N36M 1QYRA 1G4AE 3FTDA 3MHVC 2ZAOA 1R7RA 2Y0TA 3L27A 2D7GA 3LQRA 5EP4A 3FTCA 4KHPM 1VDDA 4G4QA 1HR0M 1IXSB 2EUCA 1YU2A 2UUBM 4OVZA 4OVZB 4LGMA 2HHHM 1Z5BA 3KOWE 2DXIA 5EP3A 4WURA 1E9SA 2DWLA 2Y2NA 3HHZA 3LMMA 3U6CA 2YFQA 4MGKE 4S12A 1N33M 4XBOA 4B3SM 3KVWA 2CHQA 5DNYA 5ITUA 5EJCA 4FVMA 3SYLA 1ZAEA 3FD9A 2J7OA 4FD2A 3RGPA 2QBYB 2Y2PA 1R6BX 4JI3M 4L15A 3GLIA 4JI1M 1XNRM 3CTWB 2E5LM 2XLJA 4B3TM 3KS8A 3GQ5A 5EP2A 2CUZA 4JXJA 4QOSA 2KEBA 5FTJA 4PDIA 7CATA 3L28A 3TL4X 4DV3M 5KPZA 1IN4A 4X64M 4IBFA 5A2QS 1PJJA 3AOGA 3HU1A 2EA0A 1IBLM 2XF3A 2C9OA 2L6OA 4GMQA 5LMNM 2QP9X 3J7BA 1IN7A 2RGHA 1PJIA 4LF5M 2R4EA 3GLHB 4X66M 3U6OA 4LF7M 2CHVA 2D7HA 4FCVA 1K82A 2Y2KA 3J7AS 3SAUA 2JA2A 1YU3A 5FTNA 2J7NA 1IN8A 2LNHC 4A3VB 1Z5CA 2Y2IA 2UUCM 4JI8M 2OQ4A 2I7NA 4OU7A 4DV6M 4JYAM 3L29A 1XHBA 3K8ZA 1IY2A 4DV5M 3TWLA 3FTFA 1H6UA 4QNRA 4L16A 1L1TA 2L7IA 4OW0A 3GRUA 5H37D 3U6EA 3OTOM 3GQ3A 2KRUA 3I51A 4G6ZA 3VFDA 3HONA 3UK6A 1NSFA 2Z3XA 2F5QA 1L2CA 2R4JA 4P16A 1NY6A 1TDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBD A;  4IBI A;  4IBE A;  4IBJ A;  4IJF A;  3L28 A;  4GHL A;  3L29 A;  4IBF A;  4IJE A;  3KS4 A;  3L2A A;  4IBG A;  4GH9 A;  3L26 A;  4IBB A;  3L25 A;  4LG2 A;  3FKE A;  4IBK A;  4GHA A;  3KS8 A;  5BPV A;  3L27 A;  4IBC A; 
#chains in the Genus database with same CATH topology
 4G4N A;  3VLF B;  3H4M A;  4CIZ A;  3SAS A;  1OTR A;  3RFW A;  3K9P A;  2IOU A;  2R0I A;  4IBE A;  2JY6 B;  3LVW A;  3WD4 A;  1OFH A;  2QCU A;  2KA6 B;  1NY5 A;  3A45 A;  5BR8 M;  2MGW A;  2WSC F;  2M5Z A;  4G4O A;  1GJS A;  1YE9 A;  1L8Q A;  3HHW A;  1GL6 A;  2OPF A;  2JZ0 A;  3HHY A;  3GPX A;  2Z7J A;  4LRS A;  1N78 A;  2LWX A;  2Y2L A;  3KS4 A;  2QNJ A;  4M0D A;  4B3M M;  1XMO M;  4NSO B;  1SXJ C;  1ZMU A;  2EJS A;  4UN2 B;  5IRE B;  1C7Y A;  5E6J A;  4NZ1 A;  1WR1 B;  1R4G A;  2O25 A;  3KDS E;  3KOY E;  1DV0 A;  3KSX A;  4AG5 A;  1I4W A;  4LJ5 A;  3KXE C;  2OOA A;  3GRY A;  4GC9 A;  4DV2 M;  2ZM6 M;  2QZ4 A;  2RGO A;  5IT9 S;  3B74 A;  2L2D A;  3HWS A;  2XSZ D;  2VF8 A;  4M9X A;  2C9C A;  1QAO A;  1NHW C;  2Z8Y M;  3WHK A;  3HY5 A;  3T1H M;  2CP8 A;  2HCB A;  2XGN A;  2YR0 A;  2MJ5 B;  3IHP A;  4IJE A;  5KPR A;  2CEA A;  2L09 A;  2RRU A;  2J5Y A;  3M7G A;  5KQD A;  1QZM A;  3DA1 A;  3ZQJ A;  4MH0 E;  3EIE A;  3JAM S;  2DAG A;  1HNZ M;  3Q8G A;  1SXJ E;  1W5S A;  2YNM D;  3AV0 A;  4NOO B;  2L7H A;  1DO2 A;  2DHY A;  2F5S A;  4NRW A;  4NXM M;  5ITQ A;  1IFY A;  1EAK A;  4Z2K A;  3ILK A;  3GLG E;  4JI0 M;  2I7P A;  4HL4 A;  4NL4 H;  1IBK M;  2CV0 A;  3CF0 A;  3B89 A;  1E94 E;  4FW9 A;  4II7 A;  3SHG B;  4JI5 M;  2CHG A;  4L4U A;  3VK7 A;  2QHO B;  3VKH A;  1OGB A;  2LVP C;  3FUV A;  1QQW A;  3PXG A;  1MU5 A;  3HJQ A;  3KP1 E;  1SXJ A;  3SMP A;  4DV7 M;  3N3F A;  1QAM A;  1R2Y A;  4JI6 M;  4NZ3 A;  4QOZ C;  3VDP A;  2HL7 A;  3CGW A;  2R6F A;  3GLG A;  3GLG B;  1XC8 A;  1Q3B A;  4JI4 M;  1KYI A;  2M60 A;  2V1C A;  5L8R F;  2UXD M;  1YU1 A;  1J5E M;  3JR4 A;  1IXZ A;  3R9X B;  2LVQ D;  4AG6 A;  2ZAM A;  3UJN A;  2K0B X;  2XFS A;  1G71 A;  1LV7 A;  5IWA M;  2FS1 A;  3SAT A;  3GQ4 A;  1OAO C;  4X62 M;  4KOD A;  1Q3C A;  1EIJ A;  4GHA A;  1NJF A;  4FCW A;  2AHM A;  1DGB A;  2MRO B;  2DWZ B;  1YSY A;  5BPV A;  3GLI B;  4I5S A;  2XD5 A;  4OJP A;  3T1Y M;  2CFO A;  1E9R A;  3FUX A;  3A42 A;  4GKK M;  2X49 A;  1H8P A;  4QNM A;  4GHL A;  3HGI A;  3T15 A;  1QAQ A;  2KZS A;  4R7G A;  4BLC A;  4X65 M;  3QWL A;  1NVM A;  3E4R A;  2R45 A;  1QUS A;  4Z2I A;  2ZBK B;  1Z6T A;  5E26 A;  3SAV A;  3IG5 A;  3KFU G;  3I4V A;  5GKN A;  2LTU A;  1MX0 A;  1GL7 A;  4JI7 M;  2Y20 A;  1OIZ A;  4MGH A;  4WP2 A;  1FNN A;  3EIH A;  2XH9 A;  3GLF E;  3I4Y A;  3TWK A;  2YQZ A;  3LCU A;  4R71 A;  3NBI A;  4B7F A;  5ITT A;  3GPP A;  4FCT A;  4Z2G A;  3I01 M;  1Z59 A;  2G5G X;  3IEC A;  5DFL A;  3GPU A;  4AI6 A;  2W82 A;  1WGL A;  1WIV A;  3AOE C;  4DR3 M;  4NYU A;  2FFJ A;  3GPY A;  2Z4S A;  2JZ1 A;  3AL0 C;  2DAE A;  2DAM A;  3T38 A;  1TGU A;  3CF6 E;  4PD2 A;  4ZPX A;  1ZQ9 A;  5ITX E;  5KQ8 A;  1YU0 A;  1E88 A;  2MH8 A;  3HHX A;  3GLF A;  4EIW A;  2X8A A;  3U61 A;  3SHF A;  4LF6 M;  2EO2 A;  5JI2 E;  3U6S A;  8CAT A;  4AW4 A;  2VDB B;  2LVN C;  1OQY A;  1TH4 A;  3WD3 A;  3A98 B;  4DR5 M;  1E6P A;  3AFH A;  2R65 A;  4D81 A;  5F3W A;  4JV5 M;  2BWE A;  3DOA A;  4L78 A;  4OJ6 A;  3VK8 A;  3D8B A;  4GRI A;  2DWM A;  4MB7 A;  3FKE A;  3FRI A;  2DKL A;  1IQP A;  1JR3 D;  4DR1 M;  2BJW A;  1L6J A;  1TTE A;  2DAK A;  4M0W A;  2K9D A;  4M9Z A;  1YUE A;  2R44 A;  3E46 A;  2JCH A;  1TH3 A;  2LHG A;  4Q7J A;  4BBA A;  3LW5 F;  1Z5A A;  4IIW A;  1AUA A;  5LMU M;  1K3W A;  1L2D A;  3TQS A;  1HNW M;  5DYG A;  1YUB A;  4PDG A;  5ITY A;  2ZAN A;  3QAU A;  4I81 A;  4R3D A;  1N32 M;  3FUU A;  1KS0 A;  3R8F A;  2F4V M;  5FTL A;  3L2A A;  5FSW A;  5DYI A;  3WD0 A;  3T6P A;  4MB5 A;  1VEK A;  4MM3 B;  2JY8 A;  3GRV A;  1TF0 B;  2K47 A;  4W5W A;  2DVW B;  1NJG A;  4LFA M;  4IBB A;  1XXH E;  1W1P A;  2JE5 A;  2L4F A;  3HZJ A;  3K2L A;  4M9S A;  4LF4 M;  4B08 A;  3B7N A;  4YHH M;  2UXC M;  3WX7 A;  3J27 B;  4B3R M;  4RF1 A;  3KOZ E;  3KOX E;  1DGF A;  2FOI C;  2A5Y B;  2K6B A;  3QYB A;  4F1I A;  2WSF F;  2CE7 A;  1I94 M;  2Y2J A;  4MGI E;  3J81 S;  2KNA A;  1WJ7 A;  2N35 A;  2QPA A;  4LZJ A;  4IJF A;  3PNV A;  1XXH A;  1ZMV A;  1GLN A;  1YLA A;  4B7H A;  4PCZ A;  3FUT A;  3KSJ A;  3J2P B;  4DUZ M;  4DV4 M;  1WXQ A;  4MB3 A;  3JR5 A;  4GKJ M;  3HJS A;  4Y28 F;  3C3E A;  2XFT A;  3CF2 A;  1FJG M;  3FUW A;  1GVN A;  1EFU B;  4LF9 M;  1OFI A;  2Y21 A;  1OJL A;  4DBG B;  1NNU C;  3W68 A;  2UWX A;  1W5T A;  3ZCB B;  3MJ5 A;  4FWD A;  3M6A A;  4AQY M;  4DR7 M;  3TPZ A;  1E15 A;  1X37 A;  2KXE A;  4GIT A;  4XK8 F;  1JB0 F;  3U5Z A;  3U5Z B;  4LCB A;  4P17 A;  5EP1 A;  5KPT A;  3B9P A;  3PVS A;  2Y0Q A;  2P5T A;  4HEO A;  4L8R C;  4RKU F;  2ZTD A;  5ITR A;  4CHT B;  4IBI A;  1H0G A;  2BG1 A;  5JI3 E;  2FFF B;  4NYY A;  1SXJ B;  3WHL A;  3U6L A;  3HSH A;  2BWB A;  2XEP A;  1N77 A;  1DGH A;  2LH0 A;  2L4E A;  4GIP A;  3RGS A;  1IY0 A;  1UM8 A;  1P3Q Q;  5FTK A;  1PM5 A;  3WD2 A;  1UFZ A;  4NRV A;  2EKK A;  4FWH A;  1NV8 A;  3M0E A;  1G8P A;  2R46 A;  2Y2G A;  2DHR A;  2C98 A;  3HU3 A;  3Q8X A;  3E9S A;  4IBG A;  4RNA A;  4OX9 M;  2R18 A;  1CK7 A;  3L25 A;  2G8L A;  3SMS A;  3BXW A;  4NY2 A;  3FYC A;  3K92 A;  2HKJ A;  3MMP A;  5C18 A;  3GO8 A;  2CRU A;  2LBC A;  4OJL A;  2O5R A;  3TE6 A;  1VEG A;  3VKG A;  4LY6 A;  1G41 A;  2F5P A;  2APL A;  1IXS A;  2X4A A;  2NQ8 C;  3DFZ A;  1A5T A;  1QUT A;  4QHS A;  4D80 A;  4DV0 M;  1QZE A;  2OO9 A;  2D7E A;  1HQY E;  4LJ7 A;  2UXB M;  4I8O A;  2H1R A;  3HJ8 A;  1D2N A;  4HME A;  2C5R A;  4G3O A;  2CV2 A;  1C1K A;  2DEN A;  2JY5 A;  2FN2 A;  2JP7 A;  2XSZ A;  1WGN A;  4CGY B;  4CJ6 A;  1HT1 E;  4MGZ E;  4ANR A;  3LVV A;  4HLQ A;  1HNX M;  2F5N A;  2Y2H A;  4OUI A;  1G59 A;  1J7K A;  4LJ4 A;  2QQ8 A;  2R62 A;  2QBY A;  2LXE A;  2BNK A;  4NZ5 A;  3UGJ A;  3DZD A;  2BJV A;  4GEW A;  4GH9 A;  4XGI A;  2DZN B;  3ZH9 B;  4LG2 A;  1SG9 A;  1QAN A;  4K0K M;  4AKG A;  1TDH A;  4JN6 A;  3SBJ A;  3SYK A;  1E6R A;  4NXN M;  1AIW A;  3HX3 A;  3KP0 E;  2JXN A;  2RKO A;  4B7G A;  1D0M A;  5IZ7 D;  5EXT A;  4PT5 A;  1XMQ M;  1IBM M;  4IBJ A;  2C99 A;  4Z2H A;  3FYD A;  3GLF B;  1O6I A;  3GLH E;  4BB9 A;  3U6M A;  3MK6 A;  3U61 B;  2F5O A;  2O01 F;  3ZC7 B;  2DZO B;  3U60 A;  3AJI B;  3U60 B;  1XNQ M;  4MB4 A;  1QVR A;  5EXX A;  3GRR A;  4GC5 A;  2KNZ A;  4NSR A;  5EXP A;  5ITX A;  1ORY B;  4YY3 M;  4Z2L A;  1EE8 A;  2MR9 A;  5EXS A;  4LJA A;  3GLH A;  3L26 A;  1ZMW A;  1Q39 A;  3MQL A;  4IBK A;  4L6V 6;  1N75 A;  1R5L A;  3H4J A;  1H0I A;  1GO5 A;  4DR4 M;  4LJ9 A;  4NZ4 A;  1KSF X;  1NHG C;  3SFZ A;  3K9O A;  2UU9 M;  1J7M A;  4ITQ A;  1W1V A;  1QDT A;  1N34 M;  2DI0 A;  3SC3 A;  4TUW A;  2ERC A;  1IM2 A;  2UUA M;  3SAW A;  1VG5 A;  2V1U A;  1GOI A;  2ZTC A;  1NNJ A;  1G3I A;  4WW0 A;  2XZU A;  5FLX S;  4QHT A;  1IN5 A;  3AOE A;  3J80 S;  1L2B A;  1GKI A;  1Q02 A;  1WHC A;  2G3Q A;  3NWL A;  4LGY A;  5KO3 A;  2JNH A;  4DR6 M;  4NC6 A;  1T3T A;  2KHH A;  4LFB M;  2C96 A;  2KRK A;  4OJO A;  1IXR C;  1D0L A;  1VQ1 A;  2FNA A;  2QSF X;  4KO8 A;  2DWN A;  4Z6Y A;  1SXJ D;  4AZF A;  3W0L B;  3IG8 A;  5C1B A;  3M7P A;  3U6P A;  1CUK A;  3I04 M;  4CIS A;  4JI2 M;  1HJP A;  1J09 A;  3LCV B;  4IBC A;  3GP1 A;  1V34 A;  4REZ A;  3BOS A;  2JY7 A;  1E8B A;  1DO0 A;  1HQC A;  1IY1 A;  4RF0 A;  1L1Z A;  1XWI A;  3UMM A;  3U6Q A;  4AKI A;  3UZU A;  4OJ5 A;  1TR8 A;  4LJ6 A;  1XXH B;  2Q2E B;  1HT2 E;  2Z4R A;  3AKZ A;  3B7Z A;  4DV1 M;  2Y2O A;  2CV1 A;  2VQE M;  1KFV A;  2LVA A;  1S3S A;  3W0F A;  2GQF A;  1F4I A;  3BBZ A;  3E21 A;  1GJT A;  1OAI A;  1CXW A;  1TH2 A;  2VII A;  2WSE F;  2DZL A;  1QDR A;  3SAR A;  2QEN A;  3K1J A;  3FTE A;  4AKH A;  2V6Z M;  1R2Z A;  4FWG A;  1PJT A;  1E6Z A;  4G4R A;  1E32 A;  1JR3 E;  1K3X A;  3THG A;  3HU2 A;  3RE8 A;  3VDU A;  1YU4 A;  1AIP C;  1IN6 A;  1JQJ C;  1RU3 A;  2KW0 A;  1PGY A;  4IBD A;  4LZZ A;  2XZF A;  2JWS A;  4LF8 M;  1VEJ A;  3FE3 A;  4LFC M;  5EQT A;  2FH0 A;  3PNY A;  1LTM A;  3C9P A;  4MGY E;  4LRT A;  5FTM A;  1JR3 A;  3D8L A;  3U6D A;  3LQQ A;  1PJQ A;  2D49 A;  1DGH B;  2FE8 A;  2XD1 A;  3KW6 A;  1XB2 B;  3A46 A;  1E6N A;  2VQF M;  1W1T A;  4I4L A;  3PFI A;  1DGG A;  2Y2Q A;  4D82 A;  2HAK A;  1V33 A;  3HKP A;  3TWM A;  2KZU A;  4LJ8 A;  4DUY M;  3C58 A;  1T43 A;  1MN3 A;  4KLN A;  4DR2 M;  4Z8X A;  1N36 M;  1QYR A;  3C3D A;  1G4A E;  1UR8 A;  3FTD A;  3MHV C;  2ZAO A;  4TX8 A;  2B3T A;  1R7R A;  2GNO A;  2Y0T A;  3L27 A;  2D7G A;  3LQR A;  5EP4 A;  3FTC A;  4KHP M;  1VDD A;  3FRH A;  4HMD A;  4G4Q A;  1HR0 M;  1IXS B;  2EUC A;  1YU2 A;  3QYE A;  2UUB M;  4OVZ A;  4OVZ B;  4LGM A;  2HHH M;  1Z5B A;  3KOW E;  2DXI A;  5EP3 A;  4WUR A;  1E9S A;  2DWL A;  2Y2N A;  3HHZ A;  3LMM A;  3U6C A;  1GAB A;  2YFQ A;  2LHC A;  4MGK E;  4S12 A;  3GLI E;  4XBO A;  4B3S M;  1N33 M;  2DNA A;  1PDC A;  1MJG M;  3KVW A;  2CHQ A;  3WD1 A;  4Z2J A;  5DNY A;  5ITU A;  1BVS A;  4FVM A;  5EJC A;  3SYL A;  1ZAE A;  2J7O A;  3FD9 A;  4FD2 A;  3RGP A;  2QBY B;  2Y2P A;  1R6B X;  4JI3 M;  1UR9 A;  4L15 A;  3GLI A;  1ZV1 A;  4JI1 M;  1XNR M;  3CTW B;  2E5L M;  2XLJ A;  4B3T M;  3KS8 A;  3GQ5 A;  4KT0 F;  2CUZ A;  4JXJ A;  3NBX X;  5EP2 A;  1QO6 A;  2H5X A;  4QOS A;  1ED7 A;  2KEB A;  5FTJ A;  1W1Y A;  4PDI A;  7CAT A;  3L28 A;  3V76 A;  3TL4 X;  1VDL A;  4DV3 M;  4F2L A;  5KPZ A;  1IN4 A;  1T6O A;  3F92 A;  4X64 M;  4IBF A;  3W67 A;  5A2Q S;  1PJJ A;  3AOG A;  3HU1 A;  2EA0 A;  2KNV A;  1IBL M;  2XF3 A;  2CWB A;  1OIP A;  2C9O A;  2L6O A;  2VF7 A;  4GMQ A;  5LMN M;  1Y8G A;  2QP9 X;  1IN7 A;  2JUJ A;  2RGH A;  3J7B A;  1PJI A;  4LF5 M;  4QNL A;  2R4E A;  3GLH B;  4X66 M;  3U6O A;  4LF7 M;  2V5O A;  2CHV A;  2D7H A;  4FCV A;  1K82 A;  2Y2K A;  2Y2M A;  3J7A S;  3SAU A;  2RTS A;  2JA2 A;  1YU3 A;  5FTN A;  2J7N A;  1IN8 A;  2LNH C;  4A3V B;  1Z5C A;  2Y2I A;  2OOB A;  2UUC M;  2LVO C;  4JI8 M;  2OQ4 A;  2I7N A;  4OU7 A;  4DV6 M;  4JYA M;  2KDL A;  1XHB A;  3L29 A;  1IY2 A;  3K8Z A;  4DV5 M;  1GXD A;  3TWL A;  3FTF A;  1NO1 A;  1H6U A;  1NV9 A;  4HMC A;  4QNR A;  1OGG A;  4L16 A;  1L1T A;  2L7I A;  4OW0 A;  3GRU A;  1PRB A;  1OKS A;  1D0K A;  5H37 D;  3OTO M;  3GQ3 A;  2KRU A;  3U6E A;  1GPF A;  3I51 A;  2DAI A;  4G6Z A;  3VFD A;  3HON A;  3UK6 A;  1NSF A;  2HWJ A;  2Z3X A;  3B7Q A;  2F5Q A;  2WZJ A;  1V92 A;  1L2C A;  1PJS A;  2EKF A;  2R4J A;  4P16 A;  1NY6 A;  1TDZ A; 
#chains in the Genus database with same CATH homology
 4G4N A;  3VLF B;  3H4M A;  3SAS A;  3RFW A;  2IOU A;  4IBE A;  3LVW A;  1OFH A;  2QCU A;  2KA6 B;  1NY5 A;  3A45 A;  5BR8 M;  4G4O A;  2M5Z A;  1YE9 A;  1L8Q A;  3HHW A;  1GL6 A;  2OPF A;  3HHY A;  3GPX A;  2Z7J A;  4LRS A;  1N78 A;  2LWX A;  2Y2L A;  3KS4 A;  4B3M M;  4M0D A;  1XMO M;  4NSO B;  1SXJ C;  5IRE B;  5E6J A;  4NZ1 A;  3KDS E;  3KOY E;  3KSX A;  4AG5 A;  1I4W A;  4LJ5 A;  3KXE C;  4DV2 M;  3GRY A;  4GC9 A;  2ZM6 M;  2QZ4 A;  2RGO A;  5IT9 S;  3HWS A;  2XSZ D;  4M9X A;  2C9C A;  1QAO A;  1NHW C;  3WHK A;  3T1H M;  2HCB A;  2XGN A;  2YR0 A;  4IJE A;  5KPR A;  2CEA A;  2L09 A;  3M7G A;  5KQD A;  1QZM A;  3DA1 A;  4MH0 E;  3EIE A;  3JAM S;  1HNZ M;  1SXJ E;  1W5S A;  2YNM D;  3AV0 A;  4NOO B;  2L7H A;  1DO2 A;  2F5S A;  4NRW A;  4NXM M;  5ITQ A;  3ILK A;  4JI0 M;  2I7P A;  4HL4 A;  4NL4 H;  1IBK M;  2CV0 A;  3CF0 A;  4FW9 A;  1E94 E;  4II7 A;  3SHG B;  4JI5 M;  2CHG A;  4L4U A;  3VK7 A;  3VKH A;  4QNL A;  3FUV A;  1QQW A;  3PXG A;  1MU5 A;  3HJQ A;  3KP1 E;  1SXJ A;  3SMP A;  4DV7 M;  3N3F A;  1QAM A;  1R2Y A;  4JI6 M;  4NZ3 A;  4QOZ C;  3VDP A;  2HL7 A;  3GLG A;  3GLG B;  1XC8 A;  1Q3B A;  4JI4 M;  1KYI A;  2M60 A;  2V1C A;  2UXD M;  1YU1 A;  1J5E M;  3JR4 A;  1IXZ A;  3R9X B;  4AG6 A;  2ZAM A;  3UJN A;  2XFS A;  1LV7 A;  5IWA M;  3SAT A;  3GQ4 A;  4X62 M;  4KOD A;  1Q3C A;  4GHA A;  1NJF A;  4FCW A;  2AHM A;  1DGB A;  5BPV A;  2DWZ B;  1YSY A;  3GLI B;  2XD5 A;  4I5S A;  4OJP A;  3T1Y M;  2CFO A;  1E9R A;  3FUX A;  3A42 A;  4GKK M;  2X49 A;  4QNM A;  4GHL A;  3HGI A;  3T15 A;  1QAQ A;  2KZS A;  4R7G A;  4BLC A;  4X65 M;  3QWL A;  1NVM A;  3E4R A;  2R45 A;  2ZBK B;  1Z6T A;  5E26 A;  3SAV A;  3IG5 A;  3KFU G;  3I4V A;  5GKN A;  4JI7 M;  1MX0 A;  1GL7 A;  2Y20 A;  4MGH A;  1FNN A;  3EIH A;  2XH9 A;  3I4Y A;  3TWK A;  2YQZ A;  2Y2M A;  3GPP A;  3NBI A;  4B7F A;  5ITT A;  4FCT A;  1Z59 A;  2G5G X;  3GPU A;  4AI6 A;  2W82 A;  4DR3 M;  3AOE C;  4NYU A;  2FFJ A;  3GPY A;  2Z4S A;  3AL0 C;  3T38 A;  1TGU A;  3CF6 E;  4PD2 A;  4ZPX A;  1ZQ9 A;  5ITX E;  5KQ8 A;  1YU0 A;  3GLF A;  3HHX A;  4EIW A;  2X8A A;  3U61 A;  3SHF A;  4LF6 M;  2EO2 A;  5JI2 E;  3U6S A;  8CAT A;  4AW4 A;  1TH4 A;  3A98 B;  4DR5 M;  3AFH A;  2R65 A;  4D81 A;  5F3W A;  4JV5 M;  3DOA A;  4L78 A;  4OJ6 A;  3VK8 A;  3D8B A;  4GRI A;  2DWM A;  4MB7 A;  3FKE A;  1IQP A;  1JR3 D;  4DR1 M;  2BJW A;  4M0W A;  4M9Z A;  1YUE A;  2JCH A;  1TH3 A;  4BBA A;  4IIW A;  1Z5A A;  5LMU M;  1K3W A;  1L2D A;  1HNW M;  3TQS A;  5DYG A;  1YUB A;  4PDG A;  5ITY A;  2ZAN A;  3QAU A;  4I81 A;  4R3D A;  1N32 M;  3FUU A;  3R8F A;  2F4V M;  5FTL A;  3L2A A;  5FSW A;  5DYI A;  4MM3 B;  3GRV A;  2K47 A;  4W5W A;  2DVW B;  1NJG A;  4LFA M;  4IBB A;  2JE5 A;  3K2L A;  4M9S A;  4LF4 M;  4B08 A;  4YHH M;  2UXC M;  3WX7 A;  3J27 B;  4B3R M;  4RF1 A;  3KOZ E;  3KOX E;  1DGF A;  2FOI C;  2A5Y B;  1I94 M;  2CE7 A;  2Y2J A;  4MGI E;  3J81 S;  2QPA A;  4LZJ A;  4IJF A;  3PNV A;  1XXH A;  1GLN A;  4B7H A;  4PCZ A;  3FUT A;  3KSJ A;  3J2P B;  4DUZ M;  4DV4 M;  1WXQ A;  3JR5 A;  4GKJ M;  3HJS A;  2XFT A;  3CF2 A;  1FJG M;  3FUW A;  1GVN A;  4LF9 M;  1OFI A;  2Y21 A;  1OJL A;  1NNU C;  2UWX A;  1W5T A;  3ZCB B;  3MJ5 A;  4FWD A;  3M6A A;  4AQY M;  4DR7 M;  3TPZ A;  1X37 A;  2KXE A;  4GIT A;  3U5Z A;  3U5Z B;  4LCB A;  5EP1 A;  5KPT A;  3B9P A;  3PVS A;  2Y0Q A;  2P5T A;  4L8R C;  5ITR A;  4CHT B;  4IBI A;  2BG1 A;  2FFF B;  5JI3 E;  4NYY A;  1SXJ B;  3WHL A;  3U6L A;  3HSH A;  2XEP A;  1N77 A;  1DGH A;  2LH0 A;  4GIP A;  3RGS A;  1IY0 A;  1UM8 A;  5FTK A;  1PM5 A;  4NRV A;  4FWH A;  3M0E A;  1G8P A;  2R46 A;  2Y2G A;  2DHR A;  2C98 A;  3HU3 A;  3Q8X A;  3E9S A;  4IBG A;  4RNA A;  4OX9 M;  2R18 A;  3L25 A;  2G8L A;  3SMS A;  4NY2 A;  3FYC A;  3K92 A;  2HKJ A;  5C18 A;  3GO8 A;  4OJL A;  2O5R A;  3TE6 A;  3VKG A;  4LY6 A;  1G41 A;  2F5P A;  2X4A A;  2NQ8 C;  3DFZ A;  4D80 A;  4QHS A;  4DV0 M;  2D7E A;  1HQY E;  4LJ7 A;  2UXB M;  4I8O A;  2H1R A;  3HJ8 A;  1D2N A;  2C5R A;  2CV2 A;  1C1K A;  2XSZ A;  4CGY B;  1HT1 E;  4MGZ E;  1HNX M;  3LVV A;  4HLQ A;  2F5N A;  2Y2H A;  4OUI A;  1G59 A;  1J7K A;  4LJ4 A;  2R62 A;  2QBY A;  2LXE A;  2BNK A;  4NZ5 A;  3UGJ A;  3DZD A;  2BJV A;  4GH9 A;  4XGI A;  2DZN B;  3ZH9 B;  4LG2 A;  1QAN A;  4K0K M;  4AKG A;  1TDH A;  4JN6 A;  3SBJ A;  3SYK A;  4NXN M;  3KP0 E;  2RKO A;  4B7G A;  5IZ7 D;  5EXT A;  4PT5 A;  1XMQ M;  1IBM M;  4IBJ A;  2C99 A;  3FYD A;  3GLF B;  4BB9 A;  3U6M A;  3MK6 A;  3U61 B;  2F5O A;  3ZC7 B;  2DZO B;  3U60 A;  3AJI B;  3U60 B;  1XNQ M;  1QVR A;  5EXX A;  3GRR A;  4GC5 A;  4NSR A;  5EXP A;  5ITX A;  1ORY B;  4YY3 M;  1EE8 A;  5EXS A;  4LJA A;  3GLH A;  3L26 A;  1Q39 A;  4IBK A;  1N75 A;  4DR4 M;  4LJ9 A;  4NZ4 A;  1KSF X;  1NHG C;  3SFZ A;  2UU9 M;  4ITQ A;  1N34 M;  3SC3 A;  4TUW A;  2ERC A;  1IM2 A;  2UUA M;  3SAW A;  2V1U A;  1NNJ A;  1G3I A;  4WW0 A;  2XZU A;  5FLX S;  4QHT A;  1IN5 A;  3AOE A;  3J80 S;  1L2B A;  1GKI A;  3NWL A;  4LGY A;  5KO3 A;  4DR6 M;  1T3T A;  4LFB M;  2C96 A;  2KRK A;  4OJO A;  1IXR C;  2FNA A;  2DWN A;  4KO8 A;  4Z6Y A;  1SXJ D;  4AZF A;  3W0L B;  3IG8 A;  5C1B A;  3U6P A;  4CIS A;  4JI2 M;  1J09 A;  4IBC A;  3GP1 A;  4REZ A;  3BOS A;  1DO0 A;  1HQC A;  1IY1 A;  4RF0 A;  1L1Z A;  1XWI A;  3UMM A;  3U6Q A;  4OJ5 A;  3UZU A;  4LJ6 A;  1XXH B;  2Q2E B;  1HT2 E;  2Z4R A;  3AKZ A;  4DV1 M;  2Y2O A;  2CV1 A;  2VQE M;  1KFV A;  1S3S A;  3W0F A;  1TH2 A;  2VII A;  3SAR A;  2QEN A;  3K1J A;  3FTE A;  4AKH A;  2V6Z M;  1R2Z A;  4FWG A;  4G4R A;  1E32 A;  1K3X A;  3THG A;  3HU2 A;  3RE8 A;  3VDU A;  1YU4 A;  1IN6 A;  1JQJ C;  2KW0 A;  4LZZ A;  4IBD A;  2XZF A;  4LF8 M;  4AKI A;  4LFC M;  5EQT A;  4MGY E;  3PNY A;  5FTM A;  4LRT A;  1JR3 A;  3D8L A;  3U6D A;  3LQQ A;  1DGH B;  2FE8 A;  2XD1 A;  3KW6 A;  3A46 A;  2VQF M;  4I4L A;  3PFI A;  1DGG A;  2Y2Q A;  4D82 A;  3HKP A;  3TWM A;  2KZU A;  4LJ8 A;  4DUY M;  3C58 A;  4KLN A;  4DR2 M;  4Z8X A;  1N36 M;  1QYR A;  1G4A E;  3FTD A;  3MHV C;  2ZAO A;  1R7R A;  2Y0T A;  3L27 A;  2D7G A;  3LQR A;  5EP4 A;  3FTC A;  4KHP M;  1VDD A;  4G4Q A;  1HR0 M;  1IXS B;  2EUC A;  1YU2 A;  2UUB M;  4OVZ A;  4OVZ B;  4LGM A;  2HHH M;  1Z5B A;  3KOW E;  2DXI A;  5EP3 A;  4WUR A;  1E9S A;  2DWL A;  2Y2N A;  3HHZ A;  3LMM A;  3U6C A;  2YFQ A;  4MGK E;  4S12 A;  1N33 M;  4XBO A;  4B3S M;  3KVW A;  2CHQ A;  5DNY A;  5ITU A;  5EJC A;  4FVM A;  3SYL A;  1ZAE A;  3FD9 A;  2J7O A;  4FD2 A;  3RGP A;  2QBY B;  2Y2P A;  1R6B X;  4JI3 M;  4L15 A;  3GLI A;  4JI1 M;  1XNR M;  3CTW B;  2E5L M;  2XLJ A;  4B3T M;  3KS8 A;  3GQ5 A;  5EP2 A;  2CUZ A;  4JXJ A;  4QOS A;  2KEB A;  5FTJ A;  4PDI A;  7CAT A;  3L28 A;  3TL4 X;  4DV3 M;  5KPZ A;  1IN4 A;  4X64 M;  4IBF A;  5A2Q S;  1PJJ A;  3AOG A;  3HU1 A;  2EA0 A;  1IBL M;  2XF3 A;  2C9O A;  2L6O A;  4GMQ A;  5LMN M;  2QP9 X;  3J7B A;  1IN7 A;  2RGH A;  1PJI A;  4LF5 M;  2R4E A;  3GLH B;  4X66 M;  3U6O A;  4LF7 M;  2CHV A;  2D7H A;  4FCV A;  1K82 A;  2Y2K A;  3J7A S;  3SAU A;  2JA2 A;  1YU3 A;  5FTN A;  2J7N A;  1IN8 A;  2LNH C;  4A3V B;  1Z5C A;  2Y2I A;  2UUC M;  4JI8 M;  2OQ4 A;  2I7N A;  4OU7 A;  4DV6 M;  4JYA M;  3L29 A;  1XHB A;  3K8Z A;  1IY2 A;  4DV5 M;  3TWL A;  3FTF A;  1H6U A;  4QNR A;  4L16 A;  1L1T A;  2L7I A;  4OW0 A;  3GRU A;  5H37 D;  3U6E A;  3OTO M;  3GQ3 A;  2KRU A;  3I51 A;  4G6Z A;  3VFD A;  3HON A;  3UK6 A;  1NSF A;  2Z3X A;  2F5Q A;  1L2C A;  2R4J A;  4P16 A;  1NY6 A;  1TDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...