3L25A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
molecule keywords Polymerase cofactor VP35
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l25A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l25A02
4IJFA 4LG2A 4IBDA 3L29A 4IBCA 4IBBA 3L25A 4IJEA 4IBFA 5BPVA 3L27A 4IBGA 4IBIA 3KS4A 4GH9A 3L28A 3L26A 3FKEA 3L2AA 4IBJA 4IBEA 4GHAA 4GHLA 4IBKA 3KS8A
chains in the Genus database with same CATH superfamily
1PDCA 2H1RA 2LWXA 4FWDA 2Y2PA 3FTFA 1WGNA 1MN3A 3JR4A 4GKJM 2F5SA 2M60A 2DAKA 1UR9A 4D81A 3H4JA 4FD2A 4DV1M 2O01F 4DV4M 4IBFA 1R2ZA 2CV2A 2KRKA 2JP7A 4ZPXA 5JI2E 1Z5BA 4GMQA 3B7QA 1TF0B 4DR1M 1I94M 4IBIA 3KXEC 4B7HA 1EIJA 4A3VB 1G3IA 5KPRA 3I04M 2UUAM 1NNJA 3BOSA 5L8RF 4QNRA 3L26A 4DR2M 4L16A 4FWGA 1QAQA 4AG6A 2C96A 4CIZA 3W0LB 1PM5A 1W1TA 4OJ5A 2JY7A 3LVWA 4DV3M 3Q8XA 4QNMA 5ITXA 4LCBA 4IBKA 3GPYA 1SXJB 1YE9A 4DV2M 2RRUA 5JI3E 4G4RA 4OJPA 3I4YA 2DWLA 3VKHA 2LHCA 4PDGA 4NYUA 3JR5A 1GO5A 2KZUA 3SAUA 1YLAA 1KFVA 3SASA 1DO0A 4I4LA 4LZJA 4D82A 1IXRC 3K9OA 4DV7M 2K9DA 4LJ8A 1KS0A 3W0FA 3J2PB 1N75A 1QDTA 3D8LA 3FUWA 1QDRA 3KSJA 2Y2QA 2VQEM 4XBOA 1DGHB 1IN6A 2L7IA 3K1JA 1YU4A 4NY2A 4GH9A 5FTKA 1IXSB 1E15A 1XWIA 1TTEA 5DYGA 1EFUB 1GJTA 5KPTA 4JV5M 4IBEA 4LF4M 2KRUA 2LNHC 2XFTA 2FN2A 4LGYA 4S12A 1W5SA 3PNYA 4QHTA 3HZJA 4LG2A 1YU0A 3RE8A 5FTLA 1V34A 2O5RA 3GLHE 2G8LA 3KW6A 1E32A 2P5TA 3LCVB 3E21A 4QOZC 4Y28F 2V5OA 3U6QA 2CRUA 2XGNA 2EO2A 2QENA 1KYIA 3VDPA 2L4FA 1L2CA 3SMPA 2RKOA 4LRSA 4TX8A 3LQRA 4MGYE 3SAWA 2N35A 2DENA 2JY5A 1SXJA 2EKKA 2VDBB 3M7GA 3KFUG 3AOEC 4QOSA 2Y21A 4LY6A 3GPPA 3WX7A 5DYIA 3QYEA 1WXQA 4L8RC 4OVZB 4LFCM 3AL0C 4LJ5A 3T6PA 4OJ6A 1PGYA 4OJOA 3D8BA 2B3TA 1W1VA 2C98A 2VF8A 2D49A 3WHLA 4P16A 2H5XA 5BR8M 4HMEA 1DGHA 1EE8A 1NJFA 1UFZA 3UK6A 3HJ8A 4BBAA 3MQLA 1IXSA 3DOAA 4LJ6A 3B89A 2FFJA 1J5EM 3BXWA 1YU1A 4NZ3A 4W5WA 2HL7A 2F5OA 4MM3B 3GO8A 4I81A 1N78A 1XHBA 1HT1E 1NHGC 3CTWB 2XZUA 2XD1A 1IBKM 1ZMWA 4DR5M 5EXTA 4MB3A 1K3WA 1H6UA 1T6OA 1S3SA 4IBGA 2DAIA 4ANRA 3SHGB 2FFFB 2BJVA 2KNZA 3KS4A 4KT0F 3UJNA 3L28A 1JR3D 5DNYA 3U60A 4LF8M 3GLGE 4LF9M 3A42A 3T15A 1GL7A 1Z5CA 3FKEA 2J5YA 4L4UA 1PJJA 1G59A 4JI6M 5EP2A 1G41A 4FCTA 2VQFM 1MU5A 1IQPA 5FTJA 3U61B 3HX3A 5FSWA 3U6CA 2K47A 4NSOB 2F5NA 3AOGA 3EIHA 1J7KA 3K9PA 3NBIA 3UZUA 5F3WA 4JI8M 4AKGA 2DWMA 2C9CA 3WD3A 3I51A 4M9ZA 3J81S 3U6SA 2HHHM 3KSXA 5KO3A 2MROB 4L78A 4OVZA 4OX9M 1QAMA 2DAMA 2CHVA 2OPFA 3W67A 4FWHA 4MB4A 2ZAMA 4Z2IA 2JNHA 2LVAA 4R71A 1GL6A 1C1KA 1Q02A 2LTUA 3HHZA 2RGHA 5LMNM 4DUZM 4JI0M 2Y2HA 2KZSA 1ZMVA 1O6IA 1TGUA 2DZNB 1TDHA 3N3FA 2J7NA 1HNXM 4G6ZA 1VDDA 3SATA 3FRIA 3KVWA 4B3SM 4L15A 4B3MM 4R7GA 4GHLA 4GITA 3SARA 2MJ5B 2DWNA 2Y2IA 2L7HA 5EXSA 2QCUA 4YHHM 2R0IA 4PD2A 5ITQA 2OOBA 1H8PA 1G8PA 4AW4A 1L8QA 2MGWA 2I7NA 1VG5A 4LZZA 1N33M 2R45A 2HAKA 4NZ4A 1C7YA 1H0IA 3TE6A 3RGSA 2V1UA 2Y20A 4HLQA 4HEOA 3U61A 2F4VM 1OQYA 1V92A 2AHMA 4R3DA 5A2QS 5KQDA 1R7RA 5E26A 4B08A 1K82A 2VF7A 1JB0F 1NHWC 2Q2EB 3RFWA 4AKIA 2YQZA 4IBJA 1TH3A 3FTEA 1OAIA 3GLGB 2EA0A 3AKZA 3GRRA 3E4RA 4I5SA 4B3RM 1YU3A 3GLIA 2R44A 1DO2A 3J80S 4AZFA 2MR9A 3R8FA 1L2DA 4DR7M 3FD9A 2CHGA 3LQQA 3U6DA 3HJSA 1WHCA 5E6JA 1JR3E 3HGIA 4CHTB 3IHPA 4NZ1A 2HCBA 2LHGA 2XSZA 1HQCA 3QAUA 3GRVA 2Z3XA 1L2BA 3MJ5A 3B74A 4CGYB 3PXGA 3NWLA 1DGGA 1F4IA 2CWBA 1PJTA 1E6RA 2UWXA 2Y2NA 2DHYA 4M9XA 1IN7A 1OGGA 1X37A 1N34M 2D7EA 2CHQA 2GNOA 2M5ZA 5IWAM 4F1IA 2JZ0A 4DUYM 5EJCA 1OFHA 2JWSA 1BVSA 1NNUC 1PRBA 3THGA 3TQSA 3ZH9B 3U6PA 4AI6A 3C9PA 2ERCA 2R4EA 2DNAA 1YUEA 1RU3A 1Z5AA 3HU3A 3ZCBB 4LJ9A 4LJ7A 2L6OA 2DXIA 2EKFA 1ED7A 4CJ6A 3AJIB 3SC3A 2Z4RA 3FYDA 2CV0A 1A5TA 4MGIE 3EIEA 1WJ7A 3A46A 3HJQA 3H4MA 4YY3M 3J27B 3GQ3A 3FTDA 1XMQM 2JCHA 2QPAA 4X62M 2KNVA 1DGBA 2LBCA 1OAOC 1V33A 3LMMA 1NSFA 3GRUA 4JI3M 3W68A 3GLGA 3GPUA 4REZA 2ZM6M 3SHFA 1XB2B 3A45A 1HR0M 2XLJA 1D0KA 3SBJA 3B9PA 3FTCA 3V76A 1QYRA 3HHWA 4HMDA 3CF6E 3QWLA 1HNZM 3FE3A 3HONA 3L2AA 2RGOA 4NSRA 1N36M 1HT2E 3FUTA 1DV0A 3M7PA 4NL4H 1IY1A 5C1BA 1EAKA 2KXEA 4G4NA 1GOIA 2OOAA 4AG5A 4BB9A 3U5ZB 1E88A 1VEGA 1Q3BA 1QAOA 3HHYA 3U6MA 4JI1M 4Z2LA 1HJPA 1YSYA 1GABA 5KPZA 2L2DA 4M0DA 2C99A 5EQTA 5EP3A 4EIWA 2D7GA 4DV6M 2OO9A 3HHXA 2XH9A 3HKPA 3PFIA 1D0LA 2QSFX 3J7BA 3SYKA 4II7A 2KNAA 1ZV1A 1YUBA 2Y0TA 2JA2A 3K8ZA 4G4OA 3LCUA 3LW5F 4OUIA 1J7MA 2E5LM 3KP1E 4MB7A 4QHSA 1NVMA 3JAMS 3R9XB 3CGWA 3OTOM 3NBXX 2D7HA 4NYYA 2JE5A 1G4AE 2GQFA 3VFDA 3TWMA 4GC5A 2UXDM 4FCVA 5FLXS 4B7FA 1NJGA 2APLA 1QZMA 1QZEA 2Z8YM 4HL4A 1NY5A 4WURA 4HMCA 3UGJA 3FUUA 1E8BA 3Q8GA 1OKSA 1CK7A 1GJSA 4PDIA 1VDLA 1LV7A 3AV0A 5LMUM 3U6EA 2CP8A 2JZ1A 3TPZA 3VLFB 2JXNA 3GQ4A 4DR3M 3FRHA 3GLHB 2WSCF 4RF0A 3SMSA 3ZC7B 1NV8A 4XGIA 4OW0A 3GLFE 1W1PA 1IM2A 1AUAA 4IIWA 2Y2JA 3MHVC 3U5ZA 4AQYM 3KOYE 3U6LA 1WIVA 2ZANA 3GQ5A 4NXMM 4P17A 1JQJC 1SXJE 4OJLA 4MGHA 1PJQA 3AFHA 1VQ1A 3CF2A 5GKNA 4CISA 2X8AA 5IT9S 1OFIA 4JN6A 8CATA 4PT5A 1LTMA 1JR3A 1Y8GA 3T1HM 1E9SA 1DGFA 1L1ZA 2Y2LA 3WD0A 2EJSA 2HWJA 3PNVA 2BJWA 4IBDA 2L4EA 4IBCA 3TWKA 3WD2A 4IBBA 1L1TA 4D80A 3L25A 2Y2GA 5FTMA 4F2LA 2R65A 2XD5A 4NC6A 2QP9X 3GPXA 4DV5M 4ITQA 1PJIA 1N77A 1GKIA 4GKKM 1IY2A 4MB5A 4WP2A 4Z6YA 1K3XA 4FCWA 4LF5M 1ORYB 4NRVA 3TWLA 3I4VA 3BBZA 3GLFB 1FJGM 1XXHE 3B7ZA 1QO6A 2XFSA 3MMPA 2DWZB 1GXDA 2RTSA 3GLHA 1PJSA 2QNJA 3GRYA 2YFQA 1QQWA 1WR1B 2FNAA 1IXZA 1FNNA 2UUCM 2DAGA 3FUXA 3L29A 5IZ7D 2Y2MA 4LF6M 3IG8A 1XC8A 1E6ZA 4JXJA 1D2NA 3E9SA 1TDZA 4GRIA 5EP1A 4OU7A 4WW0A 1R5LA 3ZQJA 3B7NA 2OQ4A 5ITTA 1OTRA 3SFZA 1QUTA 2QQ8A 4TUWA 2Y2KA 2CEAA 3AOEA 4K0KM 4GC9A 4PCZA 1TR8A 1HQYE 1KSFX 2LVOC 1GVNA 1NO1A 2CE7A 2KW0A 3QYBA 3RGPA 5ITYA 4RNAA 2J7OA 1IBLM 1WGLA 3KOWE 2F5PA 2UU9M 4DR4M 4GHAA 2O25A 4LRTA 5FTNA 3C58A 1IN5A 4L6V6 1TH4A 1J09A 2R4JA 2YNMD 3KOZE 3KS8A 1GPFA 2K6BA 3VDUA 2KHHA 4DV0M 4I8OA 3IECA 2HKJA 1SXJD 2JUJA 4LJAA 2V6ZM 1IBMM 4B3TM 1HNWM 3KP0E 2X4AA 1VEJA 3DZDA 3U6OA 2NQ8C 4NOOB 3MK6A 3KOXE 5BPVA 5KQ8A 4DR6M 4UN2B 1OIPA 3M0EA 1E9RA 1CUKA 3SYLA 1NV9A 2LVPC 1QANA 4LFBM 5ITRA 3VK7A 2Y0QA 3IG5A 5DFLA 2UUBM 1ZAEA 1TH2A 4X65M 1OJLA 3C3DA 2JY6B 3WD1A 2C9OA 3HU1A 3U60B 2F5QA 5H37D 2CV1A 1XXHB 3A98B 2CUZA 3WHKA 5ITXE 1XMOM 4LF7M 2R62A 2ZTCA 1YU2A 2WZJA 2Z4SA 3CF0A 5EP4A 1IN8A 3GLFA 2G5GX 2YR0A 3GLIE 3M6AA 1R6BX 2EUCA 2L09A 2MH8A 2XF3A 4KLNA 4BLCA 4JI4M 2BWEA 2LVNC 1W5TA 4KHPM 1UR8A 1Q39A 1VEKA 1T43A 1UM8A 2DZOB 3HY5A 4G4QA 3SAVA 4M0WA 1H0GA 2FOIC 2G3QA 3VKGA 1P3QQ 1R4GA 3T38A 1MX0A 2DZLA 2QHOB 1OIZA 2XEPA 4NRWA 4X64M 2FH0A 2LH0A 1NY6A 4Q7JA 3VK8A 4KO8A 1XNQM 2QBYB 1AIPC 4IJFA 3HU2A 3E46A 1IY0A 3LVVA 4LGMA 3UMMA 4AKHA 4NXNM 4Z2GA 4RF1A 1OGBA 3J7AS 2BNKA 4MGKE 4X66M 2K0BX 4JYAM 2IOUA 3GP1A 2WSFF 1Z59A 2BWBA 5EXPA 3L27A 4FVMA 3I01M 1CXWA 1SXJC 1W1YA 2KEBA 1XXHA 4Z8XA 2KDLA 1I4WA 2UXBM 4NZ5A 2V1CA 4M9SA 1IN4A 1G71A 2FS1A 1T3TA 5EXXA 1E6NA 3F92A 2DHRA 2LVQD 3HWSA 3K2LA 4MH0E 2CFOA 2R46A 4JI5M 3PVSA 5IREB 3DA1A 2DI0A 4DBGB 3TL4X 2Z7JA 4Z2HA 2DAEA 1MJGM 1QUSA 4XK8F 2XZFA 3FYCA 3KDSE 1QVRA 4JI2M 2DKLA 1Q3CA 2VIIA 2ZAOA 1N32M 2UXCM 4JI7M 4Z2KA 1IFYA 2DVWB 2I7PA 3HSHA 2BG1A 1GLNA 2A5YB 5C18A 3C3EA 3K92A 4GEWA 2C5RA 4QNLA 1SG9A 1ZMUA 3T1YM 2KA6B 4IJEA 4MGZE 3WD4A 4B7GA 4KODA 1ZQ9A 1E6PA 1AIWA 4LJ4A 4RKUF 1Z6TA 2LXEA 3DFZA 3GLIB 4FW9A 2ZTDA 1XNRM 2R6FA 1E94E 5ITUA 4LFAM 1R2YA 2QBYA 2X49A 7CATA 2Y2OA 4GIPA 2FE8A 1D0MA 4Z2JA 2R18A 2ZBKB 3FUVA 2JY8A 2W82A 3ILKA 1L6JA 2WSEF 4G3OA 2XSZD 2QZ4A
chains in the Genus database with same CATH topology
2H1RA 2LWXA 4FWDA 2Y2PA 3FTFA 3JR4A 4GKJM 2F5SA 2M60A 4D81A 4FD2A 4DV1M 4DV4M 4IBFA 1R2ZA 2CV2A 2KRKA 4ZPXA 5JI2E 1Z5BA 4GMQA 4DR1M 1I94M 4IBIA 3KXEC 4B7HA 4A3VB 1G3IA 5KPRA 2UUAM 1NNJA 3BOSA 3L26A 4QNRA 4DR2M 4L16A 4FWGA 1QAQA 4AG6A 2C96A 1PM5A 3W0LB 4OJ5A 3LVWA 4DV3M 3Q8XA 4QNMA 5ITXA 4LCBA 4IBKA 3GPYA 1SXJB 1YE9A 4DV2M 5JI3E 4OJPA 4G4RA 3I4YA 2DWLA 3VKHA 4PDGA 4NYUA 3JR5A 2KZUA 3SAUA 1KFVA 3SASA 1DO0A 4I4LA 4LZJA 4D82A 1IXRC 4DV7M 4LJ8A 3W0FA 3J2PB 1N75A 3D8LA 3FUWA 3KSJA 2Y2QA 2VQEM 4XBOA 1DGHB 1IN6A 2L7IA 3K1JA 1YU4A 4NY2A 4GH9A 5FTKA 1IXSB 1XWIA 5DYGA 5KPTA 4JV5M 4IBEA 4LF4M 2KRUA 2LNHC 2XFTA 4LGYA 4S12A 1W5SA 3PNYA 4QHTA 4LG2A 1YU0A 3RE8A 5FTLA 2O5RA 2G8LA 3KW6A 1E32A 2P5TA 4QOZC 3U6QA 2XGNA 2EO2A 2QENA 1KYIA 3VDPA 1L2CA 3SMPA 2RKOA 4LRSA 3LQRA 4MGYE 3SAWA 1SXJA 3M7GA 3KFUG 3AOEC 4QOSA 2Y21A 4LY6A 3GPPA 3WX7A 5DYIA 4LFCM 1WXQA 4L8RC 4OVZB 3AL0C 4OJ6A 4LJ5A 4OJOA 3D8BA 2C98A 3WHLA 4P16A 5BR8M 1DGHA 1EE8A 1NJFA 3UK6A 4BBAA 3HJ8A 3DOAA 4LJ6A 2FFJA 1J5EM 1YU1A 4NZ3A 4W5WA 2HL7A 2F5OA 4MM3B 3GO8A 4I81A 1N78A 1XHBA 1HT1E 1NHGC 3CTWB 2XZUA 2XD1A 1IBKM 4DR5M 5EXTA 1K3WA 1H6UA 2FFFB 1S3SA 4IBGA 3SHGB 2BJVA 3KS4A 3UJNA 5DNYA 3L28A 1JR3D 3U60A 4LF8M 4LF9M 3A42A 3T15A 1GL7A 1Z5CA 3FKEA 4L4UA 1PJJA 1G59A 4JI6M 5EP2A 1G41A 4FCTA 2VQFM 1MU5A 1IQPA 5FTJA 3U61B 5FSWA 3U6CA 2K47A 4NSOB 2F5NA 3AOGA 3EIHA 1J7KA 3NBIA 3UZUA 5F3WA 4JI8M 4AKGA 2DWMA 2C9CA 3I51A 4M9ZA 3J81S 3U6SA 2HHHM 3KSXA 5KO3A 4L78A 4OVZA 4OX9M 1QAMA 2CHVA 2OPFA 4FWHA 2ZAMA 4DUZM 1GL6A 1C1KA 3HHZA 5LMNM 2Y2HA 2RGHA 4JI0M 2KZSA 1TGUA 2DZNB 1TDHA 3N3FA 2J7NA 1HNXM 4G6ZA 1VDDA 3SATA 3KVWA 4B3SM 4L15A 4B3MM 4R7GA 4GHLA 4GITA 3SARA 2DWNA 2Y2IA 2L7HA 5EXSA 2QCUA 4YHHM 4PD2A 5ITQA 1G8PA 4AW4A 1L8QA 2I7NA 4LZZA 1N33M 2R45A 4NZ4A 3TE6A 3RGSA 2V1UA 2Y20A 4HLQA 3U61A 2F4VM 2AHMA 4R3DA 5A2QS 5KQDA 1R7RA 5E26A 4B08A 1K82A 2Q2EB 1NHWC 3RFWA 4AKIA 2YQZA 4IBJA 1TH3A 3FTEA 3GLGB 2EA0A 3AKZA 3GRRA 3E4RA 4I5SA 4B3RM 1YU3A 3GLIA 1DO2A 3J80S 4AZFA 3R8FA 1L2DA 4DR7M 3FD9A 2CHGA 3LQQA 3U6DA 3HJSA 5E6JA 3HGIA 4CHTB 4NZ1A 2HCBA 2XSZA 3QAUA 1HQCA 3GRVA 2Z3XA 1L2BA 3MJ5A 4CGYB 3PXGA 3NWLA 1DGGA 2UWXA 2Y2NA 4M9XA 1IN7A 1X37A 1N34M 2D7EA 2CHQA 5IWAM 2M5ZA 4DUYM 5EJCA 1OFHA 1NNUC 4AI6A 3THGA 3TQSA 3ZH9B 3U6PA 2ERCA 2R4EA 1YUEA 1Z5AA 3HU3A 3ZCBB 4LJ9A 4LJ7A 2L6OA 2DXIA 3AJIB 3SC3A 2Z4RA 3FYDA 2CV0A 4MGIE 3EIEA 3A46A 3HJQA 3H4MA 4YY3M 3J27B 3GQ3A 3FTDA 1XMQM 2JCHA 2QPAA 4X62M 1DGBA 4JI3M 3U6MA 3LMMA 1NSFA 3GRUA 3GLGA 2ZM6M 3GPUA 4REZA 1HR0M 3SHFA 3A45A 2XLJA 3SBJA 3B9PA 3FTCA 1QYRA 3HHWA 3CF6E 3QWLA 1HNZM 3HONA 3L2AA 2RGOA 4NSRA 1N36M 1HT2E 3FUTA 4NL4H 1IY1A 5C1BA 2KXEA 4G4NA 4AG5A 4BB9A 3U5ZB 1Q3BA 1QAOA 3HHYA 4JI1M 1YSYA 5KPZA 4M0DA 2C99A 5EQTA 5EP3A 4EIWA 2D7GA 4DV6M 3HHXA 2XH9A 3HKPA 3PFIA 3J7BA 3SYKA 4II7A 2Y0TA 1YUBA 3K8ZA 2JA2A 4G4OA 4OUIA 2E5LM 3KP1E 4MB7A 4QHSA 1NVMA 3JAMS 3R9XB 3OTOM 2D7HA 4NYYA 2JE5A 1G4AE 3VFDA 3TWMA 4GC5A 2UXDM 4FCVA 5FLXS 4B7FA 1NJGA 1QZMA 4HL4A 1NY5A 4WURA 3UGJA 3FUUA 4PDIA 1LV7A 3AV0A 5LMUM 3U6EA 3TPZA 3VLFB 3GQ4A 4DR3M 3GLHB 4RF0A 3SMSA 3ZC7B 4XGIA 4OW0A 1IM2A 4IIWA 2Y2JA 3MHVC 3U5ZA 4AQYM 3KOYE 3U6LA 3GQ5A 2ZANA 4NXMM 4OJLA 1JQJC 1SXJE 4MGHA 3AFHA 3CF2A 4CISA 5GKNA 2X8AA 5IT9S 1OFIA 4JN6A 8CATA 4PT5A 1JR3A 3T1HM 1E9SA 1DGFA 1L1ZA 2Y2LA 3PNVA 2BJWA 4IBDA 4IBCA 3TWKA 4IBBA 1L1TA 4D80A 3L25A 2Y2GA 5FTMA 2R65A 2XD5A 2QP9X 3GPXA 4DV5M 4ITQA 1PJIA 1N77A 1GKIA 4GKKM 1IY2A 4Z6YA 1K3XA 4FCWA 4LF5M 1ORYB 4NRVA 3TWLA 3I4VA 1FJGM 2XFSA 2DWZB 3GLHA 3GRYA 2YFQA 1QQWA 2FNAA 1IXZA 1FNNA 2UUCM 3FUXA 3L29A 5IZ7D 2Y2MA 4LF6M 3IG8A 1XC8A 4JXJA 1D2NA 3E9SA 1TDZA 4GRIA 5EP1A 4OU7A 4WW0A 2OQ4A 5ITTA 3SFZA 4TUWA 2Y2KA 2CEAA 3AOEA 4K0KM 4GC9A 4PCZA 1HQYE 1GVNA 1KSFX 2CE7A 3RGPA 2KW0A 5ITYA 3GLFB 4RNAA 2J7OA 1IBLM 3KOWE 2F5PA 2UU9M 4DR4M 4GHAA 4LRTA 5FTNA 3C58A 1IN5A 1TH4A 1J09A 2YNMD 2R4JA 3KOZE 3KS8A 3VDUA 4DV0M 4I8OA 2HKJA 1SXJD 4LJAA 2V6ZM 1IBMM 4B3TM 1HNWM 3KP0E 2X4AA 3DZDA 3U6OA 2NQ8C 4NOOB 3MK6A 3KOXE 5BPVA 5KQ8A 4DR6M 3M0EA 1E9RA 3SYLA 1QANA 4LFBM 5ITRA 3VK7A 2Y0QA 3IG5A 2UUBM 1ZAEA 1TH2A 4X65M 1OJLA 2C9OA 3HU1A 3U60B 2F5QA 5H37D 2CV1A 1XXHB 3A98B 2CUZA 3WHKA 5ITXE 1XMOM 4LF7M 2R62A 1YU2A 2Z4SA 3CF0A 5EP4A 1IN8A 3GLFA 2G5GX 2YR0A 3M6AA 1R6BX 2EUCA 2L09A 4BLCA 2XF3A 4KLNA 4JI4M 4KHPM 1W5TA 1Q39A 1UM8A 2DZOB 4G4QA 3SAVA 4M0WA 2FOIC 3VKGA 3T38A 1MX0A 2XEPA 4NRWA 4X64M 2LH0A 1NY6A 3VK8A 4KO8A 1XNQM 2QBYB 4IJFA 3HU2A 3LVVA 1IY0A 4LGMA 3UMMA 4AKHA 4NXNM 4RF1A 3J7AS 2BNKA 4MGKE 4X66M 4JYAM 2IOUA 3GP1A 1Z59A 5EXPA 3L27A 4FVMA 1SXJC 2KEBA 1XXHA 4Z8XA 1I4WA 2UXBM 4NZ5A 2V1CA 4M9SA 1IN4A 5EXXA 1T3TA 3HWSA 2DHRA 4MH0E 3K2LA 2CFOA 2R46A 4JI5M 3PVSA 5IREB 3DA1A 3TL4X 2Z7JA 2XZFA 3FYCA 3KDSE 1QVRA 4JI2M 2VIIA 1Q3CA 1N32M 2ZAOA 2UXCM 4JI7M 2DVWB 2I7PA 3HSHA 2BG1A 1GLNA 2A5YB 5C18A 3K92A 2C5RA 4QNLA 3T1YM 2KA6B 4IJEA 4MGZE 4B7GA 4KODA 1ZQ9A 4LJ4A 1Z6TA 2LXEA 3DFZA 3GLIB 4FW9A 1XNRM 1E94E 5ITUA 4LFAM 1R2YA 2QBYA 2X49A 7CATA 2Y2OA 4GIPA 2FE8A 2R18A 2ZBKB 3FUVA 2W82A 3ILKA 2XSZD 2QZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJF A;  4LG2 A;  4IBD A;  3L29 A;  4IBC A;  4IBB A;  3L25 A;  4IJE A;  4IBF A;  5BPV A;  3L27 A;  4IBG A;  4IBI A;  3KS4 A;  4GH9 A;  3L28 A;  3L26 A;  3FKE A;  3L2A A;  4IBJ A;  4IBE A;  4GHA A;  4GHL A;  4IBK A;  3KS8 A; 
#chains in the Genus database with same CATH topology
 1PDC A;  2H1R A;  2LWX A;  4FWD A;  2Y2P A;  3FTF A;  1WGN A;  1MN3 A;  3JR4 A;  4GKJ M;  2F5S A;  2M60 A;  2DAK A;  1UR9 A;  4D81 A;  3H4J A;  4FD2 A;  4DV1 M;  2O01 F;  4DV4 M;  4IBF A;  1R2Z A;  2CV2 A;  2KRK A;  2JP7 A;  4ZPX A;  5JI2 E;  1Z5B A;  4GMQ A;  3B7Q A;  1TF0 B;  4DR1 M;  1I94 M;  4IBI A;  3KXE C;  4B7H A;  1EIJ A;  4A3V B;  1G3I A;  5KPR A;  3I04 M;  2UUA M;  1NNJ A;  3BOS A;  5L8R F;  4QNR A;  3L26 A;  4DR2 M;  4L16 A;  4FWG A;  1QAQ A;  4AG6 A;  2C96 A;  4CIZ A;  3W0L B;  1PM5 A;  1W1T A;  4OJ5 A;  2JY7 A;  3LVW A;  4DV3 M;  3Q8X A;  4QNM A;  5ITX A;  4LCB A;  4IBK A;  3GPY A;  1SXJ B;  1YE9 A;  4DV2 M;  2RRU A;  5JI3 E;  4G4R A;  4OJP A;  3I4Y A;  2DWL A;  3VKH A;  2LHC A;  4PDG A;  4NYU A;  3JR5 A;  1GO5 A;  2KZU A;  3SAU A;  1YLA A;  1KFV A;  3SAS A;  1DO0 A;  4I4L A;  4LZJ A;  4D82 A;  1IXR C;  3K9O A;  4DV7 M;  2K9D A;  4LJ8 A;  1KS0 A;  3W0F A;  3J2P B;  1N75 A;  1QDT A;  3D8L A;  3FUW A;  1QDR A;  3KSJ A;  2Y2Q A;  2VQE M;  4XBO A;  1DGH B;  1IN6 A;  2L7I A;  3K1J A;  1YU4 A;  4NY2 A;  4GH9 A;  5FTK A;  1IXS B;  1E15 A;  1XWI A;  1TTE A;  5DYG A;  1EFU B;  1GJT A;  5KPT A;  4JV5 M;  4IBE A;  4LF4 M;  2KRU A;  2LNH C;  2XFT A;  2FN2 A;  4LGY A;  4S12 A;  1W5S A;  3PNY A;  4QHT A;  3HZJ A;  4LG2 A;  1YU0 A;  3RE8 A;  5FTL A;  1V34 A;  2O5R A;  3GLH E;  2G8L A;  3KW6 A;  1E32 A;  2P5T A;  3LCV B;  3E21 A;  4QOZ C;  4Y28 F;  2V5O A;  3U6Q A;  2CRU A;  2XGN A;  2EO2 A;  2QEN A;  1KYI A;  3VDP A;  2L4F A;  1L2C A;  3SMP A;  2RKO A;  4LRS A;  4TX8 A;  3LQR A;  4MGY E;  3SAW A;  2N35 A;  2DEN A;  2JY5 A;  1SXJ A;  2EKK A;  2VDB B;  3M7G A;  3KFU G;  3AOE C;  4QOS A;  2Y21 A;  4LY6 A;  3GPP A;  3WX7 A;  5DYI A;  3QYE A;  1WXQ A;  4L8R C;  4OVZ B;  4LFC M;  3AL0 C;  4LJ5 A;  3T6P A;  4OJ6 A;  1PGY A;  4OJO A;  3D8B A;  2B3T A;  1W1V A;  2C98 A;  2VF8 A;  2D49 A;  3WHL A;  4P16 A;  2H5X A;  5BR8 M;  4HME A;  1DGH A;  1EE8 A;  1NJF A;  1UFZ A;  3UK6 A;  3HJ8 A;  4BBA A;  3MQL A;  1IXS A;  3DOA A;  4LJ6 A;  3B89 A;  2FFJ A;  1J5E M;  3BXW A;  1YU1 A;  4NZ3 A;  4W5W A;  2HL7 A;  2F5O A;  4MM3 B;  3GO8 A;  4I81 A;  1N78 A;  1XHB A;  1HT1 E;  1NHG C;  3CTW B;  2XZU A;  2XD1 A;  1IBK M;  1ZMW A;  4DR5 M;  5EXT A;  4MB3 A;  1K3W A;  1H6U A;  1T6O A;  1S3S A;  4IBG A;  2DAI A;  4ANR A;  3SHG B;  2FFF B;  2BJV A;  2KNZ A;  3KS4 A;  4KT0 F;  3UJN A;  3L28 A;  1JR3 D;  5DNY A;  3U60 A;  4LF8 M;  3GLG E;  4LF9 M;  3A42 A;  3T15 A;  1GL7 A;  1Z5C A;  3FKE A;  2J5Y A;  4L4U A;  1PJJ A;  1G59 A;  4JI6 M;  5EP2 A;  1G41 A;  4FCT A;  2VQF M;  1MU5 A;  1IQP A;  5FTJ A;  3U61 B;  3HX3 A;  5FSW A;  3U6C A;  2K47 A;  4NSO B;  2F5N A;  3AOG A;  3EIH A;  1J7K A;  3K9P A;  3NBI A;  3UZU A;  5F3W A;  4JI8 M;  4AKG A;  2DWM A;  2C9C A;  3WD3 A;  3I51 A;  4M9Z A;  3J81 S;  3U6S A;  2HHH M;  3KSX A;  5KO3 A;  2MRO B;  4L78 A;  4OVZ A;  4OX9 M;  1QAM A;  2DAM A;  2CHV A;  2OPF A;  3W67 A;  4FWH A;  4MB4 A;  2ZAM A;  4Z2I A;  2JNH A;  2LVA A;  4R71 A;  1GL6 A;  1C1K A;  1Q02 A;  2LTU A;  3HHZ A;  2RGH A;  5LMN M;  4DUZ M;  4JI0 M;  2Y2H A;  2KZS A;  1ZMV A;  1O6I A;  1TGU A;  2DZN B;  1TDH A;  3N3F A;  2J7N A;  1HNX M;  4G6Z A;  1VDD A;  3SAT A;  3FRI A;  3KVW A;  4B3S M;  4L15 A;  4B3M M;  4R7G A;  4GHL A;  4GIT A;  3SAR A;  2MJ5 B;  2DWN A;  2Y2I A;  2L7H A;  5EXS A;  2QCU A;  4YHH M;  2R0I A;  4PD2 A;  5ITQ A;  2OOB A;  1H8P A;  1G8P A;  4AW4 A;  1L8Q A;  2MGW A;  2I7N A;  1VG5 A;  4LZZ A;  1N33 M;  2R45 A;  2HAK A;  4NZ4 A;  1C7Y A;  1H0I A;  3TE6 A;  3RGS A;  2V1U A;  2Y20 A;  4HLQ A;  4HEO A;  3U61 A;  2F4V M;  1OQY A;  1V92 A;  2AHM A;  4R3D A;  5A2Q S;  5KQD A;  1R7R A;  5E26 A;  4B08 A;  1K82 A;  2VF7 A;  1JB0 F;  1NHW C;  2Q2E B;  3RFW A;  4AKI A;  2YQZ A;  4IBJ A;  1TH3 A;  3FTE A;  1OAI A;  3GLG B;  2EA0 A;  3AKZ A;  3GRR A;  3E4R A;  4I5S A;  4B3R M;  1YU3 A;  3GLI A;  2R44 A;  1DO2 A;  3J80 S;  4AZF A;  2MR9 A;  3R8F A;  1L2D A;  4DR7 M;  3FD9 A;  2CHG A;  3LQQ A;  3U6D A;  3HJS A;  1WHC A;  5E6J A;  1JR3 E;  3HGI A;  4CHT B;  3IHP A;  4NZ1 A;  2HCB A;  2LHG A;  2XSZ A;  1HQC A;  3QAU A;  3GRV A;  2Z3X A;  1L2B A;  3MJ5 A;  3B74 A;  4CGY B;  3PXG A;  3NWL A;  1DGG A;  1F4I A;  2CWB A;  1PJT A;  1E6R A;  2UWX A;  2Y2N A;  2DHY A;  4M9X A;  1IN7 A;  1OGG A;  1X37 A;  1N34 M;  2D7E A;  2CHQ A;  2GNO A;  2M5Z A;  5IWA M;  4F1I A;  2JZ0 A;  4DUY M;  5EJC A;  1OFH A;  2JWS A;  1BVS A;  1NNU C;  1PRB A;  3THG A;  3TQS A;  3ZH9 B;  3U6P A;  4AI6 A;  3C9P A;  2ERC A;  2R4E A;  2DNA A;  1YUE A;  1RU3 A;  1Z5A A;  3HU3 A;  3ZCB B;  4LJ9 A;  4LJ7 A;  2L6O A;  2DXI A;  2EKF A;  1ED7 A;  4CJ6 A;  3AJI B;  3SC3 A;  2Z4R A;  3FYD A;  2CV0 A;  1A5T A;  4MGI E;  3EIE A;  1WJ7 A;  3A46 A;  3HJQ A;  3H4M A;  4YY3 M;  3J27 B;  3GQ3 A;  3FTD A;  1XMQ M;  2JCH A;  2QPA A;  4X62 M;  2KNV A;  1DGB A;  2LBC A;  1OAO C;  1V33 A;  3LMM A;  1NSF A;  3GRU A;  4JI3 M;  3W68 A;  3GLG A;  3GPU A;  4REZ A;  2ZM6 M;  3SHF A;  1XB2 B;  3A45 A;  1HR0 M;  2XLJ A;  1D0K A;  3SBJ A;  3B9P A;  3FTC A;  3V76 A;  1QYR A;  3HHW A;  4HMD A;  3CF6 E;  3QWL A;  1HNZ M;  3FE3 A;  3HON A;  3L2A A;  2RGO A;  4NSR A;  1N36 M;  1HT2 E;  3FUT A;  1DV0 A;  3M7P A;  4NL4 H;  1IY1 A;  5C1B A;  1EAK A;  2KXE A;  4G4N A;  1GOI A;  2OOA A;  4AG5 A;  4BB9 A;  3U5Z B;  1E88 A;  1VEG A;  1Q3B A;  1QAO A;  3HHY A;  3U6M A;  4JI1 M;  4Z2L A;  1HJP A;  1YSY A;  1GAB A;  5KPZ A;  2L2D A;  4M0D A;  2C99 A;  5EQT A;  5EP3 A;  4EIW A;  2D7G A;  4DV6 M;  2OO9 A;  3HHX A;  2XH9 A;  3HKP A;  3PFI A;  1D0L A;  2QSF X;  3J7B A;  3SYK A;  4II7 A;  2KNA A;  1ZV1 A;  1YUB A;  2Y0T A;  2JA2 A;  3K8Z A;  4G4O A;  3LCU A;  3LW5 F;  4OUI A;  1J7M A;  2E5L M;  3KP1 E;  4MB7 A;  4QHS A;  1NVM A;  3JAM S;  3R9X B;  3CGW A;  3OTO M;  3NBX X;  2D7H A;  4NYY A;  2JE5 A;  1G4A E;  2GQF A;  3VFD A;  3TWM A;  4GC5 A;  2UXD M;  4FCV A;  5FLX S;  4B7F A;  1NJG A;  2APL A;  1QZM A;  1QZE A;  2Z8Y M;  4HL4 A;  1NY5 A;  4WUR A;  4HMC A;  3UGJ A;  3FUU A;  1E8B A;  3Q8G A;  1OKS A;  1CK7 A;  1GJS A;  4PDI A;  1VDL A;  1LV7 A;  3AV0 A;  5LMU M;  3U6E A;  2CP8 A;  2JZ1 A;  3TPZ A;  3VLF B;  2JXN A;  3GQ4 A;  4DR3 M;  3FRH A;  3GLH B;  2WSC F;  4RF0 A;  3SMS A;  3ZC7 B;  1NV8 A;  4XGI A;  4OW0 A;  3GLF E;  1W1P A;  1IM2 A;  1AUA A;  4IIW A;  2Y2J A;  3MHV C;  3U5Z A;  4AQY M;  3KOY E;  3U6L A;  1WIV A;  2ZAN A;  3GQ5 A;  4NXM M;  4P17 A;  1JQJ C;  1SXJ E;  4OJL A;  4MGH A;  1PJQ A;  3AFH A;  1VQ1 A;  3CF2 A;  5GKN A;  4CIS A;  2X8A A;  5IT9 S;  1OFI A;  4JN6 A;  8CAT A;  4PT5 A;  1LTM A;  1JR3 A;  1Y8G A;  3T1H M;  1E9S A;  1DGF A;  1L1Z A;  2Y2L A;  3WD0 A;  2EJS A;  2HWJ A;  3PNV A;  2BJW A;  4IBD A;  2L4E A;  4IBC A;  3TWK A;  3WD2 A;  4IBB A;  1L1T A;  4D80 A;  3L25 A;  2Y2G A;  5FTM A;  4F2L A;  2R65 A;  2XD5 A;  4NC6 A;  2QP9 X;  3GPX A;  4DV5 M;  4ITQ A;  1PJI A;  1N77 A;  1GKI A;  4GKK M;  1IY2 A;  4MB5 A;  4WP2 A;  4Z6Y A;  1K3X A;  4FCW A;  4LF5 M;  1ORY B;  4NRV A;  3TWL A;  3I4V A;  3BBZ A;  3GLF B;  1FJG M;  1XXH E;  3B7Z A;  1QO6 A;  2XFS A;  3MMP A;  2DWZ B;  1GXD A;  2RTS A;  3GLH A;  1PJS A;  2QNJ A;  3GRY A;  2YFQ A;  1QQW A;  1WR1 B;  2FNA A;  1IXZ A;  1FNN A;  2UUC M;  2DAG A;  3FUX A;  3L29 A;  5IZ7 D;  2Y2M A;  4LF6 M;  3IG8 A;  1XC8 A;  1E6Z A;  4JXJ A;  1D2N A;  3E9S A;  1TDZ A;  4GRI A;  5EP1 A;  4OU7 A;  4WW0 A;  1R5L A;  3ZQJ A;  3B7N A;  2OQ4 A;  5ITT A;  1OTR A;  3SFZ A;  1QUT A;  2QQ8 A;  4TUW A;  2Y2K A;  2CEA A;  3AOE A;  4K0K M;  4GC9 A;  4PCZ A;  1TR8 A;  1HQY E;  1KSF X;  2LVO C;  1GVN A;  1NO1 A;  2CE7 A;  2KW0 A;  3QYB A;  3RGP A;  5ITY A;  4RNA A;  2J7O A;  1IBL M;  1WGL A;  3KOW E;  2F5P A;  2UU9 M;  4DR4 M;  4GHA A;  2O25 A;  4LRT A;  5FTN A;  3C58 A;  1IN5 A;  4L6V 6;  1TH4 A;  1J09 A;  2R4J A;  2YNM D;  3KOZ E;  3KS8 A;  1GPF A;  2K6B A;  3VDU A;  2KHH A;  4DV0 M;  4I8O A;  3IEC A;  2HKJ A;  1SXJ D;  2JUJ A;  4LJA A;  2V6Z M;  1IBM M;  4B3T M;  1HNW M;  3KP0 E;  2X4A A;  1VEJ A;  3DZD A;  3U6O A;  2NQ8 C;  4NOO B;  3MK6 A;  3KOX E;  5BPV A;  5KQ8 A;  4DR6 M;  4UN2 B;  1OIP A;  3M0E A;  1E9R A;  1CUK A;  3SYL A;  1NV9 A;  2LVP C;  1QAN A;  4LFB M;  5ITR A;  3VK7 A;  2Y0Q A;  3IG5 A;  5DFL A;  2UUB M;  1ZAE A;  1TH2 A;  4X65 M;  1OJL A;  3C3D A;  2JY6 B;  3WD1 A;  2C9O A;  3HU1 A;  3U60 B;  2F5Q A;  5H37 D;  2CV1 A;  1XXH B;  3A98 B;  2CUZ A;  3WHK A;  5ITX E;  1XMO M;  4LF7 M;  2R62 A;  2ZTC A;  1YU2 A;  2WZJ A;  2Z4S A;  3CF0 A;  5EP4 A;  1IN8 A;  3GLF A;  2G5G X;  2YR0 A;  3GLI E;  3M6A A;  1R6B X;  2EUC A;  2L09 A;  2MH8 A;  2XF3 A;  4KLN A;  4BLC A;  4JI4 M;  2BWE A;  2LVN C;  1W5T A;  4KHP M;  1UR8 A;  1Q39 A;  1VEK A;  1T43 A;  1UM8 A;  2DZO B;  3HY5 A;  4G4Q A;  3SAV A;  4M0W A;  1H0G A;  2FOI C;  2G3Q A;  3VKG A;  1P3Q Q;  1R4G A;  3T38 A;  1MX0 A;  2DZL A;  2QHO B;  1OIZ A;  2XEP A;  4NRW A;  4X64 M;  2FH0 A;  2LH0 A;  1NY6 A;  4Q7J A;  3VK8 A;  4KO8 A;  1XNQ M;  2QBY B;  1AIP C;  4IJF A;  3HU2 A;  3E46 A;  1IY0 A;  3LVV A;  4LGM A;  3UMM A;  4AKH A;  4NXN M;  4Z2G A;  4RF1 A;  1OGB A;  3J7A S;  2BNK A;  4MGK E;  4X66 M;  2K0B X;  4JYA M;  2IOU A;  3GP1 A;  2WSF F;  1Z59 A;  2BWB A;  5EXP A;  3L27 A;  4FVM A;  3I01 M;  1CXW A;  1SXJ C;  1W1Y A;  2KEB A;  1XXH A;  4Z8X A;  2KDL A;  1I4W A;  2UXB M;  4NZ5 A;  2V1C A;  4M9S A;  1IN4 A;  1G71 A;  2FS1 A;  1T3T A;  5EXX A;  1E6N A;  3F92 A;  2DHR A;  2LVQ D;  3HWS A;  3K2L A;  4MH0 E;  2CFO A;  2R46 A;  4JI5 M;  3PVS A;  5IRE B;  3DA1 A;  2DI0 A;  4DBG B;  3TL4 X;  2Z7J A;  4Z2H A;  2DAE A;  1MJG M;  1QUS A;  4XK8 F;  2XZF A;  3FYC A;  3KDS E;  1QVR A;  4JI2 M;  2DKL A;  1Q3C A;  2VII A;  2ZAO A;  1N32 M;  2UXC M;  4JI7 M;  4Z2K A;  1IFY A;  2DVW B;  2I7P A;  3HSH A;  2BG1 A;  1GLN A;  2A5Y B;  5C18 A;  3C3E A;  3K92 A;  4GEW A;  2C5R A;  4QNL A;  1SG9 A;  1ZMU A;  3T1Y M;  2KA6 B;  4IJE A;  4MGZ E;  3WD4 A;  4B7G A;  4KOD A;  1ZQ9 A;  1E6P A;  1AIW A;  4LJ4 A;  4RKU F;  1Z6T A;  2LXE A;  3DFZ A;  3GLI B;  4FW9 A;  2ZTD A;  1XNR M;  2R6F A;  1E94 E;  5ITU A;  4LFA M;  1R2Y A;  2QBY A;  2X49 A;  7CAT A;  2Y2O A;  4GIP A;  2FE8 A;  1D0M A;  4Z2J A;  2R18 A;  2ZBK B;  3FUV A;  2JY8 A;  2W82 A;  3ILK A;  1L6J A;  2WSE F;  4G3O A;  2XSZ D;  2QZ4 A; 
#chains in the Genus database with same CATH homology
 2H1R A;  2LWX A;  4FWD A;  2Y2P A;  3FTF A;  3JR4 A;  4GKJ M;  2F5S A;  2M60 A;  4D81 A;  4FD2 A;  4DV1 M;  4DV4 M;  4IBF A;  1R2Z A;  2CV2 A;  2KRK A;  4ZPX A;  5JI2 E;  1Z5B A;  4GMQ A;  4DR1 M;  1I94 M;  4IBI A;  3KXE C;  4B7H A;  4A3V B;  1G3I A;  5KPR A;  2UUA M;  1NNJ A;  3BOS A;  3L26 A;  4QNR A;  4DR2 M;  4L16 A;  4FWG A;  1QAQ A;  4AG6 A;  2C96 A;  1PM5 A;  3W0L B;  4OJ5 A;  3LVW A;  4DV3 M;  3Q8X A;  4QNM A;  5ITX A;  4LCB A;  4IBK A;  3GPY A;  1SXJ B;  1YE9 A;  4DV2 M;  5JI3 E;  4OJP A;  4G4R A;  3I4Y A;  2DWL A;  3VKH A;  4PDG A;  4NYU A;  3JR5 A;  2KZU A;  3SAU A;  1KFV A;  3SAS A;  1DO0 A;  4I4L A;  4LZJ A;  4D82 A;  1IXR C;  4DV7 M;  4LJ8 A;  3W0F A;  3J2P B;  1N75 A;  3D8L A;  3FUW A;  3KSJ A;  2Y2Q A;  2VQE M;  4XBO A;  1DGH B;  1IN6 A;  2L7I A;  3K1J A;  1YU4 A;  4NY2 A;  4GH9 A;  5FTK A;  1IXS B;  1XWI A;  5DYG A;  5KPT A;  4JV5 M;  4IBE A;  4LF4 M;  2KRU A;  2LNH C;  2XFT A;  4LGY A;  4S12 A;  1W5S A;  3PNY A;  4QHT A;  4LG2 A;  1YU0 A;  3RE8 A;  5FTL A;  2O5R A;  2G8L A;  3KW6 A;  1E32 A;  2P5T A;  4QOZ C;  3U6Q A;  2XGN A;  2EO2 A;  2QEN A;  1KYI A;  3VDP A;  1L2C A;  3SMP A;  2RKO A;  4LRS A;  3LQR A;  4MGY E;  3SAW A;  1SXJ A;  3M7G A;  3KFU G;  3AOE C;  4QOS A;  2Y21 A;  4LY6 A;  3GPP A;  3WX7 A;  5DYI A;  4LFC M;  1WXQ A;  4L8R C;  4OVZ B;  3AL0 C;  4OJ6 A;  4LJ5 A;  4OJO A;  3D8B A;  2C98 A;  3WHL A;  4P16 A;  5BR8 M;  1DGH A;  1EE8 A;  1NJF A;  3UK6 A;  4BBA A;  3HJ8 A;  3DOA A;  4LJ6 A;  2FFJ A;  1J5E M;  1YU1 A;  4NZ3 A;  4W5W A;  2HL7 A;  2F5O A;  4MM3 B;  3GO8 A;  4I81 A;  1N78 A;  1XHB A;  1HT1 E;  1NHG C;  3CTW B;  2XZU A;  2XD1 A;  1IBK M;  4DR5 M;  5EXT A;  1K3W A;  1H6U A;  2FFF B;  1S3S A;  4IBG A;  3SHG B;  2BJV A;  3KS4 A;  3UJN A;  5DNY A;  3L28 A;  1JR3 D;  3U60 A;  4LF8 M;  4LF9 M;  3A42 A;  3T15 A;  1GL7 A;  1Z5C A;  3FKE A;  4L4U A;  1PJJ A;  1G59 A;  4JI6 M;  5EP2 A;  1G41 A;  4FCT A;  2VQF M;  1MU5 A;  1IQP A;  5FTJ A;  3U61 B;  5FSW A;  3U6C A;  2K47 A;  4NSO B;  2F5N A;  3AOG A;  3EIH A;  1J7K A;  3NBI A;  3UZU A;  5F3W A;  4JI8 M;  4AKG A;  2DWM A;  2C9C A;  3I51 A;  4M9Z A;  3J81 S;  3U6S A;  2HHH M;  3KSX A;  5KO3 A;  4L78 A;  4OVZ A;  4OX9 M;  1QAM A;  2CHV A;  2OPF A;  4FWH A;  2ZAM A;  4DUZ M;  1GL6 A;  1C1K A;  3HHZ A;  5LMN M;  2Y2H A;  2RGH A;  4JI0 M;  2KZS A;  1TGU A;  2DZN B;  1TDH A;  3N3F A;  2J7N A;  1HNX M;  4G6Z A;  1VDD A;  3SAT A;  3KVW A;  4B3S M;  4L15 A;  4B3M M;  4R7G A;  4GHL A;  4GIT A;  3SAR A;  2DWN A;  2Y2I A;  2L7H A;  5EXS A;  2QCU A;  4YHH M;  4PD2 A;  5ITQ A;  1G8P A;  4AW4 A;  1L8Q A;  2I7N A;  4LZZ A;  1N33 M;  2R45 A;  4NZ4 A;  3TE6 A;  3RGS A;  2V1U A;  2Y20 A;  4HLQ A;  3U61 A;  2F4V M;  2AHM A;  4R3D A;  5A2Q S;  5KQD A;  1R7R A;  5E26 A;  4B08 A;  1K82 A;  2Q2E B;  1NHW C;  3RFW A;  4AKI A;  2YQZ A;  4IBJ A;  1TH3 A;  3FTE A;  3GLG B;  2EA0 A;  3AKZ A;  3GRR A;  3E4R A;  4I5S A;  4B3R M;  1YU3 A;  3GLI A;  1DO2 A;  3J80 S;  4AZF A;  3R8F A;  1L2D A;  4DR7 M;  3FD9 A;  2CHG A;  3LQQ A;  3U6D A;  3HJS A;  5E6J A;  3HGI A;  4CHT B;  4NZ1 A;  2HCB A;  2XSZ A;  3QAU A;  1HQC A;  3GRV A;  2Z3X A;  1L2B A;  3MJ5 A;  4CGY B;  3PXG A;  3NWL A;  1DGG A;  2UWX A;  2Y2N A;  4M9X A;  1IN7 A;  1X37 A;  1N34 M;  2D7E A;  2CHQ A;  5IWA M;  2M5Z A;  4DUY M;  5EJC A;  1OFH A;  1NNU C;  4AI6 A;  3THG A;  3TQS A;  3ZH9 B;  3U6P A;  2ERC A;  2R4E A;  1YUE A;  1Z5A A;  3HU3 A;  3ZCB B;  4LJ9 A;  4LJ7 A;  2L6O A;  2DXI A;  3AJI B;  3SC3 A;  2Z4R A;  3FYD A;  2CV0 A;  4MGI E;  3EIE A;  3A46 A;  3HJQ A;  3H4M A;  4YY3 M;  3J27 B;  3GQ3 A;  3FTD A;  1XMQ M;  2JCH A;  2QPA A;  4X62 M;  1DGB A;  4JI3 M;  3U6M A;  3LMM A;  1NSF A;  3GRU A;  3GLG A;  2ZM6 M;  3GPU A;  4REZ A;  1HR0 M;  3SHF A;  3A45 A;  2XLJ A;  3SBJ A;  3B9P A;  3FTC A;  1QYR A;  3HHW A;  3CF6 E;  3QWL A;  1HNZ M;  3HON A;  3L2A A;  2RGO A;  4NSR A;  1N36 M;  1HT2 E;  3FUT A;  4NL4 H;  1IY1 A;  5C1B A;  2KXE A;  4G4N A;  4AG5 A;  4BB9 A;  3U5Z B;  1Q3B A;  1QAO A;  3HHY A;  4JI1 M;  1YSY A;  5KPZ A;  4M0D A;  2C99 A;  5EQT A;  5EP3 A;  4EIW A;  2D7G A;  4DV6 M;  3HHX A;  2XH9 A;  3HKP A;  3PFI A;  3J7B A;  3SYK A;  4II7 A;  2Y0T A;  1YUB A;  3K8Z A;  2JA2 A;  4G4O A;  4OUI A;  2E5L M;  3KP1 E;  4MB7 A;  4QHS A;  1NVM A;  3JAM S;  3R9X B;  3OTO M;  2D7H A;  4NYY A;  2JE5 A;  1G4A E;  3VFD A;  3TWM A;  4GC5 A;  2UXD M;  4FCV A;  5FLX S;  4B7F A;  1NJG A;  1QZM A;  4HL4 A;  1NY5 A;  4WUR A;  3UGJ A;  3FUU A;  4PDI A;  1LV7 A;  3AV0 A;  5LMU M;  3U6E A;  3TPZ A;  3VLF B;  3GQ4 A;  4DR3 M;  3GLH B;  4RF0 A;  3SMS A;  3ZC7 B;  4XGI A;  4OW0 A;  1IM2 A;  4IIW A;  2Y2J A;  3MHV C;  3U5Z A;  4AQY M;  3KOY E;  3U6L A;  3GQ5 A;  2ZAN A;  4NXM M;  4OJL A;  1JQJ C;  1SXJ E;  4MGH A;  3AFH A;  3CF2 A;  4CIS A;  5GKN A;  2X8A A;  5IT9 S;  1OFI A;  4JN6 A;  8CAT A;  4PT5 A;  1JR3 A;  3T1H M;  1E9S A;  1DGF A;  1L1Z A;  2Y2L A;  3PNV A;  2BJW A;  4IBD A;  4IBC A;  3TWK A;  4IBB A;  1L1T A;  4D80 A;  3L25 A;  2Y2G A;  5FTM A;  2R65 A;  2XD5 A;  2QP9 X;  3GPX A;  4DV5 M;  4ITQ A;  1PJI A;  1N77 A;  1GKI A;  4GKK M;  1IY2 A;  4Z6Y A;  1K3X A;  4FCW A;  4LF5 M;  1ORY B;  4NRV A;  3TWL A;  3I4V A;  1FJG M;  2XFS A;  2DWZ B;  3GLH A;  3GRY A;  2YFQ A;  1QQW A;  2FNA A;  1IXZ A;  1FNN A;  2UUC M;  3FUX A;  3L29 A;  5IZ7 D;  2Y2M A;  4LF6 M;  3IG8 A;  1XC8 A;  4JXJ A;  1D2N A;  3E9S A;  1TDZ A;  4GRI A;  5EP1 A;  4OU7 A;  4WW0 A;  2OQ4 A;  5ITT A;  3SFZ A;  4TUW A;  2Y2K A;  2CEA A;  3AOE A;  4K0K M;  4GC9 A;  4PCZ A;  1HQY E;  1GVN A;  1KSF X;  2CE7 A;  3RGP A;  2KW0 A;  5ITY A;  3GLF B;  4RNA A;  2J7O A;  1IBL M;  3KOW E;  2F5P A;  2UU9 M;  4DR4 M;  4GHA A;  4LRT A;  5FTN A;  3C58 A;  1IN5 A;  1TH4 A;  1J09 A;  2YNM D;  2R4J A;  3KOZ E;  3KS8 A;  3VDU A;  4DV0 M;  4I8O A;  2HKJ A;  1SXJ D;  4LJA A;  2V6Z M;  1IBM M;  4B3T M;  1HNW M;  3KP0 E;  2X4A A;  3DZD A;  3U6O A;  2NQ8 C;  4NOO B;  3MK6 A;  3KOX E;  5BPV A;  5KQ8 A;  4DR6 M;  3M0E A;  1E9R A;  3SYL A;  1QAN A;  4LFB M;  5ITR A;  3VK7 A;  2Y0Q A;  3IG5 A;  2UUB M;  1ZAE A;  1TH2 A;  4X65 M;  1OJL A;  2C9O A;  3HU1 A;  3U60 B;  2F5Q A;  5H37 D;  2CV1 A;  1XXH B;  3A98 B;  2CUZ A;  3WHK A;  5ITX E;  1XMO M;  4LF7 M;  2R62 A;  1YU2 A;  2Z4S A;  3CF0 A;  5EP4 A;  1IN8 A;  3GLF A;  2G5G X;  2YR0 A;  3M6A A;  1R6B X;  2EUC A;  2L09 A;  4BLC A;  2XF3 A;  4KLN A;  4JI4 M;  4KHP M;  1W5T A;  1Q39 A;  1UM8 A;  2DZO B;  4G4Q A;  3SAV A;  4M0W A;  2FOI C;  3VKG A;  3T38 A;  1MX0 A;  2XEP A;  4NRW A;  4X64 M;  2LH0 A;  1NY6 A;  3VK8 A;  4KO8 A;  1XNQ M;  2QBY B;  4IJF A;  3HU2 A;  3LVV A;  1IY0 A;  4LGM A;  3UMM A;  4AKH A;  4NXN M;  4RF1 A;  3J7A S;  2BNK A;  4MGK E;  4X66 M;  4JYA M;  2IOU A;  3GP1 A;  1Z59 A;  5EXP A;  3L27 A;  4FVM A;  1SXJ C;  2KEB A;  1XXH A;  4Z8X A;  1I4W A;  2UXB M;  4NZ5 A;  2V1C A;  4M9S A;  1IN4 A;  5EXX A;  1T3T A;  3HWS A;  2DHR A;  4MH0 E;  3K2L A;  2CFO A;  2R46 A;  4JI5 M;  3PVS A;  5IRE B;  3DA1 A;  3TL4 X;  2Z7J A;  2XZF A;  3FYC A;  3KDS E;  1QVR A;  4JI2 M;  2VII A;  1Q3C A;  1N32 M;  2ZAO A;  2UXC M;  4JI7 M;  2DVW B;  2I7P A;  3HSH A;  2BG1 A;  1GLN A;  2A5Y B;  5C18 A;  3K92 A;  2C5R A;  4QNL A;  3T1Y M;  2KA6 B;  4IJE A;  4MGZ E;  4B7G A;  4KOD A;  1ZQ9 A;  4LJ4 A;  1Z6T A;  2LXE A;  3DFZ A;  3GLI B;  4FW9 A;  1XNR M;  1E94 E;  5ITU A;  4LFA M;  1R2Y A;  2QBY A;  2X49 A;  7CAT A;  2Y2O A;  4GIP A;  2FE8 A;  2R18 A;  2ZBK B;  3FUV A;  2W82 A;  3ILK A;  2XSZ D;  2QZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...