3L25A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l25A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l25A02
4GHAA 4IJEA 4IBKA 3L27A 3FKEA 3L28A 3L29A 4GH9A 4IBGA 4IBEA 4IBJA 4IBCA 3L25A 4IJFA 3L26A 3KS4A 3KS8A 4GHLA 4IBIA 4IBFA 5BPVA 4LG2A 4IBDA 4IBBA 3L2AA
chains in the Genus database with same CATH superfamily
2J5YA 4FW9A 2UXCM 2R44A 3KOZE 2Y2JA 1P3QQ 5FTJA 2KW0A 2R46A 2J7OA 3GLGA 4GITA 2Y21A 3W68A 3EIEA 3GPPA 5JI2E 4LJ6A 4DV6M 2DZOB 2VQEM 2OOAA 3CGWA 3VK8A 4QOZC 1EFUB 4AG6A 1WJ7A 4M9SA 3JAMS 1YU4A 2XD1A 3TWMA 3HU3A 4IJFA 3RGPA 2Y2HA 3K9OA 3B74A 4NOOB 1K3WA 4B3TM 3LCVB 3T15A 1Z59A 2EO2A 1HQCA 4AKIA 3SASA 4JN6A 3ILKA 4QHSA 1GL6A 1Y8GA 3SMSA 2HWJA 1L1TA 3GPUA 2Y2IA 4LZZA 5KO3A 4GHAA 4JYAM 2ERCA 3SHFA 2YR0A 4LFAM 4NRVA 5C18A 1WIVA 2DWZB 4MB7A 2CUZA 3H4JA 4AZFA 4B7HA 1ZMUA 2RRUA 3FYCA 3SC3A 3ZCBB 4DR6M 4GEWA 3SBJA 1JR3A 1CK7A 1H0GA 1H8PA 1KYIA 3N3FA 2CHVA 2JZ0A 3V76A 2R0IA 4LGYA 4Z2LA 2EKFA 3MHVC 2LTUA 2VDBB 2QP9X 2JE5A 1HQYE 5LMUM 3GLIA 1HJPA 1QVRA 1Z6TA 2RGOA 1YLAA 1MX0A 3HHXA 1YU0A 1PJSA 1SG9A 1E9SA 3W0FA 5GKNA 4FCWA 2GNOA 5KQ8A 1RU3A 1E9RA 4DUYM 1QUSA 1GXDA 4Z2JA 4P17A 2UXDM 5FTLA 5ITQA 3SAVA 2JNHA 3IG8A 5C1BA 3T1HM 1HNXM 2Y0QA 3AV0A 4DR4M 1F4IA 3KOXE 4BBAA 4DUZM 1L6JA 2V6ZM 4CJ6A 4RNAA 1G71A 4OUIA 2AHMA 2XZFA 3UJNA 2BWEA 2RTSA 1X37A 2KEBA 3LQRA 1XXHA 4LZJA 5ITYA 1G3IA 3GQ4A 1R2ZA 4JI4M 4MH0E 4Z2HA 3BOSA 3HY5A 1E32A 3TE6A 2FE8A 3FTFA 3B89A 2BNKA 3VLFB 4PT5A 5ITXE 4PCZA 2VF7A 3NBIA 2F5QA 4JI8M 1PRBA 2XZUA 2QCUA 4LF8M 3KS8A 2DAMA 2OOBA 2VF8A 3SYLA 1IXZA 2QNJA 3PFIA 5KQDA 1QZEA 3A98B 3GRUA 3ZC7B 1TDHA 5A2QS 4YHHM 3SAWA 3GQ3A 2G8LA 2UUAM 4JI7M 2L6OA 2YQZA 2EKKA 3JR5A 1QDRA 4L78A 3U6LA 4LJ7A 4CIZA 3GLGB 3FUVA 3GO8A 2VQFM 3IHPA 1W1YA 2D49A 3DFZA 2OO9A 4HMDA 3L27A 3FKEA 1EAKA 1E8BA 2KRUA 2JY5A 4AQYM 1DGBA 4I5SA 2X4AA 4I8OA 1UFZA 5KPTA 3J7BA 3QYEA 5EP2A 1XC8A 3M0EA 1IN4A 1DV0A 3B9PA 1OFHA 4Z6YA 1Q39A 2HKJA 1E94E 1PJTA 2R18A 1YU2A 4KO8A 4Z2IA 2O5RA 4OJ6A 2FFFB 2C98A 4NSRA 4DR1M 3AFHA 4WW0A 4REZA 4L6V6 4R3DA 1PJJA 2ZAOA 3J7AS 4LF6M 4LJ5A 1ZAEA 2P5TA 2DZNB 2XSZD 2X49A 3K92A 1R2YA 1K82A 3SARA 3C3EA 2K47A 3GLFE 4RKUF 1HNZM 2GQFA 4PD2A 2CWBA 1IM2A 4L16A 2YNMD 1OAOC 1YUEA 2XF3A 4LRTA 1NHGC 3FTEA 3HHYA 2KZSA 4UN2B 2DWMA 1OJLA 3CF2A 2D7EA 2R4EA 1IY1A 1J7KA 3GLIB 1IQPA 4FVMA 2Y2NA 1VEJA 2ZANA 3DOAA 4NSOB 3WD4A 2Z3XA 5EP4A 5FTNA 1NY6A 3R9XB 1NHWC 4GHLA 4AKHA 1YU1A 1WGLA 3HGIA 4B7FA 1TGUA 3D8LA 2W82A 3U61A 1QANA 5ITTA 2LH0A 2QQ8A 2XSZA 1UR8A 2LBCA 4MB3A 4LRSA 3KSXA 1GO5A 4Z2GA 4BB9A 4D81A 1IBLM 1W1PA 2H5XA 1ED7A 1MJGM 3GQ5A 2RKOA 3E21A 3JR4A 3SMPA 1XXHB 2QZ4A 2Y2KA 1XWIA 3HWSA 2DAEA 4WURA 1N78A 1ORYB 4II7A 3J80S 1JR3D 4NXNM 2CV2A 4IBGA 4PDIA 4FWDA 2HHHM 2WSCF 2CFOA 2XFSA 3SAUA 4OJOA 4NYUA 2C9CA 5FTKA 2FS1A 3T38A 8CATA 4DV3M 1EE8A 1PDCA 3VKHA 4L8RC 1PM5A 3AOGA 2K0BX 4KT0F 1IN7A 2KNVA 2JP7A 3W67A 1XMOM 2Z7JA 4B3RM 1ZV1A 1AIPC 3HJQA 3UK6A 4XBOA 3J81S 1E6PA 2R6FA 2KRKA 1C1KA 1Q02A 3GRYA 3HU2A 1DO2A 3HX3A 3I4YA 3PVSA 1T3TA 2KHHA 3U6PA 4HMCA 5E6JA 4AG5A 1E88A 1D2NA 1DGFA 3F92A 2CEAA 2OQ4A 3L29A 1QDTA 2A5YB 1MN3A 3C9PA 5ITXA 1ZMWA 2QSFX 3PNYA 3LVVA 1QZMA 3UMMA 1L2CA 2Y2PA 4FWGA 1OGBA 1NY5A 1GLNA 3LW5F 2DZLA 5DYIA 2L09A 4GIPA 4OJPA 3GRVA 4NL4H 3BXWA 3W0LB 2LVAA 3CF0A 4DBGB 3GLHE 1BVSA 1QAMA 4MGYE 3WX7A 2XD5A 1T43A 1IN5A 1XMQM 4FWHA 4NZ3A 4LGMA 3TL4X 1JB0F 2XFTA 1A5TA 3EIHA 3T6PA 1IXRC 5LMNM 1LV7A 1R4GA 4QNLA 3NBXX 1OIPA 2Z4SA 4CGYB 3KOYE 4G6ZA 2O01F 3E9SA 3SHGB 4G4QA 1FJGM 3U5ZA 4LJ9A 4HLQA 2DWNA 4B3SM 5EXPA 2HCBA 2N35A 3AKZA 4FD2A 3CTWB 4OX9M 1UR9A 2DAIA 3UZUA 2QBYA 1S3SA 3FYDA 3K9PA 2QENA 4LY6A 4Q7JA 4S12A 4A3VB 1QQWA 3AOEC 4KLNA 2EA0A 3U61B 4GMQA 1J7MA 4IBFA 3GPXA 3WD2A 2M5ZA 3HHWA 5KPZA 5FLXS 3SATA 5KPRA 2V1CA 1SXJE 2L4FA 4LCBA 2MR9A 2CV0A 3C3DA 3WD0A 4LFBM 1VEKA 4JI0M 2WSFF 5E26A 4DR3M 1GPFA 4LJ4A 1IN8A 4CISA 3C58A 3MQLA 2Z8YM 3U6CA 1V34A 3KP1E 1JQJC 1TH3A 3DA1A 4OVZB 1AIWA 3A42A 3NWLA 2E5LM 3HJ8A 2JXNA 3B7NA 1TH2A 3L25A 4LJAA 4QHTA 4Z8XA 4TUWA 1HT1E 3FUUA 2DKLA 4G4RA 1VEGA 5BPVA 3LCUA 3GLIE 4OJ5A 2Q2EB 3AJIB 4AI6A 1XNRM 1VDDA 2BJVA 2WSEF 2JA2A 2JY6B 3FUWA 3FUXA 2D7GA 3HKPA 1T6OA 2VIIA 1GJSA 1SXJC 2I7PA 1YSYA 3TQSA 4DV4M 1E6NA 2C96A 2D7HA 3FRHA 1OKSA 2KZUA 1N32M 4K0KM 4AKGA 1QYRA 2HL7A 3KXEC 3ZH9B 1J09A 3E46A 1H6UA 4ANRA 2OPFA 2J7NA 1W1VA 3DZDA 4QOSA 3WD1A 4GH9A 2MROB 1E6ZA 2X8AA 1OIZA 4IBJA 2Y2LA 1XXHE 4LF7M 1KSFX 5L8RF 1OQYA 1WHCA 1KS0A 3KS4A 3K2LA 4OJLA 2R65A 2FOIC 1R5LA 2Y0TA 1GJTA 2R45A 2NQ8C 3ZQJA 4WP2A 1C7YA 5EP1A 2CRUA 1R7RA 1CXWA 4LF4M 3KW6A 3L2AA 2UXBM 4D80A 2CV1A 1LTMA 2DHYA 3HZJA 2K9DA 4B7GA 4W5WA 5IREB 4GKJM 4RF0A 2F5NA 3U5ZB 3LQQA 2LVNC 1IXSB 3L28A 3KP0E 3MMPA 3CF6E 4G3OA 2MJ5B 2KNZA 4R71A 2APLA 2QBYB 4X64M 2JUJA 3BBZA 3J27B 2F5SA 1YU3A 2ZBKB 4JI1M 4OVZA 5JI3E 1N33M 3GLHA 4Y28F 3IG5A 1NVMA 5FTMA 3GLFB 2ZTCA 3E4RA 1GVNA 3B7ZA 1VG5A 4IBIA 1IFYA 2LNHC 1TTEA 2DI0A 4F2LA 3KFUG 1UM8A 2C99A 2DVWB 4F1IA 1V92A 3VKGA 2CHGA 3QAUA 4ZPXA 2LVPC 3TWKA 2XLJA 4DV1M 2DAKA 2G5GX 4X62M 2V1UA 2R4JA 1HR0M 3K1JA 3FD9A 3GPYA 1OAIA 3U6SA 5IZ7D 1L8QA 1XHBA 3I01M 1YUBA 1OTRA 1L2BA 1E6RA 5DFLA 7CATA 3TPZA 4B08A 2DNAA 1IN6A 1NSFA 4JXJA 4LJ8A 4IIWA 5H37D 2C5RA 4R7GA 4GC5A 1I94M 3U60A 4EIWA 4JV5M 1GL7A 4M9XA 3WHKA 4DR2M 1HT2E 2MGWA 4L15A 1D0LA 4QNMA 5F3WA 1IY0A 2Y20A 2ZAMA 3GP1A 2ZM6M 2JY8A 2DWLA 3L26A 1GKIA 2CHQA 1SXJA 4I4LA 4LFCM 1OGGA 1IBKM 2V5OA 1QO6A 4DV7M 4P16A 3RGSA 4B3MM 3RE8A 1D0MA 4G4OA 3KVWA 3HJSA 1GOIA 2M60A 2LHGA 5EXSA 3M6AA 1YE9A 1DGHA 4MB4A 4TX8A 4MGIE 4FCVA 4MB5A 4IJEA 4LF9M 1TF0B 2LWXA 2UUBM 3KDSE 3THGA 1ZMVA 2R62A 4XK8F 5EJCA 1N36M 2KNAA 4NY2A 1Z5AA 3PNVA 2CP8A 1TH4A 3GLGE 5DNYA 3FE3A 3WHLA 1Q3BA 2XGNA 1DO0A 4FCTA 4NZ4A 3QWLA 1IXSA 2FH0A 1Q3CA 1ZQ9A 4M0WA 3U6DA 1K3XA 5IWAM 1W5TA 4PDGA 2HAKA 4CHTB 4JI3M 4X66M 4GRIA 3R8FA 1NJFA 3GLFA 2FN2A 3IECA 5EXXA 1DGGA 4MM3B 3HHZA 3HONA 1N75A 2LHCA 3U6OA 2Y2MA 3FRIA 2UWXA 2EJSA 1VQ1A 2L7IA 4DR7M 2Y2GA 5FSWA 4I81A 1NNJA 5ITRA 3VDUA 3PXGA 4QNRA 3AL0C 2WZJA 2JZ1A 4JI6M 3SFZA 3I51A 2L2DA 4MGHA 3H4MA 3M7GA 4Z2KA 1TDZA 1G8PA 1MU5A 2Y2OA 4DV5M 1PJIA 1JR3E 2QHOB 2K6BA 3GLHB 4IBCA 4MGZE 4DV2M 3U6EA 1HNWM 1H0IA 2L4EA 1CUKA 1G41A 1G4AE 5ITUA 4X65M 2DENA 2BG1A 2QPAA 1FNNA 2LVQD 1Z5CA 3I4VA 2MH8A 1Z5BA 2Z4RA 1KFVA 1NV8A 2C9OA 4KHPM 1OFIA 1TR8A 2JY7A 2KA6B 2YFQA 3VFDA 2G3QA 3RFWA 1N77A 4IBDA 3SYKA 1V33A 3KSJA 1D0KA 3A45A 3J2PB 3K8ZA 1R6BX 5DYGA 3OTOM 3A46A 4NRWA 2F4VM 2JCHA 4HMEA 3Q8XA 4GKKM 5EQTA 5IT9S 4NC6A 1PGYA 1VDLA 2KDLA 1IBMM 4IBKA 2LVOC 3U60B 3HSHA 2CE7A 3FTCA 3MK6A 1QAQA 4RF1A 3T1YM 2Y2QA 4JI2M 1W5SA 1E15A 3U6QA 1NJGA 2DAGA 1SXJB 2KXEA 1N34M 4AW4A 2I7NA 2XEPA 2XH9A 3FUTA 2O25A 3WD3A 2JWSA 3FTDA 2LXEA 2RGHA 1AUAA 1IY2A 3I04M 4YY3M 1QUTA 2FNAA 1NNUC 1NO1A 3MJ5A 4JI5M 1DGHB 2DXIA 2FFJA 4LG2A 1XNQM 1WR1B 2F5PA 4GC9A 4IBBA 2F5OA 1PJQA 2UU9M 3KOWE 3LMMA 3M7PA 4NZ1A 3B7QA 3VDPA 3TWLA 2UUCM 1EIJA 1GABA 4HL4A 4NYYA 1O6IA 1W1TA 1J5EM 2ZTDA 3HU1A 4M9ZA 4D82A 1WXQA 2B3TA 3AOEA 2DHRA 4IBEA 4M0DA 1XB2B 2BJWA 4OU7A 4NZ5A 2BWBA 1G59A 2H1RA 1L2DA 1NV9A 4DV0M 1QAOA 2EUCA 3Q8GA 3UGJA 4KODA 2IOUA 4XGIA 4NXMM 1SXJD 2L7HA 5EP3A 4LF5M 1WGNA 3GRRA 5BR8M 3LVWA 3U6MA 3VK7A 4MGKE 4BLCA 4L4UA 3D8BA 1I4WA 3QYBA 4DR5M 1L1ZA 4ITQA 4G4NA 4OW0A 5EXTA 4HEOA
chains in the Genus database with same CATH topology
4FW9A 3KOZE 2Y2JA 5FTJA 2KW0A 2R46A 2J7OA 3GLGA 4GITA 2Y21A 3GPPA 3EIEA 4DV6M 5JI2E 4LJ6A 2DZOB 2VQEM 3VK8A 4QOZC 4AG6A 4M9SA 3JAMS 1YU4A 2XD1A 3TWMA 3HU3A 4IJFA 3RGPA 2Y2HA 4NOOB 1K3WA 4B3TM 3T15A 1Z59A 2EO2A 1HQCA 4AKIA 3SASA 4JN6A 3ILKA 4QHSA 1GL6A 3SMSA 1L1TA 3GPUA 2Y2IA 4LZZA 5KO3A 4GHAA 4JYAM 2ERCA 3SHFA 2YR0A 4LFAM 4NRVA 5C18A 2DWZB 4MB7A 2CUZA 4AZFA 4B7HA 4LF8M 3SC3A 3ZCBB 3FYCA 4DR6M 3N3FA 3SBJA 1JR3A 1KYIA 2CHVA 4LGYA 3MHVC 2QP9X 2JE5A 1HQYE 5LMUM 3GLIA 1QVRA 1Z6TA 2RGOA 1YU0A 1MX0A 3HHXA 1E9SA 3W0FA 5GKNA 4FCWA 5KQ8A 1E9RA 4DUYM 2UXDM 5FTLA 5ITQA 3SAVA 3IG8A 5C1BA 3T1HM 1HNXM 2Y0QA 3AV0A 4DR4M 3KOXE 4BBAA 4DUZM 2V6ZM 4RNAA 4OUIA 2AHMA 2XZFA 3UJNA 1X37A 2KEBA 3LQRA 1XXHA 4LZJA 5ITYA 1G3IA 3GQ4A 1R2ZA 4JI4M 4MH0E 3BOSA 1E32A 3TE6A 2FE8A 3FTFA 2BNKA 3VLFB 4PT5A 5ITXE 4PCZA 3NBIA 2F5QA 4JI8M 2XZUA 2QCUA 3KS8A 3SYLA 1IXZA 3PFIA 5KQDA 3A98B 3GRUA 3ZC7B 5A2QS 1TDHA 3SAWA 4YHHM 2UUAM 3AL0C 2G8LA 4JI7M 2L6OA 2YQZA 3JR5A 4L78A 3U6LA 4LJ7A 3GLGB 3FUVA 3GO8A 2VQFM 3DFZA 3L27A 3FKEA 2KRUA 4AQYM 1DGBA 4I5SA 2X4AA 4I8OA 5KPTA 3J7BA 5EP2A 1XC8A 3M0EA 1IN4A 3B9PA 1OFHA 4Z6YA 1Q39A 2HKJA 1E94E 1YU2A 2R18A 4KO8A 2O5RA 4OJ6A 2FFFB 2C98A 4NSRA 4DR1M 3AFHA 4WW0A 4REZA 1PJJA 4R3DA 2ZAOA 3J7AS 4LF6M 4LJ5A 1ZAEA 2P5TA 2DZNB 2XSZD 2X49A 3K92A 1R2YA 1K82A 3SARA 2K47A 1HNZM 4PD2A 1IM2A 4L16A 2YNMD 1YUEA 2XF3A 4LRTA 1NHGC 3FTEA 3HHYA 2KZSA 2DWMA 1OJLA 3CF2A 2D7EA 2R4EA 1IY1A 1J7KA 3GLIB 1IQPA 4FVMA 2Y2NA 2ZANA 3DOAA 4NSOB 2Z3XA 5EP4A 5FTNA 1NY6A 3R9XB 1NHWC 4GHLA 4AKHA 1YU1A 4B7FA 3HGIA 1TGUA 3D8LA 2W82A 3U61A 1QANA 5ITTA 2LH0A 2XSZA 4LRSA 3KSXA 4BB9A 4D81A 1IBLM 3GQ5A 2RKOA 3JR4A 3SMPA 1XXHB 2QZ4A 2Y2KA 1XWIA 3HWSA 4WURA 1N78A 1ORYB 4II7A 3J80S 1JR3D 4NXNM 2CV2A 4IBGA 4PDIA 4FWDA 2HHHM 2CFOA 2XFSA 3SAUA 4OJOA 4NYUA 2C9CA 5FTKA 3T38A 8CATA 4DV3M 1EE8A 3VKHA 4L8RC 1PM5A 3AOGA 1IN7A 1XMOM 2Z7JA 4B3RM 3HJQA 3UK6A 4XBOA 2KRKA 1C1KA 3GRYA 3HU2A 3I4YA 1DO2A 3PVSA 3U6PA 1T3TA 5E6JA 4AG5A 1D2NA 1DGFA 2CEAA 2OQ4A 3L29A 2A5YB 5ITXA 3J81S 1L2CA 2Y2PA 3PNYA 3UMMA 3LVVA 1QZMA 4FWGA 1NY5A 1GLNA 5DYIA 2L09A 4GIPA 4OJPA 3GRVA 4NL4H 3W0LB 3GQ3A 3CF0A 3WX7A 4MGYE 1QAMA 2XD5A 1IN5A 1XMQM 4FWHA 4NZ3A 4LGMA 3TL4X 2XFTA 3EIHA 1IXRC 5LMNM 1LV7A 4QNLA 4CGYB 2Z4SA 3KOYE 4G6ZA 3E9SA 3SHGB 4G4QA 1FJGM 3U5ZA 4LJ9A 4HLQA 2DWNA 4B3SM 5EXPA 2HCBA 3AKZA 4FD2A 3CTWB 4OX9M 3UZUA 2QBYA 3FYDA 1S3SA 2QENA 4LY6A 4S12A 4A3VB 2EA0A 1QQWA 3AOEC 4KLNA 3U61B 4GMQA 4IBFA 3GPXA 2M5ZA 3HHWA 5KPZA 5FLXS 3SATA 5KPRA 2V1CA 1SXJE 4LCBA 2CV0A 4LFBM 4JI0M 5E26A 4DR3M 4LJ4A 1IN8A 4CISA 3C58A 3U6CA 3KP1E 1JQJC 1TH3A 3DA1A 4OVZB 3A42A 3NWLA 2E5LM 3HJ8A 1TH2A 3L25A 4LJAA 4QHTA 4Z8XA 4TUWA 1HT1E 3FUUA 4G4RA 5BPVA 4OJ5A 2Q2EB 3AJIB 4AI6A 1XNRM 1VDDA 2BJVA 3FUXA 2JA2A 3FUWA 2D7GA 3HKPA 2VIIA 1SXJC 2I7PA 1YSYA 3TQSA 4DV4M 2C96A 2D7HA 2KZUA 1N32M 4K0KM 4AKGA 1QYRA 2HL7A 3KXEC 3ZH9B 1J09A 1H6UA 2OPFA 2J7NA 3DZDA 4QOSA 4GH9A 2X8AA 4IBJA 2Y2LA 4LF7M 1KSFX 3KS4A 3K2LA 4OJLA 2R65A 2FOIC 2Y0TA 2R45A 2NQ8C 5EP1A 1R7RA 4LF4M 3KW6A 3L2AA 2UXBM 4D80A 2CV1A 4B7GA 4W5WA 5IREB 4GKJM 4RF0A 2F5NA 3U5ZB 3LQQA 1IXSB 3L28A 3KP0E 3CF6E 2QBYB 4X64M 3J27B 2F5SA 1YU3A 2ZBKB 4JI1M 4OVZA 5JI3E 1N33M 3GLHA 3IG5A 1NVMA 5FTMA 3GLFB 3E4RA 1GVNA 4IBIA 2LNHC 3KFUG 1UM8A 2C99A 2DVWB 3VKGA 2CHGA 3QAUA 4ZPXA 3TWKA 2XLJA 4DV1M 2G5GX 4X62M 2V1UA 2R4JA 1HR0M 3K1JA 3FD9A 3GPYA 3U6SA 5IZ7D 1L8QA 1XHBA 1L2BA 1YUBA 7CATA 3TPZA 4B08A 1IN6A 1NSFA 4JXJA 4LJ8A 4IIWA 5H37D 2C5RA 4R7GA 4GC5A 1I94M 3U60A 4EIWA 4JV5M 1GL7A 4M9XA 3WHKA 4DR2M 1HT2E 4L15A 4QNMA 5F3WA 2UXCM 1IY0A 2Y20A 2ZAMA 3GP1A 2ZM6M 2DWLA 4LFCM 3L26A 1GKIA 2CHQA 1SXJA 4I4LA 1IBKM 4DV7M 4P16A 3RGSA 4B3MM 3RE8A 4G4OA 3KVWA 3HJSA 2M60A 5EXSA 3M6AA 1YE9A 1DGHA 4MGIE 4FCVA 4IJEA 4LF9M 2LWXA 2UUBM 3KDSE 3THGA 2R62A 5EJCA 1N36M 4NY2A 1Z5AA 3PNVA 1TH4A 5DNYA 3WHLA 1Q3BA 2XGNA 1DO0A 4FCTA 4NZ4A 3QWLA 1Q3CA 1ZQ9A 4M0WA 3U6DA 1K3XA 5IWAM 1W5TA 4PDGA 4CHTB 4JI3M 4X66M 4GRIA 3R8FA 1NJFA 3GLFA 5EXXA 1DGGA 4MM3B 3HHZA 3HONA 1N75A 3U6OA 2Y2MA 2UWXA 2Y2GA 2L7IA 4DR7M 5FSWA 4I81A 1NNJA 5ITRA 3VDUA 3PXGA 4QNRA 4JI6M 3SFZA 3I51A 4MGHA 3H4MA 3M7GA 1TDZA 1G8PA 1MU5A 2Y2OA 4DV5M 1PJIA 3GLHB 4MGZE 4DV2M 4IBCA 3U6EA 1HNWM 1G41A 1G4AE 5ITUA 4X65M 2BG1A 2QPAA 1FNNA 1Z5CA 3I4VA 1Z5BA 2Z4RA 1KFVA 2C9OA 4KHPM 1OFIA 2YFQA 2KA6B 3VFDA 3RFWA 1N77A 4IBDA 3SYKA 3KSJA 3J2PB 3A45A 5DYGA 3K8ZA 1R6BX 3OTOM 3A46A 4NRWA 2F4VM 2JCHA 3Q8XA 4GKKM 5EQTA 5IT9S 1IBMM 4IBKA 3U60B 3HSHA 2CE7A 3FTCA 3MK6A 1QAQA 4RF1A 3T1YM 2Y2QA 4JI2M 1W5SA 3U6QA 1NJGA 1SXJB 2KXEA 1N34M 4AW4A 2I7NA 2XEPA 2XH9A 3FUTA 3FTDA 2LXEA 2RGHA 1IY2A 4YY3M 2FNAA 1NNUC 3MJ5A 4JI5M 1DGHB 2DXIA 2FFJA 4LG2A 1XNQM 2F5PA 4GC9A 4IBBA 2F5OA 2UU9M 3KOWE 3LMMA 4NZ1A 3VDPA 2UUCM 3TWLA 4HL4A 4NYYA 1J5EM 3HU1A 4M9ZA 4D82A 1WXQA 3AOEA 4IBEA 2DHRA 4M0DA 4OU7A 2BJWA 4NZ5A 1G59A 2H1RA 1L2DA 4DV0M 1QAOA 2EUCA 3UGJA 4KODA 2IOUA 4XGIA 4NXMM 1SXJD 2L7HA 5EP3A 4LF5M 3GRRA 5BR8M 3LVWA 3U6MA 3VK7A 4MGKE 4BLCA 4L4UA 3D8BA 1I4WA 4DR5M 1L1ZA 4ITQA 4G4NA 4OW0A 5EXTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GHA A;  4IJE A;  4IBK A;  3L27 A;  3FKE A;  3L28 A;  3L29 A;  4GH9 A;  4IBG A;  4IBE A;  4IBJ A;  4IBC A;  3L25 A;  4IJF A;  3L26 A;  3KS4 A;  3KS8 A;  4GHL A;  4IBI A;  4IBF A;  5BPV A;  4LG2 A;  4IBD A;  4IBB A;  3L2A A; 
#chains in the Genus database with same CATH topology
 2J5Y A;  4FW9 A;  2UXC M;  2R44 A;  3KOZ E;  2Y2J A;  1P3Q Q;  5FTJ A;  2KW0 A;  2R46 A;  2J7O A;  3GLG A;  4GIT A;  2Y21 A;  3W68 A;  3EIE A;  3GPP A;  5JI2 E;  4LJ6 A;  4DV6 M;  2DZO B;  2VQE M;  2OOA A;  3CGW A;  3VK8 A;  4QOZ C;  1EFU B;  4AG6 A;  1WJ7 A;  4M9S A;  3JAM S;  1YU4 A;  2XD1 A;  3TWM A;  3HU3 A;  4IJF A;  3RGP A;  2Y2H A;  3K9O A;  3B74 A;  4NOO B;  1K3W A;  4B3T M;  3LCV B;  3T15 A;  1Z59 A;  2EO2 A;  1HQC A;  4AKI A;  3SAS A;  4JN6 A;  3ILK A;  4QHS A;  1GL6 A;  1Y8G A;  3SMS A;  2HWJ A;  1L1T A;  3GPU A;  2Y2I A;  4LZZ A;  5KO3 A;  4GHA A;  4JYA M;  2ERC A;  3SHF A;  2YR0 A;  4LFA M;  4NRV A;  5C18 A;  1WIV A;  2DWZ B;  4MB7 A;  2CUZ A;  3H4J A;  4AZF A;  4B7H A;  1ZMU A;  2RRU A;  3FYC A;  3SC3 A;  3ZCB B;  4DR6 M;  4GEW A;  3SBJ A;  1JR3 A;  1CK7 A;  1H0G A;  1H8P A;  1KYI A;  3N3F A;  2CHV A;  2JZ0 A;  3V76 A;  2R0I A;  4LGY A;  4Z2L A;  2EKF A;  3MHV C;  2LTU A;  2VDB B;  2QP9 X;  2JE5 A;  1HQY E;  5LMU M;  3GLI A;  1HJP A;  1QVR A;  1Z6T A;  2RGO A;  1YLA A;  1MX0 A;  3HHX A;  1YU0 A;  1PJS A;  1SG9 A;  1E9S A;  3W0F A;  5GKN A;  4FCW A;  2GNO A;  5KQ8 A;  1RU3 A;  1E9R A;  4DUY M;  1QUS A;  1GXD A;  4Z2J A;  4P17 A;  2UXD M;  5FTL A;  5ITQ A;  3SAV A;  2JNH A;  3IG8 A;  5C1B A;  3T1H M;  1HNX M;  2Y0Q A;  3AV0 A;  4DR4 M;  1F4I A;  3KOX E;  4BBA A;  4DUZ M;  1L6J A;  2V6Z M;  4CJ6 A;  4RNA A;  1G71 A;  4OUI A;  2AHM A;  2XZF A;  3UJN A;  2BWE A;  2RTS A;  1X37 A;  2KEB A;  3LQR A;  1XXH A;  4LZJ A;  5ITY A;  1G3I A;  3GQ4 A;  1R2Z A;  4JI4 M;  4MH0 E;  4Z2H A;  3BOS A;  3HY5 A;  1E32 A;  3TE6 A;  2FE8 A;  3FTF A;  3B89 A;  2BNK A;  3VLF B;  4PT5 A;  5ITX E;  4PCZ A;  2VF7 A;  3NBI A;  2F5Q A;  4JI8 M;  1PRB A;  2XZU A;  2QCU A;  4LF8 M;  3KS8 A;  2DAM A;  2OOB A;  2VF8 A;  3SYL A;  1IXZ A;  2QNJ A;  3PFI A;  5KQD A;  1QZE A;  3A98 B;  3GRU A;  3ZC7 B;  1TDH A;  5A2Q S;  4YHH M;  3SAW A;  3GQ3 A;  2G8L A;  2UUA M;  4JI7 M;  2L6O A;  2YQZ A;  2EKK A;  3JR5 A;  1QDR A;  4L78 A;  3U6L A;  4LJ7 A;  4CIZ A;  3GLG B;  3FUV A;  3GO8 A;  2VQF M;  3IHP A;  1W1Y A;  2D49 A;  3DFZ A;  2OO9 A;  4HMD A;  3L27 A;  3FKE A;  1EAK A;  1E8B A;  2KRU A;  2JY5 A;  4AQY M;  1DGB A;  4I5S A;  2X4A A;  4I8O A;  1UFZ A;  5KPT A;  3J7B A;  3QYE A;  5EP2 A;  1XC8 A;  3M0E A;  1IN4 A;  1DV0 A;  3B9P A;  1OFH A;  4Z6Y A;  1Q39 A;  2HKJ A;  1E94 E;  1PJT A;  2R18 A;  1YU2 A;  4KO8 A;  4Z2I A;  2O5R A;  4OJ6 A;  2FFF B;  2C98 A;  4NSR A;  4DR1 M;  3AFH A;  4WW0 A;  4REZ A;  4L6V 6;  4R3D A;  1PJJ A;  2ZAO A;  3J7A S;  4LF6 M;  4LJ5 A;  1ZAE A;  2P5T A;  2DZN B;  2XSZ D;  2X49 A;  3K92 A;  1R2Y A;  1K82 A;  3SAR A;  3C3E A;  2K47 A;  3GLF E;  4RKU F;  1HNZ M;  2GQF A;  4PD2 A;  2CWB A;  1IM2 A;  4L16 A;  2YNM D;  1OAO C;  1YUE A;  2XF3 A;  4LRT A;  1NHG C;  3FTE A;  3HHY A;  2KZS A;  4UN2 B;  2DWM A;  1OJL A;  3CF2 A;  2D7E A;  2R4E A;  1IY1 A;  1J7K A;  3GLI B;  1IQP A;  4FVM A;  2Y2N A;  1VEJ A;  2ZAN A;  3DOA A;  4NSO B;  3WD4 A;  2Z3X A;  5EP4 A;  5FTN A;  1NY6 A;  3R9X B;  1NHW C;  4GHL A;  4AKH A;  1YU1 A;  1WGL A;  3HGI A;  4B7F A;  1TGU A;  3D8L A;  2W82 A;  3U61 A;  1QAN A;  5ITT A;  2LH0 A;  2QQ8 A;  2XSZ A;  1UR8 A;  2LBC A;  4MB3 A;  4LRS A;  3KSX A;  1GO5 A;  4Z2G A;  4BB9 A;  4D81 A;  1IBL M;  1W1P A;  2H5X A;  1ED7 A;  1MJG M;  3GQ5 A;  2RKO A;  3E21 A;  3JR4 A;  3SMP A;  1XXH B;  2QZ4 A;  2Y2K A;  1XWI A;  3HWS A;  2DAE A;  4WUR A;  1N78 A;  1ORY B;  4II7 A;  3J80 S;  1JR3 D;  4NXN M;  2CV2 A;  4IBG A;  4PDI A;  4FWD A;  2HHH M;  2WSC F;  2CFO A;  2XFS A;  3SAU A;  4OJO A;  4NYU A;  2C9C A;  5FTK A;  2FS1 A;  3T38 A;  8CAT A;  4DV3 M;  1EE8 A;  1PDC A;  3VKH A;  4L8R C;  1PM5 A;  3AOG A;  2K0B X;  4KT0 F;  1IN7 A;  2KNV A;  2JP7 A;  3W67 A;  1XMO M;  2Z7J A;  4B3R M;  1ZV1 A;  1AIP C;  3HJQ A;  3UK6 A;  4XBO A;  3J81 S;  1E6P A;  2R6F A;  2KRK A;  1C1K A;  1Q02 A;  3GRY A;  3HU2 A;  1DO2 A;  3HX3 A;  3I4Y A;  3PVS A;  1T3T A;  2KHH A;  3U6P A;  4HMC A;  5E6J A;  4AG5 A;  1E88 A;  1D2N A;  1DGF A;  3F92 A;  2CEA A;  2OQ4 A;  3L29 A;  1QDT A;  2A5Y B;  1MN3 A;  3C9P A;  5ITX A;  1ZMW A;  2QSF X;  3PNY A;  3LVV A;  1QZM A;  3UMM A;  1L2C A;  2Y2P A;  4FWG A;  1OGB A;  1NY5 A;  1GLN A;  3LW5 F;  2DZL A;  5DYI A;  2L09 A;  4GIP A;  4OJP A;  3GRV A;  4NL4 H;  3BXW A;  3W0L B;  2LVA A;  3CF0 A;  4DBG B;  3GLH E;  1BVS A;  1QAM A;  4MGY E;  3WX7 A;  2XD5 A;  1T43 A;  1IN5 A;  1XMQ M;  4FWH A;  4NZ3 A;  4LGM A;  3TL4 X;  1JB0 F;  2XFT A;  1A5T A;  3EIH A;  3T6P A;  1IXR C;  5LMN M;  1LV7 A;  1R4G A;  4QNL A;  3NBX X;  1OIP A;  2Z4S A;  4CGY B;  3KOY E;  4G6Z A;  2O01 F;  3E9S A;  3SHG B;  4G4Q A;  1FJG M;  3U5Z A;  4LJ9 A;  4HLQ A;  2DWN A;  4B3S M;  5EXP A;  2HCB A;  2N35 A;  3AKZ A;  4FD2 A;  3CTW B;  4OX9 M;  1UR9 A;  2DAI A;  3UZU A;  2QBY A;  1S3S A;  3FYD A;  3K9P A;  2QEN A;  4LY6 A;  4Q7J A;  4S12 A;  4A3V B;  1QQW A;  3AOE C;  4KLN A;  2EA0 A;  3U61 B;  4GMQ A;  1J7M A;  4IBF A;  3GPX A;  3WD2 A;  2M5Z A;  3HHW A;  5KPZ A;  5FLX S;  3SAT A;  5KPR A;  2V1C A;  1SXJ E;  2L4F A;  4LCB A;  2MR9 A;  2CV0 A;  3C3D A;  3WD0 A;  4LFB M;  1VEK A;  4JI0 M;  2WSF F;  5E26 A;  4DR3 M;  1GPF A;  4LJ4 A;  1IN8 A;  4CIS A;  3C58 A;  3MQL A;  2Z8Y M;  3U6C A;  1V34 A;  3KP1 E;  1JQJ C;  1TH3 A;  3DA1 A;  4OVZ B;  1AIW A;  3A42 A;  3NWL A;  2E5L M;  3HJ8 A;  2JXN A;  3B7N A;  1TH2 A;  3L25 A;  4LJA A;  4QHT A;  4Z8X A;  4TUW A;  1HT1 E;  3FUU A;  2DKL A;  4G4R A;  1VEG A;  5BPV A;  3LCU A;  3GLI E;  4OJ5 A;  2Q2E B;  3AJI B;  4AI6 A;  1XNR M;  1VDD A;  2BJV A;  2WSE F;  2JA2 A;  2JY6 B;  3FUW A;  3FUX A;  2D7G A;  3HKP A;  1T6O A;  2VII A;  1GJS A;  1SXJ C;  2I7P A;  1YSY A;  3TQS A;  4DV4 M;  1E6N A;  2C96 A;  2D7H A;  3FRH A;  1OKS A;  2KZU A;  1N32 M;  4K0K M;  4AKG A;  1QYR A;  2HL7 A;  3KXE C;  3ZH9 B;  1J09 A;  3E46 A;  1H6U A;  4ANR A;  2OPF A;  2J7N A;  1W1V A;  3DZD A;  4QOS A;  3WD1 A;  4GH9 A;  2MRO B;  1E6Z A;  2X8A A;  1OIZ A;  4IBJ A;  2Y2L A;  1XXH E;  4LF7 M;  1KSF X;  5L8R F;  1OQY A;  1WHC A;  1KS0 A;  3KS4 A;  3K2L A;  4OJL A;  2R65 A;  2FOI C;  1R5L A;  2Y0T A;  1GJT A;  2R45 A;  2NQ8 C;  3ZQJ A;  4WP2 A;  1C7Y A;  5EP1 A;  2CRU A;  1R7R A;  1CXW A;  4LF4 M;  3KW6 A;  3L2A A;  2UXB M;  4D80 A;  2CV1 A;  1LTM A;  2DHY A;  3HZJ A;  2K9D A;  4B7G A;  4W5W A;  5IRE B;  4GKJ M;  4RF0 A;  2F5N A;  3U5Z B;  3LQQ A;  2LVN C;  1IXS B;  3L28 A;  3KP0 E;  3MMP A;  3CF6 E;  4G3O A;  2MJ5 B;  2KNZ A;  4R71 A;  2APL A;  2QBY B;  4X64 M;  2JUJ A;  3BBZ A;  3J27 B;  2F5S A;  1YU3 A;  2ZBK B;  4JI1 M;  4OVZ A;  5JI3 E;  1N33 M;  3GLH A;  4Y28 F;  3IG5 A;  1NVM A;  5FTM A;  3GLF B;  2ZTC A;  3E4R A;  1GVN A;  3B7Z A;  1VG5 A;  4IBI A;  1IFY A;  2LNH C;  1TTE A;  2DI0 A;  4F2L A;  3KFU G;  1UM8 A;  2C99 A;  2DVW B;  4F1I A;  1V92 A;  3VKG A;  2CHG A;  3QAU A;  4ZPX A;  2LVP C;  3TWK A;  2XLJ A;  4DV1 M;  2DAK A;  2G5G X;  4X62 M;  2V1U A;  2R4J A;  1HR0 M;  3K1J A;  3FD9 A;  3GPY A;  1OAI A;  3U6S A;  5IZ7 D;  1L8Q A;  1XHB A;  3I01 M;  1YUB A;  1OTR A;  1L2B A;  1E6R A;  5DFL A;  7CAT A;  3TPZ A;  4B08 A;  2DNA A;  1IN6 A;  1NSF A;  4JXJ A;  4LJ8 A;  4IIW A;  5H37 D;  2C5R A;  4R7G A;  4GC5 A;  1I94 M;  3U60 A;  4EIW A;  4JV5 M;  1GL7 A;  4M9X A;  3WHK A;  4DR2 M;  1HT2 E;  2MGW A;  4L15 A;  1D0L A;  4QNM A;  5F3W A;  1IY0 A;  2Y20 A;  2ZAM A;  3GP1 A;  2ZM6 M;  2JY8 A;  2DWL A;  3L26 A;  1GKI A;  2CHQ A;  1SXJ A;  4I4L A;  4LFC M;  1OGG A;  1IBK M;  2V5O A;  1QO6 A;  4DV7 M;  4P16 A;  3RGS A;  4B3M M;  3RE8 A;  1D0M A;  4G4O A;  3KVW A;  3HJS A;  1GOI A;  2M60 A;  2LHG A;  5EXS A;  3M6A A;  1YE9 A;  1DGH A;  4MB4 A;  4TX8 A;  4MGI E;  4FCV A;  4MB5 A;  4IJE A;  4LF9 M;  1TF0 B;  2LWX A;  2UUB M;  3KDS E;  3THG A;  1ZMV A;  2R62 A;  4XK8 F;  5EJC A;  1N36 M;  2KNA A;  4NY2 A;  1Z5A A;  3PNV A;  2CP8 A;  1TH4 A;  3GLG E;  5DNY A;  3FE3 A;  3WHL A;  1Q3B A;  2XGN A;  1DO0 A;  4FCT A;  4NZ4 A;  3QWL A;  1IXS A;  2FH0 A;  1Q3C A;  1ZQ9 A;  4M0W A;  3U6D A;  1K3X A;  5IWA M;  1W5T A;  4PDG A;  2HAK A;  4CHT B;  4JI3 M;  4X66 M;  4GRI A;  3R8F A;  1NJF A;  3GLF A;  2FN2 A;  3IEC A;  5EXX A;  1DGG A;  4MM3 B;  3HHZ A;  3HON A;  1N75 A;  2LHC A;  3U6O A;  2Y2M A;  3FRI A;  2UWX A;  2EJS A;  1VQ1 A;  2L7I A;  4DR7 M;  2Y2G A;  5FSW A;  4I81 A;  1NNJ A;  5ITR A;  3VDU A;  3PXG A;  4QNR A;  3AL0 C;  2WZJ A;  2JZ1 A;  4JI6 M;  3SFZ A;  3I51 A;  2L2D A;  4MGH A;  3H4M A;  3M7G A;  4Z2K A;  1TDZ A;  1G8P A;  1MU5 A;  2Y2O A;  4DV5 M;  1PJI A;  1JR3 E;  2QHO B;  2K6B A;  3GLH B;  4IBC A;  4MGZ E;  4DV2 M;  3U6E A;  1HNW M;  1H0I A;  2L4E A;  1CUK A;  1G41 A;  1G4A E;  5ITU A;  4X65 M;  2DEN A;  2BG1 A;  2QPA A;  1FNN A;  2LVQ D;  1Z5C A;  3I4V A;  2MH8 A;  1Z5B A;  2Z4R A;  1KFV A;  1NV8 A;  2C9O A;  4KHP M;  1OFI A;  1TR8 A;  2JY7 A;  2KA6 B;  2YFQ A;  3VFD A;  2G3Q A;  3RFW A;  1N77 A;  4IBD A;  3SYK A;  1V33 A;  3KSJ A;  1D0K A;  3A45 A;  3J2P B;  3K8Z A;  1R6B X;  5DYG A;  3OTO M;  3A46 A;  4NRW A;  2F4V M;  2JCH A;  4HME A;  3Q8X A;  4GKK M;  5EQT A;  5IT9 S;  4NC6 A;  1PGY A;  1VDL A;  2KDL A;  1IBM M;  4IBK A;  2LVO C;  3U60 B;  3HSH A;  2CE7 A;  3FTC A;  3MK6 A;  1QAQ A;  4RF1 A;  3T1Y M;  2Y2Q A;  4JI2 M;  1W5S A;  1E15 A;  3U6Q A;  1NJG A;  2DAG A;  1SXJ B;  2KXE A;  1N34 M;  4AW4 A;  2I7N A;  2XEP A;  2XH9 A;  3FUT A;  2O25 A;  3WD3 A;  2JWS A;  3FTD A;  2LXE A;  2RGH A;  1AUA A;  1IY2 A;  3I04 M;  4YY3 M;  1QUT A;  2FNA A;  1NNU C;  1NO1 A;  3MJ5 A;  4JI5 M;  1DGH B;  2DXI A;  2FFJ A;  4LG2 A;  1XNQ M;  1WR1 B;  2F5P A;  4GC9 A;  4IBB A;  2F5O A;  1PJQ A;  2UU9 M;  3KOW E;  3LMM A;  3M7P A;  4NZ1 A;  3B7Q A;  3VDP A;  3TWL A;  2UUC M;  1EIJ A;  1GAB A;  4HL4 A;  4NYY A;  1O6I A;  1W1T A;  1J5E M;  2ZTD A;  3HU1 A;  4M9Z A;  4D82 A;  1WXQ A;  2B3T A;  3AOE A;  2DHR A;  4IBE A;  4M0D A;  1XB2 B;  2BJW A;  4OU7 A;  4NZ5 A;  2BWB A;  1G59 A;  2H1R A;  1L2D A;  1NV9 A;  4DV0 M;  1QAO A;  2EUC A;  3Q8G A;  3UGJ A;  4KOD A;  2IOU A;  4XGI A;  4NXM M;  1SXJ D;  2L7H A;  5EP3 A;  4LF5 M;  1WGN A;  3GRR A;  5BR8 M;  3LVW A;  3U6M A;  3VK7 A;  4MGK E;  4BLC A;  4L4U A;  3D8B A;  1I4W A;  3QYB A;  4DR5 M;  1L1Z A;  4ITQ A;  4G4N A;  4OW0 A;  5EXT A;  4HEO A; 
#chains in the Genus database with same CATH homology
 4FW9 A;  3KOZ E;  2Y2J A;  5FTJ A;  2KW0 A;  2R46 A;  2J7O A;  3GLG A;  4GIT A;  2Y21 A;  3GPP A;  3EIE A;  4DV6 M;  5JI2 E;  4LJ6 A;  2DZO B;  2VQE M;  3VK8 A;  4QOZ C;  4AG6 A;  4M9S A;  3JAM S;  1YU4 A;  2XD1 A;  3TWM A;  3HU3 A;  4IJF A;  3RGP A;  2Y2H A;  4NOO B;  1K3W A;  4B3T M;  3T15 A;  1Z59 A;  2EO2 A;  1HQC A;  4AKI A;  3SAS A;  4JN6 A;  3ILK A;  4QHS A;  1GL6 A;  3SMS A;  1L1T A;  3GPU A;  2Y2I A;  4LZZ A;  5KO3 A;  4GHA A;  4JYA M;  2ERC A;  3SHF A;  2YR0 A;  4LFA M;  4NRV A;  5C18 A;  2DWZ B;  4MB7 A;  2CUZ A;  4AZF A;  4B7H A;  4LF8 M;  3SC3 A;  3ZCB B;  3FYC A;  4DR6 M;  3N3F A;  3SBJ A;  1JR3 A;  1KYI A;  2CHV A;  4LGY A;  3MHV C;  2QP9 X;  2JE5 A;  1HQY E;  5LMU M;  3GLI A;  1QVR A;  1Z6T A;  2RGO A;  1YU0 A;  1MX0 A;  3HHX A;  1E9S A;  3W0F A;  5GKN A;  4FCW A;  5KQ8 A;  1E9R A;  4DUY M;  2UXD M;  5FTL A;  5ITQ A;  3SAV A;  3IG8 A;  5C1B A;  3T1H M;  1HNX M;  2Y0Q A;  3AV0 A;  4DR4 M;  3KOX E;  4BBA A;  4DUZ M;  2V6Z M;  4RNA A;  4OUI A;  2AHM A;  2XZF A;  3UJN A;  1X37 A;  2KEB A;  3LQR A;  1XXH A;  4LZJ A;  5ITY A;  1G3I A;  3GQ4 A;  1R2Z A;  4JI4 M;  4MH0 E;  3BOS A;  1E32 A;  3TE6 A;  2FE8 A;  3FTF A;  2BNK A;  3VLF B;  4PT5 A;  5ITX E;  4PCZ A;  3NBI A;  2F5Q A;  4JI8 M;  2XZU A;  2QCU A;  3KS8 A;  3SYL A;  1IXZ A;  3PFI A;  5KQD A;  3A98 B;  3GRU A;  3ZC7 B;  5A2Q S;  1TDH A;  3SAW A;  4YHH M;  2UUA M;  3AL0 C;  2G8L A;  4JI7 M;  2L6O A;  2YQZ A;  3JR5 A;  4L78 A;  3U6L A;  4LJ7 A;  3GLG B;  3FUV A;  3GO8 A;  2VQF M;  3DFZ A;  3L27 A;  3FKE A;  2KRU A;  4AQY M;  1DGB A;  4I5S A;  2X4A A;  4I8O A;  5KPT A;  3J7B A;  5EP2 A;  1XC8 A;  3M0E A;  1IN4 A;  3B9P A;  1OFH A;  4Z6Y A;  1Q39 A;  2HKJ A;  1E94 E;  1YU2 A;  2R18 A;  4KO8 A;  2O5R A;  4OJ6 A;  2FFF B;  2C98 A;  4NSR A;  4DR1 M;  3AFH A;  4WW0 A;  4REZ A;  1PJJ A;  4R3D A;  2ZAO A;  3J7A S;  4LF6 M;  4LJ5 A;  1ZAE A;  2P5T A;  2DZN B;  2XSZ D;  2X49 A;  3K92 A;  1R2Y A;  1K82 A;  3SAR A;  2K47 A;  1HNZ M;  4PD2 A;  1IM2 A;  4L16 A;  2YNM D;  1YUE A;  2XF3 A;  4LRT A;  1NHG C;  3FTE A;  3HHY A;  2KZS A;  2DWM A;  1OJL A;  3CF2 A;  2D7E A;  2R4E A;  1IY1 A;  1J7K A;  3GLI B;  1IQP A;  4FVM A;  2Y2N A;  2ZAN A;  3DOA A;  4NSO B;  2Z3X A;  5EP4 A;  5FTN A;  1NY6 A;  3R9X B;  1NHW C;  4GHL A;  4AKH A;  1YU1 A;  4B7F A;  3HGI A;  1TGU A;  3D8L A;  2W82 A;  3U61 A;  1QAN A;  5ITT A;  2LH0 A;  2XSZ A;  4LRS A;  3KSX A;  4BB9 A;  4D81 A;  1IBL M;  3GQ5 A;  2RKO A;  3JR4 A;  3SMP A;  1XXH B;  2QZ4 A;  2Y2K A;  1XWI A;  3HWS A;  4WUR A;  1N78 A;  1ORY B;  4II7 A;  3J80 S;  1JR3 D;  4NXN M;  2CV2 A;  4IBG A;  4PDI A;  4FWD A;  2HHH M;  2CFO A;  2XFS A;  3SAU A;  4OJO A;  4NYU A;  2C9C A;  5FTK A;  3T38 A;  8CAT A;  4DV3 M;  1EE8 A;  3VKH A;  4L8R C;  1PM5 A;  3AOG A;  1IN7 A;  1XMO M;  2Z7J A;  4B3R M;  3HJQ A;  3UK6 A;  4XBO A;  2KRK A;  1C1K A;  3GRY A;  3HU2 A;  3I4Y A;  1DO2 A;  3PVS A;  3U6P A;  1T3T A;  5E6J A;  4AG5 A;  1D2N A;  1DGF A;  2CEA A;  2OQ4 A;  3L29 A;  2A5Y B;  5ITX A;  3J81 S;  1L2C A;  2Y2P A;  3PNY A;  3UMM A;  3LVV A;  1QZM A;  4FWG A;  1NY5 A;  1GLN A;  5DYI A;  2L09 A;  4GIP A;  4OJP A;  3GRV A;  4NL4 H;  3W0L B;  3GQ3 A;  3CF0 A;  3WX7 A;  4MGY E;  1QAM A;  2XD5 A;  1IN5 A;  1XMQ M;  4FWH A;  4NZ3 A;  4LGM A;  3TL4 X;  2XFT A;  3EIH A;  1IXR C;  5LMN M;  1LV7 A;  4QNL A;  4CGY B;  2Z4S A;  3KOY E;  4G6Z A;  3E9S A;  3SHG B;  4G4Q A;  1FJG M;  3U5Z A;  4LJ9 A;  4HLQ A;  2DWN A;  4B3S M;  5EXP A;  2HCB A;  3AKZ A;  4FD2 A;  3CTW B;  4OX9 M;  3UZU A;  2QBY A;  3FYD A;  1S3S A;  2QEN A;  4LY6 A;  4S12 A;  4A3V B;  2EA0 A;  1QQW A;  3AOE C;  4KLN A;  3U61 B;  4GMQ A;  4IBF A;  3GPX A;  2M5Z A;  3HHW A;  5KPZ A;  5FLX S;  3SAT A;  5KPR A;  2V1C A;  1SXJ E;  4LCB A;  2CV0 A;  4LFB M;  4JI0 M;  5E26 A;  4DR3 M;  4LJ4 A;  1IN8 A;  4CIS A;  3C58 A;  3U6C A;  3KP1 E;  1JQJ C;  1TH3 A;  3DA1 A;  4OVZ B;  3A42 A;  3NWL A;  2E5L M;  3HJ8 A;  1TH2 A;  3L25 A;  4LJA A;  4QHT A;  4Z8X A;  4TUW A;  1HT1 E;  3FUU A;  4G4R A;  5BPV A;  4OJ5 A;  2Q2E B;  3AJI B;  4AI6 A;  1XNR M;  1VDD A;  2BJV A;  3FUX A;  2JA2 A;  3FUW A;  2D7G A;  3HKP A;  2VII A;  1SXJ C;  2I7P A;  1YSY A;  3TQS A;  4DV4 M;  2C96 A;  2D7H A;  2KZU A;  1N32 M;  4K0K M;  4AKG A;  1QYR A;  2HL7 A;  3KXE C;  3ZH9 B;  1J09 A;  1H6U A;  2OPF A;  2J7N A;  3DZD A;  4QOS A;  4GH9 A;  2X8A A;  4IBJ A;  2Y2L A;  4LF7 M;  1KSF X;  3KS4 A;  3K2L A;  4OJL A;  2R65 A;  2FOI C;  2Y0T A;  2R45 A;  2NQ8 C;  5EP1 A;  1R7R A;  4LF4 M;  3KW6 A;  3L2A A;  2UXB M;  4D80 A;  2CV1 A;  4B7G A;  4W5W A;  5IRE B;  4GKJ M;  4RF0 A;  2F5N A;  3U5Z B;  3LQQ A;  1IXS B;  3L28 A;  3KP0 E;  3CF6 E;  2QBY B;  4X64 M;  3J27 B;  2F5S A;  1YU3 A;  2ZBK B;  4JI1 M;  4OVZ A;  5JI3 E;  1N33 M;  3GLH A;  3IG5 A;  1NVM A;  5FTM A;  3GLF B;  3E4R A;  1GVN A;  4IBI A;  2LNH C;  3KFU G;  1UM8 A;  2C99 A;  2DVW B;  3VKG A;  2CHG A;  3QAU A;  4ZPX A;  3TWK A;  2XLJ A;  4DV1 M;  2G5G X;  4X62 M;  2V1U A;  2R4J A;  1HR0 M;  3K1J A;  3FD9 A;  3GPY A;  3U6S A;  5IZ7 D;  1L8Q A;  1XHB A;  1L2B A;  1YUB A;  7CAT A;  3TPZ A;  4B08 A;  1IN6 A;  1NSF A;  4JXJ A;  4LJ8 A;  4IIW A;  5H37 D;  2C5R A;  4R7G A;  4GC5 A;  1I94 M;  3U60 A;  4EIW A;  4JV5 M;  1GL7 A;  4M9X A;  3WHK A;  4DR2 M;  1HT2 E;  4L15 A;  4QNM A;  5F3W A;  2UXC M;  1IY0 A;  2Y20 A;  2ZAM A;  3GP1 A;  2ZM6 M;  2DWL A;  4LFC M;  3L26 A;  1GKI A;  2CHQ A;  1SXJ A;  4I4L A;  1IBK M;  4DV7 M;  4P16 A;  3RGS A;  4B3M M;  3RE8 A;  4G4O A;  3KVW A;  3HJS A;  2M60 A;  5EXS A;  3M6A A;  1YE9 A;  1DGH A;  4MGI E;  4FCV A;  4IJE A;  4LF9 M;  2LWX A;  2UUB M;  3KDS E;  3THG A;  2R62 A;  5EJC A;  1N36 M;  4NY2 A;  1Z5A A;  3PNV A;  1TH4 A;  5DNY A;  3WHL A;  1Q3B A;  2XGN A;  1DO0 A;  4FCT A;  4NZ4 A;  3QWL A;  1Q3C A;  1ZQ9 A;  4M0W A;  3U6D A;  1K3X A;  5IWA M;  1W5T A;  4PDG A;  4CHT B;  4JI3 M;  4X66 M;  4GRI A;  3R8F A;  1NJF A;  3GLF A;  5EXX A;  1DGG A;  4MM3 B;  3HHZ A;  3HON A;  1N75 A;  3U6O A;  2Y2M A;  2UWX A;  2Y2G A;  2L7I A;  4DR7 M;  5FSW A;  4I81 A;  1NNJ A;  5ITR A;  3VDU A;  3PXG A;  4QNR A;  4JI6 M;  3SFZ A;  3I51 A;  4MGH A;  3H4M A;  3M7G A;  1TDZ A;  1G8P A;  1MU5 A;  2Y2O A;  4DV5 M;  1PJI A;  3GLH B;  4MGZ E;  4DV2 M;  4IBC A;  3U6E A;  1HNW M;  1G41 A;  1G4A E;  5ITU A;  4X65 M;  2BG1 A;  2QPA A;  1FNN A;  1Z5C A;  3I4V A;  1Z5B A;  2Z4R A;  1KFV A;  2C9O A;  4KHP M;  1OFI A;  2YFQ A;  2KA6 B;  3VFD A;  3RFW A;  1N77 A;  4IBD A;  3SYK A;  3KSJ A;  3J2P B;  3A45 A;  5DYG A;  3K8Z A;  1R6B X;  3OTO M;  3A46 A;  4NRW A;  2F4V M;  2JCH A;  3Q8X A;  4GKK M;  5EQT A;  5IT9 S;  1IBM M;  4IBK A;  3U60 B;  3HSH A;  2CE7 A;  3FTC A;  3MK6 A;  1QAQ A;  4RF1 A;  3T1Y M;  2Y2Q A;  4JI2 M;  1W5S A;  3U6Q A;  1NJG A;  1SXJ B;  2KXE A;  1N34 M;  4AW4 A;  2I7N A;  2XEP A;  2XH9 A;  3FUT A;  3FTD A;  2LXE A;  2RGH A;  1IY2 A;  4YY3 M;  2FNA A;  1NNU C;  3MJ5 A;  4JI5 M;  1DGH B;  2DXI A;  2FFJ A;  4LG2 A;  1XNQ M;  2F5P A;  4GC9 A;  4IBB A;  2F5O A;  2UU9 M;  3KOW E;  3LMM A;  4NZ1 A;  3VDP A;  2UUC M;  3TWL A;  4HL4 A;  4NYY A;  1J5E M;  3HU1 A;  4M9Z A;  4D82 A;  1WXQ A;  3AOE A;  4IBE A;  2DHR A;  4M0D A;  4OU7 A;  2BJW A;  4NZ5 A;  1G59 A;  2H1R A;  1L2D A;  4DV0 M;  1QAO A;  2EUC A;  3UGJ A;  4KOD A;  2IOU A;  4XGI A;  4NXM M;  1SXJ D;  2L7H A;  5EP3 A;  4LF5 M;  3GRR A;  5BR8 M;  3LVW A;  3U6M A;  3VK7 A;  4MGK E;  4BLC A;  4L4U A;  3D8B A;  1I4W A;  4DR5 M;  1L1Z A;  4ITQ A;  4G4N A;  4OW0 A;  5EXT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...