3L25A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
molecule keywords Polymerase cofactor VP35
total genus 40
structure length 123
sequence length 123
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l25A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l25A02
3L29A 4GHAA 3L2AA 3KS8A 4IBFA 4IBGA 4IJFA 4IBDA 4IBJA 4GHLA 4IBEA 3L27A 4LG2A 4GH9A 3FKEA 5BPVA 3KS4A 4IBBA 4IBKA 3L28A 3L26A 4IJEA 3L25A 4IBIA 4IBCA
chains in the Genus database with same CATH superfamily
3FE3A 4GKJM 2F4VM 1V33A 4JI3M 2R4JA 3PFIA 3A46A 3VK7A 4MGKE 1LTMA 3SAWA 2XD5A 1GJTA 4FCTA 1QZEA 4LG2A 1IXZA 2KNVA 3NBIA 3J81S 1HQCA 2OOBA 1Q3BA 3AOEC 4YY3M 2UXCM 1MN3A 2DXIA 1JB0F 2UXBM 4OJ6A 1JR3D 1L6JA 3FKEA 4LJ9A 5FTMA 2XD1A 2ZBKB 3WD4A 1JQJC 1HQYE 2N35A 4B7GA 1IN6A 1IBMM 5EJCA 4PDIA 2OPFA 1E94E 1R7RA 4G3OA 2NQ8C 4R3DA 1RU3A 4OJLA 4BB9A 4QHSA 2BG1A 2F5NA 3HJSA 4JXJA 2C98A 2UXDM 1GABA 1T3TA 3FRHA 1XNQM 4GHAA 3GQ3A 3VKGA 3GQ4A 1IXSB 4IBFA 3SFZA 3HSHA 1TH4A 4HEOA 3F92A 1A5TA 3GRRA 3SHFA 4GHLA 1W1TA 2V1UA 1Q39A 2EJSA 1QZMA 3M7PA 1GOIA 4TUWA 4LFAM 3SASA 4NXNM 1DGBA 2P5TA 2KNAA 3GPXA 4PD2A 1K3XA 1NJFA 1F4IA 4MM3B 1E6NA 3KOXE 3HHYA 4Z8XA 3BXWA 3U6DA 3U6OA 3HONA 3TL4X 3U61A 4MB3A 3Q8XA 1YUBA 2CFOA 4B08A 3CF6E 4CGYB 2JA2A 1KSFX 2FE8A 4DUZM 2YQZA 2J7NA 2ZTDA 1E32A 3E21A 1H8PA 3GLGB 1KFVA 4DR7M 4AI6A 3KP1E 2XZUA 4MGYE 2FFJA 4DV4M 4JI4M 1IBLM 5FTLA 3WX7A 2DI0A 2WZJA 1IBKM 1D0KA 3U61B 3FYCA 1NY6A 4KHPM 3GRUA 3TPZA 3KP0E 1ZMWA 3EIEA 4DR3M 1K3WA 1W5TA 2QENA 5KPRA 4OVZA 4OJOA 1G71A 3ILKA 5DFLA 2K6BA 2ZTCA 2FNAA 4FD2A 2F5SA 4DV2M 1EIJA 2WSCF 3WD3A 1NJGA 2R4EA 1ZMUA 1QAOA 5E26A 3U6EA 4MB4A 2DZLA 3MJ5A 2QHOB 4GITA 4NZ5A 4OJ5A 3QAUA 2DAIA 2AHMA 2R18A 3E9SA 4QHTA 4DV0M 4DR2M 1HR0M 1FJGM 3J7BA 4XBOA 1VDDA 3W67A 2OOAA 4IBCA 2LTUA 3A45A 5C18A 3KSXA 2E5LM 4JI6M 2DAEA 3L29A 4PCZA 2X49A 2LVPC 1EAKA 3RGSA 3GLIB 3WD2A 4G6ZA 3GPPA 4NZ3A 4LF6M 2DAKA 4GC5A 4BBAA 4AG5A 4LRTA 3JR5A 2DWNA 2CV2A 2JZ1A 4IBEA 1OFHA 3PNYA 4R71A 1W5SA 1DO0A 5KQDA 1K82A 2XFTA 1XB2B 5ITUA 4B3MM 4JI2M 4KODA 1YU1A 4M9ZA 3MHVC 4LJAA 2QCUA 2HWJA 1NNJA 4WW0A 3L28A 2H1RA 2LNHC 3LW5F 4LF4M 3IHPA 3ZCBB 5ITYA 3SMSA 3UJNA 4D80A 1UM8A 4DR6M 2QQ8A 4KO8A 1J7KA 3DFZA 2KW0A 2HAKA 3U6QA 3IG5A 2OO9A 3FTDA 3U6CA 2UWXA 1N32M 3HY5A 3TE6A 3GLFE 2Y2OA 2BJWA 2RGHA 2V6ZM 2M60A 4WP2A 3D8BA 1GO5A 1W1YA 5JI3E 3HGIA 3FUVA 2I7PA 2X8AA 3HU2A 3KOZE 3ZH9B 2QBYA 2X4AA 2IOUA 2Y2GA 1NHGC 1NHWC 2VF7A 3CTWB 4MH0E 5IREB 2Z4RA 1E8BA 2K0BX 3K9PA 3IG8A 2R45A 3J27B 4Z2KA 5KQ8A 4P17A 3W68A 1IFYA 4CJ6A 2BWEA 4JV5M 2D49A 1R4GA 4I4LA 4IBKA 2C9OA 2F5OA 4LF7M 1CUKA 3B7ZA 3FUWA 4NYUA 1MU5A 4R7GA 5EQTA 2JNHA 1N36M 1AIWA 1WJ7A 1QAQA 2Y2HA 2Y2LA 4Z2JA 2BNKA 2MROB 3I04M 2KNZA 1OGGA 4W5WA 1MX0A 1WHCA 1GL6A 2FH0A 4Q7JA 1GL7A 4L16A 2LVOC 3R9XB 1NVMA 3L2AA 4FW9A 3GLIA 1QYRA 2KXEA 4JI0M 3T6PA 2JE5A 5H37D 3FYDA 2QZ4A 3PXGA 5IT9S 3ZQJA 1V92A 1Z5CA 4IJFA 1IN5A 5BR8M 4RF0A 4NY2A 3GLIE 2XFSA 3LCUA 4HLQA 4NSRA 1XC8A 4GH9A 2RTSA 2EO2A 3SBJA 5ITQA 2WSFF 4Z6YA 1C1KA 2RRUA 2C99A 1YU4A 1Z6TA 3LVVA 1TF0B 2UUCM 2C9CA 1N33M 1PM5A 4DV1M 5E6JA 4NL4H 3EIHA 3LQQA 1O6IA 4JI5M 2VDBB 4NC6A 3TWLA 2QSFX 4LY6A 5ITRA 1W1PA 1XMOM 3VFDA 5FTJA 1Z5AA 3SC3A 3W0LB 3K2LA 1PGYA 4LF8M 2JCHA 2D7HA 2Y2JA 1GJSA 4PT5A 4LJ7A 1ORYB 1XXHB 4IBJA 4AG6A 3BOSA 1I94M 4NRWA 2LH0A 2O25A 1L8QA 3LCVB 1OAOC 3J2PB 1VEKA 3MMPA 1VEJA 2FFFB 1D0MA 2CE7A 2EKKA 3JAMS 3K9OA 4EIWA 1VG5A 1G59A 4JN6A 1C7YA 2DWMA 1ZV1A 4PDGA 2XLJA 2HKJA 3SATA 1NNUC 1Z59A 2CV1A 1QQWA 3C3EA 2L4EA 1FNNA 3FTCA 2KEBA 3QYEA 1HT1E 4HMCA 4LFCM 3KFUG 1SXJC 2CHVA 1EFUB 3BBZA 1QAMA 1GXDA 4LJ8A 4MB5A 2DAMA 2DVWB 2DWZB 2ZAMA 3U5ZB 3GLGE 4LF5M 3WHKA 1YLAA 1WIVA 3RFWA 3D8LA 4B3TM 4JI7M 2D7GA 2DENA 2Y2IA 4L6V6 5EP2A 2D7EA 4HMDA 1E9SA 2DKLA 2L2DA 4LJ4A 1E6ZA 4TX8A 4AZFA 2K47A 1G3IA 4OX9M 4M0DA 3KS4A 3FUXA 4ITQA 1R2ZA 2XF3A 3UZUA 2KZUA 4B7HA 2R65A 1OKSA 4I81A 1AUAA 3K1JA 2KRUA 4KT0F 3I51A 3GLFB 4DBGB 4JI1M 4OJPA 3H4JA 3GLHB 2CWBA 3PVSA 4OVZB 3C58A 2Y0QA 3B7QA 5FTNA 2V1CA 4P16A 4XK8F 1GKIA 3KW6A 1KYIA 5ITXE 2G3QA 3V76A 3UGJA 2UUBM 4RKUF 1W1VA 1PJIA 4X65M 2QBYB 1HNWM 4KLNA 1IXRC 1DGHB 2CRUA 3SHGB 2VQFM 3VDUA 1OJLA 3AOEA 2KA6B 2KZSA 5DYIA 2DWLA 2DAGA 2KHHA 3NWLA 3U6MA 1L1TA 2XZFA 3AL0C 2ZAOA 3K8ZA 2Y21A 3NBXX 4NZ4A 1YE9A 2Y2KA 5JI2E 2XSZD 3IECA 3LQRA 1BVSA 1DGGA 1TGUA 1L2DA 2JP7A 1OQYA 3SARA 2L09A 7CATA 3SMPA 2L6OA 3HU3A 3GQ5A 4L15A 3OTOM 1E15A 3T1HM 2H5XA 1YSYA 2L7IA 2L7HA 3CF0A 3Q8GA 1G4AE 3KOWE 4LFBM 4AW4A 1IQPA 1L2CA 2KDLA 3HJQA 4Z2GA 3J80S 2V5OA 4NRVA 4FWHA 2JY7A 2JY8A 5FSWA 1DO2A 2HL7A 4IBBA 3C9PA 2ERCA 1XHBA 2RGOA 1IY0A 2MH8A 3T38A 4CISA 3AOGA 2HCBA 1T6OA 3MK6A 8CATA 5L8RF 1GLNA 1T43A 4OW0A 4LGYA 4QNMA 1DGFA 2MGWA 3HWSA 4DV3M 1IN7A 3GLGA 1N78A 2G8LA 5F3WA 4DR1M 1R5LA 3A42A 3R8FA 1H0GA 4IIWA 1QDRA 1E6PA 4G4NA 1XMQM 1L1ZA 3KS8A 4LZJA 1QVRA 5KO3A 3N3FA 1SXJA 1ZMVA 4G4OA 4CIZA 3AKZA 4GC9A 1YU2A 1DGHA 1D0LA 4LRSA 2FS1A 4CHTB 4GRIA 4IBDA 3C3DA 1XXHA 2Z8YM 5DNYA 4X64M 1NSFA 2Y2NA 3HZJA 3HX3A 2LHGA 4D81A 1PRBA 1UR9A 2J5YA 4FCVA 4L78A 3UMMA 1NV9A 1QUTA 3KVWA 3LMMA 1IN4A 2XSZA 4FVMA 4X66M 4BLCA 4YHHM 4DV7M 2M5ZA 1CK7A 4MGIE 3THGA 2BWBA 3B9PA 5EP1A 4GKKM 2L4FA 1VQ1A 4RF1A 3U60B 1WGNA 1E9RA 4HMEA 5ITXA 1G8PA 3I4VA 1TH2A 2JZ0A 1YUEA 2QNJA 3I4YA 5KPZA 3U6LA 4LF9M 2J7OA 3GP1A 3ZC7B 3H4MA 2Y2MA 1HT2E 4NSOB 4S12A 4Z2HA 2XEPA 3T15A 2LWXA 1VEGA 4B3SM 1E88A 5ITTA 1HNZM 3FUTA 4QNRA 5LMNM 1PJJA 1L2BA 3GRVA 4MB7A 1VDLA 3B89A 4LGMA 1IN8A 3HHXA 4MGHA 2VF8A 4DR5M 2Q2EB 1N34M 1OGBA 4Y28F 1NV8A 5FLXS 2Y20A 1IY1A 1JR3A 4DV6M 2EUCA 1H6UA 1XXHE 2CHGA 2EKFA 2W82A 3KDSE 4LCBA 4M9SA 4XGIA 1Q3CA 3SAUA 2LHCA 3LVWA 1OAIA 3TWKA 2OQ4A 3KXEC 4DV5M 4OUIA 2JY6B 4WURA 3PNVA 1I4WA 2R0IA 4JYAM 3GLHA 2C96A 2CHQA 2DNAA 4G4QA 3AJIB 3RGPA 3CF2A 1NY5A 2R44A 2Z4SA 3SYLA 4G4RA 4GEWA 4L8RC 1J09A 4I5SA 2DZOB 4K0KM 2XH9A 1WXQA 3GRYA 4IBGA 2LXEA 3VK8A 1J5EM 4AKIA 4Z2IA 4FWDA 3VLFB 3E4RA 2UUAM 1SG9A 2CUZA 4F1IA 2R6FA 5EXTA 2KRKA 3SAVA 1KS0A 1NO1A 2A5YB 3GPUA 3KOYE 4DR4M 5BPVA 1XWIA 2YNMD 2LVQD 4HL4A 1ED7A 1GVNA 2O5RA 1EE8A 1TH3A 3E46A 2APLA 1OTRA 2Z7JA 4UN2B 4M0WA 1PJQA 2YFQA 4ANRA 2VQEM 1YU3A 2MJ5B 3GO8A 4GMQA 5DYGA 2YR0A 3A98B 4A3VB 1OIPA 1S3SA 3W0FA 1MJGM 3QYBA 2QPAA 2JUJA 4M9XA 2BJVA 1Z5BA 4REZA 5EXSA 1WGLA 1ZAEA 2MR9A 2R62A 4OU7A 1QO6A 1YU0A 3FD9A 3U6SA 1IXSA 3GLHE 1PJTA 2WSEF 3K92A 1WR1B 4GIPA 2DHYA 2JWSA 1HJPA 3I01M 3TWMA 4QOSA 3T1YM 2LVNC 1G41A 1ZQ9A 2GNOA 2QP9X 4JI8M 4I8OA 4LZZA 3AV0A 2C5RA 3HHWA 1PJSA 4LJ5A 1GPFA 1TDZA 3VDPA 3L25A 4LJ6A 5EP3A 3UK6A 5EXXA 1IY2A 4AQYM 4QNLA 3HHZA 1Q02A 3GPYA 1LV7A 4AKGA 3JR4A 4NOOB 2Y0TA 2GQFA 3TQSA 4QOZC 1H0IA 1DV0A 4FCWA 3KSJA 5A2QS 1PDCA 1J7MA 3HJ8A 3HKPA 2ZM6M 3B74A 1E6RA 3M7GA 2F5QA 1JR3E 3SYKA 2CV0A 3L27A 4NXMM 5IWAM 1UR8A 2F5PA 1SXJE 4L4UA 2EA0A 2Y2PA 2CEAA 2Y2QA 2FOIC 1N77A 3M0EA 2Z3XA 2R46A 1SXJB 1TR8A 4X62M 3L26A 1HNXM 5GKNA 3DA1A 4IJEA 4F2LA 1AIPC 1R2YA 5C1BA 3AFHA 1N75A 1QANA 2B3TA 1TDHA 2CP8A 2VIIA 3HU1A 3RE8A 4B7FA 3DOAA 1Y8GA 4ZPXA 5LMUM 2O01F 4RNAA 3U60A 2JY5A 2HHHM 3FTEA 2I7NA 3FUUA 3WHLA 3WD1A 1SXJD 1OFIA 1QUSA 4DUYM 3WD0A 3U5ZA 2DHRA 1V34A 2LBCA 4MGZE 3U6PA 2DZNB 2LVAA 4FWGA 4II7A 1P3QQ 5KPTA 1IM2A 3VKHA 1D2NA 4NYYA 5EXPA 1R6BX 3DZDA 3FRIA 3M6AA 2RKOA 2XGNA 2G5GX 3QWLA 1CXWA 3J7AS 1XNRM 1UFZA 2JXNA 2K9DA 3B7NA 1OIZA 1TTEA 3CGWA 3GLFA 3FTFA 4B3RM 4D82A 4AKHA 3MQLA 5EP4A 2UU9M 2ZANA 5FTKA 1QDTA 4IBIA 2FN2A 4Z2LA 1X37A 5IZ7D 4NZ1A
chains in the Genus database with same CATH topology
4GKJM 2F4VM 4JI3M 2R4JA 3PFIA 2XD5A 3VK7A 4MGKE 3SAWA 4FCTA 1IXZA 3NBIA 3J81S 1HQCA 3AOEC 1Q3BA 4YY3M 2UXCM 2DXIA 4OJ6A 2UXBM 1JR3D 3FKEA 4LJ9A 5FTMA 2XD1A 2ZBKB 1JQJC 1HQYE 4B7GA 1IN6A 1IBMM 5EJCA 4PDIA 1E94E 1R7RA 2NQ8C 4R3DA 4OJLA 4BB9A 4QHSA 2BG1A 2F5NA 3HJSA 4JXJA 2C98A 2UXDM 1T3TA 1XNQM 4GHAA 3GQ3A 3VKGA 3GQ4A 1IXSB 4IBFA 3SFZA 3HSHA 1TH4A 3GRRA 3SHFA 4GHLA 2V1UA 1Q39A 1QZMA 4TUWA 4LFAM 3SASA 4NXNM 1DGBA 2P5TA 3GPXA 1K3XA 4PD2A 1NJFA 4MM3B 3KOXE 3HHYA 4Z8XA 3U6DA 3U6OA 3HONA 3TL4X 3U61A 3Q8XA 1YUBA 2CFOA 4B08A 3CF6E 4CGYB 2JA2A 1KSFX 2FE8A 4DUZM 2YQZA 2J7NA 1E32A 3GLGB 1KFVA 4DR7M 4AI6A 3KP1E 2XZUA 4MGYE 2FFJA 4DV4M 4JI4M 1IBLM 5FTLA 3WX7A 1IBKM 4KHPM 3U61B 3FYCA 1NY6A 3GRUA 3TPZA 3KP0E 3EIEA 4DR3M 1K3WA 1W5TA 2QENA 5KPRA 4OVZA 4OJOA 3ILKA 2FNAA 4FD2A 2F5SA 4DV2M 1NJGA 2R4EA 1QAOA 5E26A 3U6EA 3MJ5A 4NZ5A 4GITA 4OJ5A 3QAUA 2R18A 2AHMA 4QHTA 3E9SA 4DV0M 4DR2M 1HR0M 1FJGM 3J7BA 4XBOA 1VDDA 4IBCA 3A45A 5C18A 2E5LM 3KSXA 4JI6M 3L29A 4PCZA 2X49A 3RGSA 3GLIB 4G6ZA 3GPPA 4NZ3A 4LF6M 4GC5A 4BBAA 3JR5A 4AG5A 4LRTA 2DWNA 2CV2A 4IBEA 1OFHA 3PNYA 1W5SA 1DO0A 5KQDA 1K82A 2XFTA 5ITUA 4B3MM 4JI2M 1YU1A 4KODA 4M9ZA 3MHVC 4LJAA 2QCUA 1NNJA 4WW0A 3L28A 2H1RA 2LNHC 4LF4M 3ZCBB 5ITYA 3SMSA 3UJNA 4D80A 1UM8A 4DR6M 4KO8A 1J7KA 3DFZA 2KW0A 3U6QA 2UWXA 3IG5A 3U6CA 3FTDA 1N32M 3TE6A 2Y2OA 2RGHA 2BJWA 2V6ZM 2M60A 3D8BA 5JI3E 3HGIA 3FUVA 2I7PA 2X8AA 3HU2A 3KOZE 3ZH9B 2QBYA 2X4AA 2IOUA 2Y2GA 1NHGC 1NHWC 3CTWB 4MH0E 5IREB 2Z4RA 3IG8A 2R45A 3J27B 5KQ8A 4JV5M 4I4LA 4IBKA 2C9OA 2F5OA 4LF7M 3FUWA 4NYUA 1MU5A 4R7GA 5EQTA 1N36M 2Y2HA 1QAQA 2Y2LA 2BNKA 4W5WA 1MX0A 1GL6A 1GL7A 4L16A 3R9XB 1NVMA 3L2AA 4FW9A 3GLIA 1QYRA 2KXEA 4JI0M 2JE5A 5H37D 3FYDA 2QZ4A 3PXGA 5IT9S 1Z5CA 4IJFA 5BR8M 1IN5A 4RF0A 4NY2A 2XFSA 4HLQA 1XC8A 4NSRA 4GH9A 2EO2A 3SBJA 5ITQA 4Z6YA 1C1KA 2C99A 1YU4A 1Z6TA 3LVVA 2UUCM 2C9CA 1N33M 1PM5A 4DV1M 5E6JA 4NL4H 3EIHA 3LQQA 4JI5M 3TWLA 4LY6A 5ITRA 1XMOM 3VFDA 5FTJA 1Z5AA 3SC3A 3W0LB 3K2LA 4LF8M 2JCHA 2D7HA 2Y2JA 4PT5A 4LJ7A 1ORYB 1XXHB 4IBJA 4AG6A 3BOSA 1I94M 4NRWA 2LH0A 1L8QA 3J2PB 2FFFB 2CE7A 3JAMS 4EIWA 1G59A 2DWMA 4JN6A 4PDGA 2XLJA 2HKJA 3SATA 1NNUC 1Z59A 2CV1A 1QQWA 3FTCA 1FNNA 2KEBA 1HT1E 4LFCM 3KFUG 1SXJC 2CHVA 1QAMA 4LJ8A 2DVWB 2DWZB 2ZAMA 3U5ZB 4LF5M 3WHKA 3RFWA 3D8LA 4B3TM 4JI7M 2D7GA 2Y2IA 5EP2A 2D7EA 1E9SA 4LJ4A 4AZFA 2K47A 1G3IA 4OX9M 4M0DA 3KS4A 3FUXA 4ITQA 1R2ZA 2XF3A 3UZUA 2KZUA 4B7HA 2R65A 4I81A 3K1JA 2KRUA 3I51A 3GLFB 4JI1M 4OJPA 3GLHB 3PVSA 4OVZB 3C58A 2Y0QA 5FTNA 2V1CA 4P16A 1GKIA 3KW6A 1KYIA 5ITXE 3UGJA 2UUBM 1PJIA 4X65M 2QBYB 1HNWM 4KLNA 1IXRC 1DGHB 3SHGB 2VQFM 3VDUA 1OJLA 3AOEA 2KA6B 2KZSA 5DYIA 2DWLA 3U6MA 3NWLA 1L1TA 2XZFA 3AL0C 2ZAOA 3K8ZA 2Y21A 4NZ4A 1YE9A 2Y2KA 5JI2E 2XSZD 3LQRA 1DGGA 1TGUA 1L2DA 3SARA 2L09A 7CATA 3SMPA 2L6OA 3HU3A 3GQ5A 4L15A 3OTOM 3T1HM 1YSYA 2L7IA 2L7HA 3CF0A 1G4AE 3KOWE 4LFBM 4AW4A 1IQPA 1L2CA 3HJQA 3J80S 4NRVA 4FWHA 5FSWA 1DO2A 2HL7A 4IBBA 2ERCA 1XHBA 2RGOA 1IY0A 3T38A 4CISA 3AOGA 2HCBA 3MK6A 8CATA 1GLNA 4OW0A 4LGYA 4QNMA 1DGFA 3HWSA 4DV3M 1IN7A 3GLGA 1N78A 2G8LA 5F3WA 4DR1M 3A42A 3R8FA 4IIWA 4G4NA 1XMQM 1L1ZA 3KS8A 4LZJA 1QVRA 5KO3A 3N3FA 1SXJA 4G4OA 3AKZA 4GC9A 1YU2A 1DGHA 4LRSA 2OPFA 4CHTB 4GRIA 4IBDA 5DNYA 1XXHA 4X64M 2Y2NA 1NSFA 4D81A 4FCVA 4L78A 3UMMA 4FVMA 3KVWA 4X66M 3LMMA 1IN4A 2XSZA 4BLCA 4YHHM 4DV7M 2M5ZA 4MGIE 3THGA 3B9PA 5EP1A 4GKKM 4RF1A 3U60B 1E9RA 5ITXA 1G8PA 3I4VA 1TH2A 1YUEA 5KPZA 3I4YA 3U6LA 4LF9M 2J7OA 3GP1A 3ZC7B 3H4MA 2Y2MA 1HT2E 4NSOB 4S12A 2XEPA 3T15A 2LWXA 4B3SM 5ITTA 1HNZM 3FUTA 4QNRA 5LMNM 1PJJA 1L2BA 3GRVA 4MB7A 4LG2A 4LGMA 1IN8A 3HHXA 4MGHA 4DR5M 1N34M 2Q2EB 5FLXS 2Y20A 1IY1A 1JR3A 4DV6M 2EUCA 1H6UA 2CHGA 2W82A 2CV0A 3KDSE 4M9SA 4LCBA 4XGIA 3SAUA 1Q3CA 3TWKA 3LVWA 2OQ4A 3KXEC 4DV5M 4OUIA 4WURA 3PNVA 1I4WA 4JYAM 3GLHA 2C96A 2CHQA 4G4QA 3AJIB 3RGPA 3CF2A 1NY5A 2Z4SA 4G4RA 3SYLA 4L8RC 1J09A 4I5SA 2DZOB 4K0KM 2XH9A 1WXQA 3GRYA 4IBGA 2LXEA 3VK8A 1J5EM 4AKIA 4FWDA 3VLFB 3E4RA 2UUAM 2CUZA 5EXTA 3SAVA 2KRKA 4DR4M 2A5YB 3GPUA 3KOYE 5BPVA 1XWIA 2YNMD 4HL4A 1GVNA 2O5RA 1EE8A 1TH3A 2Z7JA 4M0WA 2YFQA 2VQEM 1YU3A 3GO8A 4GMQA 5DYGA 2YR0A 3A98B 4A3VB 1S3SA 3W0FA 2QPAA 4M9XA 4REZA 2BJVA 1Z5BA 5EXSA 3A46A 1ZAEA 2R62A 4OU7A 1YU0A 3FD9A 3U6SA 3K92A 4GIPA 3TWMA 4QOSA 3T1YM 1G41A 1ZQ9A 4JI8M 2QP9X 4I8OA 4LZZA 3AV0A 2C5RA 3HHWA 4LJ5A 1TDZA 3VDPA 3L25A 4LJ6A 5EP3A 3UK6A 5EXXA 1IY2A 4AQYM 4QNLA 3HHZA 3GPYA 1LV7A 4AKGA 3JR4A 4NOOB 2Y0TA 4QOZC 3TQSA 4FCWA 3KSJA 5A2QS 3HJ8A 3HKPA 2ZM6M 3M7GA 2F5QA 3SYKA 4NXMM 3L27A 5IWAM 2F5PA 1SXJE 4L4UA 2EA0A 2Y2PA 2CEAA 2Y2QA 2FOIC 1N77A 3M0EA 2Z3XA 2R46A 1SXJB 4X62M 3L26A 1HNXM 5GKNA 3DA1A 4IJEA 1R2YA 5C1BA 3AFHA 1N75A 1QANA 2VIIA 1TDHA 3RE8A 4B7FA 3HU1A 5LMUM 3DOAA 4ZPXA 3U60A 4RNAA 2HHHM 3FTEA 2I7NA 3FUUA 3WHLA 1SXJD 1OFIA 4DUYM 3U5ZA 2DHRA 4MGZE 3U6PA 2DZNB 4FWGA 4II7A 3VKHA 5KPTA 1IM2A 1D2NA 4NYYA 5EXPA 1R6BX 3DZDA 3M6AA 2RKOA 2XGNA 3QWLA 2G5GX 3J7AS 1XNRM 3FTFA 3GLFA 4AKHA 4B3RM 4D82A 5EP4A 2UU9M 2ZANA 5FTKA 4IBIA 1X37A 5IZ7D 4NZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L29 A;  4GHA A;  3L2A A;  3KS8 A;  4IBF A;  4IBG A;  4IJF A;  4IBD A;  4IBJ A;  4GHL A;  4IBE A;  3L27 A;  4LG2 A;  4GH9 A;  3FKE A;  5BPV A;  3KS4 A;  4IBB A;  4IBK A;  3L28 A;  3L26 A;  4IJE A;  3L25 A;  4IBI A;  4IBC A; 
#chains in the Genus database with same CATH topology
 3FE3 A;  4GKJ M;  2F4V M;  1V33 A;  4JI3 M;  2R4J A;  3PFI A;  3A46 A;  3VK7 A;  4MGK E;  1LTM A;  3SAW A;  2XD5 A;  1GJT A;  4FCT A;  1QZE A;  4LG2 A;  1IXZ A;  2KNV A;  3NBI A;  3J81 S;  1HQC A;  2OOB A;  1Q3B A;  3AOE C;  4YY3 M;  2UXC M;  1MN3 A;  2DXI A;  1JB0 F;  2UXB M;  4OJ6 A;  1JR3 D;  1L6J A;  3FKE A;  4LJ9 A;  5FTM A;  2XD1 A;  2ZBK B;  3WD4 A;  1JQJ C;  1HQY E;  2N35 A;  4B7G A;  1IN6 A;  1IBM M;  5EJC A;  4PDI A;  2OPF A;  1E94 E;  1R7R A;  4G3O A;  2NQ8 C;  4R3D A;  1RU3 A;  4OJL A;  4BB9 A;  4QHS A;  2BG1 A;  2F5N A;  3HJS A;  4JXJ A;  2C98 A;  2UXD M;  1GAB A;  1T3T A;  3FRH A;  1XNQ M;  4GHA A;  3GQ3 A;  3VKG A;  3GQ4 A;  1IXS B;  4IBF A;  3SFZ A;  3HSH A;  1TH4 A;  4HEO A;  3F92 A;  1A5T A;  3GRR A;  3SHF A;  4GHL A;  1W1T A;  2V1U A;  1Q39 A;  2EJS A;  1QZM A;  3M7P A;  1GOI A;  4TUW A;  4LFA M;  3SAS A;  4NXN M;  1DGB A;  2P5T A;  2KNA A;  3GPX A;  4PD2 A;  1K3X A;  1NJF A;  1F4I A;  4MM3 B;  1E6N A;  3KOX E;  3HHY A;  4Z8X A;  3BXW A;  3U6D A;  3U6O A;  3HON A;  3TL4 X;  3U61 A;  4MB3 A;  3Q8X A;  1YUB A;  2CFO A;  4B08 A;  3CF6 E;  4CGY B;  2JA2 A;  1KSF X;  2FE8 A;  4DUZ M;  2YQZ A;  2J7N A;  2ZTD A;  1E32 A;  3E21 A;  1H8P A;  3GLG B;  1KFV A;  4DR7 M;  4AI6 A;  3KP1 E;  2XZU A;  4MGY E;  2FFJ A;  4DV4 M;  4JI4 M;  1IBL M;  5FTL A;  3WX7 A;  2DI0 A;  2WZJ A;  1IBK M;  1D0K A;  3U61 B;  3FYC A;  1NY6 A;  4KHP M;  3GRU A;  3TPZ A;  3KP0 E;  1ZMW A;  3EIE A;  4DR3 M;  1K3W A;  1W5T A;  2QEN A;  5KPR A;  4OVZ A;  4OJO A;  1G71 A;  3ILK A;  5DFL A;  2K6B A;  2ZTC A;  2FNA A;  4FD2 A;  2F5S A;  4DV2 M;  1EIJ A;  2WSC F;  3WD3 A;  1NJG A;  2R4E A;  1ZMU A;  1QAO A;  5E26 A;  3U6E A;  4MB4 A;  2DZL A;  3MJ5 A;  2QHO B;  4GIT A;  4NZ5 A;  4OJ5 A;  3QAU A;  2DAI A;  2AHM A;  2R18 A;  3E9S A;  4QHT A;  4DV0 M;  4DR2 M;  1HR0 M;  1FJG M;  3J7B A;  4XBO A;  1VDD A;  3W67 A;  2OOA A;  4IBC A;  2LTU A;  3A45 A;  5C18 A;  3KSX A;  2E5L M;  4JI6 M;  2DAE A;  3L29 A;  4PCZ A;  2X49 A;  2LVP C;  1EAK A;  3RGS A;  3GLI B;  3WD2 A;  4G6Z A;  3GPP A;  4NZ3 A;  4LF6 M;  2DAK A;  4GC5 A;  4BBA A;  4AG5 A;  4LRT A;  3JR5 A;  2DWN A;  2CV2 A;  2JZ1 A;  4IBE A;  1OFH A;  3PNY A;  4R71 A;  1W5S A;  1DO0 A;  5KQD A;  1K82 A;  2XFT A;  1XB2 B;  5ITU A;  4B3M M;  4JI2 M;  4KOD A;  1YU1 A;  4M9Z A;  3MHV C;  4LJA A;  2QCU A;  2HWJ A;  1NNJ A;  4WW0 A;  3L28 A;  2H1R A;  2LNH C;  3LW5 F;  4LF4 M;  3IHP A;  3ZCB B;  5ITY A;  3SMS A;  3UJN A;  4D80 A;  1UM8 A;  4DR6 M;  2QQ8 A;  4KO8 A;  1J7K A;  3DFZ A;  2KW0 A;  2HAK A;  3U6Q A;  3IG5 A;  2OO9 A;  3FTD A;  3U6C A;  2UWX A;  1N32 M;  3HY5 A;  3TE6 A;  3GLF E;  2Y2O A;  2BJW A;  2RGH A;  2V6Z M;  2M60 A;  4WP2 A;  3D8B A;  1GO5 A;  1W1Y A;  5JI3 E;  3HGI A;  3FUV A;  2I7P A;  2X8A A;  3HU2 A;  3KOZ E;  3ZH9 B;  2QBY A;  2X4A A;  2IOU A;  2Y2G A;  1NHG C;  1NHW C;  2VF7 A;  3CTW B;  4MH0 E;  5IRE B;  2Z4R A;  1E8B A;  2K0B X;  3K9P A;  3IG8 A;  2R45 A;  3J27 B;  4Z2K A;  5KQ8 A;  4P17 A;  3W68 A;  1IFY A;  4CJ6 A;  2BWE A;  4JV5 M;  2D49 A;  1R4G A;  4I4L A;  4IBK A;  2C9O A;  2F5O A;  4LF7 M;  1CUK A;  3B7Z A;  3FUW A;  4NYU A;  1MU5 A;  4R7G A;  5EQT A;  2JNH A;  1N36 M;  1AIW A;  1WJ7 A;  1QAQ A;  2Y2H A;  2Y2L A;  4Z2J A;  2BNK A;  2MRO B;  3I04 M;  2KNZ A;  1OGG A;  4W5W A;  1MX0 A;  1WHC A;  1GL6 A;  2FH0 A;  4Q7J A;  1GL7 A;  4L16 A;  2LVO C;  3R9X B;  1NVM A;  3L2A A;  4FW9 A;  3GLI A;  1QYR A;  2KXE A;  4JI0 M;  3T6P A;  2JE5 A;  5H37 D;  3FYD A;  2QZ4 A;  3PXG A;  5IT9 S;  3ZQJ A;  1V92 A;  1Z5C A;  4IJF A;  1IN5 A;  5BR8 M;  4RF0 A;  4NY2 A;  3GLI E;  2XFS A;  3LCU A;  4HLQ A;  4NSR A;  1XC8 A;  4GH9 A;  2RTS A;  2EO2 A;  3SBJ A;  5ITQ A;  2WSF F;  4Z6Y A;  1C1K A;  2RRU A;  2C99 A;  1YU4 A;  1Z6T A;  3LVV A;  1TF0 B;  2UUC M;  2C9C A;  1N33 M;  1PM5 A;  4DV1 M;  5E6J A;  4NL4 H;  3EIH A;  3LQQ A;  1O6I A;  4JI5 M;  2VDB B;  4NC6 A;  3TWL A;  2QSF X;  4LY6 A;  5ITR A;  1W1P A;  1XMO M;  3VFD A;  5FTJ A;  1Z5A A;  3SC3 A;  3W0L B;  3K2L A;  1PGY A;  4LF8 M;  2JCH A;  2D7H A;  2Y2J A;  1GJS A;  4PT5 A;  4LJ7 A;  1ORY B;  1XXH B;  4IBJ A;  4AG6 A;  3BOS A;  1I94 M;  4NRW A;  2LH0 A;  2O25 A;  1L8Q A;  3LCV B;  1OAO C;  3J2P B;  1VEK A;  3MMP A;  1VEJ A;  2FFF B;  1D0M A;  2CE7 A;  2EKK A;  3JAM S;  3K9O A;  4EIW A;  1VG5 A;  1G59 A;  4JN6 A;  1C7Y A;  2DWM A;  1ZV1 A;  4PDG A;  2XLJ A;  2HKJ A;  3SAT A;  1NNU C;  1Z59 A;  2CV1 A;  1QQW A;  3C3E A;  2L4E A;  1FNN A;  3FTC A;  2KEB A;  3QYE A;  1HT1 E;  4HMC A;  4LFC M;  3KFU G;  1SXJ C;  2CHV A;  1EFU B;  3BBZ A;  1QAM A;  1GXD A;  4LJ8 A;  4MB5 A;  2DAM A;  2DVW B;  2DWZ B;  2ZAM A;  3U5Z B;  3GLG E;  4LF5 M;  3WHK A;  1YLA A;  1WIV A;  3RFW A;  3D8L A;  4B3T M;  4JI7 M;  2D7G A;  2DEN A;  2Y2I A;  4L6V 6;  5EP2 A;  2D7E A;  4HMD A;  1E9S A;  2DKL A;  2L2D A;  4LJ4 A;  1E6Z A;  4TX8 A;  4AZF A;  2K47 A;  1G3I A;  4OX9 M;  4M0D A;  3KS4 A;  3FUX A;  4ITQ A;  1R2Z A;  2XF3 A;  3UZU A;  2KZU A;  4B7H A;  2R65 A;  1OKS A;  4I81 A;  1AUA A;  3K1J A;  2KRU A;  4KT0 F;  3I51 A;  3GLF B;  4DBG B;  4JI1 M;  4OJP A;  3H4J A;  3GLH B;  2CWB A;  3PVS A;  4OVZ B;  3C58 A;  2Y0Q A;  3B7Q A;  5FTN A;  2V1C A;  4P16 A;  4XK8 F;  1GKI A;  3KW6 A;  1KYI A;  5ITX E;  2G3Q A;  3V76 A;  3UGJ A;  2UUB M;  4RKU F;  1W1V A;  1PJI A;  4X65 M;  2QBY B;  1HNW M;  4KLN A;  1IXR C;  1DGH B;  2CRU A;  3SHG B;  2VQF M;  3VDU A;  1OJL A;  3AOE A;  2KA6 B;  2KZS A;  5DYI A;  2DWL A;  2DAG A;  2KHH A;  3NWL A;  3U6M A;  1L1T A;  2XZF A;  3AL0 C;  2ZAO A;  3K8Z A;  2Y21 A;  3NBX X;  4NZ4 A;  1YE9 A;  2Y2K A;  5JI2 E;  2XSZ D;  3IEC A;  3LQR A;  1BVS A;  1DGG A;  1TGU A;  1L2D A;  2JP7 A;  1OQY A;  3SAR A;  2L09 A;  7CAT A;  3SMP A;  2L6O A;  3HU3 A;  3GQ5 A;  4L15 A;  3OTO M;  1E15 A;  3T1H M;  2H5X A;  1YSY A;  2L7I A;  2L7H A;  3CF0 A;  3Q8G A;  1G4A E;  3KOW E;  4LFB M;  4AW4 A;  1IQP A;  1L2C A;  2KDL A;  3HJQ A;  4Z2G A;  3J80 S;  2V5O A;  4NRV A;  4FWH A;  2JY7 A;  2JY8 A;  5FSW A;  1DO2 A;  2HL7 A;  4IBB A;  3C9P A;  2ERC A;  1XHB A;  2RGO A;  1IY0 A;  2MH8 A;  3T38 A;  4CIS A;  3AOG A;  2HCB A;  1T6O A;  3MK6 A;  8CAT A;  5L8R F;  1GLN A;  1T43 A;  4OW0 A;  4LGY A;  4QNM A;  1DGF A;  2MGW A;  3HWS A;  4DV3 M;  1IN7 A;  3GLG A;  1N78 A;  2G8L A;  5F3W A;  4DR1 M;  1R5L A;  3A42 A;  3R8F A;  1H0G A;  4IIW A;  1QDR A;  1E6P A;  4G4N A;  1XMQ M;  1L1Z A;  3KS8 A;  4LZJ A;  1QVR A;  5KO3 A;  3N3F A;  1SXJ A;  1ZMV A;  4G4O A;  4CIZ A;  3AKZ A;  4GC9 A;  1YU2 A;  1DGH A;  1D0L A;  4LRS A;  2FS1 A;  4CHT B;  4GRI A;  4IBD A;  3C3D A;  1XXH A;  2Z8Y M;  5DNY A;  4X64 M;  1NSF A;  2Y2N A;  3HZJ A;  3HX3 A;  2LHG A;  4D81 A;  1PRB A;  1UR9 A;  2J5Y A;  4FCV A;  4L78 A;  3UMM A;  1NV9 A;  1QUT A;  3KVW A;  3LMM A;  1IN4 A;  2XSZ A;  4FVM A;  4X66 M;  4BLC A;  4YHH M;  4DV7 M;  2M5Z A;  1CK7 A;  4MGI E;  3THG A;  2BWB A;  3B9P A;  5EP1 A;  4GKK M;  2L4F A;  1VQ1 A;  4RF1 A;  3U60 B;  1WGN A;  1E9R A;  4HME A;  5ITX A;  1G8P A;  3I4V A;  1TH2 A;  2JZ0 A;  1YUE A;  2QNJ A;  3I4Y A;  5KPZ A;  3U6L A;  4LF9 M;  2J7O A;  3GP1 A;  3ZC7 B;  3H4M A;  2Y2M A;  1HT2 E;  4NSO B;  4S12 A;  4Z2H A;  2XEP A;  3T15 A;  2LWX A;  1VEG A;  4B3S M;  1E88 A;  5ITT A;  1HNZ M;  3FUT A;  4QNR A;  5LMN M;  1PJJ A;  1L2B A;  3GRV A;  4MB7 A;  1VDL A;  3B89 A;  4LGM A;  1IN8 A;  3HHX A;  4MGH A;  2VF8 A;  4DR5 M;  2Q2E B;  1N34 M;  1OGB A;  4Y28 F;  1NV8 A;  5FLX S;  2Y20 A;  1IY1 A;  1JR3 A;  4DV6 M;  2EUC A;  1H6U A;  1XXH E;  2CHG A;  2EKF A;  2W82 A;  3KDS E;  4LCB A;  4M9S A;  4XGI A;  1Q3C A;  3SAU A;  2LHC A;  3LVW A;  1OAI A;  3TWK A;  2OQ4 A;  3KXE C;  4DV5 M;  4OUI A;  2JY6 B;  4WUR A;  3PNV A;  1I4W A;  2R0I A;  4JYA M;  3GLH A;  2C96 A;  2CHQ A;  2DNA A;  4G4Q A;  3AJI B;  3RGP A;  3CF2 A;  1NY5 A;  2R44 A;  2Z4S A;  3SYL A;  4G4R A;  4GEW A;  4L8R C;  1J09 A;  4I5S A;  2DZO B;  4K0K M;  2XH9 A;  1WXQ A;  3GRY A;  4IBG A;  2LXE A;  3VK8 A;  1J5E M;  4AKI A;  4Z2I A;  4FWD A;  3VLF B;  3E4R A;  2UUA M;  1SG9 A;  2CUZ A;  4F1I A;  2R6F A;  5EXT A;  2KRK A;  3SAV A;  1KS0 A;  1NO1 A;  2A5Y B;  3GPU A;  3KOY E;  4DR4 M;  5BPV A;  1XWI A;  2YNM D;  2LVQ D;  4HL4 A;  1ED7 A;  1GVN A;  2O5R A;  1EE8 A;  1TH3 A;  3E46 A;  2APL A;  1OTR A;  2Z7J A;  4UN2 B;  4M0W A;  1PJQ A;  2YFQ A;  4ANR A;  2VQE M;  1YU3 A;  2MJ5 B;  3GO8 A;  4GMQ A;  5DYG A;  2YR0 A;  3A98 B;  4A3V B;  1OIP A;  1S3S A;  3W0F A;  1MJG M;  3QYB A;  2QPA A;  2JUJ A;  4M9X A;  2BJV A;  1Z5B A;  4REZ A;  5EXS A;  1WGL A;  1ZAE A;  2MR9 A;  2R62 A;  4OU7 A;  1QO6 A;  1YU0 A;  3FD9 A;  3U6S A;  1IXS A;  3GLH E;  1PJT A;  2WSE F;  3K92 A;  1WR1 B;  4GIP A;  2DHY A;  2JWS A;  1HJP A;  3I01 M;  3TWM A;  4QOS A;  3T1Y M;  2LVN C;  1G41 A;  1ZQ9 A;  2GNO A;  2QP9 X;  4JI8 M;  4I8O A;  4LZZ A;  3AV0 A;  2C5R A;  3HHW A;  1PJS A;  4LJ5 A;  1GPF A;  1TDZ A;  3VDP A;  3L25 A;  4LJ6 A;  5EP3 A;  3UK6 A;  5EXX A;  1IY2 A;  4AQY M;  4QNL A;  3HHZ A;  1Q02 A;  3GPY A;  1LV7 A;  4AKG A;  3JR4 A;  4NOO B;  2Y0T A;  2GQF A;  3TQS A;  4QOZ C;  1H0I A;  1DV0 A;  4FCW A;  3KSJ A;  5A2Q S;  1PDC A;  1J7M A;  3HJ8 A;  3HKP A;  2ZM6 M;  3B74 A;  1E6R A;  3M7G A;  2F5Q A;  1JR3 E;  3SYK A;  2CV0 A;  3L27 A;  4NXM M;  5IWA M;  1UR8 A;  2F5P A;  1SXJ E;  4L4U A;  2EA0 A;  2Y2P A;  2CEA A;  2Y2Q A;  2FOI C;  1N77 A;  3M0E A;  2Z3X A;  2R46 A;  1SXJ B;  1TR8 A;  4X62 M;  3L26 A;  1HNX M;  5GKN A;  3DA1 A;  4IJE A;  4F2L A;  1AIP C;  1R2Y A;  5C1B A;  3AFH A;  1N75 A;  1QAN A;  2B3T A;  1TDH A;  2CP8 A;  2VII A;  3HU1 A;  3RE8 A;  4B7F A;  3DOA A;  1Y8G A;  4ZPX A;  5LMU M;  2O01 F;  4RNA A;  3U60 A;  2JY5 A;  2HHH M;  3FTE A;  2I7N A;  3FUU A;  3WHL A;  3WD1 A;  1SXJ D;  1OFI A;  1QUS A;  4DUY M;  3WD0 A;  3U5Z A;  2DHR A;  1V34 A;  2LBC A;  4MGZ E;  3U6P A;  2DZN B;  2LVA A;  4FWG A;  4II7 A;  1P3Q Q;  5KPT A;  1IM2 A;  3VKH A;  1D2N A;  4NYY A;  5EXP A;  1R6B X;  3DZD A;  3FRI A;  3M6A A;  2RKO A;  2XGN A;  2G5G X;  3QWL A;  1CXW A;  3J7A S;  1XNR M;  1UFZ A;  2JXN A;  2K9D A;  3B7N A;  1OIZ A;  1TTE A;  3CGW A;  3GLF A;  3FTF A;  4B3R M;  4D82 A;  4AKH A;  3MQL A;  5EP4 A;  2UU9 M;  2ZAN A;  5FTK A;  1QDT A;  4IBI A;  2FN2 A;  4Z2L A;  1X37 A;  5IZ7 D;  4NZ1 A; 
#chains in the Genus database with same CATH homology
 4GKJ M;  2F4V M;  4JI3 M;  2R4J A;  3PFI A;  2XD5 A;  3VK7 A;  4MGK E;  3SAW A;  4FCT A;  1IXZ A;  3NBI A;  3J81 S;  1HQC A;  3AOE C;  1Q3B A;  4YY3 M;  2UXC M;  2DXI A;  4OJ6 A;  2UXB M;  1JR3 D;  3FKE A;  4LJ9 A;  5FTM A;  2XD1 A;  2ZBK B;  1JQJ C;  1HQY E;  4B7G A;  1IN6 A;  1IBM M;  5EJC A;  4PDI A;  1E94 E;  1R7R A;  2NQ8 C;  4R3D A;  4OJL A;  4BB9 A;  4QHS A;  2BG1 A;  2F5N A;  3HJS A;  4JXJ A;  2C98 A;  2UXD M;  1T3T A;  1XNQ M;  4GHA A;  3GQ3 A;  3VKG A;  3GQ4 A;  1IXS B;  4IBF A;  3SFZ A;  3HSH A;  1TH4 A;  3GRR A;  3SHF A;  4GHL A;  2V1U A;  1Q39 A;  1QZM A;  4TUW A;  4LFA M;  3SAS A;  4NXN M;  1DGB A;  2P5T A;  3GPX A;  1K3X A;  4PD2 A;  1NJF A;  4MM3 B;  3KOX E;  3HHY A;  4Z8X A;  3U6D A;  3U6O A;  3HON A;  3TL4 X;  3U61 A;  3Q8X A;  1YUB A;  2CFO A;  4B08 A;  3CF6 E;  4CGY B;  2JA2 A;  1KSF X;  2FE8 A;  4DUZ M;  2YQZ A;  2J7N A;  1E32 A;  3GLG B;  1KFV A;  4DR7 M;  4AI6 A;  3KP1 E;  2XZU A;  4MGY E;  2FFJ A;  4DV4 M;  4JI4 M;  1IBL M;  5FTL A;  3WX7 A;  1IBK M;  4KHP M;  3U61 B;  3FYC A;  1NY6 A;  3GRU A;  3TPZ A;  3KP0 E;  3EIE A;  4DR3 M;  1K3W A;  1W5T A;  2QEN A;  5KPR A;  4OVZ A;  4OJO A;  3ILK A;  2FNA A;  4FD2 A;  2F5S A;  4DV2 M;  1NJG A;  2R4E A;  1QAO A;  5E26 A;  3U6E A;  3MJ5 A;  4NZ5 A;  4GIT A;  4OJ5 A;  3QAU A;  2R18 A;  2AHM A;  4QHT A;  3E9S A;  4DV0 M;  4DR2 M;  1HR0 M;  1FJG M;  3J7B A;  4XBO A;  1VDD A;  4IBC A;  3A45 A;  5C18 A;  2E5L M;  3KSX A;  4JI6 M;  3L29 A;  4PCZ A;  2X49 A;  3RGS A;  3GLI B;  4G6Z A;  3GPP A;  4NZ3 A;  4LF6 M;  4GC5 A;  4BBA A;  3JR5 A;  4AG5 A;  4LRT A;  2DWN A;  2CV2 A;  4IBE A;  1OFH A;  3PNY A;  1W5S A;  1DO0 A;  5KQD A;  1K82 A;  2XFT A;  5ITU A;  4B3M M;  4JI2 M;  1YU1 A;  4KOD A;  4M9Z A;  3MHV C;  4LJA A;  2QCU A;  1NNJ A;  4WW0 A;  3L28 A;  2H1R A;  2LNH C;  4LF4 M;  3ZCB B;  5ITY A;  3SMS A;  3UJN A;  4D80 A;  1UM8 A;  4DR6 M;  4KO8 A;  1J7K A;  3DFZ A;  2KW0 A;  3U6Q A;  2UWX A;  3IG5 A;  3U6C A;  3FTD A;  1N32 M;  3TE6 A;  2Y2O A;  2RGH A;  2BJW A;  2V6Z M;  2M60 A;  3D8B A;  5JI3 E;  3HGI A;  3FUV A;  2I7P A;  2X8A A;  3HU2 A;  3KOZ E;  3ZH9 B;  2QBY A;  2X4A A;  2IOU A;  2Y2G A;  1NHG C;  1NHW C;  3CTW B;  4MH0 E;  5IRE B;  2Z4R A;  3IG8 A;  2R45 A;  3J27 B;  5KQ8 A;  4JV5 M;  4I4L A;  4IBK A;  2C9O A;  2F5O A;  4LF7 M;  3FUW A;  4NYU A;  1MU5 A;  4R7G A;  5EQT A;  1N36 M;  2Y2H A;  1QAQ A;  2Y2L A;  2BNK A;  4W5W A;  1MX0 A;  1GL6 A;  1GL7 A;  4L16 A;  3R9X B;  1NVM A;  3L2A A;  4FW9 A;  3GLI A;  1QYR A;  2KXE A;  4JI0 M;  2JE5 A;  5H37 D;  3FYD A;  2QZ4 A;  3PXG A;  5IT9 S;  1Z5C A;  4IJF A;  5BR8 M;  1IN5 A;  4RF0 A;  4NY2 A;  2XFS A;  4HLQ A;  1XC8 A;  4NSR A;  4GH9 A;  2EO2 A;  3SBJ A;  5ITQ A;  4Z6Y A;  1C1K A;  2C99 A;  1YU4 A;  1Z6T A;  3LVV A;  2UUC M;  2C9C A;  1N33 M;  1PM5 A;  4DV1 M;  5E6J A;  4NL4 H;  3EIH A;  3LQQ A;  4JI5 M;  3TWL A;  4LY6 A;  5ITR A;  1XMO M;  3VFD A;  5FTJ A;  1Z5A A;  3SC3 A;  3W0L B;  3K2L A;  4LF8 M;  2JCH A;  2D7H A;  2Y2J A;  4PT5 A;  4LJ7 A;  1ORY B;  1XXH B;  4IBJ A;  4AG6 A;  3BOS A;  1I94 M;  4NRW A;  2LH0 A;  1L8Q A;  3J2P B;  2FFF B;  2CE7 A;  3JAM S;  4EIW A;  1G59 A;  2DWM A;  4JN6 A;  4PDG A;  2XLJ A;  2HKJ A;  3SAT A;  1NNU C;  1Z59 A;  2CV1 A;  1QQW A;  3FTC A;  1FNN A;  2KEB A;  1HT1 E;  4LFC M;  3KFU G;  1SXJ C;  2CHV A;  1QAM A;  4LJ8 A;  2DVW B;  2DWZ B;  2ZAM A;  3U5Z B;  4LF5 M;  3WHK A;  3RFW A;  3D8L A;  4B3T M;  4JI7 M;  2D7G A;  2Y2I A;  5EP2 A;  2D7E A;  1E9S A;  4LJ4 A;  4AZF A;  2K47 A;  1G3I A;  4OX9 M;  4M0D A;  3KS4 A;  3FUX A;  4ITQ A;  1R2Z A;  2XF3 A;  3UZU A;  2KZU A;  4B7H A;  2R65 A;  4I81 A;  3K1J A;  2KRU A;  3I51 A;  3GLF B;  4JI1 M;  4OJP A;  3GLH B;  3PVS A;  4OVZ B;  3C58 A;  2Y0Q A;  5FTN A;  2V1C A;  4P16 A;  1GKI A;  3KW6 A;  1KYI A;  5ITX E;  3UGJ A;  2UUB M;  1PJI A;  4X65 M;  2QBY B;  1HNW M;  4KLN A;  1IXR C;  1DGH B;  3SHG B;  2VQF M;  3VDU A;  1OJL A;  3AOE A;  2KA6 B;  2KZS A;  5DYI A;  2DWL A;  3U6M A;  3NWL A;  1L1T A;  2XZF A;  3AL0 C;  2ZAO A;  3K8Z A;  2Y21 A;  4NZ4 A;  1YE9 A;  2Y2K A;  5JI2 E;  2XSZ D;  3LQR A;  1DGG A;  1TGU A;  1L2D A;  3SAR A;  2L09 A;  7CAT A;  3SMP A;  2L6O A;  3HU3 A;  3GQ5 A;  4L15 A;  3OTO M;  3T1H M;  1YSY A;  2L7I A;  2L7H A;  3CF0 A;  1G4A E;  3KOW E;  4LFB M;  4AW4 A;  1IQP A;  1L2C A;  3HJQ A;  3J80 S;  4NRV A;  4FWH A;  5FSW A;  1DO2 A;  2HL7 A;  4IBB A;  2ERC A;  1XHB A;  2RGO A;  1IY0 A;  3T38 A;  4CIS A;  3AOG A;  2HCB A;  3MK6 A;  8CAT A;  1GLN A;  4OW0 A;  4LGY A;  4QNM A;  1DGF A;  3HWS A;  4DV3 M;  1IN7 A;  3GLG A;  1N78 A;  2G8L A;  5F3W A;  4DR1 M;  3A42 A;  3R8F A;  4IIW A;  4G4N A;  1XMQ M;  1L1Z A;  3KS8 A;  4LZJ A;  1QVR A;  5KO3 A;  3N3F A;  1SXJ A;  4G4O A;  3AKZ A;  4GC9 A;  1YU2 A;  1DGH A;  4LRS A;  2OPF A;  4CHT B;  4GRI A;  4IBD A;  5DNY A;  1XXH A;  4X64 M;  2Y2N A;  1NSF A;  4D81 A;  4FCV A;  4L78 A;  3UMM A;  4FVM A;  3KVW A;  4X66 M;  3LMM A;  1IN4 A;  2XSZ A;  4BLC A;  4YHH M;  4DV7 M;  2M5Z A;  4MGI E;  3THG A;  3B9P A;  5EP1 A;  4GKK M;  4RF1 A;  3U60 B;  1E9R A;  5ITX A;  1G8P A;  3I4V A;  1TH2 A;  1YUE A;  5KPZ A;  3I4Y A;  3U6L A;  4LF9 M;  2J7O A;  3GP1 A;  3ZC7 B;  3H4M A;  2Y2M A;  1HT2 E;  4NSO B;  4S12 A;  2XEP A;  3T15 A;  2LWX A;  4B3S M;  5ITT A;  1HNZ M;  3FUT A;  4QNR A;  5LMN M;  1PJJ A;  1L2B A;  3GRV A;  4MB7 A;  4LG2 A;  4LGM A;  1IN8 A;  3HHX A;  4MGH A;  4DR5 M;  1N34 M;  2Q2E B;  5FLX S;  2Y20 A;  1IY1 A;  1JR3 A;  4DV6 M;  2EUC A;  1H6U A;  2CHG A;  2W82 A;  2CV0 A;  3KDS E;  4M9S A;  4LCB A;  4XGI A;  3SAU A;  1Q3C A;  3TWK A;  3LVW A;  2OQ4 A;  3KXE C;  4DV5 M;  4OUI A;  4WUR A;  3PNV A;  1I4W A;  4JYA M;  3GLH A;  2C96 A;  2CHQ A;  4G4Q A;  3AJI B;  3RGP A;  3CF2 A;  1NY5 A;  2Z4S A;  4G4R A;  3SYL A;  4L8R C;  1J09 A;  4I5S A;  2DZO B;  4K0K M;  2XH9 A;  1WXQ A;  3GRY A;  4IBG A;  2LXE A;  3VK8 A;  1J5E M;  4AKI A;  4FWD A;  3VLF B;  3E4R A;  2UUA M;  2CUZ A;  5EXT A;  3SAV A;  2KRK A;  4DR4 M;  2A5Y B;  3GPU A;  3KOY E;  5BPV A;  1XWI A;  2YNM D;  4HL4 A;  1GVN A;  2O5R A;  1EE8 A;  1TH3 A;  2Z7J A;  4M0W A;  2YFQ A;  2VQE M;  1YU3 A;  3GO8 A;  4GMQ A;  5DYG A;  2YR0 A;  3A98 B;  4A3V B;  1S3S A;  3W0F A;  2QPA A;  4M9X A;  4REZ A;  2BJV A;  1Z5B A;  5EXS A;  3A46 A;  1ZAE A;  2R62 A;  4OU7 A;  1YU0 A;  3FD9 A;  3U6S A;  3K92 A;  4GIP A;  3TWM A;  4QOS A;  3T1Y M;  1G41 A;  1ZQ9 A;  4JI8 M;  2QP9 X;  4I8O A;  4LZZ A;  3AV0 A;  2C5R A;  3HHW A;  4LJ5 A;  1TDZ A;  3VDP A;  3L25 A;  4LJ6 A;  5EP3 A;  3UK6 A;  5EXX A;  1IY2 A;  4AQY M;  4QNL A;  3HHZ A;  3GPY A;  1LV7 A;  4AKG A;  3JR4 A;  4NOO B;  2Y0T A;  4QOZ C;  3TQS A;  4FCW A;  3KSJ A;  5A2Q S;  3HJ8 A;  3HKP A;  2ZM6 M;  3M7G A;  2F5Q A;  3SYK A;  4NXM M;  3L27 A;  5IWA M;  2F5P A;  1SXJ E;  4L4U A;  2EA0 A;  2Y2P A;  2CEA A;  2Y2Q A;  2FOI C;  1N77 A;  3M0E A;  2Z3X A;  2R46 A;  1SXJ B;  4X62 M;  3L26 A;  1HNX M;  5GKN A;  3DA1 A;  4IJE A;  1R2Y A;  5C1B A;  3AFH A;  1N75 A;  1QAN A;  2VII A;  1TDH A;  3RE8 A;  4B7F A;  3HU1 A;  5LMU M;  3DOA A;  4ZPX A;  3U60 A;  4RNA A;  2HHH M;  3FTE A;  2I7N A;  3FUU A;  3WHL A;  1SXJ D;  1OFI A;  4DUY M;  3U5Z A;  2DHR A;  4MGZ E;  3U6P A;  2DZN B;  4FWG A;  4II7 A;  3VKH A;  5KPT A;  1IM2 A;  1D2N A;  4NYY A;  5EXP A;  1R6B X;  3DZD A;  3M6A A;  2RKO A;  2XGN A;  3QWL A;  2G5G X;  3J7A S;  1XNR M;  3FTF A;  3GLF A;  4AKH A;  4B3R M;  4D82 A;  5EP4 A;  2UU9 M;  2ZAN A;  5FTK A;  4IBI A;  1X37 A;  5IZ7 D;  4NZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...