3L25A

Crystal structure of zaire ebola vp35 interferon inhibitory domain bound to 8 bp dsrna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
123
structure length
123
Chain Sequence
DISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein/rna
total genus 40
structure length 123
sequence length 123
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l25A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l25A02
4IBKA 5BPVA 3L27A 4IBEA 3L29A 4IBJA 3L2AA 4IJFA 4GHLA 4IBIA 3KS4A 3FKEA 4IBBA 3KS8A 4IBGA 4IBFA 4IJEA 4IBDA 4IBCA 4GHAA 4LG2A 3L28A 3L26A 3L25A 4GH9A
chains in the Genus database with same CATH superfamily
3FUVA 1IQPA 4CJ6A 3U6SA 1L1ZA 1CXWA 2G5GX 2L4FA 2F5SA 2Z8YM 1L2BA 4HMCA 5FTJA 2IOUA 3MHVC 2NQ8C 2CV0A 1N36M 3VLFB 2JNHA 4GKKM 1TH4A 3U6LA 1E9RA 4R3DA 5ITXA 1GVNA 1UM8A 4DR5M 4LZJA 3SC3A 1K3WA 5EP2A 2I7NA 4AG6A 3RFWA 3PVSA 3HSHA 3JR5A 3HHWA 3AOEA 3UZUA 2QBYB 4MGZE 1QQWA 3K9OA 4B08A 3GP1A 2L7HA 3SFZA 1G59A 1AIWA 3KFUG 4DV3M 1YSYA 2JY7A 4IJEA 4LGMA 3W0LB 4QNRA 1EAKA 4B3TM 2R4EA 1HR0M 1XC8A 5F3WA 2YFQA 3MK6A 4DV1M 2DAEA 4X66M 4D82A 4FVMA 3GLIB 1J7KA 1E88A 5EXPA 4L15A 5IREB 4L4UA 3LCVB 3U6QA 1R2ZA 3B7ZA 3NBXX 4JV5M 3OTOM 3WD0A 5KPRA 2JZ0A 2JY6B 4Y28F 1N78A 1TF0B 3GLIE 4WW0A 2CEAA 4IIWA 2XZUA 4JYAM 3U5ZB 2C5RA 4RNAA 4LJ7A 3J80S 3FYDA 2LTUA 4MM3B 1QAQA 1IY0A 2QZ4A 1YE9A 2KA6B 2ZM6M 3U60B 1OIZA 4NXMM 3GPXA 1XB2B 4HMDA 2XF3A 4M9XA 1ZMUA 1EIJA 4DUZM 4MB3A 2L4EA 4MB7A 1KS0A 1OFIA 3J27B 2KNZA 5H37D 4GHAA 5KQ8A 1OIPA 2K47A 4XGIA 1HNXM 3H4JA 3T6PA 2APLA 1EE8A 2DZOB 2ERCA 2MR9A 5FTMA 3SAVA 2O5RA 4CGYB 1E6RA 2V1CA 2Y2OA 1VEKA 1HT2E 3HJQA 4LF8M 1N33M 2EKKA 4OW0A 3K2LA 1J5EM 2DVWB 4LY6A 3C58A 3AV0A 3KP0E 2EA0A 3N3FA 2R46A 1W1YA 2ZANA 2Y20A 3HX3A 3GPPA 3GPYA 1TDHA 2UWXA 4DR2M 1JR3E 2J7NA 3GLHE 4QOSA 3DOAA 2JUJA 2KDLA 4KLNA 4RF1A 4DUYM 2F4VM 3BOSA 4NRWA 2JE5A 1IM2A 4LJAA 2O25A 1FNNA 3IG5A 2Y0QA 2QCUA 4TUWA 4L6V6 5BR8M 1UFZA 3ILKA 1NJGA 2R0IA 4NZ5A 1CK7A 2BG1A 5EP1A 3FUUA 1Y8GA 4CISA 4KHPM 1YUEA 2LH0A 4Z2IA 2MH8A 4Q7JA 4G4RA 4AG5A 4DR1M 2FNAA 5EJCA 3QYBA 3E46A 3AJIB 1E6PA 4M0WA 3SHFA 3E9SA 4GMQA 3KOYE 4LJ5A 3SARA 4LF7M 4LJ6A 1NJFA 3M6AA 1GL6A 4B3SM 4DV4M 3VKHA 1L2CA 4AKHA 3U61A 2Z4SA 3GLHA 3A45A 4LZZA 1T3TA 1YLAA 4DV0M 1XMOM 2Y2KA 3EIEA 2RGHA 3CF2A 2HWJA 1IXSB 3F92A 3VFDA 4JI4M 4NC6A 3VK8A 2DWLA 1R7RA 2E5LM 1D0KA 2GNOA 2FOIC 3TQSA 4OX9M 1F4IA 3THGA 3WX7A 2Z3XA 4DV5M 4LFCM 1IY1A 4OJOA 3VK7A 1N75A 1XMQM 4GITA 2G8LA 2DWNA 5LMNM 1QDRA 3I4YA 1Z59A 2KHHA 4NYYA 2KNVA 2D7HA 3Q8GA 3GPUA 1QYRA 1HT1E 1V33A 3J81S 3T1YM 4GKJM 1G4AE 1ZQ9A 2H5XA 1Z5CA 2L09A 4MGIE 3FYCA 1SXJA 4JI0M 2RRUA 2X8AA 4QOZC 3T1HM 3R8FA 1DGHA 2CFOA 2OOAA 2J7OA 1R5LA 2CV1A 2LBCA 3HJ8A 5FTLA 1NV8A 3D8BA 3E4RA 3PXGA 5ITXE 3SMSA 1L1TA 4JI5M 4JI1M 3KOZE 1OQYA 3BXWA 3FUTA 3HU1A 2WZJA 4DR7M 1Q3BA 4JI8M 1Z6TA 2Y2NA 4S12A 3ZQJA 4B7HA 2QQ8A 4IBDA 5ITQA 1GJSA 1H0IA 5IZ7D 1QUSA 5FLXS 1GO5A 3QAUA 1HNWM 5ITYA 1ZAEA 1GABA 2XH9A 2VF7A 1IXRC 1PJQA 2HKJA 4JXJA 5FTNA 5C18A 2Z7JA 3HHYA 2HHHM 3NBIA 4LJ9A 3J7BA 2D7EA 4UN2B 3GQ3A 2V5OA 1E6NA 4A3VB 4NXNM 5LMUM 4REZA 2ZAMA 4WP2A 1SXJD 4X64M 3KS4A 1DGFA 2FH0A 3W67A 4W5WA 4CHTB 5IT9S 3KP1E 2VDBB 3IHPA 3GLGA 1NNJA 3H4MA 3J7AS 5C1BA 5EQTA 2JCHA 1W5SA 1DGGA 1WR1B 2XSZA 2OOBA 2D49A 1LTMA 2LWXA 4FD2A 4G3OA 4X65M 1DGBA 4NL4H 1OAOC 3K1JA 3LVWA 4P17A 2FFFB 2DZNB 2CHGA 4GEWA 5EXTA 3TWKA 3A42A 3R9XB 1AIPC 1JB0F 2KZUA 3K92A 3SHGB 2B3TA 1PM5A 4NYUA 4FCWA 3EIHA 4Z2LA 2EKFA 2I7PA 1QO6A 1QAOA 2K6BA 2JP7A 4Z2HA 3FD9A 4KO8A 5ITTA 3JAMS 3LW5F 3ZC7B 3RGSA 4LRSA 1XXHE 3K9PA 5A2QS 5EP4A 3HU2A 3U6DA 5E26A 5KO3A 4I4LA 4KT0F 4ANRA 2X4AA 3AOEC 3FUWA 4Z8XA 1HQYE 3IG8A 2DENA 3UK6A 2Y2PA 2R62A 3B7NA 3GRUA 4LFBM 4Z2KA 1KYIA 4Z2JA 1P3QQ 3VKGA 4D81A 4LF6M 1TH2A 2DHRA 3A98B 3Q8XA 1Q3CA 5KPZA 4HLQA 3GO8A 2N35A 3U61B 4LGYA 2UXBM 2QENA 3FE3A 4R7GA 3GLHB 1WHCA 1VG5A 5EXSA 1NO1A 1WIVA 2XFTA 5JI2E 2LVQD 2MJ5B 2VF8A 2BNKA 1O6IA 1ORYB 1MJGM 2XSZD 1I4WA 1Z5AA 2XD1A 4OJ5A 1PJIA 4I8OA 1OAIA 1IN6A 3LQRA 3PFIA 1FJGM 3SMPA 3SAUA 1HNZM 1XXHA 4DR4M 2WSCF 4M9SA 2L6OA 1YU2A 3QWLA 3TE6A 3M7PA 3SYLA 2UUBM 3AKZA 4DR3M 1RU3A 1UR9A 4JI3M 3L26A 4BBAA 4Z2GA 1NY5A 2C9CA 1E94E 1SXJB 3FTDA 3HONA 2R45A 2JZ1A 3L27A 1DGHB 1GLNA 4PCZA 3QYEA 4MGHA 1R2YA 2Y2IA 2WSEF 4IBEA 3U6OA 3TPZA 1WJ7A 4FWGA 1PRBA 1G8PA 1MN3A 1K3XA 1LV7A 1T43A 1VDLA 3NWLA 1SXJE 1VEJA 1J7MA 5FTKA 1GXDA 1J09A 1PDCA 2Y2HA 4QHSA 3CF0A 7CATA 4OJ6A 1G41A 2Y2GA 2JWSA 2CE7A 4D80A 1NV9A 5EXXA 3W0FA 2D7GA 2CWBA 2V1UA 4AW4A 1JQJC 4AKIA 1GOIA 2FN2A 3DFZA 3KDSE 2Y2QA 4R71A 1Q39A 2R44A 4BB9A 4OJLA 2JA2A 1WGLA 4LG2A 1ZMWA 2BJVA 2P5TA 2LVNC 2XGNA 1NNUC 3GLFB 4DV2M 1TTEA 4DBGB 4P16A 4RKUF 2KNAA 4LCBA 1S3SA 2DAMA 3SBJA 5KQDA 1DO0A 1SG9A 4F1IA 3D8LA 3M0EA 3T38A 3GLFE 1N77A 2AHMA 2L2DA 3HGIA 1UR8A 4G4QA 1IXZA 2YNMD 4DV6M 2UU9M 4NZ3A 2A5YB 2C9OA 2ZTCA 1D0MA 4L16A 5DFLA 3ZCBB 2K0BX 5IWAM 2XD5A 4M9ZA 2C96A 2VQFM 3B7QA 3FKEA 2LVPC 3IECA 4KODA 3GLGB 1IBKM 1E15A 2YR0A 2DKLA 1X37A 2DI0A 3KW6A 3W68A 2VIIA 4GIPA 2OO9A 2F5OA 1HJPA 1OFHA 2M60A 3UGJA 1CUKA 4FW9A 1L8QA 3GLGE 2R65A 1YU3A 4QNLA 4PDGA 4MGYE 2QPAA 3ZH9B 3FTCA 5BPVA 2R18A 1PJTA 4F2LA 3RE8A 3B9PA 2CUZA 2ZAOA 2RTSA 2KEBA 3FRHA 2QSFX 2ZBKB 3GLFA 4G4NA 1IN5A 4XK8F 3CGWA 2UUCM 2EUCA 2O01F 3C9PA 2DAKA 3HHXA 4IJFA 4ZPXA 1WXQA 4OJPA 2Z4RA 3B74A 4IBIA 2FS1A 2QHOB 3I01M 4LRTA 4YHHM 2UXDM 1SXJC 1MX0A 1AUAA 1R4GA 3VDPA 1IBMM 4IBBA 3WD2A 2X49A 4YY3M 3HY5A 1DV0A 3M7GA 4B7FA 1K82A 2KW0A 3HWSA 3PNYA 1XNQM 1GKIA 3WHLA 1W1PA 2Y2LA 4GC9A 1QZEA 4LF4M 2C99A 3CF6E 2JY5A 4X62M 2F5NA 4IBKA 1KSFX 3BBZA 1V92A 2J5YA 1E6ZA 2H1RA 1HQCA 2R4JA 2YQZA 2XEPA 4AKGA 1N34M 1IY2A 3AOGA 4G6ZA 1XXHB 2RGOA 4LJ4A 3UJNA 3LCUA 1EFUB 1OJLA 4OVZA 1TDZA 3SASA 3HKPA 4EIWA 2KRUA 4L8RC 1A5TA 5KPTA 4NSRA 2LNHC 2CV2A 4ITQA 2QNJA 1L6JA 4JI6M 3GQ4A 3L28A 4M0DA 4JI2M 2VQEM 1D0LA 4II7A 4QNMA 1QANA 5FSWA 1TGUA 1WGNA 4GH9A 2W82A 4XBOA 4DR6M 3MJ5A 4NZ1A 2RKOA 1KFVA 2XFSA 1IBLM 1NSFA 1Z5BA 3TWLA 2UUAM 1G3IA 4NSOB 1VDDA 2LVAA 2L7IA 1H8PA 3K8ZA 1L2DA 1TH3A 1TR8A 5DYGA 3FTFA 4JN6A 2GQFA 2F5QA 3CTWB 3U6CA 3SATA 4PDIA 4G4OA 3A46A 1W1TA 1D2NA 2DXIA 2DAIA 5EP3A 1ZMVA 4GC5A 3FRIA 5L8RF 4FCTA 3VDUA 4FWDA 2LHGA 1YUBA 2QBYA 4TX8A 3KSJA 2ZTDA 1GPFA 4MH0E 1IN7A 1PJSA 2DWMA 1MU5A 4OUIA 2UXCM 2QP9X 1GL7A 1QVRA 3GRRA 3U6EA 2BWEA 4AI6A 4DV7M 3HHZA 4WURA 4AQYM 2JY8A 3GLIA 2JXNA 2CP8A 4GRIA 1OTRA 2DZLA 3L29A 2G3QA 4IBJA 3RGPA 3AL0C 3L2AA 2LXEA 5ITUA 2BJWA 2CHQA 3U6MA 4GHLA 2HL7A 1PGYA 4L78A 1E8BA 1YU1A 3KXEC 2Y2JA 2K9DA 2MGWA 3HZJA 4I81A 3U5ZA 3TL4X 2XLJA 3KOWE 3TWMA 3KS8A 1E9SA 4IBGA 3FTEA 1QUTA 1V34A 1OGGA 1YU0A 2Q2EB 3HU3A 3SYKA 5JI3E 3U60A 1H0GA 1Q02A 2DAGA 3LMMA 5DYIA 3L25A 4NY2A 2M5ZA 3HJSA 3LVVA 4FCVA 4FWHA 1G71A 2HCBA 3E21A 4HL4A 4I5SA 1T6OA 1VEGA 3KOXE 3LQQA 2OQ4A 4B3MM 3MQLA 2Y2MA 1QDTA 4OU7A 3JR4A 2EO2A 1OKSA 2MROB 3J2PB 5GKNA 2Y21A 4B3RM 3WD4A 1ZV1A 1GJTA 3MMPA 4K0KM 2KZSA 3C3DA 1JR3A 4MGKE 4NOOB 1PJJA 1I94M 3AFHA 1IFYA 4MB4A 1BVSA 3WD1A 1IN8A 1OGBA 4QHTA 2R6FA 2DWZB 1YU4A 1XNRM 4NZ4A 3DZDA 3KSXA 2XZFA 3I51A 2OPFA 3PNVA 4IBFA 4Z6YA 2FE8A 2HAKA 3WHKA 1R6BX 4IBCA 4PT5A 1W1VA 1H6UA 4HMEA 1NHWC 2KRKA 2V6ZM 3WD3A 2CRUA 3C3EA 2LHCA 4B7GA 4NRVA 1W5TA 3GRVA 1NHGC 3T15A 3V76A 4HEOA 4LFAM 1QZMA 2DNAA 3GRYA 4OVZB 8CATA 1NY6A 4RF0A 4AZFA 3SAWA 3DA1A 3FUXA 3UMMA 2F5PA 1NVMA 2BWBA 2LVOC 3I04M 3GQ5A 1C7YA 1ED7A 1XHBA 2Y0TA 2DHYA 2EJSA 5DNYA 2KXEA 5ITRA 3B89A 4PD2A 1JR3D 3I4VA 4CIZA 4BLCA 4JI7M 1N32M 2FFJA 1XWIA 4LJ8A 2C98A 3U6PA 1DO2A 3KVWA 2WSFF 1C1KA 1IXSA 2CHVA 1E32A 1IN4A 1QAMA 4LF5M 5E6JA 4MB5A 4LF9M 1VQ1A
chains in the Genus database with same CATH topology
3FUVA 1IQPA 3U6SA 1L1ZA 2G5GX 2F5SA 1L2BA 5FTJA 2IOUA 3MHVC 2NQ8C 2CV0A 1N36M 3VLFB 4GKKM 1TH4A 3U6LA 1E9RA 4R3DA 5ITXA 1GVNA 1UM8A 4DR5M 4LZJA 3SC3A 1K3WA 5EP2A 2I7NA 4AG6A 3RFWA 3PVSA 3HSHA 3JR5A 3HHWA 3AOEA 3UZUA 2QBYB 4MGZE 1QQWA 4B08A 3GP1A 2L7HA 3SFZA 1G59A 3KFUG 4DV3M 1YSYA 4IJEA 4LGMA 3W0LB 4QNRA 4B3TM 2R4EA 1HR0M 1XC8A 5F3WA 2YFQA 3MK6A 4DV1M 4X66M 4D82A 4FVMA 3GLIB 1J7KA 5EXPA 4L15A 5IREB 4L4UA 3U6QA 1R2ZA 4JV5M 3OTOM 5KPRA 1N78A 4WW0A 2CEAA 4IIWA 2XZUA 4JYAM 3U5ZB 2C5RA 4RNAA 4LJ7A 3J80S 3FYDA 4MM3B 1QAQA 1IY0A 2QZ4A 1YE9A 2KA6B 2ZM6M 3U60B 4NXMM 3GPXA 2XF3A 4M9XA 4DUZM 4MB7A 1OFIA 3J27B 5H37D 4GHAA 5KQ8A 2K47A 4XGIA 1HNXM 2DZOB 1EE8A 2ERCA 5FTMA 3SAVA 2O5RA 4CGYB 2V1CA 2Y2OA 1HT2E 3HJQA 4LF8M 1N33M 4OW0A 3K2LA 1J5EM 2DVWB 4LY6A 3C58A 3AV0A 3KP0E 2EA0A 3N3FA 2R46A 2ZANA 2Y20A 3GPPA 3GPYA 1TDHA 2UWXA 4DR2M 2J7NA 4QOSA 3DOAA 2F4VM 4KLNA 4RF1A 4DUYM 2JE5A 3BOSA 4NRWA 1IM2A 4LJAA 1FNNA 3IG5A 2Y0QA 2QCUA 4TUWA 5BR8M 3ILKA 1NJGA 4NZ5A 2BG1A 5EP1A 3FUUA 4CISA 4KHPM 1YUEA 2LH0A 4G4RA 4AG5A 4DR1M 2FNAA 5EJCA 3AJIB 4M0WA 3SHFA 3E9SA 4GMQA 3KOYE 4LJ5A 3SARA 4LF7M 4LJ6A 1NJFA 3M6AA 1GL6A 4B3SM 4DV4M 3VKHA 1L2CA 4AKHA 3U61A 2Z4SA 3GLHA 3A45A 4LZZA 1T3TA 4DV0M 1XMOM 2Y2KA 3EIEA 2RGHA 3CF2A 1IXSB 3VFDA 4JI4M 3VK8A 2DWLA 1R7RA 2E5LM 2FOIC 3TQSA 4OX9M 3WX7A 3THGA 2Z3XA 4DV5M 4LFCM 1IY1A 4OJOA 3VK7A 1N75A 1XMQM 4GITA 2G8LA 2DWNA 5LMNM 3I4YA 1Z59A 4NYYA 2D7HA 3GPUA 1QYRA 1HT1E 3J81S 3T1YM 4GKJM 1G4AE 1ZQ9A 1Z5CA 2L09A 4MGIE 3FYCA 1SXJA 4JI0M 4QOZC 2X8AA 3T1HM 3R8FA 1DGHA 2CFOA 2J7OA 2CV1A 3HJ8A 5FTLA 3PXGA 3D8BA 3E4RA 5ITXE 3SMSA 1L1TA 4JI5M 4JI1M 3KOZE 3FUTA 3HU1A 4DR7M 1Q3BA 4JI8M 1Z6TA 2Y2NA 4S12A 4B7HA 4IBDA 5ITQA 5IZ7D 5FLXS 3QAUA 1HNWM 5ITYA 1ZAEA 2XH9A 1IXRC 2HKJA 4JXJA 5FTNA 5C18A 2Z7JA 3HHYA 2HHHM 3NBIA 4LJ9A 3J7BA 2D7EA 3GQ3A 4A3VB 4NXNM 5LMUM 4REZA 2ZAMA 1SXJD 4X64M 3KS4A 1DGFA 4W5WA 4CHTB 5IT9S 3KP1E 3GLGA 1NNJA 3H4MA 3J7AS 5C1BA 5EQTA 2JCHA 1W5SA 1DGGA 2XSZA 2LWXA 4FD2A 4X65M 1DGBA 4NL4H 3K1JA 3LVWA 2FFFB 2DZNB 2CHGA 5EXTA 3TWKA 3A42A 3R9XB 3K92A 2KZUA 3SHGB 4NYUA 1PM5A 4FCWA 3EIHA 2I7PA 1QAOA 3FD9A 4KO8A 5ITTA 3JAMS 3ZC7B 3RGSA 4LRSA 5A2QS 5EP4A 3HU2A 3U6DA 5E26A 5KO3A 4I4LA 2X4AA 3AOEC 3FUWA 4Z8XA 1HQYE 3IG8A 3UK6A 2Y2PA 2R62A 3GRUA 4LFBM 1KYIA 3VKGA 4D81A 4LF6M 1TH2A 2DHRA 3A98B 3Q8XA 1Q3CA 5KPZA 4HLQA 3GO8A 2UXBM 3U61B 4LGYA 2QENA 4R7GA 5EXSA 3GLHB 5JI2E 2XFTA 2BNKA 1ORYB 2XSZD 1I4WA 1Z5AA 2XD1A 4OJ5A 1PJIA 4I8OA 1IN6A 3LQRA 3PFIA 1FJGM 3SMPA 3SAUA 1HNZM 1XXHA 4DR4M 4M9SA 2L6OA 1YU2A 3QWLA 3TE6A 3SYLA 2UUBM 3AKZA 4DR3M 4JI3M 3L26A 4BBAA 1NY5A 2C9CA 1E94E 1SXJB 3FTDA 3HONA 2R45A 3L27A 1DGHB 1GLNA 4PCZA 4MGHA 1R2YA 2Y2IA 4IBEA 3U6OA 3TPZA 4FWGA 1G8PA 1K3XA 1LV7A 3NWLA 1SXJE 5FTKA 2Y2HA 1J09A 4QHSA 3CF0A 7CATA 4OJ6A 1G41A 2Y2GA 2CE7A 4D80A 5EXXA 3W0FA 2D7GA 2V1UA 4AKIA 4AW4A 1JQJC 2Y2QA 3DFZA 3KDSE 1Q39A 4BB9A 4OJLA 2JA2A 4LG2A 2BJVA 2P5TA 2XGNA 1NNUC 3GLFB 4DV2M 4P16A 4LCBA 1S3SA 3SBJA 5KQDA 1DO0A 3D8LA 3M0EA 3T38A 1N77A 2AHMA 3HGIA 4G4QA 1IXZA 2YNMD 4DV6M 2UU9M 4NZ3A 2A5YB 2C9OA 3ZCBB 4L16A 2XD5A 5IWAM 4M9ZA 2C96A 2VQFM 3FKEA 3GLGB 4KODA 1IBKM 2YR0A 1X37A 3KW6A 2VIIA 4GIPA 2F5OA 1OFHA 2M60A 3UGJA 4FW9A 1L8QA 2R65A 1YU3A 4QNLA 4PDGA 4MGYE 2QPAA 3ZH9B 3FTCA 5BPVA 2R18A 3RE8A 3B9PA 2CUZA 2ZAOA 2KEBA 2ZBKB 3GLFA 4G4NA 1IN5A 2UUCM 2EUCA 3HHXA 4IJFA 4ZPXA 1WXQA 4OJPA 2Z4RA 4IBIA 4YHHM 4LRTA 2UXDM 1SXJC 1MX0A 3VDPA 1IBMM 4IBBA 2X49A 4YY3M 3M7GA 4B7FA 1K82A 2KW0A 3HWSA 3PNYA 1XNQM 1GKIA 3WHLA 2Y2LA 4GC9A 4LF4M 2C99A 3CF6E 4X62M 2F5NA 4IBKA 1KSFX 2H1RA 1HQCA 2R4JA 2YQZA 2XEPA 4AKGA 1N34M 1IY2A 3AOGA 4G6ZA 1XXHB 2RGOA 4LJ4A 3UJNA 1OJLA 4OVZA 1TDZA 3SASA 3HKPA 4EIWA 2KRUA 4L8RC 5KPTA 4NSRA 2LNHC 2CV2A 4ITQA 4JI6M 3GQ4A 3L28A 4M0DA 4JI2M 2VQEM 4II7A 4QNMA 1QANA 5FSWA 1TGUA 4GH9A 4XBOA 2W82A 4DR6M 4NZ1A 3MJ5A 2RKOA 1KFVA 2XFSA 1IBLM 1NSFA 1Z5BA 3TWLA 2UUAM 1G3IA 4NSOB 1VDDA 2L7IA 3K8ZA 1L2DA 1TH3A 5DYGA 3FTFA 4JN6A 3SATA 2F5QA 3CTWB 3U6CA 4PDIA 4G4OA 3A46A 1D2NA 2DXIA 5EP3A 4GC5A 4FCTA 3VDUA 4FWDA 2QBYA 1YUBA 3KSJA 4MH0E 1IN7A 2DWMA 1MU5A 4OUIA 2UXCM 2QP9X 1GL7A 1QVRA 3GRRA 3U6EA 4AI6A 4DV7M 3HHZA 4WURA 4AQYM 3GLIA 4GRIA 3L29A 4IBJA 3RGPA 3AL0C 3L2AA 2LXEA 5ITUA 2BJWA 2CHQA 3U6MA 4GHLA 2HL7A 4L78A 1YU1A 3KXEC 2Y2JA 4I81A 3U5ZA 3TL4X 2XLJA 3KOWE 3TWMA 3KS8A 1E9SA 4IBGA 3FTEA 1YU0A 2Q2EB 3HU3A 3SYKA 5JI3E 3U60A 3LMMA 5DYIA 3L25A 4NY2A 2M5ZA 3HJSA 3LVVA 4FCVA 4FWHA 2HCBA 4I5SA 4B3MM 4HL4A 3KOXE 2OQ4A 3LQQA 2Y2MA 4OU7A 3JR4A 2EO2A 3J2PB 5GKNA 2Y21A 4B3RM 4K0KM 2KZSA 1PJJA 1JR3A 4MGKE 4NOOB 1I94M 3AFHA 1IN8A 4QHTA 2DWZB 1YU4A 1XNRM 4NZ4A 3DZDA 3KSXA 2XZFA 3I51A 2OPFA 3PNVA 4IBFA 4Z6YA 2FE8A 3WHKA 1R6BX 4IBCA 4PT5A 1H6UA 1NHWC 2KRKA 2V6ZM 4B7GA 4NRVA 1W5TA 3GRVA 1NHGC 3T15A 4LFAM 1QZMA 3GRYA 4OVZB 8CATA 1NY6A 4RF0A 4AZFA 3SAWA 3DA1A 3FUXA 3UMMA 2F5PA 1NVMA 3GQ5A 1XHBA 2Y0TA 5DNYA 2KXEA 5ITRA 4PD2A 1JR3D 3I4VA 4BLCA 4JI7M 1N32M 2FFJA 1XWIA 4LJ8A 2C98A 3U6PA 1DO2A 3KVWA 1C1KA 2CHVA 1E32A 1IN4A 1QAMA 4LF5M 5E6JA 4LF9M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBK A;  5BPV A;  3L27 A;  4IBE A;  3L29 A;  4IBJ A;  3L2A A;  4IJF A;  4GHL A;  4IBI A;  3KS4 A;  3FKE A;  4IBB A;  3KS8 A;  4IBG A;  4IBF A;  4IJE A;  4IBD A;  4IBC A;  4GHA A;  4LG2 A;  3L28 A;  3L26 A;  3L25 A;  4GH9 A; 
#chains in the Genus database with same CATH topology
 3FUV A;  1IQP A;  4CJ6 A;  3U6S A;  1L1Z A;  1CXW A;  2G5G X;  2L4F A;  2F5S A;  2Z8Y M;  1L2B A;  4HMC A;  5FTJ A;  2IOU A;  3MHV C;  2NQ8 C;  2CV0 A;  1N36 M;  3VLF B;  2JNH A;  4GKK M;  1TH4 A;  3U6L A;  1E9R A;  4R3D A;  5ITX A;  1GVN A;  1UM8 A;  4DR5 M;  4LZJ A;  3SC3 A;  1K3W A;  5EP2 A;  2I7N A;  4AG6 A;  3RFW A;  3PVS A;  3HSH A;  3JR5 A;  3HHW A;  3AOE A;  3UZU A;  2QBY B;  4MGZ E;  1QQW A;  3K9O A;  4B08 A;  3GP1 A;  2L7H A;  3SFZ A;  1G59 A;  1AIW A;  3KFU G;  4DV3 M;  1YSY A;  2JY7 A;  4IJE A;  4LGM A;  3W0L B;  4QNR A;  1EAK A;  4B3T M;  2R4E A;  1HR0 M;  1XC8 A;  5F3W A;  2YFQ A;  3MK6 A;  4DV1 M;  2DAE A;  4X66 M;  4D82 A;  4FVM A;  3GLI B;  1J7K A;  1E88 A;  5EXP A;  4L15 A;  5IRE B;  4L4U A;  3LCV B;  3U6Q A;  1R2Z A;  3B7Z A;  3NBX X;  4JV5 M;  3OTO M;  3WD0 A;  5KPR A;  2JZ0 A;  2JY6 B;  4Y28 F;  1N78 A;  1TF0 B;  3GLI E;  4WW0 A;  2CEA A;  4IIW A;  2XZU A;  4JYA M;  3U5Z B;  2C5R A;  4RNA A;  4LJ7 A;  3J80 S;  3FYD A;  2LTU A;  4MM3 B;  1QAQ A;  1IY0 A;  2QZ4 A;  1YE9 A;  2KA6 B;  2ZM6 M;  3U60 B;  1OIZ A;  4NXM M;  3GPX A;  1XB2 B;  4HMD A;  2XF3 A;  4M9X A;  1ZMU A;  1EIJ A;  4DUZ M;  4MB3 A;  2L4E A;  4MB7 A;  1KS0 A;  1OFI A;  3J27 B;  2KNZ A;  5H37 D;  4GHA A;  5KQ8 A;  1OIP A;  2K47 A;  4XGI A;  1HNX M;  3H4J A;  3T6P A;  2APL A;  1EE8 A;  2DZO B;  2ERC A;  2MR9 A;  5FTM A;  3SAV A;  2O5R A;  4CGY B;  1E6R A;  2V1C A;  2Y2O A;  1VEK A;  1HT2 E;  3HJQ A;  4LF8 M;  1N33 M;  2EKK A;  4OW0 A;  3K2L A;  1J5E M;  2DVW B;  4LY6 A;  3C58 A;  3AV0 A;  3KP0 E;  2EA0 A;  3N3F A;  2R46 A;  1W1Y A;  2ZAN A;  2Y20 A;  3HX3 A;  3GPP A;  3GPY A;  1TDH A;  2UWX A;  4DR2 M;  1JR3 E;  2J7N A;  3GLH E;  4QOS A;  3DOA A;  2JUJ A;  2KDL A;  4KLN A;  4RF1 A;  4DUY M;  2F4V M;  3BOS A;  4NRW A;  2JE5 A;  1IM2 A;  4LJA A;  2O25 A;  1FNN A;  3IG5 A;  2Y0Q A;  2QCU A;  4TUW A;  4L6V 6;  5BR8 M;  1UFZ A;  3ILK A;  1NJG A;  2R0I A;  4NZ5 A;  1CK7 A;  2BG1 A;  5EP1 A;  3FUU A;  1Y8G A;  4CIS A;  4KHP M;  1YUE A;  2LH0 A;  4Z2I A;  2MH8 A;  4Q7J A;  4G4R A;  4AG5 A;  4DR1 M;  2FNA A;  5EJC A;  3QYB A;  3E46 A;  3AJI B;  1E6P A;  4M0W A;  3SHF A;  3E9S A;  4GMQ A;  3KOY E;  4LJ5 A;  3SAR A;  4LF7 M;  4LJ6 A;  1NJF A;  3M6A A;  1GL6 A;  4B3S M;  4DV4 M;  3VKH A;  1L2C A;  4AKH A;  3U61 A;  2Z4S A;  3GLH A;  3A45 A;  4LZZ A;  1T3T A;  1YLA A;  4DV0 M;  1XMO M;  2Y2K A;  3EIE A;  2RGH A;  3CF2 A;  2HWJ A;  1IXS B;  3F92 A;  3VFD A;  4JI4 M;  4NC6 A;  3VK8 A;  2DWL A;  1R7R A;  2E5L M;  1D0K A;  2GNO A;  2FOI C;  3TQS A;  4OX9 M;  1F4I A;  3THG A;  3WX7 A;  2Z3X A;  4DV5 M;  4LFC M;  1IY1 A;  4OJO A;  3VK7 A;  1N75 A;  1XMQ M;  4GIT A;  2G8L A;  2DWN A;  5LMN M;  1QDR A;  3I4Y A;  1Z59 A;  2KHH A;  4NYY A;  2KNV A;  2D7H A;  3Q8G A;  3GPU A;  1QYR A;  1HT1 E;  1V33 A;  3J81 S;  3T1Y M;  4GKJ M;  1G4A E;  1ZQ9 A;  2H5X A;  1Z5C A;  2L09 A;  4MGI E;  3FYC A;  1SXJ A;  4JI0 M;  2RRU A;  2X8A A;  4QOZ C;  3T1H M;  3R8F A;  1DGH A;  2CFO A;  2OOA A;  2J7O A;  1R5L A;  2CV1 A;  2LBC A;  3HJ8 A;  5FTL A;  1NV8 A;  3D8B A;  3E4R A;  3PXG A;  5ITX E;  3SMS A;  1L1T A;  4JI5 M;  4JI1 M;  3KOZ E;  1OQY A;  3BXW A;  3FUT A;  3HU1 A;  2WZJ A;  4DR7 M;  1Q3B A;  4JI8 M;  1Z6T A;  2Y2N A;  4S12 A;  3ZQJ A;  4B7H A;  2QQ8 A;  4IBD A;  5ITQ A;  1GJS A;  1H0I A;  5IZ7 D;  1QUS A;  5FLX S;  1GO5 A;  3QAU A;  1HNW M;  5ITY A;  1ZAE A;  1GAB A;  2XH9 A;  2VF7 A;  1IXR C;  1PJQ A;  2HKJ A;  4JXJ A;  5FTN A;  5C18 A;  2Z7J A;  3HHY A;  2HHH M;  3NBI A;  4LJ9 A;  3J7B A;  2D7E A;  4UN2 B;  3GQ3 A;  2V5O A;  1E6N A;  4A3V B;  4NXN M;  5LMU M;  4REZ A;  2ZAM A;  4WP2 A;  1SXJ D;  4X64 M;  3KS4 A;  1DGF A;  2FH0 A;  3W67 A;  4W5W A;  4CHT B;  5IT9 S;  3KP1 E;  2VDB B;  3IHP A;  3GLG A;  1NNJ A;  3H4M A;  3J7A S;  5C1B A;  5EQT A;  2JCH A;  1W5S A;  1DGG A;  1WR1 B;  2XSZ A;  2OOB A;  2D49 A;  1LTM A;  2LWX A;  4FD2 A;  4G3O A;  4X65 M;  1DGB A;  4NL4 H;  1OAO C;  3K1J A;  3LVW A;  4P17 A;  2FFF B;  2DZN B;  2CHG A;  4GEW A;  5EXT A;  3TWK A;  3A42 A;  3R9X B;  1AIP C;  1JB0 F;  2KZU A;  3K92 A;  3SHG B;  2B3T A;  1PM5 A;  4NYU A;  4FCW A;  3EIH A;  4Z2L A;  2EKF A;  2I7P A;  1QO6 A;  1QAO A;  2K6B A;  2JP7 A;  4Z2H A;  3FD9 A;  4KO8 A;  5ITT A;  3JAM S;  3LW5 F;  3ZC7 B;  3RGS A;  4LRS A;  1XXH E;  3K9P A;  5A2Q S;  5EP4 A;  3HU2 A;  3U6D A;  5E26 A;  5KO3 A;  4I4L A;  4KT0 F;  4ANR A;  2X4A A;  3AOE C;  3FUW A;  4Z8X A;  1HQY E;  3IG8 A;  2DEN A;  3UK6 A;  2Y2P A;  2R62 A;  3B7N A;  3GRU A;  4LFB M;  4Z2K A;  1KYI A;  4Z2J A;  1P3Q Q;  3VKG A;  4D81 A;  4LF6 M;  1TH2 A;  2DHR A;  3A98 B;  3Q8X A;  1Q3C A;  5KPZ A;  4HLQ A;  3GO8 A;  2N35 A;  3U61 B;  4LGY A;  2UXB M;  2QEN A;  3FE3 A;  4R7G A;  3GLH B;  1WHC A;  1VG5 A;  5EXS A;  1NO1 A;  1WIV A;  2XFT A;  5JI2 E;  2LVQ D;  2MJ5 B;  2VF8 A;  2BNK A;  1O6I A;  1ORY B;  1MJG M;  2XSZ D;  1I4W A;  1Z5A A;  2XD1 A;  4OJ5 A;  1PJI A;  4I8O A;  1OAI A;  1IN6 A;  3LQR A;  3PFI A;  1FJG M;  3SMP A;  3SAU A;  1HNZ M;  1XXH A;  4DR4 M;  2WSC F;  4M9S A;  2L6O A;  1YU2 A;  3QWL A;  3TE6 A;  3M7P A;  3SYL A;  2UUB M;  3AKZ A;  4DR3 M;  1RU3 A;  1UR9 A;  4JI3 M;  3L26 A;  4BBA A;  4Z2G A;  1NY5 A;  2C9C A;  1E94 E;  1SXJ B;  3FTD A;  3HON A;  2R45 A;  2JZ1 A;  3L27 A;  1DGH B;  1GLN A;  4PCZ A;  3QYE A;  4MGH A;  1R2Y A;  2Y2I A;  2WSE F;  4IBE A;  3U6O A;  3TPZ A;  1WJ7 A;  4FWG A;  1PRB A;  1G8P A;  1MN3 A;  1K3X A;  1LV7 A;  1T43 A;  1VDL A;  3NWL A;  1SXJ E;  1VEJ A;  1J7M A;  5FTK A;  1GXD A;  1J09 A;  1PDC A;  2Y2H A;  4QHS A;  3CF0 A;  7CAT A;  4OJ6 A;  1G41 A;  2Y2G A;  2JWS A;  2CE7 A;  4D80 A;  1NV9 A;  5EXX A;  3W0F A;  2D7G A;  2CWB A;  2V1U A;  4AW4 A;  1JQJ C;  4AKI A;  1GOI A;  2FN2 A;  3DFZ A;  3KDS E;  2Y2Q A;  4R71 A;  1Q39 A;  2R44 A;  4BB9 A;  4OJL A;  2JA2 A;  1WGL A;  4LG2 A;  1ZMW A;  2BJV A;  2P5T A;  2LVN C;  2XGN A;  1NNU C;  3GLF B;  4DV2 M;  1TTE A;  4DBG B;  4P16 A;  4RKU F;  2KNA A;  4LCB A;  1S3S A;  2DAM A;  3SBJ A;  5KQD A;  1DO0 A;  1SG9 A;  4F1I A;  3D8L A;  3M0E A;  3T38 A;  3GLF E;  1N77 A;  2AHM A;  2L2D A;  3HGI A;  1UR8 A;  4G4Q A;  1IXZ A;  2YNM D;  4DV6 M;  2UU9 M;  4NZ3 A;  2A5Y B;  2C9O A;  2ZTC A;  1D0M A;  4L16 A;  5DFL A;  3ZCB B;  2K0B X;  5IWA M;  2XD5 A;  4M9Z A;  2C96 A;  2VQF M;  3B7Q A;  3FKE A;  2LVP C;  3IEC A;  4KOD A;  3GLG B;  1IBK M;  1E15 A;  2YR0 A;  2DKL A;  1X37 A;  2DI0 A;  3KW6 A;  3W68 A;  2VII A;  4GIP A;  2OO9 A;  2F5O A;  1HJP A;  1OFH A;  2M60 A;  3UGJ A;  1CUK A;  4FW9 A;  1L8Q A;  3GLG E;  2R65 A;  1YU3 A;  4QNL A;  4PDG A;  4MGY E;  2QPA A;  3ZH9 B;  3FTC A;  5BPV A;  2R18 A;  1PJT A;  4F2L A;  3RE8 A;  3B9P A;  2CUZ A;  2ZAO A;  2RTS A;  2KEB A;  3FRH A;  2QSF X;  2ZBK B;  3GLF A;  4G4N A;  1IN5 A;  4XK8 F;  3CGW A;  2UUC M;  2EUC A;  2O01 F;  3C9P A;  2DAK A;  3HHX A;  4IJF A;  4ZPX A;  1WXQ A;  4OJP A;  2Z4R A;  3B74 A;  4IBI A;  2FS1 A;  2QHO B;  3I01 M;  4LRT A;  4YHH M;  2UXD M;  1SXJ C;  1MX0 A;  1AUA A;  1R4G A;  3VDP A;  1IBM M;  4IBB A;  3WD2 A;  2X49 A;  4YY3 M;  3HY5 A;  1DV0 A;  3M7G A;  4B7F A;  1K82 A;  2KW0 A;  3HWS A;  3PNY A;  1XNQ M;  1GKI A;  3WHL A;  1W1P A;  2Y2L A;  4GC9 A;  1QZE A;  4LF4 M;  2C99 A;  3CF6 E;  2JY5 A;  4X62 M;  2F5N A;  4IBK A;  1KSF X;  3BBZ A;  1V92 A;  2J5Y A;  1E6Z A;  2H1R A;  1HQC A;  2R4J A;  2YQZ A;  2XEP A;  4AKG A;  1N34 M;  1IY2 A;  3AOG A;  4G6Z A;  1XXH B;  2RGO A;  4LJ4 A;  3UJN A;  3LCU A;  1EFU B;  1OJL A;  4OVZ A;  1TDZ A;  3SAS A;  3HKP A;  4EIW A;  2KRU A;  4L8R C;  1A5T A;  5KPT A;  4NSR A;  2LNH C;  2CV2 A;  4ITQ A;  2QNJ A;  1L6J A;  4JI6 M;  3GQ4 A;  3L28 A;  4M0D A;  4JI2 M;  2VQE M;  1D0L A;  4II7 A;  4QNM A;  1QAN A;  5FSW A;  1TGU A;  1WGN A;  4GH9 A;  2W82 A;  4XBO A;  4DR6 M;  3MJ5 A;  4NZ1 A;  2RKO A;  1KFV A;  2XFS A;  1IBL M;  1NSF A;  1Z5B A;  3TWL A;  2UUA M;  1G3I A;  4NSO B;  1VDD A;  2LVA A;  2L7I A;  1H8P A;  3K8Z A;  1L2D A;  1TH3 A;  1TR8 A;  5DYG A;  3FTF A;  4JN6 A;  2GQF A;  2F5Q A;  3CTW B;  3U6C A;  3SAT A;  4PDI A;  4G4O A;  3A46 A;  1W1T A;  1D2N A;  2DXI A;  2DAI A;  5EP3 A;  1ZMV A;  4GC5 A;  3FRI A;  5L8R F;  4FCT A;  3VDU A;  4FWD A;  2LHG A;  1YUB A;  2QBY A;  4TX8 A;  3KSJ A;  2ZTD A;  1GPF A;  4MH0 E;  1IN7 A;  1PJS A;  2DWM A;  1MU5 A;  4OUI A;  2UXC M;  2QP9 X;  1GL7 A;  1QVR A;  3GRR A;  3U6E A;  2BWE A;  4AI6 A;  4DV7 M;  3HHZ A;  4WUR A;  4AQY M;  2JY8 A;  3GLI A;  2JXN A;  2CP8 A;  4GRI A;  1OTR A;  2DZL A;  3L29 A;  2G3Q A;  4IBJ A;  3RGP A;  3AL0 C;  3L2A A;  2LXE A;  5ITU A;  2BJW A;  2CHQ A;  3U6M A;  4GHL A;  2HL7 A;  1PGY A;  4L78 A;  1E8B A;  1YU1 A;  3KXE C;  2Y2J A;  2K9D A;  2MGW A;  3HZJ A;  4I81 A;  3U5Z A;  3TL4 X;  2XLJ A;  3KOW E;  3TWM A;  3KS8 A;  1E9S A;  4IBG A;  3FTE A;  1QUT A;  1V34 A;  1OGG A;  1YU0 A;  2Q2E B;  3HU3 A;  3SYK A;  5JI3 E;  3U60 A;  1H0G A;  1Q02 A;  2DAG A;  3LMM A;  5DYI A;  3L25 A;  4NY2 A;  2M5Z A;  3HJS A;  3LVV A;  4FCV A;  4FWH A;  1G71 A;  2HCB A;  3E21 A;  4HL4 A;  4I5S A;  1T6O A;  1VEG A;  3KOX E;  3LQQ A;  2OQ4 A;  4B3M M;  3MQL A;  2Y2M A;  1QDT A;  4OU7 A;  3JR4 A;  2EO2 A;  1OKS A;  2MRO B;  3J2P B;  5GKN A;  2Y21 A;  4B3R M;  3WD4 A;  1ZV1 A;  1GJT A;  3MMP A;  4K0K M;  2KZS A;  3C3D A;  1JR3 A;  4MGK E;  4NOO B;  1PJJ A;  1I94 M;  3AFH A;  1IFY A;  4MB4 A;  1BVS A;  3WD1 A;  1IN8 A;  1OGB A;  4QHT A;  2R6F A;  2DWZ B;  1YU4 A;  1XNR M;  4NZ4 A;  3DZD A;  3KSX A;  2XZF A;  3I51 A;  2OPF A;  3PNV A;  4IBF A;  4Z6Y A;  2FE8 A;  2HAK A;  3WHK A;  1R6B X;  4IBC A;  4PT5 A;  1W1V A;  1H6U A;  4HME A;  1NHW C;  2KRK A;  2V6Z M;  3WD3 A;  2CRU A;  3C3E A;  2LHC A;  4B7G A;  4NRV A;  1W5T A;  3GRV A;  1NHG C;  3T15 A;  3V76 A;  4HEO A;  4LFA M;  1QZM A;  2DNA A;  3GRY A;  4OVZ B;  8CAT A;  1NY6 A;  4RF0 A;  4AZF A;  3SAW A;  3DA1 A;  3FUX A;  3UMM A;  2F5P A;  1NVM A;  2BWB A;  2LVO C;  3I04 M;  3GQ5 A;  1C7Y A;  1ED7 A;  1XHB A;  2Y0T A;  2DHY A;  2EJS A;  5DNY A;  2KXE A;  5ITR A;  3B89 A;  4PD2 A;  1JR3 D;  3I4V A;  4CIZ A;  4BLC A;  4JI7 M;  1N32 M;  2FFJ A;  1XWI A;  4LJ8 A;  2C98 A;  3U6P A;  1DO2 A;  3KVW A;  2WSF F;  1C1K A;  1IXS A;  2CHV A;  1E32 A;  1IN4 A;  1QAM A;  4LF5 M;  5E6J A;  4MB5 A;  4LF9 M;  1VQ1 A; 
#chains in the Genus database with same CATH homology
 3FUV A;  1IQP A;  3U6S A;  1L1Z A;  2G5G X;  2F5S A;  1L2B A;  5FTJ A;  2IOU A;  3MHV C;  2NQ8 C;  2CV0 A;  1N36 M;  3VLF B;  4GKK M;  1TH4 A;  3U6L A;  1E9R A;  4R3D A;  5ITX A;  1GVN A;  1UM8 A;  4DR5 M;  4LZJ A;  3SC3 A;  1K3W A;  5EP2 A;  2I7N A;  4AG6 A;  3RFW A;  3PVS A;  3HSH A;  3JR5 A;  3HHW A;  3AOE A;  3UZU A;  2QBY B;  4MGZ E;  1QQW A;  4B08 A;  3GP1 A;  2L7H A;  3SFZ A;  1G59 A;  3KFU G;  4DV3 M;  1YSY A;  4IJE A;  4LGM A;  3W0L B;  4QNR A;  4B3T M;  2R4E A;  1HR0 M;  1XC8 A;  5F3W A;  2YFQ A;  3MK6 A;  4DV1 M;  4X66 M;  4D82 A;  4FVM A;  3GLI B;  1J7K A;  5EXP A;  4L15 A;  5IRE B;  4L4U A;  3U6Q A;  1R2Z A;  4JV5 M;  3OTO M;  5KPR A;  1N78 A;  4WW0 A;  2CEA A;  4IIW A;  2XZU A;  4JYA M;  3U5Z B;  2C5R A;  4RNA A;  4LJ7 A;  3J80 S;  3FYD A;  4MM3 B;  1QAQ A;  1IY0 A;  2QZ4 A;  1YE9 A;  2KA6 B;  2ZM6 M;  3U60 B;  4NXM M;  3GPX A;  2XF3 A;  4M9X A;  4DUZ M;  4MB7 A;  1OFI A;  3J27 B;  5H37 D;  4GHA A;  5KQ8 A;  2K47 A;  4XGI A;  1HNX M;  2DZO B;  1EE8 A;  2ERC A;  5FTM A;  3SAV A;  2O5R A;  4CGY B;  2V1C A;  2Y2O A;  1HT2 E;  3HJQ A;  4LF8 M;  1N33 M;  4OW0 A;  3K2L A;  1J5E M;  2DVW B;  4LY6 A;  3C58 A;  3AV0 A;  3KP0 E;  2EA0 A;  3N3F A;  2R46 A;  2ZAN A;  2Y20 A;  3GPP A;  3GPY A;  1TDH A;  2UWX A;  4DR2 M;  2J7N A;  4QOS A;  3DOA A;  2F4V M;  4KLN A;  4RF1 A;  4DUY M;  2JE5 A;  3BOS A;  4NRW A;  1IM2 A;  4LJA A;  1FNN A;  3IG5 A;  2Y0Q A;  2QCU A;  4TUW A;  5BR8 M;  3ILK A;  1NJG A;  4NZ5 A;  2BG1 A;  5EP1 A;  3FUU A;  4CIS A;  4KHP M;  1YUE A;  2LH0 A;  4G4R A;  4AG5 A;  4DR1 M;  2FNA A;  5EJC A;  3AJI B;  4M0W A;  3SHF A;  3E9S A;  4GMQ A;  3KOY E;  4LJ5 A;  3SAR A;  4LF7 M;  4LJ6 A;  1NJF A;  3M6A A;  1GL6 A;  4B3S M;  4DV4 M;  3VKH A;  1L2C A;  4AKH A;  3U61 A;  2Z4S A;  3GLH A;  3A45 A;  4LZZ A;  1T3T A;  4DV0 M;  1XMO M;  2Y2K A;  3EIE A;  2RGH A;  3CF2 A;  1IXS B;  3VFD A;  4JI4 M;  3VK8 A;  2DWL A;  1R7R A;  2E5L M;  2FOI C;  3TQS A;  4OX9 M;  3WX7 A;  3THG A;  2Z3X A;  4DV5 M;  4LFC M;  1IY1 A;  4OJO A;  3VK7 A;  1N75 A;  1XMQ M;  4GIT A;  2G8L A;  2DWN A;  5LMN M;  3I4Y A;  1Z59 A;  4NYY A;  2D7H A;  3GPU A;  1QYR A;  1HT1 E;  3J81 S;  3T1Y M;  4GKJ M;  1G4A E;  1ZQ9 A;  1Z5C A;  2L09 A;  4MGI E;  3FYC A;  1SXJ A;  4JI0 M;  4QOZ C;  2X8A A;  3T1H M;  3R8F A;  1DGH A;  2CFO A;  2J7O A;  2CV1 A;  3HJ8 A;  5FTL A;  3PXG A;  3D8B A;  3E4R A;  5ITX E;  3SMS A;  1L1T A;  4JI5 M;  4JI1 M;  3KOZ E;  3FUT A;  3HU1 A;  4DR7 M;  1Q3B A;  4JI8 M;  1Z6T A;  2Y2N A;  4S12 A;  4B7H A;  4IBD A;  5ITQ A;  5IZ7 D;  5FLX S;  3QAU A;  1HNW M;  5ITY A;  1ZAE A;  2XH9 A;  1IXR C;  2HKJ A;  4JXJ A;  5FTN A;  5C18 A;  2Z7J A;  3HHY A;  2HHH M;  3NBI A;  4LJ9 A;  3J7B A;  2D7E A;  3GQ3 A;  4A3V B;  4NXN M;  5LMU M;  4REZ A;  2ZAM A;  1SXJ D;  4X64 M;  3KS4 A;  1DGF A;  4W5W A;  4CHT B;  5IT9 S;  3KP1 E;  3GLG A;  1NNJ A;  3H4M A;  3J7A S;  5C1B A;  5EQT A;  2JCH A;  1W5S A;  1DGG A;  2XSZ A;  2LWX A;  4FD2 A;  4X65 M;  1DGB A;  4NL4 H;  3K1J A;  3LVW A;  2FFF B;  2DZN B;  2CHG A;  5EXT A;  3TWK A;  3A42 A;  3R9X B;  3K92 A;  2KZU A;  3SHG B;  4NYU A;  1PM5 A;  4FCW A;  3EIH A;  2I7P A;  1QAO A;  3FD9 A;  4KO8 A;  5ITT A;  3JAM S;  3ZC7 B;  3RGS A;  4LRS A;  5A2Q S;  5EP4 A;  3HU2 A;  3U6D A;  5E26 A;  5KO3 A;  4I4L A;  2X4A A;  3AOE C;  3FUW A;  4Z8X A;  1HQY E;  3IG8 A;  3UK6 A;  2Y2P A;  2R62 A;  3GRU A;  4LFB M;  1KYI A;  3VKG A;  4D81 A;  4LF6 M;  1TH2 A;  2DHR A;  3A98 B;  3Q8X A;  1Q3C A;  5KPZ A;  4HLQ A;  3GO8 A;  2UXB M;  3U61 B;  4LGY A;  2QEN A;  4R7G A;  5EXS A;  3GLH B;  5JI2 E;  2XFT A;  2BNK A;  1ORY B;  2XSZ D;  1I4W A;  1Z5A A;  2XD1 A;  4OJ5 A;  1PJI A;  4I8O A;  1IN6 A;  3LQR A;  3PFI A;  1FJG M;  3SMP A;  3SAU A;  1HNZ M;  1XXH A;  4DR4 M;  4M9S A;  2L6O A;  1YU2 A;  3QWL A;  3TE6 A;  3SYL A;  2UUB M;  3AKZ A;  4DR3 M;  4JI3 M;  3L26 A;  4BBA A;  1NY5 A;  2C9C A;  1E94 E;  1SXJ B;  3FTD A;  3HON A;  2R45 A;  3L27 A;  1DGH B;  1GLN A;  4PCZ A;  4MGH A;  1R2Y A;  2Y2I A;  4IBE A;  3U6O A;  3TPZ A;  4FWG A;  1G8P A;  1K3X A;  1LV7 A;  3NWL A;  1SXJ E;  5FTK A;  2Y2H A;  1J09 A;  4QHS A;  3CF0 A;  7CAT A;  4OJ6 A;  1G41 A;  2Y2G A;  2CE7 A;  4D80 A;  5EXX A;  3W0F A;  2D7G A;  2V1U A;  4AKI A;  4AW4 A;  1JQJ C;  2Y2Q A;  3DFZ A;  3KDS E;  1Q39 A;  4BB9 A;  4OJL A;  2JA2 A;  4LG2 A;  2BJV A;  2P5T A;  2XGN A;  1NNU C;  3GLF B;  4DV2 M;  4P16 A;  4LCB A;  1S3S A;  3SBJ A;  5KQD A;  1DO0 A;  3D8L A;  3M0E A;  3T38 A;  1N77 A;  2AHM A;  3HGI A;  4G4Q A;  1IXZ A;  2YNM D;  4DV6 M;  2UU9 M;  4NZ3 A;  2A5Y B;  2C9O A;  3ZCB B;  4L16 A;  2XD5 A;  5IWA M;  4M9Z A;  2C96 A;  2VQF M;  3FKE A;  3GLG B;  4KOD A;  1IBK M;  2YR0 A;  1X37 A;  3KW6 A;  2VII A;  4GIP A;  2F5O A;  1OFH A;  2M60 A;  3UGJ A;  4FW9 A;  1L8Q A;  2R65 A;  1YU3 A;  4QNL A;  4PDG A;  4MGY E;  2QPA A;  3ZH9 B;  3FTC A;  5BPV A;  2R18 A;  3RE8 A;  3B9P A;  2CUZ A;  2ZAO A;  2KEB A;  2ZBK B;  3GLF A;  4G4N A;  1IN5 A;  2UUC M;  2EUC A;  3HHX A;  4IJF A;  4ZPX A;  1WXQ A;  4OJP A;  2Z4R A;  4IBI A;  4YHH M;  4LRT A;  2UXD M;  1SXJ C;  1MX0 A;  3VDP A;  1IBM M;  4IBB A;  2X49 A;  4YY3 M;  3M7G A;  4B7F A;  1K82 A;  2KW0 A;  3HWS A;  3PNY A;  1XNQ M;  1GKI A;  3WHL A;  2Y2L A;  4GC9 A;  4LF4 M;  2C99 A;  3CF6 E;  4X62 M;  2F5N A;  4IBK A;  1KSF X;  2H1R A;  1HQC A;  2R4J A;  2YQZ A;  2XEP A;  4AKG A;  1N34 M;  1IY2 A;  3AOG A;  4G6Z A;  1XXH B;  2RGO A;  4LJ4 A;  3UJN A;  1OJL A;  4OVZ A;  1TDZ A;  3SAS A;  3HKP A;  4EIW A;  2KRU A;  4L8R C;  5KPT A;  4NSR A;  2LNH C;  2CV2 A;  4ITQ A;  4JI6 M;  3GQ4 A;  3L28 A;  4M0D A;  4JI2 M;  2VQE M;  4II7 A;  4QNM A;  1QAN A;  5FSW A;  1TGU A;  4GH9 A;  4XBO A;  2W82 A;  4DR6 M;  4NZ1 A;  3MJ5 A;  2RKO A;  1KFV A;  2XFS A;  1IBL M;  1NSF A;  1Z5B A;  3TWL A;  2UUA M;  1G3I A;  4NSO B;  1VDD A;  2L7I A;  3K8Z A;  1L2D A;  1TH3 A;  5DYG A;  3FTF A;  4JN6 A;  3SAT A;  2F5Q A;  3CTW B;  3U6C A;  4PDI A;  4G4O A;  3A46 A;  1D2N A;  2DXI A;  5EP3 A;  4GC5 A;  4FCT A;  3VDU A;  4FWD A;  2QBY A;  1YUB A;  3KSJ A;  4MH0 E;  1IN7 A;  2DWM A;  1MU5 A;  4OUI A;  2UXC M;  2QP9 X;  1GL7 A;  1QVR A;  3GRR A;  3U6E A;  4AI6 A;  4DV7 M;  3HHZ A;  4WUR A;  4AQY M;  3GLI A;  4GRI A;  3L29 A;  4IBJ A;  3RGP A;  3AL0 C;  3L2A A;  2LXE A;  5ITU A;  2BJW A;  2CHQ A;  3U6M A;  4GHL A;  2HL7 A;  4L78 A;  1YU1 A;  3KXE C;  2Y2J A;  4I81 A;  3U5Z A;  3TL4 X;  2XLJ A;  3KOW E;  3TWM A;  3KS8 A;  1E9S A;  4IBG A;  3FTE A;  1YU0 A;  2Q2E B;  3HU3 A;  3SYK A;  5JI3 E;  3U60 A;  3LMM A;  5DYI A;  3L25 A;  4NY2 A;  2M5Z A;  3HJS A;  3LVV A;  4FCV A;  4FWH A;  2HCB A;  4I5S A;  4B3M M;  4HL4 A;  3KOX E;  2OQ4 A;  3LQQ A;  2Y2M A;  4OU7 A;  3JR4 A;  2EO2 A;  3J2P B;  5GKN A;  2Y21 A;  4B3R M;  4K0K M;  2KZS A;  1PJJ A;  1JR3 A;  4MGK E;  4NOO B;  1I94 M;  3AFH A;  1IN8 A;  4QHT A;  2DWZ B;  1YU4 A;  1XNR M;  4NZ4 A;  3DZD A;  3KSX A;  2XZF A;  3I51 A;  2OPF A;  3PNV A;  4IBF A;  4Z6Y A;  2FE8 A;  3WHK A;  1R6B X;  4IBC A;  4PT5 A;  1H6U A;  1NHW C;  2KRK A;  2V6Z M;  4B7G A;  4NRV A;  1W5T A;  3GRV A;  1NHG C;  3T15 A;  4LFA M;  1QZM A;  3GRY A;  4OVZ B;  8CAT A;  1NY6 A;  4RF0 A;  4AZF A;  3SAW A;  3DA1 A;  3FUX A;  3UMM A;  2F5P A;  1NVM A;  3GQ5 A;  1XHB A;  2Y0T A;  5DNY A;  2KXE A;  5ITR A;  4PD2 A;  1JR3 D;  3I4V A;  4BLC A;  4JI7 M;  1N32 M;  2FFJ A;  1XWI A;  4LJ8 A;  2C98 A;  3U6P A;  1DO2 A;  3KVW A;  1C1K A;  2CHV A;  1E32 A;  1IN4 A;  1QAM A;  4LF5 M;  5E6J A;  4LF9 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...