3L27A

Crystal structure of zaire ebola vp35 interferon inhibitory domain r312a mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
b'PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPKIDRGWVCVFQLQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
molecule tags Rna binding protein
source organism Zaire ebolavirus
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
total genus 40
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l27A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l27A02
4IBCA 4GH9A 5BPVA 4GHAA 4GHLA 4IBDA 4IBFA 3L2AA 4IBIA 3KS4A 4IBBA 4LG2A 4IBEA 3KS8A 3L27A 3L25A 4IJFA 3L28A 4IBKA 3L26A 3L29A 4IBJA 4IBGA 3FKEA 4IJEA
chains in the Genus database with same CATH superfamily
2JP7A 2KRKA 4GH9A 3UK6A 4BB9A 5LMNM 2J7NA 1WXQA 3B7QA 2KHHA 3HHYA 1QVRA 2YQZA 4OUIA 2WSEF 3GLIE 1G3IA 3KS4A 4NXMM 3GLHB 2WSCF 3GPPA 4NRWA 3E9SA 4B3MM 3AOEC 4AKHA 2XSZA 3L27A 5EXSA 1GOIA 3I4YA 1IN5A 5FTJA 3D8LA 1WGLA 2L2DA 4OJOA 1OTRA 2Z3XA 2KNVA 2MROB 4IIWA 1W1YA 2N35A 5DYIA 3GQ5A 4NC6A 1D0MA 4GC5A 4II7A 4P16A 3UJNA 1E6NA 2CRUA 3AFHA 2ZAOA 4DR4M 3GO8A 1TH4A 2L7HA 1XMQM 4D80A 3GLFE 4NRVA 1QAMA 3HU2A 5EXPA 3V76A 5KPTA 2DAIA 3KSJA 1Y8GA 4DV2M 3A42A 2CP8A 3A46A 4DR2M 1VEJA 1IBMM 1E9SA 3GLGA 1YUEA 3AJIB 2ZTDA 3J27B 2DAMA 2FS1A 5ITYA 1OIPA 2BNKA 2OOBA 2Y0QA 4AW4A 3ILKA 4MGIE 7CATA 1D0KA 1OIZA 2UUCM 1ZV1A 3EIEA 4LJ5A 5KQ8A 3KS8A 2C9OA 2DI0A 4DR3M 1C1KA 4IJFA 1ORYB 4FWDA 3HY5A 2DAGA 4GIPA 2CEAA 2RGHA 4TUWA 1E8BA 4JI7M 2V5OA 3HWSA 4YY3M 2FE8A 3GRVA 1N77A 4DR6M 1ZMVA 2W82A 3A45A 4AKGA 1EAKA 1Z5AA 1UR9A 3U6LA 2UXBM 1DGGA 1GL7A 1NHWC 2O25A 4IJEA 2X8AA 4XBOA 2UU9M 3W0LB 4OJLA 3QWLA 2R18A 3E21A 5ITQA 2BJVA 3GQ4A 1IN6A 4OW0A 1NNJA 3R9XB 4GHLA 1NSFA 1H8PA 2XD5A 4DV1M 1N36M 3WHKA 5C18A 5IREB 4X62M 2CFOA 2KNZA 4QHTA 1VEGA 2JZ1A 4RNAA 2XGNA 3GQ3A 1GJSA 3E4RA 1DGHA 5L8RF 3CF6E 4X66M 4TX8A 5JI3E 1GJTA 3L28A 2LVOC 1PJSA 3KOWE 4S12A 1R2YA 2F5QA 2B3TA 1FJGM 3KVWA 4L15A 5KQDA 1CUKA 2R4JA 4XGIA 2KA6B 2LHGA 2CWBA 1GO5A 4MB3A 1Q3BA 2DVWB 2Y20A 1Z59A 3KXEC 2CV0A 2K9DA 2XSZD 3T1YM 4HMDA 2GNOA 3K2LA 3HKPA 4LJ7A 4JI0M 1C7YA 2Y2IA 3D8BA 3KW6A 3GLGE 1PGYA 1TTEA 1AIPC 1KYIA 4QNRA 2FN2A 2OPFA 2ZM6M 2MJ5B 3NBIA 4MGYE 2QQ8A 1NY6A 2KW0A 4QHSA 2CHGA 2R44A 3IECA 4RF1A 2XFSA 4I4LA 2K6BA 4ITQA 2DAKA 1WJ7A 3CF2A 3F92A 2RGOA 1FNNA 4B7GA 2RKOA 3QAUA 3FYCA 1J09A 5IZ7D 3T15A 4DUYM 1F4IA 4MGHA 1QAQA 1PJQA 3VDPA 2Z4RA 3HZJA 1E6PA 2CHVA 1NHGC 3Q8XA 3TQSA 2J5YA 2D7GA 2LVPC 2VF7A 4KT0F 2FOIC 4LRSA 4JI6M 1DGFA 3U6CA 4M9XA 3FUXA 3FKEA 2HWJA 3DOAA 3JAMS 3HHXA 3C3EA 3VLFB 5FSWA 3PVSA 1TR8A 4M9ZA 3SFZA 5ITUA 3GLIA 4LZJA 3RGPA 3U5ZB 3N3FA 2VIIA 4WURA 3T6PA 3W67A 5GKNA 2X4AA 4L16A 1J7KA 1D2NA 1VDLA 2FFJA 3THGA 1X37A 2Y0TA 3SMPA 1HNWM 4JI2M 3K1JA 3TPZA 2R45A 3WD3A 2JUJA 4LG2A 1OFHA 2C9CA 4Y28F 1VQ1A 1EIJA 4OJ5A 4JI8M 4K0KM 1HR0M 1Q3CA 3JR4A 4NZ3A 3GPXA 5JI2E 3HJSA 4G6ZA 3FUVA 3WHLA 1Z5CA 3U6PA 1SXJC 2C99A 1S3SA 5BR8M 2I7PA 2QBYA 1UR8A 4UN2B 1XNRM 2JWSA 4Z2IA 1IN8A 3B7ZA 3VKHA 2KRUA 3FUWA 2UUAM 1JQJC 3FUUA 5EXXA 2HKJA 1NV8A 1NY5A 4MGZE 1ZMUA 3KOZE 2OO9A 5EP2A 1HNXM 3HONA 4MM3B 3CTWB 4NYUA 2R6FA 3QYEA 2H5XA 3SYLA 1I4WA 3SHFA 3ZC7B 3TWMA 3U61A 1E6RA 3SATA 4LCBA 4X65M 4LFBM 1OAIA 3FTDA 1IXRC 3I04M 2QNJA 4PDIA 4Z8XA 2KZUA 2XFTA 4GC9A 1GPFA 3LCVB 1DV0A 2QHOB 4WW0A 2O01F 3MMPA 4FCTA 5ITRA 3FD9A 3U6SA 1IBLM 2BG1A 3WD2A 1NVMA 3I4VA 1WGNA 1V92A 4Z2KA 4Z2JA 2LVAA 4LF9M 1W1TA 3J7BA 1EE8A 1GLNA 5EJCA 1L2CA 4LFCM 2MR9A 1G8PA 3HJQA 3OTOM 4IBDA 2KDLA 3FTCA 4IBFA 2KEBA 1K3WA 2F4VM 1HQCA 4DUZM 1L1ZA 4KO8A 2DAEA 2Z4SA 4FD2A 1L2DA 3IG5A 3U6QA 2E5LM 1LV7A 1NO1A 1OFIA 3Q8GA 5EP1A 3HU1A 5IT9S 2UUBM 2G8LA 1J7MA 2ZTCA 3L25A 2OQ4A 2QBYB 3GPUA 5DNYA 4Z6YA 2Y2QA 1R6BX 3U6DA 4IBKA 3M7GA 2F5SA 1R5LA 1XWIA 4G4OA 4LGMA 1KSFX 1NJGA 1OKSA 3KDSE 2EUCA 1QO6A 1G41A 2C98A 2L4FA 4R7GA 2Y2HA 3M7PA 4WP2A 2JY5A 4QOZC 4JI5M 4IBCA 4AG6A 4DBGB 3BXWA 5ITXE 4GHAA 2JA2A 1Q02A 2LXEA 3U61B 2EO2A 2VQEM 2XZUA 1YU1A 2O5RA 4FWHA 3GLFA 2R0IA 1QZEA 3HSHA 1W1PA 3J81S 2L6OA 4FCVA 4MH0E 4MGKE 1XXHE 5E26A 4LZZA 4QOSA 4D81A 3LW5F 4NXNM 2FH0A 2DWZB 1L6JA 1SG9A 2KZSA 4P17A 2XH9A 4Z2LA 4NZ1A 5FTNA 2LVNC 4W5WA 5DFLA 3TWLA 2QSFX 2CUZA 1QAOA 1NV9A 2Z8YM 2CV1A 1YUBA 3FE3A 2GQFA 1YE9A 4FCWA 2J7OA 1JB0F 3LQQA 4G4NA 2RRUA 2Y2NA 1OQYA 2D7HA 1MX0A 4GRIA 2DHYA 5IWAM 2JNHA 3EIHA 2EJSA 1CXWA 1N33M 2XLJA 2QP9X 3HU3A 2UXCM 4BBAA 1YSYA 1QUSA 3I01M 3LVWA 1UM8A 1MJGM 4LJAA 4OU7A 1TH2A 2X49A 4GEWA 4AQYM 1DO2A 1Q39A 3AL0C 4YHHM 2V6ZM 3ZH9B 2KXEA 1OGBA 3KP1E 1GL6A 2ZBKB 1L1TA 1IN4A 1EFUB 4QNLA 2CHQA 5E6JA 4AZFA 1T3TA 2CE7A 3GPYA 2G5GX 4IBGA 4LF5M 4NZ5A 1G71A 3NWLA 3K92A 1E15A 4CHTB 4AKIA 3IG8A 1N78A 4RF0A 5A2QS 3VFDA 3WD4A 3ZQJA 2JCHA 1VDDA 1VG5A 3C9PA 1Z6TA 1J5EM 1QQWA 3E46A 2V1UA 3LMMA 1H0GA 4HL4A 3HX3A 4I81A 3RGSA 2K47A 5EXTA 4NY2A 2XF3A 2C96A 1VEKA 3VK8A 2DENA 1IY1A 4Z2GA 1XHBA 4LJ8A 1W1VA 2IOUA 3WD1A 2L4EA 2Y2GA 3MQLA 2P5TA 1E88A 5EP4A 1TH3A 2F5OA 1IY0A 4IBJA 1AUAA 3B7NA 4LF4M 4MB4A 2V1CA 2Q2EB 2LTUA 3K9PA 4OX9M 3BOSA 1IXZA 2M60A 2R4EA 1IN7A 3GP1A 2D7EA 1NJFA 1PJTA 3H4JA 4NL4H 3SAWA 3TE6A 5H37D 1A5TA 4B3TM 4Z2HA 3UMMA 3ZCBB 1HQYE 4LFAM 4DV5M 2FFFB 2QZ4A 2JY8A 1OGGA 5LMUM 3WD0A 2Y2LA 2BWEA 2VF8A 4JI4M 3LVVA 3MK6A 4GKJM 1TDHA 5ITTA 1E9RA 1O6IA 2QPAA 1JR3E 4G3OA 2Y2PA 3LQRA 3KFUG 1XXHB 1W5SA 3FYDA 1ZQ9A 1CK7A 2EKKA 2XD1A 3B9PA 2EA0A 2HAKA 3AOGA 1HNZM 4OJPA 2R46A 1LTMA 4RKUF 2L7IA 3H4MA 1MN3A 3PNVA 3HJ8A 4QNMA 3C58A 4LF6M 3AOEA 4LRTA 3TL4X 4ZPXA 1SXJB 2LNHC 1XMOM 2YNMD 4NSRA 1YU2A 2D49A 1UFZA 2YR0A 2LWXA 1XB2B 2HL7A 3M0EA 3PFIA 4FWGA 3BBZA 3L2AA 3SAVA 3SBJA 3FTFA 3SYKA 1H0IA 2JY6B 1YU3A 2MGWA 4I8OA 1R7RA 2I7NA 2WSFF 4CGYB 1L8QA 4DV7M 1IM2A 2JY7A 3A98B 4IBBA 3GLFB 5FTKA 4LF7M 3DFZA 4R3DA 3SC3A 1QZMA 2ZAMA 1T43A 2DXIA 4CISA 4MB7A 3U6MA 2LBCA 1K82A 3GRRA 4DR7M 1E94E 3RE8A 4L78A 4JXJA 4DR5M 2AHMA 4KLNA 3HGIA 5KPRA 3IHPA 4LJ9A 1TDZA 2G3QA 3M6AA 4Q7JA 1QDRA 2Z7JA 3FRIA 2OOAA 3RFWA 3PNYA 3K9OA 4D82A 3SAUA 1PJIA 1R2ZA 3SARA 5BPVA 4HLQA 1BVSA 1PRBA 3GLHE 4NSOB 3GLHA 3MJ5A 5FTMA 4HMCA 1NNUC 4HEOA 4LF8M 4F1IA 2Y2OA 2F5NA 3I51A 3T38A 4BLCA 3KOYE 4X64M 4JN6A 4NYYA 2APLA 2RTSA 3VDUA 4FW9A 3NBXX 2KNAA 3CF0A 3U60B 1HT2E 2UWXA 1YU0A 3W0FA 4DV6M 4OJ6A 3KP0E 1DGHB 1K3XA 2A5YB 1H6UA 2QENA 3AV0A 4AI6A 1PM5A 1HJPA 5FLXS 3FRHA 4M9SA 3U6EA 1R4GA 3FUTA 4PT5A 4REZA 1QDTA 2VDBB 4CIZA 4NZ4A 1TGUA 1WR1B 3MHVC 4GKKM 4LGYA 1N75A 2DKLA 2H1RA 4G4RA 1GXDA 4DR1M 2M5ZA 4JYAM 4MB5A 1PDCA 3AKZA 1DGBA 2UXDM 4M0DA 1SXJD 2DWMA 1MU5A 2XZFA 1L2BA 3R8FA 3JR5A 1I94M 3VKGA 4LJ6A 1E6ZA 2MH8A 3K8ZA 3U6OA 1RU3A 2Y2KA 5KPZA 4R71A 4OVZA 3PXGA 3B89A 4A3VB 2Y2JA 4PDGA 3L26A 1JR3A 1D0LA 2DHRA 1KS0A 4ANRA 5FTLA 1XNQM 1SXJA 1V34A 2QCUA 4L4UA 3J7AS 4NOOB 8CATA 2HCBA 3HHWA 3GLGB 2DWLA 2ZANA 2BWBA 1GVNA 1WHCA 1QYRA 1GKIA 4KHPM 4DV0M 3UGJA 2DZOB 2HHHM 2WZJA 2NQ8C 2BJWA 2YFQA 3QYBA 2C5RA 3CGWA 4AG5A 1QANA 4L8RC 1AIWA 4LY6A 3LCUA 1E32A 4JI3M 2JE5A 2CV2A 4KODA 5C1BA 3FTEA 1IQPA 1XXHA 2LVQD 2VQFM 2Y2MA 2JZ0A 1SXJE 1N32M 5EQTA 4XK8F 4FVMA 2F5PA 2FNAA 3UZUA 4PD2A 3W68A 1DO0A 2L09A 3GLIB 1HT1E 5KO3A 2R65A 2DZNB 2DWNA 1OAOC 1IFYA 4JI1M 4OVZB 3U60A 1IY2A 3GRUA 2EKFA 1W5TA 2K0BX 1XC8A 2DZLA 3KOXE 1ED7A 3VK7A 2Y21A 4M0WA 4I5SA 3B74A 2ERCA 1OJLA 4PCZA 4B3SM 1TF0B 4DV3M 1N34M 2R62A 3DA1A 3J80S 2DNAA 3HHZA 4IBIA 1G4AE 4L6V6 5EP3A 2LHCA 3SHGB 3C3DA 1QUTA 1P3QQ 1T6OA 3TWKA 4B08A 4JV5M 4B7HA 1KFVA 1JR3D 4GMQA 1IXSA 4IBEA 4B7FA 4EIWA 3J2PB 2LH0A 1WIVA 3DZDA 4GITA 3SASA 1Z5BA 4B3RM 1IBKM 1YU4A 4G4QA 3SMSA 4DV4M 3T1HM 1G59A 5F3WA 1ZAEA 4HMEA 1GABA 5ITXA 4CJ6A 1PJJA 1IXSB 3WX7A 1V33A 3L29A 4LJ4A 3KSXA 5DYGA 3GRYA 1ZMWA 4F2LA 3U5ZA 2XEPA 2JXNA 1YLAA
chains in the Genus database with same CATH topology
2KRKA 4GH9A 3UK6A 4BB9A 5LMNM 2J7NA 1WXQA 3HHYA 1QVRA 2YQZA 4OUIA 1G3IA 3KS4A 4NXMM 3GLHB 3GPPA 4NRWA 3E9SA 4B3MM 3AOEC 4AKHA 2XSZA 3L27A 5EXSA 2XD5A 3I4YA 1IN5A 5FTJA 3D8LA 4OJOA 2Z3XA 4IIWA 5DYIA 3GQ5A 4GC5A 4II7A 4P16A 3UJNA 3AFHA 2ZAOA 4DR4M 3GO8A 1TH4A 2L7HA 1XMQM 4D80A 4NRVA 1QAMA 3HU2A 5EXPA 5KPTA 3KSJA 4DR2M 4DV2M 3A42A 1IBMM 3A46A 1E9SA 3GLGA 1YUEA 3AJIB 3J27B 5ITYA 2BNKA 2Y0QA 4AW4A 3ILKA 4MGIE 7CATA 2UUCM 3KS8A 3EIEA 4LJ5A 5KQ8A 2C9OA 4DR3M 1C1KA 4IJFA 1ORYB 4FWDA 4GIPA 4TUWA 2CEAA 2RGHA 4JI7M 3HWSA 4YY3M 2FE8A 3GRVA 1N77A 4DR6M 2W82A 3A45A 4AKGA 1Z5AA 3U6LA 2UXBM 1DGGA 1GL7A 1NHWC 4IJEA 2X8AA 4XBOA 2UU9M 3W0LB 4OJLA 3QWLA 2R18A 5ITQA 2BJVA 3GQ4A 1IN6A 4OW0A 1NNJA 3R9XB 4GHLA 1NSFA 4DV1M 1N36M 3WHKA 5C18A 5IREB 4X62M 2CFOA 4QHTA 4RNAA 2XGNA 3GQ3A 3E4RA 1DGHA 3CF6E 4X66M 5JI3E 3L28A 2F5QA 4S12A 3KOWE 1R2YA 1FJGM 3KVWA 4L15A 5KQDA 2R4JA 4XGIA 2KA6B 1Q3BA 2DVWB 2Y20A 1Z59A 3KXEC 2CV0A 2XSZD 3T1YM 3K2LA 3HKPA 4LJ7A 4JI0M 2Y2IA 3D8BA 3KW6A 1KYIA 4QNRA 2OPFA 2ZM6M 3NBIA 4MGYE 1NY6A 2KW0A 4QHSA 2CHGA 4RF1A 2XFSA 4I4LA 4ITQA 3CF2A 2RGOA 1FNNA 4B7GA 2RKOA 3QAUA 3FYCA 1J09A 5IZ7D 3T15A 4DUYM 4MGHA 1QAQA 3VDPA 2Z4RA 2CHVA 1NHGC 3Q8XA 4JI6M 2D7GA 4LRSA 2FOIC 1DGFA 3U6CA 4M9XA 3FUXA 3FKEA 3DOAA 3JAMS 3HHXA 3VLFB 5FSWA 3PVSA 4M9ZA 3SFZA 5ITUA 3GLIA 3U5ZB 4LZJA 3RGPA 3N3FA 2VIIA 4WURA 5GKNA 2X4AA 4L16A 1J7KA 1D2NA 3THGA 2FFJA 2XZFA 1X37A 2Y0TA 3SMPA 1HNWM 4JI2M 3K1JA 3TPZA 2R45A 4LG2A 1OFHA 2C9CA 4OJ5A 4JI8M 4K0KM 1HR0M 1Q3CA 3JR4A 4NZ3A 3GPXA 5JI2E 3HJSA 4G6ZA 3FUVA 3WHLA 1Z5CA 3U6PA 1SXJC 2C99A 1S3SA 5BR8M 2I7PA 2QBYA 1XNRM 1IN8A 3VKHA 2KRUA 3FUWA 2UUAM 1JQJC 3FUUA 5EXXA 2HKJA 1NY5A 4MGZE 3KOZE 5EP2A 1HNXM 3HONA 4MM3B 3CTWB 4NYUA 3SYLA 1I4WA 3SHFA 3ZC7B 3TWMA 3U61A 3SATA 4LCBA 4X65M 4LFBM 3FTDA 1IXRC 4PDIA 4Z8XA 2KZUA 2XFTA 4GC9A 4WW0A 4FCTA 5ITRA 3U6SA 1IBLM 3FD9A 2BG1A 1NVMA 3I4VA 4LF9M 3J7BA 1EE8A 1GLNA 5EJCA 1L2CA 4LFCM 1G8PA 3HJQA 3OTOM 4IBDA 4IBFA 3FTCA 2F4VM 2KEBA 1K3WA 1HQCA 4DUZM 1L1ZA 4KO8A 2Z4SA 4FD2A 1L2DA 3IG5A 3U6QA 2E5LM 1LV7A 1OFIA 5EP1A 3HU1A 5IT9S 2UUBM 2G8LA 3L25A 2OQ4A 2QBYB 3GPUA 5DNYA 4Z6YA 2Y2QA 1R6BX 3U6DA 4IBKA 3M7GA 2F5SA 1XWIA 4G4OA 4LGMA 1KSFX 1NJGA 3KDSE 2EUCA 1G41A 2C98A 4R7GA 2Y2HA 4QOZC 4JI5M 4IBCA 4AG6A 5ITXE 4GHAA 2JA2A 2LXEA 3U61B 2EO2A 2VQEM 2XZUA 1YU1A 2O5RA 4FWHA 3GLFA 3HSHA 3J81S 2L6OA 4FCVA 4MH0E 4MGKE 5E26A 4LZZA 4QOSA 4D81A 4NXNM 2DWZB 2KZSA 2XH9A 4NZ1A 5FTNA 4W5WA 3TWLA 2CUZA 1QAOA 2CV1A 1YUBA 1YE9A 4FCWA 2J7OA 3LQQA 4G4NA 2Y2NA 2D7HA 1MX0A 4GRIA 5IWAM 3EIHA 1N33M 2XLJA 2QP9X 3HU3A 2UXCM 4BBAA 1YSYA 3LVWA 1UM8A 4OU7A 4LJAA 4AQYM 1TH2A 2X49A 1DO2A 1Q39A 3AL0C 4YHHM 2V6ZM 3ZH9B 2KXEA 3KP1E 1GL6A 2ZBKB 1L1TA 1IN4A 4QNLA 2CHQA 5E6JA 4AZFA 1T3TA 2CE7A 3GPYA 2G5GX 4IBGA 4LF5M 4NZ5A 3NWLA 3K92A 4CHTB 4AKIA 3IG8A 1N78A 4RF0A 5A2QS 3VFDA 2JCHA 1VDDA 1Z6TA 1J5EM 1QQWA 2V1UA 3LMMA 4HL4A 4I81A 3RGSA 2K47A 5EXTA 4NY2A 2XF3A 2C96A 3VK8A 1IY1A 1XHBA 4LJ8A 2IOUA 2Y2GA 2P5TA 5EP4A 1TH3A 2F5OA 1IY0A 4IBJA 4LF4M 2V1CA 2Q2EB 4OX9M 3BOSA 1IXZA 2M60A 2R4EA 1IN7A 3GP1A 2D7EA 1NJFA 4NL4H 3SAWA 3TE6A 5H37D 4B3TM 3UMMA 3ZCBB 1HQYE 4LFAM 4DV5M 2FFFB 2QZ4A 5LMUM 2Y2LA 4JI4M 3LVVA 3MK6A 4GKJM 1TDHA 5ITTA 1E9RA 2Y2PA 2QPAA 3LQRA 3KFUG 1XXHB 1W5SA 3FYDA 1ZQ9A 2XD1A 3B9PA 2EA0A 3AOGA 1HNZM 4OJPA 2R46A 2L7IA 3H4MA 3PNVA 3HJ8A 4QNMA 3C58A 4LF6M 3AOEA 4LRTA 3TL4X 4ZPXA 1SXJB 2LNHC 1XMOM 2YNMD 4NSRA 1YU2A 3SAVA 2YR0A 2LWXA 2HL7A 3M0EA 3PFIA 4FWGA 3FTFA 3L2AA 3SBJA 3SYKA 1YU3A 4I8OA 1R7RA 2I7NA 4CGYB 1L8QA 4DV7M 1IM2A 3A98B 4IBBA 3GLFB 5FTKA 4LF7M 3DFZA 4R3DA 3SC3A 1QZMA 2ZAMA 2DXIA 4CISA 4MB7A 3U6MA 1K82A 3GRRA 4DR7M 1E94E 3RE8A 4L78A 4JXJA 4DR5M 2AHMA 4KLNA 3HGIA 5KPRA 4LJ9A 1TDZA 3M6AA 3RFWA 3SAUA 2Z7JA 1PJIA 3PNYA 4D82A 1R2ZA 3SARA 5BPVA 4HLQA 4NSOB 3GLHA 3MJ5A 5FTMA 1NNUC 4LF8M 2Y2OA 2F5NA 3I51A 3T38A 4BLCA 3KOYE 4X64M 4JN6A 4NYYA 3VDUA 4FW9A 3CF0A 3U60B 1HT2E 2UWXA 1YU0A 3W0FA 4DV6M 4OJ6A 3KP0E 1DGHB 1K3XA 2A5YB 1H6UA 2QENA 3AV0A 4AI6A 1PM5A 5FLXS 4M9SA 3U6EA 3FUTA 4PT5A 4REZA 4NZ4A 1TGUA 3MHVC 4GKKM 4LGYA 1N75A 2H1RA 4G4RA 4DR1M 2M5ZA 4JYAM 3AKZA 1DGBA 2UXDM 4M0DA 1SXJD 2DWMA 1MU5A 1L2BA 3R8FA 3JR5A 1I94M 3VKGA 4LJ6A 3K8ZA 3U6OA 2Y2KA 5KPZA 4OVZA 3PXGA 2Y2JA 4A3VB 4PDGA 3L26A 1JR3A 2DHRA 5FTLA 1XNQM 1SXJA 2QCUA 4L4UA 3J7AS 4NOOB 8CATA 2HCBA 3HHWA 3GLGB 2DWLA 2ZANA 1GVNA 4KHPM 1QYRA 1GKIA 4DV0M 3UGJA 2DZOB 2HHHM 2NQ8C 2BJWA 2YFQA 2C5RA 4AG5A 1QANA 4L8RC 4LY6A 1E32A 4JI3M 2JE5A 2CV2A 4KODA 5C1BA 3FTEA 1IQPA 1XXHA 2VQFM 2Y2MA 1SXJE 1N32M 5EQTA 4FVMA 2F5PA 2FNAA 3UZUA 4PD2A 1DO0A 2L09A 3GLIB 1HT1E 5KO3A 2R65A 2DZNB 2DWNA 4JI1M 4OVZB 3U60A 1IY2A 3GRUA 1W5TA 1XC8A 3KOXE 3VK7A 2Y21A 4M0WA 4I5SA 2ERCA 1OJLA 4PCZA 4B3SM 4DV3M 1N34M 2R62A 3DA1A 3J80S 3HHZA 4IBIA 1G4AE 5EP3A 3SHGB 4B08A 3TWKA 4JV5M 4B7HA 1KFVA 1JR3D 4GMQA 4B7FA 4IBEA 4EIWA 3J2PB 2LH0A 3DZDA 4GITA 3SASA 4B3RM 1Z5BA 1YU4A 1IBKM 4G4QA 3SMSA 4DV4M 3T1HM 1G59A 5F3WA 1ZAEA 5ITXA 1PJJA 1IXSB 3WX7A 3L29A 5DYGA 4LJ4A 3KSXA 3U5ZA 3GRYA 2XEPA 3TQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBC A;  4GH9 A;  5BPV A;  4GHA A;  4GHL A;  4IBD A;  4IBF A;  3L2A A;  4IBI A;  3KS4 A;  4IBB A;  4LG2 A;  4IBE A;  3KS8 A;  3L27 A;  3L25 A;  4IJF A;  3L28 A;  4IBK A;  3L26 A;  3L29 A;  4IBJ A;  4IBG A;  3FKE A;  4IJE A; 
#chains in the Genus database with same CATH topology
 2JP7 A;  2KRK A;  4GH9 A;  3UK6 A;  4BB9 A;  5LMN M;  2J7N A;  1WXQ A;  3B7Q A;  2KHH A;  3HHY A;  1QVR A;  2YQZ A;  4OUI A;  2WSE F;  3GLI E;  1G3I A;  3KS4 A;  4NXM M;  3GLH B;  2WSC F;  3GPP A;  4NRW A;  3E9S A;  4B3M M;  3AOE C;  4AKH A;  2XSZ A;  3L27 A;  5EXS A;  1GOI A;  3I4Y A;  1IN5 A;  5FTJ A;  3D8L A;  1WGL A;  2L2D A;  4OJO A;  1OTR A;  2Z3X A;  2KNV A;  2MRO B;  4IIW A;  1W1Y A;  2N35 A;  5DYI A;  3GQ5 A;  4NC6 A;  1D0M A;  4GC5 A;  4II7 A;  4P16 A;  3UJN A;  1E6N A;  2CRU A;  3AFH A;  2ZAO A;  4DR4 M;  3GO8 A;  1TH4 A;  2L7H A;  1XMQ M;  4D80 A;  3GLF E;  4NRV A;  1QAM A;  3HU2 A;  5EXP A;  3V76 A;  5KPT A;  2DAI A;  3KSJ A;  1Y8G A;  4DV2 M;  3A42 A;  2CP8 A;  3A46 A;  4DR2 M;  1VEJ A;  1IBM M;  1E9S A;  3GLG A;  1YUE A;  3AJI B;  2ZTD A;  3J27 B;  2DAM A;  2FS1 A;  5ITY A;  1OIP A;  2BNK A;  2OOB A;  2Y0Q A;  4AW4 A;  3ILK A;  4MGI E;  7CAT A;  1D0K A;  1OIZ A;  2UUC M;  1ZV1 A;  3EIE A;  4LJ5 A;  5KQ8 A;  3KS8 A;  2C9O A;  2DI0 A;  4DR3 M;  1C1K A;  4IJF A;  1ORY B;  4FWD A;  3HY5 A;  2DAG A;  4GIP A;  2CEA A;  2RGH A;  4TUW A;  1E8B A;  4JI7 M;  2V5O A;  3HWS A;  4YY3 M;  2FE8 A;  3GRV A;  1N77 A;  4DR6 M;  1ZMV A;  2W82 A;  3A45 A;  4AKG A;  1EAK A;  1Z5A A;  1UR9 A;  3U6L A;  2UXB M;  1DGG A;  1GL7 A;  1NHW C;  2O25 A;  4IJE A;  2X8A A;  4XBO A;  2UU9 M;  3W0L B;  4OJL A;  3QWL A;  2R18 A;  3E21 A;  5ITQ A;  2BJV A;  3GQ4 A;  1IN6 A;  4OW0 A;  1NNJ A;  3R9X B;  4GHL A;  1NSF A;  1H8P A;  2XD5 A;  4DV1 M;  1N36 M;  3WHK A;  5C18 A;  5IRE B;  4X62 M;  2CFO A;  2KNZ A;  4QHT A;  1VEG A;  2JZ1 A;  4RNA A;  2XGN A;  3GQ3 A;  1GJS A;  3E4R A;  1DGH A;  5L8R F;  3CF6 E;  4X66 M;  4TX8 A;  5JI3 E;  1GJT A;  3L28 A;  2LVO C;  1PJS A;  3KOW E;  4S12 A;  1R2Y A;  2F5Q A;  2B3T A;  1FJG M;  3KVW A;  4L15 A;  5KQD A;  1CUK A;  2R4J A;  4XGI A;  2KA6 B;  2LHG A;  2CWB A;  1GO5 A;  4MB3 A;  1Q3B A;  2DVW B;  2Y20 A;  1Z59 A;  3KXE C;  2CV0 A;  2K9D A;  2XSZ D;  3T1Y M;  4HMD A;  2GNO A;  3K2L A;  3HKP A;  4LJ7 A;  4JI0 M;  1C7Y A;  2Y2I A;  3D8B A;  3KW6 A;  3GLG E;  1PGY A;  1TTE A;  1AIP C;  1KYI A;  4QNR A;  2FN2 A;  2OPF A;  2ZM6 M;  2MJ5 B;  3NBI A;  4MGY E;  2QQ8 A;  1NY6 A;  2KW0 A;  4QHS A;  2CHG A;  2R44 A;  3IEC A;  4RF1 A;  2XFS A;  4I4L A;  2K6B A;  4ITQ A;  2DAK A;  1WJ7 A;  3CF2 A;  3F92 A;  2RGO A;  1FNN A;  4B7G A;  2RKO A;  3QAU A;  3FYC A;  1J09 A;  5IZ7 D;  3T15 A;  4DUY M;  1F4I A;  4MGH A;  1QAQ A;  1PJQ A;  3VDP A;  2Z4R A;  3HZJ A;  1E6P A;  2CHV A;  1NHG C;  3Q8X A;  3TQS A;  2J5Y A;  2D7G A;  2LVP C;  2VF7 A;  4KT0 F;  2FOI C;  4LRS A;  4JI6 M;  1DGF A;  3U6C A;  4M9X A;  3FUX A;  3FKE A;  2HWJ A;  3DOA A;  3JAM S;  3HHX A;  3C3E A;  3VLF B;  5FSW A;  3PVS A;  1TR8 A;  4M9Z A;  3SFZ A;  5ITU A;  3GLI A;  4LZJ A;  3RGP A;  3U5Z B;  3N3F A;  2VII A;  4WUR A;  3T6P A;  3W67 A;  5GKN A;  2X4A A;  4L16 A;  1J7K A;  1D2N A;  1VDL A;  2FFJ A;  3THG A;  1X37 A;  2Y0T A;  3SMP A;  1HNW M;  4JI2 M;  3K1J A;  3TPZ A;  2R45 A;  3WD3 A;  2JUJ A;  4LG2 A;  1OFH A;  2C9C A;  4Y28 F;  1VQ1 A;  1EIJ A;  4OJ5 A;  4JI8 M;  4K0K M;  1HR0 M;  1Q3C A;  3JR4 A;  4NZ3 A;  3GPX A;  5JI2 E;  3HJS A;  4G6Z A;  3FUV A;  3WHL A;  1Z5C A;  3U6P A;  1SXJ C;  2C99 A;  1S3S A;  5BR8 M;  2I7P A;  2QBY A;  1UR8 A;  4UN2 B;  1XNR M;  2JWS A;  4Z2I A;  1IN8 A;  3B7Z A;  3VKH A;  2KRU A;  3FUW A;  2UUA M;  1JQJ C;  3FUU A;  5EXX A;  2HKJ A;  1NV8 A;  1NY5 A;  4MGZ E;  1ZMU A;  3KOZ E;  2OO9 A;  5EP2 A;  1HNX M;  3HON A;  4MM3 B;  3CTW B;  4NYU A;  2R6F A;  3QYE A;  2H5X A;  3SYL A;  1I4W A;  3SHF A;  3ZC7 B;  3TWM A;  3U61 A;  1E6R A;  3SAT A;  4LCB A;  4X65 M;  4LFB M;  1OAI A;  3FTD A;  1IXR C;  3I04 M;  2QNJ A;  4PDI A;  4Z8X A;  2KZU A;  2XFT A;  4GC9 A;  1GPF A;  3LCV B;  1DV0 A;  2QHO B;  4WW0 A;  2O01 F;  3MMP A;  4FCT A;  5ITR A;  3FD9 A;  3U6S A;  1IBL M;  2BG1 A;  3WD2 A;  1NVM A;  3I4V A;  1WGN A;  1V92 A;  4Z2K A;  4Z2J A;  2LVA A;  4LF9 M;  1W1T A;  3J7B A;  1EE8 A;  1GLN A;  5EJC A;  1L2C A;  4LFC M;  2MR9 A;  1G8P A;  3HJQ A;  3OTO M;  4IBD A;  2KDL A;  3FTC A;  4IBF A;  2KEB A;  1K3W A;  2F4V M;  1HQC A;  4DUZ M;  1L1Z A;  4KO8 A;  2DAE A;  2Z4S A;  4FD2 A;  1L2D A;  3IG5 A;  3U6Q A;  2E5L M;  1LV7 A;  1NO1 A;  1OFI A;  3Q8G A;  5EP1 A;  3HU1 A;  5IT9 S;  2UUB M;  2G8L A;  1J7M A;  2ZTC A;  3L25 A;  2OQ4 A;  2QBY B;  3GPU A;  5DNY A;  4Z6Y A;  2Y2Q A;  1R6B X;  3U6D A;  4IBK A;  3M7G A;  2F5S A;  1R5L A;  1XWI A;  4G4O A;  4LGM A;  1KSF X;  1NJG A;  1OKS A;  3KDS E;  2EUC A;  1QO6 A;  1G41 A;  2C98 A;  2L4F A;  4R7G A;  2Y2H A;  3M7P A;  4WP2 A;  2JY5 A;  4QOZ C;  4JI5 M;  4IBC A;  4AG6 A;  4DBG B;  3BXW A;  5ITX E;  4GHA A;  2JA2 A;  1Q02 A;  2LXE A;  3U61 B;  2EO2 A;  2VQE M;  2XZU A;  1YU1 A;  2O5R A;  4FWH A;  3GLF A;  2R0I A;  1QZE A;  3HSH A;  1W1P A;  3J81 S;  2L6O A;  4FCV A;  4MH0 E;  4MGK E;  1XXH E;  5E26 A;  4LZZ A;  4QOS A;  4D81 A;  3LW5 F;  4NXN M;  2FH0 A;  2DWZ B;  1L6J A;  1SG9 A;  2KZS A;  4P17 A;  2XH9 A;  4Z2L A;  4NZ1 A;  5FTN A;  2LVN C;  4W5W A;  5DFL A;  3TWL A;  2QSF X;  2CUZ A;  1QAO A;  1NV9 A;  2Z8Y M;  2CV1 A;  1YUB A;  3FE3 A;  2GQF A;  1YE9 A;  4FCW A;  2J7O A;  1JB0 F;  3LQQ A;  4G4N A;  2RRU A;  2Y2N A;  1OQY A;  2D7H A;  1MX0 A;  4GRI A;  2DHY A;  5IWA M;  2JNH A;  3EIH A;  2EJS A;  1CXW A;  1N33 M;  2XLJ A;  2QP9 X;  3HU3 A;  2UXC M;  4BBA A;  1YSY A;  1QUS A;  3I01 M;  3LVW A;  1UM8 A;  1MJG M;  4LJA A;  4OU7 A;  1TH2 A;  2X49 A;  4GEW A;  4AQY M;  1DO2 A;  1Q39 A;  3AL0 C;  4YHH M;  2V6Z M;  3ZH9 B;  2KXE A;  1OGB A;  3KP1 E;  1GL6 A;  2ZBK B;  1L1T A;  1IN4 A;  1EFU B;  4QNL A;  2CHQ A;  5E6J A;  4AZF A;  1T3T A;  2CE7 A;  3GPY A;  2G5G X;  4IBG A;  4LF5 M;  4NZ5 A;  1G71 A;  3NWL A;  3K92 A;  1E15 A;  4CHT B;  4AKI A;  3IG8 A;  1N78 A;  4RF0 A;  5A2Q S;  3VFD A;  3WD4 A;  3ZQJ A;  2JCH A;  1VDD A;  1VG5 A;  3C9P A;  1Z6T A;  1J5E M;  1QQW A;  3E46 A;  2V1U A;  3LMM A;  1H0G A;  4HL4 A;  3HX3 A;  4I81 A;  3RGS A;  2K47 A;  5EXT A;  4NY2 A;  2XF3 A;  2C96 A;  1VEK A;  3VK8 A;  2DEN A;  1IY1 A;  4Z2G A;  1XHB A;  4LJ8 A;  1W1V A;  2IOU A;  3WD1 A;  2L4E A;  2Y2G A;  3MQL A;  2P5T A;  1E88 A;  5EP4 A;  1TH3 A;  2F5O A;  1IY0 A;  4IBJ A;  1AUA A;  3B7N A;  4LF4 M;  4MB4 A;  2V1C A;  2Q2E B;  2LTU A;  3K9P A;  4OX9 M;  3BOS A;  1IXZ A;  2M60 A;  2R4E A;  1IN7 A;  3GP1 A;  2D7E A;  1NJF A;  1PJT A;  3H4J A;  4NL4 H;  3SAW A;  3TE6 A;  5H37 D;  1A5T A;  4B3T M;  4Z2H A;  3UMM A;  3ZCB B;  1HQY E;  4LFA M;  4DV5 M;  2FFF B;  2QZ4 A;  2JY8 A;  1OGG A;  5LMU M;  3WD0 A;  2Y2L A;  2BWE A;  2VF8 A;  4JI4 M;  3LVV A;  3MK6 A;  4GKJ M;  1TDH A;  5ITT A;  1E9R A;  1O6I A;  2QPA A;  1JR3 E;  4G3O A;  2Y2P A;  3LQR A;  3KFU G;  1XXH B;  1W5S A;  3FYD A;  1ZQ9 A;  1CK7 A;  2EKK A;  2XD1 A;  3B9P A;  2EA0 A;  2HAK A;  3AOG A;  1HNZ M;  4OJP A;  2R46 A;  1LTM A;  4RKU F;  2L7I A;  3H4M A;  1MN3 A;  3PNV A;  3HJ8 A;  4QNM A;  3C58 A;  4LF6 M;  3AOE A;  4LRT A;  3TL4 X;  4ZPX A;  1SXJ B;  2LNH C;  1XMO M;  2YNM D;  4NSR A;  1YU2 A;  2D49 A;  1UFZ A;  2YR0 A;  2LWX A;  1XB2 B;  2HL7 A;  3M0E A;  3PFI A;  4FWG A;  3BBZ A;  3L2A A;  3SAV A;  3SBJ A;  3FTF A;  3SYK A;  1H0I A;  2JY6 B;  1YU3 A;  2MGW A;  4I8O A;  1R7R A;  2I7N A;  2WSF F;  4CGY B;  1L8Q A;  4DV7 M;  1IM2 A;  2JY7 A;  3A98 B;  4IBB A;  3GLF B;  5FTK A;  4LF7 M;  3DFZ A;  4R3D A;  3SC3 A;  1QZM A;  2ZAM A;  1T43 A;  2DXI A;  4CIS A;  4MB7 A;  3U6M A;  2LBC A;  1K82 A;  3GRR A;  4DR7 M;  1E94 E;  3RE8 A;  4L78 A;  4JXJ A;  4DR5 M;  2AHM A;  4KLN A;  3HGI A;  5KPR A;  3IHP A;  4LJ9 A;  1TDZ A;  2G3Q A;  3M6A A;  4Q7J A;  1QDR A;  2Z7J A;  3FRI A;  2OOA A;  3RFW A;  3PNY A;  3K9O A;  4D82 A;  3SAU A;  1PJI A;  1R2Z A;  3SAR A;  5BPV A;  4HLQ A;  1BVS A;  1PRB A;  3GLH E;  4NSO B;  3GLH A;  3MJ5 A;  5FTM A;  4HMC A;  1NNU C;  4HEO A;  4LF8 M;  4F1I A;  2Y2O A;  2F5N A;  3I51 A;  3T38 A;  4BLC A;  3KOY E;  4X64 M;  4JN6 A;  4NYY A;  2APL A;  2RTS A;  3VDU A;  4FW9 A;  3NBX X;  2KNA A;  3CF0 A;  3U60 B;  1HT2 E;  2UWX A;  1YU0 A;  3W0F A;  4DV6 M;  4OJ6 A;  3KP0 E;  1DGH B;  1K3X A;  2A5Y B;  1H6U A;  2QEN A;  3AV0 A;  4AI6 A;  1PM5 A;  1HJP A;  5FLX S;  3FRH A;  4M9S A;  3U6E A;  1R4G A;  3FUT A;  4PT5 A;  4REZ A;  1QDT A;  2VDB B;  4CIZ A;  4NZ4 A;  1TGU A;  1WR1 B;  3MHV C;  4GKK M;  4LGY A;  1N75 A;  2DKL A;  2H1R A;  4G4R A;  1GXD A;  4DR1 M;  2M5Z A;  4JYA M;  4MB5 A;  1PDC A;  3AKZ A;  1DGB A;  2UXD M;  4M0D A;  1SXJ D;  2DWM A;  1MU5 A;  2XZF A;  1L2B A;  3R8F A;  3JR5 A;  1I94 M;  3VKG A;  4LJ6 A;  1E6Z A;  2MH8 A;  3K8Z A;  3U6O A;  1RU3 A;  2Y2K A;  5KPZ A;  4R71 A;  4OVZ A;  3PXG A;  3B89 A;  4A3V B;  2Y2J A;  4PDG A;  3L26 A;  1JR3 A;  1D0L A;  2DHR A;  1KS0 A;  4ANR A;  5FTL A;  1XNQ M;  1SXJ A;  1V34 A;  2QCU A;  4L4U A;  3J7A S;  4NOO B;  8CAT A;  2HCB A;  3HHW A;  3GLG B;  2DWL A;  2ZAN A;  2BWB A;  1GVN A;  1WHC A;  1QYR A;  1GKI A;  4KHP M;  4DV0 M;  3UGJ A;  2DZO B;  2HHH M;  2WZJ A;  2NQ8 C;  2BJW A;  2YFQ A;  3QYB A;  2C5R A;  3CGW A;  4AG5 A;  1QAN A;  4L8R C;  1AIW A;  4LY6 A;  3LCU A;  1E32 A;  4JI3 M;  2JE5 A;  2CV2 A;  4KOD A;  5C1B A;  3FTE A;  1IQP A;  1XXH A;  2LVQ D;  2VQF M;  2Y2M A;  2JZ0 A;  1SXJ E;  1N32 M;  5EQT A;  4XK8 F;  4FVM A;  2F5P A;  2FNA A;  3UZU A;  4PD2 A;  3W68 A;  1DO0 A;  2L09 A;  3GLI B;  1HT1 E;  5KO3 A;  2R65 A;  2DZN B;  2DWN A;  1OAO C;  1IFY A;  4JI1 M;  4OVZ B;  3U60 A;  1IY2 A;  3GRU A;  2EKF A;  1W5T A;  2K0B X;  1XC8 A;  2DZL A;  3KOX E;  1ED7 A;  3VK7 A;  2Y21 A;  4M0W A;  4I5S A;  3B74 A;  2ERC A;  1OJL A;  4PCZ A;  4B3S M;  1TF0 B;  4DV3 M;  1N34 M;  2R62 A;  3DA1 A;  3J80 S;  2DNA A;  3HHZ A;  4IBI A;  1G4A E;  4L6V 6;  5EP3 A;  2LHC A;  3SHG B;  3C3D A;  1QUT A;  1P3Q Q;  1T6O A;  3TWK A;  4B08 A;  4JV5 M;  4B7H A;  1KFV A;  1JR3 D;  4GMQ A;  1IXS A;  4IBE A;  4B7F A;  4EIW A;  3J2P B;  2LH0 A;  1WIV A;  3DZD A;  4GIT A;  3SAS A;  1Z5B A;  4B3R M;  1IBK M;  1YU4 A;  4G4Q A;  3SMS A;  4DV4 M;  3T1H M;  1G59 A;  5F3W A;  1ZAE A;  4HME A;  1GAB A;  5ITX A;  4CJ6 A;  1PJJ A;  1IXS B;  3WX7 A;  1V33 A;  3L29 A;  4LJ4 A;  3KSX A;  5DYG A;  3GRY A;  1ZMW A;  4F2L A;  3U5Z A;  2XEP A;  2JXN A;  1YLA A; 
#chains in the Genus database with same CATH homology
 2KRK A;  4GH9 A;  3UK6 A;  4BB9 A;  5LMN M;  2J7N A;  1WXQ A;  3HHY A;  1QVR A;  2YQZ A;  4OUI A;  1G3I A;  3KS4 A;  4NXM M;  3GLH B;  3GPP A;  4NRW A;  3E9S A;  4B3M M;  3AOE C;  4AKH A;  2XSZ A;  3L27 A;  5EXS A;  2XD5 A;  3I4Y A;  1IN5 A;  5FTJ A;  3D8L A;  4OJO A;  2Z3X A;  4IIW A;  5DYI A;  3GQ5 A;  4GC5 A;  4II7 A;  4P16 A;  3UJN A;  3AFH A;  2ZAO A;  4DR4 M;  3GO8 A;  1TH4 A;  2L7H A;  1XMQ M;  4D80 A;  4NRV A;  1QAM A;  3HU2 A;  5EXP A;  5KPT A;  3KSJ A;  4DR2 M;  4DV2 M;  3A42 A;  1IBM M;  3A46 A;  1E9S A;  3GLG A;  1YUE A;  3AJI B;  3J27 B;  5ITY A;  2BNK A;  2Y0Q A;  4AW4 A;  3ILK A;  4MGI E;  7CAT A;  2UUC M;  3KS8 A;  3EIE A;  4LJ5 A;  5KQ8 A;  2C9O A;  4DR3 M;  1C1K A;  4IJF A;  1ORY B;  4FWD A;  4GIP A;  4TUW A;  2CEA A;  2RGH A;  4JI7 M;  3HWS A;  4YY3 M;  2FE8 A;  3GRV A;  1N77 A;  4DR6 M;  2W82 A;  3A45 A;  4AKG A;  1Z5A A;  3U6L A;  2UXB M;  1DGG A;  1GL7 A;  1NHW C;  4IJE A;  2X8A A;  4XBO A;  2UU9 M;  3W0L B;  4OJL A;  3QWL A;  2R18 A;  5ITQ A;  2BJV A;  3GQ4 A;  1IN6 A;  4OW0 A;  1NNJ A;  3R9X B;  4GHL A;  1NSF A;  4DV1 M;  1N36 M;  3WHK A;  5C18 A;  5IRE B;  4X62 M;  2CFO A;  4QHT A;  4RNA A;  2XGN A;  3GQ3 A;  3E4R A;  1DGH A;  3CF6 E;  4X66 M;  5JI3 E;  3L28 A;  2F5Q A;  4S12 A;  3KOW E;  1R2Y A;  1FJG M;  3KVW A;  4L15 A;  5KQD A;  2R4J A;  4XGI A;  2KA6 B;  1Q3B A;  2DVW B;  2Y20 A;  1Z59 A;  3KXE C;  2CV0 A;  2XSZ D;  3T1Y M;  3K2L A;  3HKP A;  4LJ7 A;  4JI0 M;  2Y2I A;  3D8B A;  3KW6 A;  1KYI A;  4QNR A;  2OPF A;  2ZM6 M;  3NBI A;  4MGY E;  1NY6 A;  2KW0 A;  4QHS A;  2CHG A;  4RF1 A;  2XFS A;  4I4L A;  4ITQ A;  3CF2 A;  2RGO A;  1FNN A;  4B7G A;  2RKO A;  3QAU A;  3FYC A;  1J09 A;  5IZ7 D;  3T15 A;  4DUY M;  4MGH A;  1QAQ A;  3VDP A;  2Z4R A;  2CHV A;  1NHG C;  3Q8X A;  4JI6 M;  2D7G A;  4LRS A;  2FOI C;  1DGF A;  3U6C A;  4M9X A;  3FUX A;  3FKE A;  3DOA A;  3JAM S;  3HHX A;  3VLF B;  5FSW A;  3PVS A;  4M9Z A;  3SFZ A;  5ITU A;  3GLI A;  3U5Z B;  4LZJ A;  3RGP A;  3N3F A;  2VII A;  4WUR A;  5GKN A;  2X4A A;  4L16 A;  1J7K A;  1D2N A;  3THG A;  2FFJ A;  2XZF A;  1X37 A;  2Y0T A;  3SMP A;  1HNW M;  4JI2 M;  3K1J A;  3TPZ A;  2R45 A;  4LG2 A;  1OFH A;  2C9C A;  4OJ5 A;  4JI8 M;  4K0K M;  1HR0 M;  1Q3C A;  3JR4 A;  4NZ3 A;  3GPX A;  5JI2 E;  3HJS A;  4G6Z A;  3FUV A;  3WHL A;  1Z5C A;  3U6P A;  1SXJ C;  2C99 A;  1S3S A;  5BR8 M;  2I7P A;  2QBY A;  1XNR M;  1IN8 A;  3VKH A;  2KRU A;  3FUW A;  2UUA M;  1JQJ C;  3FUU A;  5EXX A;  2HKJ A;  1NY5 A;  4MGZ E;  3KOZ E;  5EP2 A;  1HNX M;  3HON A;  4MM3 B;  3CTW B;  4NYU A;  3SYL A;  1I4W A;  3SHF A;  3ZC7 B;  3TWM A;  3U61 A;  3SAT A;  4LCB A;  4X65 M;  4LFB M;  3FTD A;  1IXR C;  4PDI A;  4Z8X A;  2KZU A;  2XFT A;  4GC9 A;  4WW0 A;  4FCT A;  5ITR A;  3U6S A;  1IBL M;  3FD9 A;  2BG1 A;  1NVM A;  3I4V A;  4LF9 M;  3J7B A;  1EE8 A;  1GLN A;  5EJC A;  1L2C A;  4LFC M;  1G8P A;  3HJQ A;  3OTO M;  4IBD A;  4IBF A;  3FTC A;  2F4V M;  2KEB A;  1K3W A;  1HQC A;  4DUZ M;  1L1Z A;  4KO8 A;  2Z4S A;  4FD2 A;  1L2D A;  3IG5 A;  3U6Q A;  2E5L M;  1LV7 A;  1OFI A;  5EP1 A;  3HU1 A;  5IT9 S;  2UUB M;  2G8L A;  3L25 A;  2OQ4 A;  2QBY B;  3GPU A;  5DNY A;  4Z6Y A;  2Y2Q A;  1R6B X;  3U6D A;  4IBK A;  3M7G A;  2F5S A;  1XWI A;  4G4O A;  4LGM A;  1KSF X;  1NJG A;  3KDS E;  2EUC A;  1G41 A;  2C98 A;  4R7G A;  2Y2H A;  4QOZ C;  4JI5 M;  4IBC A;  4AG6 A;  5ITX E;  4GHA A;  2JA2 A;  2LXE A;  3U61 B;  2EO2 A;  2VQE M;  2XZU A;  1YU1 A;  2O5R A;  4FWH A;  3GLF A;  3HSH A;  3J81 S;  2L6O A;  4FCV A;  4MH0 E;  4MGK E;  5E26 A;  4LZZ A;  4QOS A;  4D81 A;  4NXN M;  2DWZ B;  2KZS A;  2XH9 A;  4NZ1 A;  5FTN A;  4W5W A;  3TWL A;  2CUZ A;  1QAO A;  2CV1 A;  1YUB A;  1YE9 A;  4FCW A;  2J7O A;  3LQQ A;  4G4N A;  2Y2N A;  2D7H A;  1MX0 A;  4GRI A;  5IWA M;  3EIH A;  1N33 M;  2XLJ A;  2QP9 X;  3HU3 A;  2UXC M;  4BBA A;  1YSY A;  3LVW A;  1UM8 A;  4OU7 A;  4LJA A;  4AQY M;  1TH2 A;  2X49 A;  1DO2 A;  1Q39 A;  3AL0 C;  4YHH M;  2V6Z M;  3ZH9 B;  2KXE A;  3KP1 E;  1GL6 A;  2ZBK B;  1L1T A;  1IN4 A;  4QNL A;  2CHQ A;  5E6J A;  4AZF A;  1T3T A;  2CE7 A;  3GPY A;  2G5G X;  4IBG A;  4LF5 M;  4NZ5 A;  3NWL A;  3K92 A;  4CHT B;  4AKI A;  3IG8 A;  1N78 A;  4RF0 A;  5A2Q S;  3VFD A;  2JCH A;  1VDD A;  1Z6T A;  1J5E M;  1QQW A;  2V1U A;  3LMM A;  4HL4 A;  4I81 A;  3RGS A;  2K47 A;  5EXT A;  4NY2 A;  2XF3 A;  2C96 A;  3VK8 A;  1IY1 A;  1XHB A;  4LJ8 A;  2IOU A;  2Y2G A;  2P5T A;  5EP4 A;  1TH3 A;  2F5O A;  1IY0 A;  4IBJ A;  4LF4 M;  2V1C A;  2Q2E B;  4OX9 M;  3BOS A;  1IXZ A;  2M60 A;  2R4E A;  1IN7 A;  3GP1 A;  2D7E A;  1NJF A;  4NL4 H;  3SAW A;  3TE6 A;  5H37 D;  4B3T M;  3UMM A;  3ZCB B;  1HQY E;  4LFA M;  4DV5 M;  2FFF B;  2QZ4 A;  5LMU M;  2Y2L A;  4JI4 M;  3LVV A;  3MK6 A;  4GKJ M;  1TDH A;  5ITT A;  1E9R A;  2Y2P A;  2QPA A;  3LQR A;  3KFU G;  1XXH B;  1W5S A;  3FYD A;  1ZQ9 A;  2XD1 A;  3B9P A;  2EA0 A;  3AOG A;  1HNZ M;  4OJP A;  2R46 A;  2L7I A;  3H4M A;  3PNV A;  3HJ8 A;  4QNM A;  3C58 A;  4LF6 M;  3AOE A;  4LRT A;  3TL4 X;  4ZPX A;  1SXJ B;  2LNH C;  1XMO M;  2YNM D;  4NSR A;  1YU2 A;  3SAV A;  2YR0 A;  2LWX A;  2HL7 A;  3M0E A;  3PFI A;  4FWG A;  3FTF A;  3L2A A;  3SBJ A;  3SYK A;  1YU3 A;  4I8O A;  1R7R A;  2I7N A;  4CGY B;  1L8Q A;  4DV7 M;  1IM2 A;  3A98 B;  4IBB A;  3GLF B;  5FTK A;  4LF7 M;  3DFZ A;  4R3D A;  3SC3 A;  1QZM A;  2ZAM A;  2DXI A;  4CIS A;  4MB7 A;  3U6M A;  1K82 A;  3GRR A;  4DR7 M;  1E94 E;  3RE8 A;  4L78 A;  4JXJ A;  4DR5 M;  2AHM A;  4KLN A;  3HGI A;  5KPR A;  4LJ9 A;  1TDZ A;  3M6A A;  3RFW A;  3SAU A;  2Z7J A;  1PJI A;  3PNY A;  4D82 A;  1R2Z A;  3SAR A;  5BPV A;  4HLQ A;  4NSO B;  3GLH A;  3MJ5 A;  5FTM A;  1NNU C;  4LF8 M;  2Y2O A;  2F5N A;  3I51 A;  3T38 A;  4BLC A;  3KOY E;  4X64 M;  4JN6 A;  4NYY A;  3VDU A;  4FW9 A;  3CF0 A;  3U60 B;  1HT2 E;  2UWX A;  1YU0 A;  3W0F A;  4DV6 M;  4OJ6 A;  3KP0 E;  1DGH B;  1K3X A;  2A5Y B;  1H6U A;  2QEN A;  3AV0 A;  4AI6 A;  1PM5 A;  5FLX S;  4M9S A;  3U6E A;  3FUT A;  4PT5 A;  4REZ A;  4NZ4 A;  1TGU A;  3MHV C;  4GKK M;  4LGY A;  1N75 A;  2H1R A;  4G4R A;  4DR1 M;  2M5Z A;  4JYA M;  3AKZ A;  1DGB A;  2UXD M;  4M0D A;  1SXJ D;  2DWM A;  1MU5 A;  1L2B A;  3R8F A;  3JR5 A;  1I94 M;  3VKG A;  4LJ6 A;  3K8Z A;  3U6O A;  2Y2K A;  5KPZ A;  4OVZ A;  3PXG A;  2Y2J A;  4A3V B;  4PDG A;  3L26 A;  1JR3 A;  2DHR A;  5FTL A;  1XNQ M;  1SXJ A;  2QCU A;  4L4U A;  3J7A S;  4NOO B;  8CAT A;  2HCB A;  3HHW A;  3GLG B;  2DWL A;  2ZAN A;  1GVN A;  4KHP M;  1QYR A;  1GKI A;  4DV0 M;  3UGJ A;  2DZO B;  2HHH M;  2NQ8 C;  2BJW A;  2YFQ A;  2C5R A;  4AG5 A;  1QAN A;  4L8R C;  4LY6 A;  1E32 A;  4JI3 M;  2JE5 A;  2CV2 A;  4KOD A;  5C1B A;  3FTE A;  1IQP A;  1XXH A;  2VQF M;  2Y2M A;  1SXJ E;  1N32 M;  5EQT A;  4FVM A;  2F5P A;  2FNA A;  3UZU A;  4PD2 A;  1DO0 A;  2L09 A;  3GLI B;  1HT1 E;  5KO3 A;  2R65 A;  2DZN B;  2DWN A;  4JI1 M;  4OVZ B;  3U60 A;  1IY2 A;  3GRU A;  1W5T A;  1XC8 A;  3KOX E;  3VK7 A;  2Y21 A;  4M0W A;  4I5S A;  2ERC A;  1OJL A;  4PCZ A;  4B3S M;  4DV3 M;  1N34 M;  2R62 A;  3DA1 A;  3J80 S;  3HHZ A;  4IBI A;  1G4A E;  5EP3 A;  3SHG B;  4B08 A;  3TWK A;  4JV5 M;  4B7H A;  1KFV A;  1JR3 D;  4GMQ A;  4B7F A;  4IBE A;  4EIW A;  3J2P B;  2LH0 A;  3DZD A;  4GIT A;  3SAS A;  4B3R M;  1Z5B A;  1YU4 A;  1IBK M;  4G4Q A;  3SMS A;  4DV4 M;  3T1H M;  1G59 A;  5F3W A;  1ZAE A;  5ITX A;  1PJJ A;  1IXS B;  3WX7 A;  3L29 A;  5DYG A;  4LJ4 A;  3KSX A;  3U5Z A;  3GRY A;  2XEP A;  3TQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...