3L27A

Crystal structure of zaire ebola vp35 interferon inhibitory domain r312a mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
total genus 40
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l27A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l27A02
3FKEA 4IBKA 4IBCA 4IBEA 4IBDA 4IBFA 3L2AA 3L28A 4IBBA 4IJFA 4IBJA 4GH9A 4GHLA 4IJEA 3L25A 3L26A 4IBIA 3L29A 3L27A 3KS4A 3KS8A 5BPVA 4IBGA 4GHAA 4LG2A
chains in the Genus database with same CATH superfamily
3B7NA 3DA1A 1WR1B 4R71A 3AKZA 2Y2QA 2JXNA 1GJTA 3FUXA 1E6NA 1NO1A 1H0IA 3SFZA 1IBKM 1IXZA 4IBBA 2HCBA 1DV0A 2J7OA 3U6PA 1SXJB 4DV2M 4B08A 1S3SA 1OKSA 1DO2A 1QAQA 1L8QA 5EP1A 1VDDA 2G5GX 2WZJA 5EJCA 5EXPA 4ITQA 5KQDA 1YLAA 1UR9A 1MN3A 3RGSA 2DAIA 5LMNM 3B74A 1PRBA 1ZMWA 3A42A 3U6QA 3W68A 3B9PA 3LQQA 4GRIA 3RE8A 1H0GA 3KS4A 2KA6B 1SXJD 1QDRA 2L4EA 2O25A 4LRSA 1IN4A 2DAGA 1G71A 3M0EA 4QNRA 4DR3M 2F5OA 3M6AA 1D0LA 5FSWA 1FJGM 4GHAA 2JP7A 2R44A 2VDBB 3VDUA 2CV1A 4F1IA 3KOXE 2X8AA 2L09A 2Q2EB 3ZC7B 4NRVA 2XZUA 3I4VA 2JCHA 3NBXX 3SHGB 1MJGM 1H6UA 1ORYB 2QBYA 4QNLA 2J5YA 1E6ZA 4Z2IA 1NNUC 1XXHA 2LVAA 4AI6A 2RTSA 1T6OA 2Z3XA 3VK7A 4XGIA 4LZJA 4Y28F 3WX7A 2X4AA 5EXXA 1E94E 4ZPXA 4GHLA 4AKGA 2BWBA 4M9SA 2VQEM 2IOUA 4CJ6A 2EA0A 3MJ5A 4JI8M 1ED7A 1QANA 4MB4A 4BLCA 1ZQ9A 2LH0A 3GLFE 4DV5M 4JI5M 2EJSA 2XLJA 1D2NA 1NJGA 3MK6A 2R6FA 1R6BX 4NOOB 3GLIE 1TTEA 1HNXM 3E46A 2D49A 1D0MA 2F5SA 1XWIA 2BJVA 4NY2A 1IN7A 1HT2E 1O6IA 4LY6A 1ZAEA 1H8PA 4FWDA 1NHWC 1KFVA 1IXRC 4PD2A 4D80A 3WD0A 1XXHB 2FN2A 3FUTA 1EFUB 1VEKA 2L2DA 4CHTB 1WGNA 3HHZA 3CF2A 3IG8A 4DR1M 3TQSA 3J7BA 4YHHM 2ZTDA 4DR2M 1Q3CA 3OTOM 1XC8A 2CFOA 3LVVA 4RNAA 1PM5A 3NWLA 2ZAOA 1QAOA 1Z6TA 5IREB 4AG6A 1NVMA 4FCTA 3UGJA 2R4EA 3A46A 1K3XA 4NXMM 3KSJA 1E88A 1QUTA 4G4QA 4L15A 4JI7M 1IN5A 2J7NA 1E9RA 2BJWA 2D7EA 2QZ4A 5KPZA 4AQYM 4JV5M 3RFWA 1Z59A 1Z5AA 4MM3B 4MGZE 4DR5M 4A3VB 4IBKA 3FTCA 2DWNA 4CISA 5IT9S 4MGIE 4X66M 2R65A 1YSYA 4P17A 1R2ZA 4B3RM 2LNHC 3LCUA 1PDCA 4IJFA 1NY6A 3EIEA 1HJPA 2C9CA 4MGKE 3U61A 1IBLM 4KHPM 1QUSA 1OFIA 1DGHB 2K47A 4NXNM 2YFQA 1LTMA 2X49A 4M0WA 2DZNB 1IY2A 2MJ5B 4B3TM 2FFFB 2KNVA 4KO8A 5E26A 2HKJA 3SMSA 4NZ5A 4OVZA 1E15A 2N35A 4HLQA 2UXCM 1K3WA 4JI2M 1UFZA 3CTWB 2RRUA 2VF8A 2WSCF 5ITTA 5BR8M 1D0KA 4LF4M 4OJOA 3W0FA 1ZMVA 3C9PA 2XF3A 5L8RF 1IN6A 4RF1A 2OPFA 5ITQA 4OU7A 1OJLA 3U6SA 3H4MA 3FD9A 2JZ1A 3GRUA 4OUIA 3E9SA 4KODA 3HHXA 4LF9M 4OX9M 3R9XB 2Y2OA 3LQRA 2ZTCA 3BOSA 1N34M 2KNZA 1JR3A 1IXSB 2ZAMA 4JN6A 3PXGA 3U61B 3R8FA 2UUAM 2QCUA 1YU1A 1T43A 4YY3M 3SATA 3I4YA 1EAKA 2APLA 2LBCA 2YR0A 2DXIA 2UXBM 1EIJA 1AUAA 2R45A 4DV6M 4X64M 3J7AS 3KOYE 4GKJM 2Y2PA 2L6OA 4GC5A 3TWKA 5ITRA 1OGGA 3GP1A 2QSFX 1TH2A 3AOEC 1MU5A 3HU2A 3PVSA 3T6PA 4LJ4A 4DR4M 1IN8A 3MHVC 3WD1A 4WURA 3KW6A 5IZ7D 2MR9A 4DUZM 2DWMA 1PJIA 4LJ5A 4NL4H 1SXJE 7CATA 3GPUA 3H4JA 2FFJA 3FTDA 4IBDA 4I8OA 3FYDA 2ERCA 1Z5BA 2DHYA 2DVWB 3Q8GA 2C5RA 3HZJA 1QQWA 4RKUF 2XSZA 1TR8A 2CRUA 5E6JA 3U6OA 1HR0M 4GH9A 3E4RA 3D8BA 1YUEA 2QP9X 1OIPA 1E8BA 3FUVA 1I94M 1GO5A 4M0DA 3SAWA 3L29A 3GQ5A 3QYBA 2F4VM 3E21A 1J5EM 2LVPC 3L27A 4BB9A 3JAMS 1N33M 3AFHA 1XMQM 1JR3D 1HT1E 3HX3A 1WGLA 2LTUA 5KPRA 1NSFA 2CV0A 2CUZA 2DAMA 3C3EA 1HQCA 1PJQA 4F2LA 4QHSA 3VFDA 5F3WA 2UU9M 3L2AA 2XZFA 4TUWA 1MX0A 2CWBA 4PDGA 1W1YA 4DR6M 1NV9A 1QZMA 4JYAM 4XK8F 2Z4SA 3SC3A 1N75A 2M60A 3L25A 3JR4A 5LMUM 3WD2A 2K6BA 1J09A 2YQZA 4CIZA 4X65M 4OJ6A 2H1RA 3TWLA 1GL7A 1OAOC 2NQ8C 4RF0A 4JI3M 3U6DA 4HL4A 3UK6A 3N3FA 3C3DA 3K92A 1C1KA 3U6LA 4Z2JA 5C18A 2KRUA 1AIWA 3BBZA 1N77A 4LJ9A 2LXEA 4DR7M 3IHPA 1XXHE 3U5ZA 4S12A 1K82A 2JNHA 1ZV1A 1A5TA 5DYGA 3U6CA 4LJAA 3QWLA 3J81S 2A5YB 3GQ4A 4NSOB 1TH3A 1Y8GA 3AV0A 2KNAA 2OOAA 1YU3A 2O5RA 3T15A 3RGPA 2QBYB 4Z2HA 1W5TA 1N32M 4FCVA 4MB3A 4FWHA 3J27B 4FCWA 5IWAM 2KDLA 3SBJA 2C99A 1L2BA 2LVQD 5C1BA 3L26A 2UXDM 3DZDA 4IBIA 2DKLA 4JI6M 2G3QA 4LJ8A 3U6EA 4JI4M 3LW5F 3VKGA 4LFCM 1VEJA 4MH0E 2F5PA 1CXWA 2DWLA 1SG9A 2VF7A 1T3TA 1JQJC 1CK7A 1V33A 4B7HA 4L8RC 2EKKA 2V6ZM 1WIVA 4I4LA 2EO2A 5EP4A 5EXSA 4DV7M 3U5ZB 4MGYE 1W1VA 3M7PA 4NZ1A 4I5SA 3U60A 3VKHA 1Z5CA 3K1JA 4B7FA 2Z7JA 3LCVB 2XFSA 2Y0QA 1XMOM 3DOAA 3GRYA 3GLHA 1NJFA 2L7HA 4P16A 3UZUA 4X62M 1IBMM 2Y0TA 2RGOA 1QZEA 2V5OA 2BWEA 1EE8A 2XGNA 3IG5A 1W1TA 1WJ7A 4L4UA 3JR5A 1OGBA 1XNRM 2R4JA 2QHOB 1R5LA 3W67A 1TDZA 1TGUA 4PT5A 2F5NA 4G3OA 4L16A 4LJ6A 5ITUA 3KXEC 3GPXA 5FTJA 2K0BX 2AHMA 3HHWA 4KT0F 5KO3A 4NZ3A 5FLXS 3GQ3A 1XHBA 1NV8A 1YUBA 4UN2B 3WHKA 2JY8A 2YNMD 2MH8A 1G8PA 5H37D 3KP1E 3HWSA 2JA2A 1F4IA 3U60B 4W5WA 3T38A 3K9OA 1QVRA 4DV1M 2I7NA 3GRRA 4LF6M 3GLGA 1N36M 4FW9A 3WD4A 2XH9A 2R46A 3VK8A 4NYUA 2KEBA 2OO9A 3GLHB 4DV4M 1GOIA 5JI3E 2XD1A 3KSXA 2UUBM 4AZFA 4QHTA 2Z4RA 2D7GA 4DV0M 2LHCA 4LJ7A 4D81A 3D8LA 4OVZB 2ZBKB 4L78A 4HMCA 4NYYA 2M5ZA 1DGGA 2HL7A 4Z2LA 5EQTA 2WSEF 1G59A 1SXJC 3DFZA 2R62A 3M7GA 1GPFA 4GITA 2EKFA 4IBEA 5ITXA 2QQ8A 2DENA 1JR3E 2FNAA 3AOEA 2Y20A 2Z8YM 2C96A 3AJIB 3I04M 2ZM6M 3L28A 3SHFA 3PFIA 4BBAA 1AIPC 2DAKA 4G4OA 1PJSA 3TL4X 1V34A 1R4GA 4LFAM 4JI0M 4GKKM 2JUJA 3K9PA 4Z2KA 4NC6A 1JB0F 3KP0E 4GMQA 5DNYA 1YU0A 1OTRA 3SASA 4K0KM 2G8LA 4B3SM 4DV3M 1UR8A 5EXTA 3FYCA 3GPPA 2Y2JA 1IFYA 4GIPA 4LG2A 2C9OA 3CGWA 3HY5A 2R0IA 5GKNA 3LVWA 4GEWA 2VQFM 2CHVA 1GKIA 2V1CA 3VLFB 1WXQA 4IBFA 3AOGA 4Q7JA 4LF8M 5FTMA 2D7HA 5EP2A 5FTNA 3SMPA 1PGYA 1VDLA 1YE9A 4DUYM 1NNJA 4LF5M 1XNQM 3ZCBB 3FTFA 3HSHA 1V92A 3FE3A 2RKOA 1DGBA 3B7QA 4JXJA 1IM2A 4AG5A 3HJ8A 3HGIA 3ILKA 4WP2A 4Z8XA 2Y2MA 2L4FA 2QENA 2DNAA 4DBGB 2FS1A 3FRHA 3KS8A 2LVNC 4D82A 3T1HM 1G41A 2DAEA 2JWSA 2XSZD 3EIHA 1YU2A 3HU3A 1Q02A 3UMMA 3I01M 3GLFA 4LCBA 4R7GA 4AKIA 1LV7A 1E6PA 4CGYB 2E5LM 1PJJA 4M9ZA 3T1YM 4B3MM 2OOBA 1DO0A 2Y2LA 1UM8A 5A2QS 3NBIA 1NY5A 4PCZA 3GLIA 3HU1A 2H5XA 1L1ZA 2KHHA 2KZSA 3GPYA 2KZUA 2CEAA 4GC9A 3SARA 4OJ5A 3MMPA 1GVNA 4IBJA 4LZZA 1IQPA 1R2YA 2Y2HA 2MROB 4G4RA 3ZQJA 1TDHA 1OQYA 1CUKA 4EIWA 1IY0A 2FH0A 1DGFA 4G6ZA 1GXDA 3QYEA 2BNKA 2I7PA 2P5TA 4OJPA 4II7A 1Q3BA 2JY5A 2UUCM 2LVOC 4IBGA 4LRTA 3HKPA 5ITYA 4LGMA 4MGHA 4M9XA 5KPTA 2QNJA 2L7IA 3FKEA 3SYLA 3GLFB 3KFUG 2XEPA 1J7MA 5FTKA 4ANRA 3HONA 3C58A 4IBCA 2JY7A 2QPAA 1QYRA 2Y21A 1I4WA 4HEOA 4LF7M 3GLIB 1R7RA 2W82A 4HMEA 3I51A 3GO8A 2Y2IA 1E6RA 1OFHA 3KOZE 1E9SA 1G3IA 1DGHA 3Q8XA 3LMMA 4Z6YA 4FVMA 1NHGC 5DFLA 1GLNA 4KLNA 3VDPA 1W1PA 2KRKA 3FUUA 2KW0A 2XD5A 1KS0A 1TF0B 2GQFA 2HAKA 2K9DA 2DZOB 5FTLA 3SAUA 4PDIA 2CHQA 3IECA 2BG1A 1OAIA 5BPVA 1N78A 4AKHA 2LHGA 4G4NA 3PNVA 5DYIA 3MQLA 4AW4A 1L6JA 4NZ4A 2HWJA 3CF6E 2DHRA 2RGHA 3SYKA 1KYIA 3THGA 4QOSA 3TE6A 1C7YA 2JY6B 3FRIA 1L2DA 2B3TA 1GABA 3A45A 2XFTA 4R3DA 3QAUA 3FTEA 4OJLA 4HMDA 4FWGA 3GLHE 4B7GA 1IXSA 2JE5A 4IIWA 1E32A 2O01F 1RU3A 3TWMA 4MB7A 2UWXA 1XB2B 2Y2NA 1P3QQ 1QAMA 1HQYE 3UJNA 4QOZC 3GRVA 2WSFF 2CV2A 3B89A 4WW0A 3PNYA 4FD2A 1HNZM 1WHCA 4REZA 2F5QA 4TX8A 2EUCA 2R18A 3ZH9B 3U6MA 1BVSA 1VEGA 4QNMA 1J7KA 2JZ0A 2MGWA 2DI0A 2CE7A 3HJQA 3SAVA 2Y2GA 1QO6A 3V76A 8CATA 3KOWE 1KSFX 2C98A 3CF0A 2FOIC 1G4AE 1GL6A 3F92A 3J80S 3HJSA 4JI1M 3HHYA 2CHGA 2DWZB 5EP3A 3TPZA 4I81A 3KVWA 2V1UA 4LGYA 1PJTA 4L6V6 3GLGE 1Q39A 5KQ8A 1YU4A 4MB5A 5JI2E 2FE8A 2ZANA 1VQ1A 1OIZA 3FUWA 1W5SA 3W0LB 3AL0C 1SXJA 2CP8A 2OQ4A 3WD3A 2HHHM 1L2CA 3WHLA 1ZMUA 3GLGB 4IJEA 4LFBM 1L1TA 4Z2GA 2DZLA 1QDTA 2LWXA 3K8ZA 3K2LA 4NSRA 2Y2KA 1TH4A 2VIIA 1IY1A 3BXWA 1FNNA 2KXEA 3A98B 3KDSE 3J2PB 4XBOA 1GJSA 4NRWA 1VG5A 2GNOA 5ITXE 1X37A 4OW0A 1HNWM 3B7ZA
chains in the Genus database with same CATH topology
3DA1A 3AKZA 2Y2QA 3FUXA 3SFZA 1IBKM 1IXZA 4IBBA 2HCBA 2J7OA 3U6PA 1SXJB 4DV2M 4B08A 1S3SA 1QAQA 1DO2A 1L8QA 5EP1A 1VDDA 2G5GX 5EJCA 5EXPA 4ITQA 5KQDA 5LMNM 3RGSA 3A42A 3U6QA 3B9PA 3LQQA 4GRIA 3RE8A 3KS4A 2KA6B 1SXJD 4QNRA 4LRSA 4DR3M 2F5OA 1IN4A 3M0EA 1FJGM 3M6AA 4GHAA 5FSWA 3VDUA 2CV1A 3KOXE 2X8AA 2L09A 2Q2EB 3ZC7B 4NRVA 2XZUA 3I4VA 2JCHA 3SHGB 1ORYB 1H6UA 2QBYA 4QNLA 1NNUC 1XXHA 4AI6A 3VK7A 2Z3XA 4XGIA 4LZJA 3WX7A 2X4AA 5EXXA 1E94E 4ZPXA 4GHLA 4AKGA 4M9SA 2VQEM 2IOUA 4JI8M 2EA0A 3MJ5A 1QANA 4BLCA 1ZQ9A 2LH0A 4DV5M 4JI5M 2XLJA 1D2NA 1NJGA 3MK6A 1R6BX 4NOOB 1HNXM 2F5SA 1XWIA 2BJVA 4NY2A 1IN7A 1HT2E 4LY6A 1ZAEA 4FWDA 1NHWC 1KFVA 1IXRC 4PD2A 4D80A 1XXHB 3FUTA 4CHTB 3HHZA 3CF2A 3IG8A 4DR1M 3TQSA 3J7BA 4YHHM 4DR2M 1Q3CA 3OTOM 1XC8A 2CFOA 3LVVA 4RNAA 1PM5A 3NWLA 2ZAOA 1QAOA 1Z6TA 5IREB 4AG6A 1NVMA 4FCTA 3UGJA 2R4EA 3A46A 1K3XA 4NXMM 3KSJA 4G4QA 4L15A 4JI7M 1IN5A 2J7NA 1E9RA 2BJWA 2D7EA 2QZ4A 5KPZA 4AQYM 4JV5M 3RFWA 1Z59A 1Z5AA 4MM3B 4MGZE 4DR5M 4A3VB 4IBKA 3FTCA 2DWNA 4CISA 5IT9S 4MGIE 4X66M 2R65A 1YSYA 1R2ZA 4B3RM 2LNHC 4IJFA 1NY6A 3EIEA 2C9CA 4MGKE 3U61A 4KHPM 1IBLM 1OFIA 1DGHB 2K47A 4NXNM 2YFQA 2X49A 4M0WA 2DZNB 1IY2A 4B3TM 2FFFB 4KO8A 5E26A 2HKJA 3SMSA 4NZ5A 4OVZA 4HLQA 2UXCM 1K3WA 4JI2M 3CTWB 5BR8M 5ITTA 4LF4M 4OJOA 3W0FA 2XF3A 1IN6A 4RF1A 2OPFA 5ITQA 4OU7A 1OJLA 3U6SA 3H4MA 3FD9A 3GRUA 4OUIA 3E9SA 4KODA 3HHXA 4LF9M 4OX9M 3R9XB 2Y2OA 3LQRA 3BOSA 1N34M 2ZAMA 1JR3A 1IXSB 4JN6A 3PXGA 3U61B 3R8FA 2UUAM 1YU1A 2QCUA 4YY3M 3SATA 3I4YA 2YR0A 2DXIA 2UXBM 2Y2PA 2R45A 4DV6M 4X64M 3J7AS 3KOYE 4GKJM 2L6OA 4GC5A 3TWKA 5ITRA 3GP1A 1TH2A 3AOEC 1MU5A 3HU2A 3PVSA 4NZ4A 4LJ4A 4DR4M 1IN8A 3MHVC 4WURA 3KW6A 5IZ7D 4DUZM 2DWMA 1PJIA 4LJ5A 4NL4H 1SXJE 7CATA 3GPUA 2FFJA 3FTDA 4IBDA 4I8OA 3FYDA 2ERCA 1Z5BA 2DVWB 2C5RA 1QQWA 2XSZA 5E6JA 3U6OA 1HR0M 4GH9A 3E4RA 3D8BA 1YUEA 2QP9X 3FUVA 1I94M 4M0DA 3SAWA 3L29A 3GQ5A 2F4VM 1J5EM 3L27A 4BB9A 3JAMS 1N33M 3AFHA 1XMQM 1JR3D 1HT1E 5KPRA 1NSFA 2CV0A 2CUZA 1HQCA 2UU9M 4QHSA 3VFDA 5F3WA 3L2AA 2XZFA 4TUWA 1MX0A 4PDGA 4DR6M 1QZMA 4JYAM 2Z4SA 3SC3A 1N75A 2M60A 3L25A 3JR4A 5LMUM 1J09A 2YQZA 4OJ6A 4X65M 2H1RA 3TWLA 1GL7A 2NQ8C 4RF0A 4JI3M 3U6DA 4HL4A 3UK6A 3N3FA 3K92A 1C1KA 3U6LA 5C18A 2KRUA 1N77A 4LJ9A 2LXEA 4DR7M 3U5ZA 1K82A 4S12A 5DYGA 3U6CA 4LJAA 3QWLA 3J81S 2A5YB 3GQ4A 4NSOB 1TH3A 3AV0A 1YU3A 2O5RA 3T15A 3RGPA 2QBYB 1W5TA 1N32M 4FCVA 4FWHA 3J27B 4FCWA 5IWAM 3SBJA 2C99A 1L2BA 5C1BA 3L26A 2UXDM 3DZDA 4IBIA 4JI6M 4LJ8A 3U6EA 3VKGA 4JI4M 4LFCM 4MH0E 2F5PA 2DWLA 1T3TA 1JQJC 4B7HA 4L8RC 2V6ZM 4I4LA 5EXSA 2EO2A 5EP4A 3U5ZB 4DV7M 4MGYE 4NZ1A 4I5SA 3U60A 3VKHA 1Z5CA 3K1JA 4B7FA 2Z7JA 2XFSA 2Y0QA 1XMOM 3DOAA 3GRYA 3GLHA 1NJFA 2L7HA 4P16A 3UZUA 4X62M 1IBMM 2Y0TA 2RGOA 1EE8A 2XGNA 3IG5A 4L4UA 3JR5A 1XNRM 2R4JA 1TDZA 1TGUA 4PT5A 2F5NA 4L16A 4LJ6A 5ITUA 3GPXA 3KXEC 5FTJA 2AHMA 3HHWA 5KO3A 4NZ3A 5FLXS 3GQ3A 1XHBA 1L2DA 1YUBA 3WHKA 2YNMD 5H37D 1G8PA 3KP1E 3HWSA 2JA2A 3U60B 4W5WA 3T38A 1QVRA 4DV1M 2I7NA 3GRRA 4LF6M 3GLGA 1N36M 4FW9A 2XH9A 2R46A 3VK8A 4NYUA 2KEBA 3GLHB 2XD1A 5JI3E 3KSXA 2UUBM 4AZFA 4QHTA 2Z4RA 2D7GA 4DV0M 4LJ7A 4D81A 3D8LA 4OVZB 2ZBKB 4L78A 4NYYA 2M5ZA 1DGGA 2HL7A 5EQTA 1G59A 1SXJC 3DFZA 2R62A 3M7GA 4GITA 4IBEA 5ITXA 2FNAA 3AOEA 2Y20A 2C96A 3AJIB 2ZM6M 3L28A 3SHFA 3PFIA 4BBAA 4G4OA 3TL4X 4GKKM 4LFAM 4JI0M 3KP0E 4GMQA 5DNYA 1YU0A 3SASA 4K0KM 2G8LA 4B3SM 4DV3M 5EXTA 3FYCA 3GPPA 2Y2JA 4GIPA 4LG2A 2C9OA 5GKNA 3LVWA 2VQFM 2CHVA 1GKIA 2V1CA 3VLFB 1WXQA 4IBFA 3AOGA 4LF8M 5FTMA 2D7HA 5EP2A 5FTNA 3SMPA 1YE9A 4DUYM 2Y2KA 1NNJA 3FTFA 4LF5M 1XNQM 3ZCBB 3HSHA 2RKOA 1DGBA 4JXJA 1IM2A 4AG5A 3HJ8A 3HGIA 3ILKA 4Z8XA 2Y2MA 2QENA 3KS8A 4D82A 3T1HM 1G41A 3EIHA 2XSZD 1YU2A 3HU3A 3UMMA 3GLFA 4AKIA 4LCBA 4R7GA 1LV7A 4CGYB 2E5LM 1PJJA 4M9ZA 3T1YM 4B3MM 1DO0A 2Y2LA 1UM8A 5A2QS 3NBIA 1NY5A 4PCZA 3GLIA 3HU1A 1L1ZA 4OJ5A 2KZSA 3GPYA 2KZUA 2CEAA 4GC9A 3SARA 4IBJA 1GVNA 4LZZA 1R2YA 1IQPA 2Y2HA 4G4RA 1TDHA 4EIWA 1IY0A 1DGFA 4G6ZA 2BNKA 2I7PA 2P5TA 4OJPA 4II7A 1Q3BA 2UUCM 4IBGA 4LRTA 3HKPA 5ITYA 4LGMA 4MGHA 4M9XA 5KPTA 2L7IA 3FKEA 3SYLA 3GLFB 3KFUG 2XEPA 5FTKA 3HONA 3C58A 4IBCA 2QPAA 1QYRA 2Y21A 1I4WA 4LF7M 3GLIB 1R7RA 2W82A 3I51A 3GO8A 2Y2IA 1OFHA 3KOZE 1E9SA 1G3IA 1DGHA 3Q8XA 3LMMA 4Z6YA 4FVMA 1NHGC 1GLNA 4KLNA 3VDPA 2KRKA 3FUUA 2KW0A 2XD5A 5FTLA 3SAUA 2DZOB 4PDIA 2CHQA 2BG1A 1N78A 5BPVA 4AKHA 4G4NA 3PNVA 5DYIA 4AW4A 3CF6E 3SYKA 2DHRA 2RGHA 1KYIA 3THGA 4QOSA 3TE6A 3A45A 2XFTA 4R3DA 3QAUA 3FTEA 4OJLA 4FWGA 4B7GA 2JE5A 4IIWA 1E32A 3TWMA 4MB7A 2UWXA 2Y2NA 1QAMA 1HQYE 3UJNA 4QOZC 3GRVA 2CV2A 4WW0A 3PNYA 4FD2A 1HNZM 4REZA 2F5QA 2EUCA 2R18A 3ZH9B 3U6MA 4QNMA 1J7KA 2Y2GA 2CE7A 3HJQA 3SAVA 8CATA 3KOWE 1KSFX 2C98A 3CF0A 2FOIC 1G4AE 1GL6A 3J80S 4JI1M 3HJSA 3HHYA 2CHGA 2DWZB 5EP3A 3TPZA 4I81A 3KVWA 2V1UA 4LGYA 1Q39A 5KQ8A 1YU4A 5JI2E 2FE8A 2ZANA 3FUWA 3W0LB 3AL0C 1W5SA 1SXJA 2OQ4A 1L2CA 3WHLA 3GLGB 4IJEA 4LFBM 1L1TA 2LWXA 3K8ZA 3K2LA 4NSRA 1TH4A 2VIIA 1IY1A 1FNNA 2KXEA 3A98B 3KDSE 3J2PB 4XBOA 4NRWA 5ITXE 4DV4M 1X37A 4OW0A 1HNWM 2HHHM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKE A;  4IBK A;  4IBC A;  4IBE A;  4IBD A;  4IBF A;  3L2A A;  3L28 A;  4IBB A;  4IJF A;  4IBJ A;  4GH9 A;  4GHL A;  4IJE A;  3L25 A;  3L26 A;  4IBI A;  3L29 A;  3L27 A;  3KS4 A;  3KS8 A;  5BPV A;  4IBG A;  4GHA A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 3B7N A;  3DA1 A;  1WR1 B;  4R71 A;  3AKZ A;  2Y2Q A;  2JXN A;  1GJT A;  3FUX A;  1E6N A;  1NO1 A;  1H0I A;  3SFZ A;  1IBK M;  1IXZ A;  4IBB A;  2HCB A;  1DV0 A;  2J7O A;  3U6P A;  1SXJ B;  4DV2 M;  4B08 A;  1S3S A;  1OKS A;  1DO2 A;  1QAQ A;  1L8Q A;  5EP1 A;  1VDD A;  2G5G X;  2WZJ A;  5EJC A;  5EXP A;  4ITQ A;  5KQD A;  1YLA A;  1UR9 A;  1MN3 A;  3RGS A;  2DAI A;  5LMN M;  3B74 A;  1PRB A;  1ZMW A;  3A42 A;  3U6Q A;  3W68 A;  3B9P A;  3LQQ A;  4GRI A;  3RE8 A;  1H0G A;  3KS4 A;  2KA6 B;  1SXJ D;  1QDR A;  2L4E A;  2O25 A;  4LRS A;  1IN4 A;  2DAG A;  1G71 A;  3M0E A;  4QNR A;  4DR3 M;  2F5O A;  3M6A A;  1D0L A;  5FSW A;  1FJG M;  4GHA A;  2JP7 A;  2R44 A;  2VDB B;  3VDU A;  2CV1 A;  4F1I A;  3KOX E;  2X8A A;  2L09 A;  2Q2E B;  3ZC7 B;  4NRV A;  2XZU A;  3I4V A;  2JCH A;  3NBX X;  3SHG B;  1MJG M;  1H6U A;  1ORY B;  2QBY A;  4QNL A;  2J5Y A;  1E6Z A;  4Z2I A;  1NNU C;  1XXH A;  2LVA A;  4AI6 A;  2RTS A;  1T6O A;  2Z3X A;  3VK7 A;  4XGI A;  4LZJ A;  4Y28 F;  3WX7 A;  2X4A A;  5EXX A;  1E94 E;  4ZPX A;  4GHL A;  4AKG A;  2BWB A;  4M9S A;  2VQE M;  2IOU A;  4CJ6 A;  2EA0 A;  3MJ5 A;  4JI8 M;  1ED7 A;  1QAN A;  4MB4 A;  4BLC A;  1ZQ9 A;  2LH0 A;  3GLF E;  4DV5 M;  4JI5 M;  2EJS A;  2XLJ A;  1D2N A;  1NJG A;  3MK6 A;  2R6F A;  1R6B X;  4NOO B;  3GLI E;  1TTE A;  1HNX M;  3E46 A;  2D49 A;  1D0M A;  2F5S A;  1XWI A;  2BJV A;  4NY2 A;  1IN7 A;  1HT2 E;  1O6I A;  4LY6 A;  1ZAE A;  1H8P A;  4FWD A;  1NHW C;  1KFV A;  1IXR C;  4PD2 A;  4D80 A;  3WD0 A;  1XXH B;  2FN2 A;  3FUT A;  1EFU B;  1VEK A;  2L2D A;  4CHT B;  1WGN A;  3HHZ A;  3CF2 A;  3IG8 A;  4DR1 M;  3TQS A;  3J7B A;  4YHH M;  2ZTD A;  4DR2 M;  1Q3C A;  3OTO M;  1XC8 A;  2CFO A;  3LVV A;  4RNA A;  1PM5 A;  3NWL A;  2ZAO A;  1QAO A;  1Z6T A;  5IRE B;  4AG6 A;  1NVM A;  4FCT A;  3UGJ A;  2R4E A;  3A46 A;  1K3X A;  4NXM M;  3KSJ A;  1E88 A;  1QUT A;  4G4Q A;  4L15 A;  4JI7 M;  1IN5 A;  2J7N A;  1E9R A;  2BJW A;  2D7E A;  2QZ4 A;  5KPZ A;  4AQY M;  4JV5 M;  3RFW A;  1Z59 A;  1Z5A A;  4MM3 B;  4MGZ E;  4DR5 M;  4A3V B;  4IBK A;  3FTC A;  2DWN A;  4CIS A;  5IT9 S;  4MGI E;  4X66 M;  2R65 A;  1YSY A;  4P17 A;  1R2Z A;  4B3R M;  2LNH C;  3LCU A;  1PDC A;  4IJF A;  1NY6 A;  3EIE A;  1HJP A;  2C9C A;  4MGK E;  3U61 A;  1IBL M;  4KHP M;  1QUS A;  1OFI A;  1DGH B;  2K47 A;  4NXN M;  2YFQ A;  1LTM A;  2X49 A;  4M0W A;  2DZN B;  1IY2 A;  2MJ5 B;  4B3T M;  2FFF B;  2KNV A;  4KO8 A;  5E26 A;  2HKJ A;  3SMS A;  4NZ5 A;  4OVZ A;  1E15 A;  2N35 A;  4HLQ A;  2UXC M;  1K3W A;  4JI2 M;  1UFZ A;  3CTW B;  2RRU A;  2VF8 A;  2WSC F;  5ITT A;  5BR8 M;  1D0K A;  4LF4 M;  4OJO A;  3W0F A;  1ZMV A;  3C9P A;  2XF3 A;  5L8R F;  1IN6 A;  4RF1 A;  2OPF A;  5ITQ A;  4OU7 A;  1OJL A;  3U6S A;  3H4M A;  3FD9 A;  2JZ1 A;  3GRU A;  4OUI A;  3E9S A;  4KOD A;  3HHX A;  4LF9 M;  4OX9 M;  3R9X B;  2Y2O A;  3LQR A;  2ZTC A;  3BOS A;  1N34 M;  2KNZ A;  1JR3 A;  1IXS B;  2ZAM A;  4JN6 A;  3PXG A;  3U61 B;  3R8F A;  2UUA M;  2QCU A;  1YU1 A;  1T43 A;  4YY3 M;  3SAT A;  3I4Y A;  1EAK A;  2APL A;  2LBC A;  2YR0 A;  2DXI A;  2UXB M;  1EIJ A;  1AUA A;  2R45 A;  4DV6 M;  4X64 M;  3J7A S;  3KOY E;  4GKJ M;  2Y2P A;  2L6O A;  4GC5 A;  3TWK A;  5ITR A;  1OGG A;  3GP1 A;  2QSF X;  1TH2 A;  3AOE C;  1MU5 A;  3HU2 A;  3PVS A;  3T6P A;  4LJ4 A;  4DR4 M;  1IN8 A;  3MHV C;  3WD1 A;  4WUR A;  3KW6 A;  5IZ7 D;  2MR9 A;  4DUZ M;  2DWM A;  1PJI A;  4LJ5 A;  4NL4 H;  1SXJ E;  7CAT A;  3GPU A;  3H4J A;  2FFJ A;  3FTD A;  4IBD A;  4I8O A;  3FYD A;  2ERC A;  1Z5B A;  2DHY A;  2DVW B;  3Q8G A;  2C5R A;  3HZJ A;  1QQW A;  4RKU F;  2XSZ A;  1TR8 A;  2CRU A;  5E6J A;  3U6O A;  1HR0 M;  4GH9 A;  3E4R A;  3D8B A;  1YUE A;  2QP9 X;  1OIP A;  1E8B A;  3FUV A;  1I94 M;  1GO5 A;  4M0D A;  3SAW A;  3L29 A;  3GQ5 A;  3QYB A;  2F4V M;  3E21 A;  1J5E M;  2LVP C;  3L27 A;  4BB9 A;  3JAM S;  1N33 M;  3AFH A;  1XMQ M;  1JR3 D;  1HT1 E;  3HX3 A;  1WGL A;  2LTU A;  5KPR A;  1NSF A;  2CV0 A;  2CUZ A;  2DAM A;  3C3E A;  1HQC A;  1PJQ A;  4F2L A;  4QHS A;  3VFD A;  5F3W A;  2UU9 M;  3L2A A;  2XZF A;  4TUW A;  1MX0 A;  2CWB A;  4PDG A;  1W1Y A;  4DR6 M;  1NV9 A;  1QZM A;  4JYA M;  4XK8 F;  2Z4S A;  3SC3 A;  1N75 A;  2M60 A;  3L25 A;  3JR4 A;  5LMU M;  3WD2 A;  2K6B A;  1J09 A;  2YQZ A;  4CIZ A;  4X65 M;  4OJ6 A;  2H1R A;  3TWL A;  1GL7 A;  1OAO C;  2NQ8 C;  4RF0 A;  4JI3 M;  3U6D A;  4HL4 A;  3UK6 A;  3N3F A;  3C3D A;  3K92 A;  1C1K A;  3U6L A;  4Z2J A;  5C18 A;  2KRU A;  1AIW A;  3BBZ A;  1N77 A;  4LJ9 A;  2LXE A;  4DR7 M;  3IHP A;  1XXH E;  3U5Z A;  4S12 A;  1K82 A;  2JNH A;  1ZV1 A;  1A5T A;  5DYG A;  3U6C A;  4LJA A;  3QWL A;  3J81 S;  2A5Y B;  3GQ4 A;  4NSO B;  1TH3 A;  1Y8G A;  3AV0 A;  2KNA A;  2OOA A;  1YU3 A;  2O5R A;  3T15 A;  3RGP A;  2QBY B;  4Z2H A;  1W5T A;  1N32 M;  4FCV A;  4MB3 A;  4FWH A;  3J27 B;  4FCW A;  5IWA M;  2KDL A;  3SBJ A;  2C99 A;  1L2B A;  2LVQ D;  5C1B A;  3L26 A;  2UXD M;  3DZD A;  4IBI A;  2DKL A;  4JI6 M;  2G3Q A;  4LJ8 A;  3U6E A;  4JI4 M;  3LW5 F;  3VKG A;  4LFC M;  1VEJ A;  4MH0 E;  2F5P A;  1CXW A;  2DWL A;  1SG9 A;  2VF7 A;  1T3T A;  1JQJ C;  1CK7 A;  1V33 A;  4B7H A;  4L8R C;  2EKK A;  2V6Z M;  1WIV A;  4I4L A;  2EO2 A;  5EP4 A;  5EXS A;  4DV7 M;  3U5Z B;  4MGY E;  1W1V A;  3M7P A;  4NZ1 A;  4I5S A;  3U60 A;  3VKH A;  1Z5C A;  3K1J A;  4B7F A;  2Z7J A;  3LCV B;  2XFS A;  2Y0Q A;  1XMO M;  3DOA A;  3GRY A;  3GLH A;  1NJF A;  2L7H A;  4P16 A;  3UZU A;  4X62 M;  1IBM M;  2Y0T A;  2RGO A;  1QZE A;  2V5O A;  2BWE A;  1EE8 A;  2XGN A;  3IG5 A;  1W1T A;  1WJ7 A;  4L4U A;  3JR5 A;  1OGB A;  1XNR M;  2R4J A;  2QHO B;  1R5L A;  3W67 A;  1TDZ A;  1TGU A;  4PT5 A;  2F5N A;  4G3O A;  4L16 A;  4LJ6 A;  5ITU A;  3KXE C;  3GPX A;  5FTJ A;  2K0B X;  2AHM A;  3HHW A;  4KT0 F;  5KO3 A;  4NZ3 A;  5FLX S;  3GQ3 A;  1XHB A;  1NV8 A;  1YUB A;  4UN2 B;  3WHK A;  2JY8 A;  2YNM D;  2MH8 A;  1G8P A;  5H37 D;  3KP1 E;  3HWS A;  2JA2 A;  1F4I A;  3U60 B;  4W5W A;  3T38 A;  3K9O A;  1QVR A;  4DV1 M;  2I7N A;  3GRR A;  4LF6 M;  3GLG A;  1N36 M;  4FW9 A;  3WD4 A;  2XH9 A;  2R46 A;  3VK8 A;  4NYU A;  2KEB A;  2OO9 A;  3GLH B;  4DV4 M;  1GOI A;  5JI3 E;  2XD1 A;  3KSX A;  2UUB M;  4AZF A;  4QHT A;  2Z4R A;  2D7G A;  4DV0 M;  2LHC A;  4LJ7 A;  4D81 A;  3D8L A;  4OVZ B;  2ZBK B;  4L78 A;  4HMC A;  4NYY A;  2M5Z A;  1DGG A;  2HL7 A;  4Z2L A;  5EQT A;  2WSE F;  1G59 A;  1SXJ C;  3DFZ A;  2R62 A;  3M7G A;  1GPF A;  4GIT A;  2EKF A;  4IBE A;  5ITX A;  2QQ8 A;  2DEN A;  1JR3 E;  2FNA A;  3AOE A;  2Y20 A;  2Z8Y M;  2C96 A;  3AJI B;  3I04 M;  2ZM6 M;  3L28 A;  3SHF A;  3PFI A;  4BBA A;  1AIP C;  2DAK A;  4G4O A;  1PJS A;  3TL4 X;  1V34 A;  1R4G A;  4LFA M;  4JI0 M;  4GKK M;  2JUJ A;  3K9P A;  4Z2K A;  4NC6 A;  1JB0 F;  3KP0 E;  4GMQ A;  5DNY A;  1YU0 A;  1OTR A;  3SAS A;  4K0K M;  2G8L A;  4B3S M;  4DV3 M;  1UR8 A;  5EXT A;  3FYC A;  3GPP A;  2Y2J A;  1IFY A;  4GIP A;  4LG2 A;  2C9O A;  3CGW A;  3HY5 A;  2R0I A;  5GKN A;  3LVW A;  4GEW A;  2VQF M;  2CHV A;  1GKI A;  2V1C A;  3VLF B;  1WXQ A;  4IBF A;  3AOG A;  4Q7J A;  4LF8 M;  5FTM A;  2D7H A;  5EP2 A;  5FTN A;  3SMP A;  1PGY A;  1VDL A;  1YE9 A;  4DUY M;  1NNJ A;  4LF5 M;  1XNQ M;  3ZCB B;  3FTF A;  3HSH A;  1V92 A;  3FE3 A;  2RKO A;  1DGB A;  3B7Q A;  4JXJ A;  1IM2 A;  4AG5 A;  3HJ8 A;  3HGI A;  3ILK A;  4WP2 A;  4Z8X A;  2Y2M A;  2L4F A;  2QEN A;  2DNA A;  4DBG B;  2FS1 A;  3FRH A;  3KS8 A;  2LVN C;  4D82 A;  3T1H M;  1G41 A;  2DAE A;  2JWS A;  2XSZ D;  3EIH A;  1YU2 A;  3HU3 A;  1Q02 A;  3UMM A;  3I01 M;  3GLF A;  4LCB A;  4R7G A;  4AKI A;  1LV7 A;  1E6P A;  4CGY B;  2E5L M;  1PJJ A;  4M9Z A;  3T1Y M;  4B3M M;  2OOB A;  1DO0 A;  2Y2L A;  1UM8 A;  5A2Q S;  3NBI A;  1NY5 A;  4PCZ A;  3GLI A;  3HU1 A;  2H5X A;  1L1Z A;  2KHH A;  2KZS A;  3GPY A;  2KZU A;  2CEA A;  4GC9 A;  3SAR A;  4OJ5 A;  3MMP A;  1GVN A;  4IBJ A;  4LZZ A;  1IQP A;  1R2Y A;  2Y2H A;  2MRO B;  4G4R A;  3ZQJ A;  1TDH A;  1OQY A;  1CUK A;  4EIW A;  1IY0 A;  2FH0 A;  1DGF A;  4G6Z A;  1GXD A;  3QYE A;  2BNK A;  2I7P A;  2P5T A;  4OJP A;  4II7 A;  1Q3B A;  2JY5 A;  2UUC M;  2LVO C;  4IBG A;  4LRT A;  3HKP A;  5ITY A;  4LGM A;  4MGH A;  4M9X A;  5KPT A;  2QNJ A;  2L7I A;  3FKE A;  3SYL A;  3GLF B;  3KFU G;  2XEP A;  1J7M A;  5FTK A;  4ANR A;  3HON A;  3C58 A;  4IBC A;  2JY7 A;  2QPA A;  1QYR A;  2Y21 A;  1I4W A;  4HEO A;  4LF7 M;  3GLI B;  1R7R A;  2W82 A;  4HME A;  3I51 A;  3GO8 A;  2Y2I A;  1E6R A;  1OFH A;  3KOZ E;  1E9S A;  1G3I A;  1DGH A;  3Q8X A;  3LMM A;  4Z6Y A;  4FVM A;  1NHG C;  5DFL A;  1GLN A;  4KLN A;  3VDP A;  1W1P A;  2KRK A;  3FUU A;  2KW0 A;  2XD5 A;  1KS0 A;  1TF0 B;  2GQF A;  2HAK A;  2K9D A;  2DZO B;  5FTL A;  3SAU A;  4PDI A;  2CHQ A;  3IEC A;  2BG1 A;  1OAI A;  5BPV A;  1N78 A;  4AKH A;  2LHG A;  4G4N A;  3PNV A;  5DYI A;  3MQL A;  4AW4 A;  1L6J A;  4NZ4 A;  2HWJ A;  3CF6 E;  2DHR A;  2RGH A;  3SYK A;  1KYI A;  3THG A;  4QOS A;  3TE6 A;  1C7Y A;  2JY6 B;  3FRI A;  1L2D A;  2B3T A;  1GAB A;  3A45 A;  2XFT A;  4R3D A;  3QAU A;  3FTE A;  4OJL A;  4HMD A;  4FWG A;  3GLH E;  4B7G A;  1IXS A;  2JE5 A;  4IIW A;  1E32 A;  2O01 F;  1RU3 A;  3TWM A;  4MB7 A;  2UWX A;  1XB2 B;  2Y2N A;  1P3Q Q;  1QAM A;  1HQY E;  3UJN A;  4QOZ C;  3GRV A;  2WSF F;  2CV2 A;  3B89 A;  4WW0 A;  3PNY A;  4FD2 A;  1HNZ M;  1WHC A;  4REZ A;  2F5Q A;  4TX8 A;  2EUC A;  2R18 A;  3ZH9 B;  3U6M A;  1BVS A;  1VEG A;  4QNM A;  1J7K A;  2JZ0 A;  2MGW A;  2DI0 A;  2CE7 A;  3HJQ A;  3SAV A;  2Y2G A;  1QO6 A;  3V76 A;  8CAT A;  3KOW E;  1KSF X;  2C98 A;  3CF0 A;  2FOI C;  1G4A E;  1GL6 A;  3F92 A;  3J80 S;  3HJS A;  4JI1 M;  3HHY A;  2CHG A;  2DWZ B;  5EP3 A;  3TPZ A;  4I81 A;  3KVW A;  2V1U A;  4LGY A;  1PJT A;  4L6V 6;  3GLG E;  1Q39 A;  5KQ8 A;  1YU4 A;  4MB5 A;  5JI2 E;  2FE8 A;  2ZAN A;  1VQ1 A;  1OIZ A;  3FUW A;  1W5S A;  3W0L B;  3AL0 C;  1SXJ A;  2CP8 A;  2OQ4 A;  3WD3 A;  2HHH M;  1L2C A;  3WHL A;  1ZMU A;  3GLG B;  4IJE A;  4LFB M;  1L1T A;  4Z2G A;  2DZL A;  1QDT A;  2LWX A;  3K8Z A;  3K2L A;  4NSR A;  2Y2K A;  1TH4 A;  2VII A;  1IY1 A;  3BXW A;  1FNN A;  2KXE A;  3A98 B;  3KDS E;  3J2P B;  4XBO A;  1GJS A;  4NRW A;  1VG5 A;  2GNO A;  5ITX E;  1X37 A;  4OW0 A;  1HNW M;  3B7Z A; 
#chains in the Genus database with same CATH homology
 3DA1 A;  3AKZ A;  2Y2Q A;  3FUX A;  3SFZ A;  1IBK M;  1IXZ A;  4IBB A;  2HCB A;  2J7O A;  3U6P A;  1SXJ B;  4DV2 M;  4B08 A;  1S3S A;  1QAQ A;  1DO2 A;  1L8Q A;  5EP1 A;  1VDD A;  2G5G X;  5EJC A;  5EXP A;  4ITQ A;  5KQD A;  5LMN M;  3RGS A;  3A42 A;  3U6Q A;  3B9P A;  3LQQ A;  4GRI A;  3RE8 A;  3KS4 A;  2KA6 B;  1SXJ D;  4QNR A;  4LRS A;  4DR3 M;  2F5O A;  1IN4 A;  3M0E A;  1FJG M;  3M6A A;  4GHA A;  5FSW A;  3VDU A;  2CV1 A;  3KOX E;  2X8A A;  2L09 A;  2Q2E B;  3ZC7 B;  4NRV A;  2XZU A;  3I4V A;  2JCH A;  3SHG B;  1ORY B;  1H6U A;  2QBY A;  4QNL A;  1NNU C;  1XXH A;  4AI6 A;  3VK7 A;  2Z3X A;  4XGI A;  4LZJ A;  3WX7 A;  2X4A A;  5EXX A;  1E94 E;  4ZPX A;  4GHL A;  4AKG A;  4M9S A;  2VQE M;  2IOU A;  4JI8 M;  2EA0 A;  3MJ5 A;  1QAN A;  4BLC A;  1ZQ9 A;  2LH0 A;  4DV5 M;  4JI5 M;  2XLJ A;  1D2N A;  1NJG A;  3MK6 A;  1R6B X;  4NOO B;  1HNX M;  2F5S A;  1XWI A;  2BJV A;  4NY2 A;  1IN7 A;  1HT2 E;  4LY6 A;  1ZAE A;  4FWD A;  1NHW C;  1KFV A;  1IXR C;  4PD2 A;  4D80 A;  1XXH B;  3FUT A;  4CHT B;  3HHZ A;  3CF2 A;  3IG8 A;  4DR1 M;  3TQS A;  3J7B A;  4YHH M;  4DR2 M;  1Q3C A;  3OTO M;  1XC8 A;  2CFO A;  3LVV A;  4RNA A;  1PM5 A;  3NWL A;  2ZAO A;  1QAO A;  1Z6T A;  5IRE B;  4AG6 A;  1NVM A;  4FCT A;  3UGJ A;  2R4E A;  3A46 A;  1K3X A;  4NXM M;  3KSJ A;  4G4Q A;  4L15 A;  4JI7 M;  1IN5 A;  2J7N A;  1E9R A;  2BJW A;  2D7E A;  2QZ4 A;  5KPZ A;  4AQY M;  4JV5 M;  3RFW A;  1Z59 A;  1Z5A A;  4MM3 B;  4MGZ E;  4DR5 M;  4A3V B;  4IBK A;  3FTC A;  2DWN A;  4CIS A;  5IT9 S;  4MGI E;  4X66 M;  2R65 A;  1YSY A;  1R2Z A;  4B3R M;  2LNH C;  4IJF A;  1NY6 A;  3EIE A;  2C9C A;  4MGK E;  3U61 A;  4KHP M;  1IBL M;  1OFI A;  1DGH B;  2K47 A;  4NXN M;  2YFQ A;  2X49 A;  4M0W A;  2DZN B;  1IY2 A;  4B3T M;  2FFF B;  4KO8 A;  5E26 A;  2HKJ A;  3SMS A;  4NZ5 A;  4OVZ A;  4HLQ A;  2UXC M;  1K3W A;  4JI2 M;  3CTW B;  5BR8 M;  5ITT A;  4LF4 M;  4OJO A;  3W0F A;  2XF3 A;  1IN6 A;  4RF1 A;  2OPF A;  5ITQ A;  4OU7 A;  1OJL A;  3U6S A;  3H4M A;  3FD9 A;  3GRU A;  4OUI A;  3E9S A;  4KOD A;  3HHX A;  4LF9 M;  4OX9 M;  3R9X B;  2Y2O A;  3LQR A;  3BOS A;  1N34 M;  2ZAM A;  1JR3 A;  1IXS B;  4JN6 A;  3PXG A;  3U61 B;  3R8F A;  2UUA M;  1YU1 A;  2QCU A;  4YY3 M;  3SAT A;  3I4Y A;  2YR0 A;  2DXI A;  2UXB M;  2Y2P A;  2R45 A;  4DV6 M;  4X64 M;  3J7A S;  3KOY E;  4GKJ M;  2L6O A;  4GC5 A;  3TWK A;  5ITR A;  3GP1 A;  1TH2 A;  3AOE C;  1MU5 A;  3HU2 A;  3PVS A;  4NZ4 A;  4LJ4 A;  4DR4 M;  1IN8 A;  3MHV C;  4WUR A;  3KW6 A;  5IZ7 D;  4DUZ M;  2DWM A;  1PJI A;  4LJ5 A;  4NL4 H;  1SXJ E;  7CAT A;  3GPU A;  2FFJ A;  3FTD A;  4IBD A;  4I8O A;  3FYD A;  2ERC A;  1Z5B A;  2DVW B;  2C5R A;  1QQW A;  2XSZ A;  5E6J A;  3U6O A;  1HR0 M;  4GH9 A;  3E4R A;  3D8B A;  1YUE A;  2QP9 X;  3FUV A;  1I94 M;  4M0D A;  3SAW A;  3L29 A;  3GQ5 A;  2F4V M;  1J5E M;  3L27 A;  4BB9 A;  3JAM S;  1N33 M;  3AFH A;  1XMQ M;  1JR3 D;  1HT1 E;  5KPR A;  1NSF A;  2CV0 A;  2CUZ A;  1HQC A;  2UU9 M;  4QHS A;  3VFD A;  5F3W A;  3L2A A;  2XZF A;  4TUW A;  1MX0 A;  4PDG A;  4DR6 M;  1QZM A;  4JYA M;  2Z4S A;  3SC3 A;  1N75 A;  2M60 A;  3L25 A;  3JR4 A;  5LMU M;  1J09 A;  2YQZ A;  4OJ6 A;  4X65 M;  2H1R A;  3TWL A;  1GL7 A;  2NQ8 C;  4RF0 A;  4JI3 M;  3U6D A;  4HL4 A;  3UK6 A;  3N3F A;  3K92 A;  1C1K A;  3U6L A;  5C18 A;  2KRU A;  1N77 A;  4LJ9 A;  2LXE A;  4DR7 M;  3U5Z A;  1K82 A;  4S12 A;  5DYG A;  3U6C A;  4LJA A;  3QWL A;  3J81 S;  2A5Y B;  3GQ4 A;  4NSO B;  1TH3 A;  3AV0 A;  1YU3 A;  2O5R A;  3T15 A;  3RGP A;  2QBY B;  1W5T A;  1N32 M;  4FCV A;  4FWH A;  3J27 B;  4FCW A;  5IWA M;  3SBJ A;  2C99 A;  1L2B A;  5C1B A;  3L26 A;  2UXD M;  3DZD A;  4IBI A;  4JI6 M;  4LJ8 A;  3U6E A;  3VKG A;  4JI4 M;  4LFC M;  4MH0 E;  2F5P A;  2DWL A;  1T3T A;  1JQJ C;  4B7H A;  4L8R C;  2V6Z M;  4I4L A;  5EXS A;  2EO2 A;  5EP4 A;  3U5Z B;  4DV7 M;  4MGY E;  4NZ1 A;  4I5S A;  3U60 A;  3VKH A;  1Z5C A;  3K1J A;  4B7F A;  2Z7J A;  2XFS A;  2Y0Q A;  1XMO M;  3DOA A;  3GRY A;  3GLH A;  1NJF A;  2L7H A;  4P16 A;  3UZU A;  4X62 M;  1IBM M;  2Y0T A;  2RGO A;  1EE8 A;  2XGN A;  3IG5 A;  4L4U A;  3JR5 A;  1XNR M;  2R4J A;  1TDZ A;  1TGU A;  4PT5 A;  2F5N A;  4L16 A;  4LJ6 A;  5ITU A;  3GPX A;  3KXE C;  5FTJ A;  2AHM A;  3HHW A;  5KO3 A;  4NZ3 A;  5FLX S;  3GQ3 A;  1XHB A;  1L2D A;  1YUB A;  3WHK A;  2YNM D;  5H37 D;  1G8P A;  3KP1 E;  3HWS A;  2JA2 A;  3U60 B;  4W5W A;  3T38 A;  1QVR A;  4DV1 M;  2I7N A;  3GRR A;  4LF6 M;  3GLG A;  1N36 M;  4FW9 A;  2XH9 A;  2R46 A;  3VK8 A;  4NYU A;  2KEB A;  3GLH B;  2XD1 A;  5JI3 E;  3KSX A;  2UUB M;  4AZF A;  4QHT A;  2Z4R A;  2D7G A;  4DV0 M;  4LJ7 A;  4D81 A;  3D8L A;  4OVZ B;  2ZBK B;  4L78 A;  4NYY A;  2M5Z A;  1DGG A;  2HL7 A;  5EQT A;  1G59 A;  1SXJ C;  3DFZ A;  2R62 A;  3M7G A;  4GIT A;  4IBE A;  5ITX A;  2FNA A;  3AOE A;  2Y20 A;  2C96 A;  3AJI B;  2ZM6 M;  3L28 A;  3SHF A;  3PFI A;  4BBA A;  4G4O A;  3TL4 X;  4GKK M;  4LFA M;  4JI0 M;  3KP0 E;  4GMQ A;  5DNY A;  1YU0 A;  3SAS A;  4K0K M;  2G8L A;  4B3S M;  4DV3 M;  5EXT A;  3FYC A;  3GPP A;  2Y2J A;  4GIP A;  4LG2 A;  2C9O A;  5GKN A;  3LVW A;  2VQF M;  2CHV A;  1GKI A;  2V1C A;  3VLF B;  1WXQ A;  4IBF A;  3AOG A;  4LF8 M;  5FTM A;  2D7H A;  5EP2 A;  5FTN A;  3SMP A;  1YE9 A;  4DUY M;  2Y2K A;  1NNJ A;  3FTF A;  4LF5 M;  1XNQ M;  3ZCB B;  3HSH A;  2RKO A;  1DGB A;  4JXJ A;  1IM2 A;  4AG5 A;  3HJ8 A;  3HGI A;  3ILK A;  4Z8X A;  2Y2M A;  2QEN A;  3KS8 A;  4D82 A;  3T1H M;  1G41 A;  3EIH A;  2XSZ D;  1YU2 A;  3HU3 A;  3UMM A;  3GLF A;  4AKI A;  4LCB A;  4R7G A;  1LV7 A;  4CGY B;  2E5L M;  1PJJ A;  4M9Z A;  3T1Y M;  4B3M M;  1DO0 A;  2Y2L A;  1UM8 A;  5A2Q S;  3NBI A;  1NY5 A;  4PCZ A;  3GLI A;  3HU1 A;  1L1Z A;  4OJ5 A;  2KZS A;  3GPY A;  2KZU A;  2CEA A;  4GC9 A;  3SAR A;  4IBJ A;  1GVN A;  4LZZ A;  1R2Y A;  1IQP A;  2Y2H A;  4G4R A;  1TDH A;  4EIW A;  1IY0 A;  1DGF A;  4G6Z A;  2BNK A;  2I7P A;  2P5T A;  4OJP A;  4II7 A;  1Q3B A;  2UUC M;  4IBG A;  4LRT A;  3HKP A;  5ITY A;  4LGM A;  4MGH A;  4M9X A;  5KPT A;  2L7I A;  3FKE A;  3SYL A;  3GLF B;  3KFU G;  2XEP A;  5FTK A;  3HON A;  3C58 A;  4IBC A;  2QPA A;  1QYR A;  2Y21 A;  1I4W A;  4LF7 M;  3GLI B;  1R7R A;  2W82 A;  3I51 A;  3GO8 A;  2Y2I A;  1OFH A;  3KOZ E;  1E9S A;  1G3I A;  1DGH A;  3Q8X A;  3LMM A;  4Z6Y A;  4FVM A;  1NHG C;  1GLN A;  4KLN A;  3VDP A;  2KRK A;  3FUU A;  2KW0 A;  2XD5 A;  5FTL A;  3SAU A;  2DZO B;  4PDI A;  2CHQ A;  2BG1 A;  1N78 A;  5BPV A;  4AKH A;  4G4N A;  3PNV A;  5DYI A;  4AW4 A;  3CF6 E;  3SYK A;  2DHR A;  2RGH A;  1KYI A;  3THG A;  4QOS A;  3TE6 A;  3A45 A;  2XFT A;  4R3D A;  3QAU A;  3FTE A;  4OJL A;  4FWG A;  4B7G A;  2JE5 A;  4IIW A;  1E32 A;  3TWM A;  4MB7 A;  2UWX A;  2Y2N A;  1QAM A;  1HQY E;  3UJN A;  4QOZ C;  3GRV A;  2CV2 A;  4WW0 A;  3PNY A;  4FD2 A;  1HNZ M;  4REZ A;  2F5Q A;  2EUC A;  2R18 A;  3ZH9 B;  3U6M A;  4QNM A;  1J7K A;  2Y2G A;  2CE7 A;  3HJQ A;  3SAV A;  8CAT A;  3KOW E;  1KSF X;  2C98 A;  3CF0 A;  2FOI C;  1G4A E;  1GL6 A;  3J80 S;  4JI1 M;  3HJS A;  3HHY A;  2CHG A;  2DWZ B;  5EP3 A;  3TPZ A;  4I81 A;  3KVW A;  2V1U A;  4LGY A;  1Q39 A;  5KQ8 A;  1YU4 A;  5JI2 E;  2FE8 A;  2ZAN A;  3FUW A;  3W0L B;  3AL0 C;  1W5S A;  1SXJ A;  2OQ4 A;  1L2C A;  3WHL A;  3GLG B;  4IJE A;  4LFB M;  1L1T A;  2LWX A;  3K8Z A;  3K2L A;  4NSR A;  1TH4 A;  2VII A;  1IY1 A;  1FNN A;  2KXE A;  3A98 B;  3KDS E;  3J2P B;  4XBO A;  4NRW A;  5ITX E;  4DV4 M;  1X37 A;  4OW0 A;  1HNW M;  2HHH M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...