3L27A

Crystal structure of zaire ebola vp35 interferon inhibitory domain r312a mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 40
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l27A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l27A02
4LG2A 4GHAA 4GHLA 3KS8A 4IBDA 4IBBA 3FKEA 3L26A 3L27A 3KS4A 4IJEA 4GH9A 4IBGA 4IJFA 3L29A 4IBEA 4IBCA 4IBKA 4IBIA 4IBFA 3L28A 3L25A 5BPVA 4IBJA 3L2AA
chains in the Genus database with same CATH superfamily
2Y2MA 1Z5BA 4R7GA 2F5OA 2KEBA 2DZOB 4A3VB 4II7A 3HWSA 4JXJA 3W68A 5ITRA 1PJJA 3IG8A 1QO6A 2Y2QA 5FLXS 3LCUA 2G5GX 3B7ZA 4MM3B 4CGYB 3WD2A 1ORYB 4HMDA 3J80S 1VDDA 3KSXA 3LCVB 1GXDA 4Z2KA 1EFUB 3NBIA 4DBGB 5FSWA 4M0DA 2AHMA 2LWXA 5KQDA 1L2CA 2WSCF 1XXHB 3QYEA 4LF6M 1HT2E 4IBGA 3HU2A 3A46A 4LF5M 3GPPA 3GQ3A 4G4OA 5EXPA 1IQPA 4GC9A 4GMQA 1MU5A 1QUTA 3CF6E 4IBFA 2K0BX 2F5PA 1E15A 3B9PA 3DFZA 5C18A 2YR0A 4P16A 1NY6A 3GRRA 4FD2A 2JUJA 3GP1A 2Z4RA 3W0FA 5ITUA 1XB2B 2C9OA 3DOAA 2Q2EB 2RGOA 2XZFA 1IFYA 1N34M 2QZ4A 3U6LA 4FWDA 4OUIA 1QYRA 1DV0A 2IOUA 5L8RF 2E5LM 3VDUA 2LVNC 2CHQA 3T15A 1OKSA 1IM2A 1XXHE 2K6BA 3VK7A 4KT0F 3E4RA 4AZFA 5ITYA 4JV5M 3U6OA 3FD9A 1WGNA 1ZQ9A 3FTDA 2F5QA 1S3SA 3KOWE 2CV0A 5E26A 1V92A 3SMSA 2ZTCA 4LGMA 2J5YA 5IWAM 3IECA 4DV0M 1IBLM 4AKHA 2N35A 3QAUA 2L2DA 1DGBA 3TWLA 1QDTA 3WHLA 2BG1A 3WD4A 4GITA 4DR5M 3A98B 1AUAA 4RF0A 5E6JA 5EP2A 1J09A 2ZBKB 4KO8A 1YUBA 5DFLA 1Z5CA 5FTKA 4LFAM 1XC8A 4NZ1A 3DZDA 3VDPA 1E6RA 1TH2A 4OJLA 3HJSA 1YSYA 3FKEA 3K2LA 1OTRA 4RKUF 3HU1A 1I4WA 5EJCA 5DYIA 2Z4SA 1HNXM 1ZMWA 4PT5A 4GKKM 1G8PA 1OJLA 3C3DA 3FUXA 3SMPA 3UZUA 1QAMA 2R4JA 3GLHA 2ZM6M 1HQYE 1IY1A 2Y21A 1L2DA 4B3RM 1WHCA 4G4NA 1QAQA 2L7HA 2ERCA 2UUAM 2KHHA 3WD1A 3KP1E 4IBJA 2QP9X 2I7NA 2QBYB 2DXIA 3GO8A 1WR1B 2HCBA 4QNMA 3SAUA 1WXQA 1XWIA 2G3QA 3E46A 1TTEA 3U6MA 2QHOB 4QOSA 1GLNA 3VKGA 2XFTA 3GRVA 2R45A 4ZPXA 3FTFA 2LVAA 2R46A 2DKLA 1XXHA 3SYKA 1NJFA 3AFHA 1R7RA 4ANRA 3GLFE 2LNHC 1GJTA 4AQYM 1N77A 1FNNA 2EA0A 4HLQA 3KOYE 4IBEA 5BR8M 3U6DA 2MH8A 4F2LA 2FFFB 1NHGC 1PJTA 3I4YA 1IXZA 4R3DA 4Z8XA 3GLIE 2DAMA 3KFUG 2LVQD 4GIPA 3EIHA 5FTMA 2HHHM 4OX9M 1ZMVA 4DR7M 4GHAA 2R6FA 3J27B 3LQRA 3D8LA 4QHSA 1GJSA 4MB3A 2OPFA 2C5RA 2KNZA 1IY2A 4Z2LA 4BB9A 3KOZE 2XZUA 5FTJA 4NOOB 2Y2KA 3MQLA 1KS0A 1MN3A 2L4EA 4OU7A 3I51A 4NYUA 1NHWC 3GPXA 3N3FA 3GLFB 2V1CA 1GOIA 3U6QA 1YUEA 4HL4A 3KS4A 3GPUA 4Z2HA 1RU3A 2LTUA 1W5SA 1N36M 3GRYA 2C9CA 2V6ZM 3HHYA 5IT9S 3C58A 1SXJA 2KXEA 3PFIA 3SAVA 3J7AS 1HJPA 4X66M 4OJ6A 5GKNA 1Z5AA 4CISA 1E9RA 3U61A 3U60B 3HHXA 3T1HM 1SG9A 5KPTA 2QNJA 3FUTA 1K3WA 5C1BA 1R6BX 4LF7M 2C96A 3PNVA 3AKZA 2CFOA 2JY8A 2RGHA 4FW9A 4DV4M 1TF0B 1HNWM 4JI1M 1D0KA 4NSOB 4I81A 2DVWB 4IBBA 3IG5A 3CTWB 4RNAA 5KPRA 3GQ5A 5FTNA 5FTLA 2KZUA 1AIPC 2OO9A 2LHCA 4QHTA 2H1RA 3KDSE 3HONA 2XLJA 1V34A 2X4AA 1OAOC 4LZZA 3RGSA 1Q3CA 4OVZA 4IJFA 2K47A 2EKKA 2JCHA 2HWJA 4LRTA 5KO3A 1IN5A 1X37A 4AW4A 1WGLA 4KHPM 3FUVA 1VEGA 1GPFA 3ZQJA 4LJ5A 3R8FA 4NRWA 3FYCA 3JR4A 4UN2B 3FTEA 3I01M 4NXMM 1W1YA 3WX7A 1L1ZA 3B89A 3BOSA 4LF4M 4NL4H 1IN8A 3FRHA 3U6CA 4JI2M 3PXGA 2DHRA 2XD1A 2M60A 1L8QA 1P3QQ 1QZMA 1SXJD 2DAKA 2R62A 3KVWA 2DENA 3MK6A 4IBDA 2MROB 3K9OA 1L1TA 1GL6A 2RTSA 2LH0A 3U5ZA 1OIPA 4XGIA 3L27A 3VLFB 1GKIA 2XH9A 4D80A 2Y2NA 2Y2GA 4OJ5A 1VQ1A 2D7HA 2XD5A 1TDZA 4FCVA 4FCWA 2KRUA 3IHPA 4HMCA 4I4LA 1TDHA 4DR3M 4B7GA 2EO2A 4YY3M 2CV2A 1UR8A 1NVMA 1PJIA 1JB0F 4PCZA 1HR0M 1XHBA 3L25A 2DWLA 4DV7M 2Z7JA 3L2AA 2EUCA 2VF8A 4I8OA 2O25A 2QCUA 4NSRA 3R9XB 2Y2HA 1LTMA 2I7PA 2L7IA 3HKPA 4REZA 3F92A 1Q39A 2Z3XA 1IN4A 8CATA 2NQ8C 2F5SA 5EP3A 1R5LA 1JR3D 3SHGB 4AKIA 1EAKA 2LVPC 3HY5A 4Y28F 1QANA 3GLGB 3GRUA 3NWLA 4RF1A 4Q7JA 2OOAA 2WSEF 4B7FA 4QOZC 2O5RA 2VF7A 1E94E 3U6PA 1E9SA 4DV1M 2W82A 1IBMM 1YU3A 5EXXA 1YU1A 2KRKA 1SXJB 4AG6A 4D81A 3Q8XA 2X8AA 4MH0E 1CXWA 4IIWA 3AV0A 2FH0A 2D7GA 2C99A 2Y2PA 2Y2LA 1PM5A 2F5NA 1ZMUA 2JNHA 1K3XA 2UXDM 4JI7M 3GQ4A 2CHGA 2Z8YM 4AG5A 4NY2A 1NNJA 1D0MA 2FS1A 4M9XA 1NO1A 1C7YA 4MB4A 4HMEA 3LMMA 1E88A 3FUWA 3HZJA 1HT1E 3HJ8A 4IJEA 3ZC7B 3J7BA 2BWBA 1IXRC 2DZLA 4NXNM 2D49A 4ITQA 2UUCM 3BXWA 1IY0A 4G3OA 3D8BA 2CP8A 4NZ3A 2MR9A 3FUUA 2KW0A 2LHGA 3B7QA 4IBIA 2DHYA 5EQTA 4R71A 3GPYA 1TH4A 2UXBM 2APLA 1NV8A 1OQYA 1UR9A 2DNAA 4MB7A 3H4MA 1XNQM 4Z2GA 4XK8F 4S12A 4D82A 3ZH9B 4HEOA 3VK8A 2FE8A 4LF9M 2UXCM 1IN6A 1GL7A 1VEJA 4CIZA 2EJSA 2WZJA 2YFQA 3GLHE 4FCTA 3HSHA 2L4FA 2YQZA 1IXSA 1N78A 2ZAOA 4LJ4A 4OJOA 2H5XA 4CHTB 3KW6A 4LRSA 3PVSA 1H0GA 1GO5A 1Q3BA 2Y0QA 5A2QS 3UMMA 4GRIA 3GLFA 1QUSA 1N32M 1R2YA 2C98A 4TX8A 1IXSB 4LCBA 1PDCA 4DV5M 4L8RC 1GVNA 1IBKM 4LFBM 1DGFA 4Z2IA 1R4GA 4DV6M 2J7NA 4F1IA 4MGKE 3V76A 4OW0A 2WSFF 3CF2A 4Z6YA 1JQJC 3UGJA 3GLGE 1FJGM 1C1KA 1D0LA 4LJ9A 4W5WA 2OQ4A 3FRIA 3M6AA 1WJ7A 4DR4M 2UUBM 1A5TA 3W0LB 3QWLA 3A42A 2XF3A 4XBOA 3ZCBB 1V33A 4K0KM 4LZJA 2JY7A 3CF0A 1DO0A 2JY5A 5JI3E 5IZ7D 1N33M 2CRUA 2DWZB 3TWKA 3SATA 4P17A 3WHKA 1TR8A 2DAGA 1L2BA 4AI6A 5ITXA 2XFSA 4JN6A 3TWMA 1LV7A 4JYAM 3LVWA 2LVOC 3QYBA 4LF8M 1CUKA 1CK7A 2J7OA 3I4VA 3BBZA 4PDGA 4DV3M 1VEKA 3PNYA 1YU4A 3HX3A 4MGHA 2UWXA 5DYGA 4X64M 1W1VA 3T6PA 3UJNA 2DAEA 4G4RA 4DR2M 2D7EA 2F4VM 3KP0E 2DAIA 3B74A 1PJQA 4G6ZA 4MGZE 3GLHB 4MGIE 4GEWA 2CWBA 5EP1A 5ITQA 3GLGA 3HJQA 3SARA 2KDLA 2DZNB 4L6V6 4GKJM 4LY6A 2DI0A 3K9PA 1MX0A 4MB5A 3WD3A 5KQ8A 2KNVA 1F4IA 4JI3M 3AL0C 2VDBB 3LW5F 3W67A 1T43A 2RKOA 3GLIA 1XMOM 1BVSA 1W5TA 2VIIA 4M9SA 1R2ZA 4JI4M 3WD0A 3L29A 4B3TM 3OTOM 2V1UA 4IBCA 4M9ZA 4IBKA 5EXTA 2L09A 3U6SA 1OGGA 1G71A 2LXEA 1OAIA 3GLIB 3ILKA 3J81S 1HNZM 5ITXE 4B3MM 3UK6A 1KFVA 2XSZA 1O6IA 2DWNA 1W1TA 1TH3A 3HU3A 4FWHA 3TQSA 1DGHB 1T3TA 1VG5A 2A5YB 2QQ8A 3AOEC 1T6OA 4FVMA 3K92A 4LJAA 4B08A 4LFCM 1H8PA 4M0WA 4DUZM 4PD2A 2RRUA 3KXEC 3FE3A 1NV9A 3L26A 2FFJA 3FYDA 1QVRA 2JWSA 3Q8GA 3JAMS 4NRVA 2Y2OA 3LVVA 4NC6A 2R4EA 1E6NA 4JI0M 2M5ZA 1G59A 2BNKA 2MGWA 3T38A 4OJPA 1TGUA 1Y8GA 2ZAMA 4L4UA 1N75A 4NZ5A 2JZ1A 4GC5A 5F3WA 3AOGA 3L28A 1DGHA 1H6UA 2Y20A 3JR5A 4JI8M 2Y2IA 1IN7A 1NJGA 2OOBA 3SBJA 1Z6TA 3FTCA 4BBAA 4LG2A 3KOXE 2CHVA 2KNAA 3AOEA 4OVZB 4GHLA 3VKHA 3SFZA 3VFDA 1UFZA 1OGBA 3SASA 2R65A 2YNMD 4PDIA 2CUZA 2V5OA 4G4QA 3C3EA 1NNUC 4FWGA 1PRBA 3RFWA 3SYLA 3TPZA 5ITTA 2JE5A 2EKFA 1J7MA 1YU0A 1QAOA 3THGA 2P5TA 1G4AE 3RE8A 1YLAA 3TE6A 1EIJA 1OFHA 1UM8A 4B3SM 1WIVA 3A45A 2FOIC 5EXSA 3U5ZB 4EIWA 2HL7A 1G41A 2HAKA 1PJSA 2XEPA 1ED7A 2CEAA 4DR1M 4B7HA 2L6OA 4X62M 4QNLA 1OIZA 2JP7A 2JY6B 4L15A 4Z2JA 5H37D 1NY5A 3KSJA 2DWMA 1QDRA 2XGNA 1PGYA 2ZANA 4WP2A 2VQEM 3U60A 3U61B 1E6PA 3H4JA 3AJIB 3M0EA 4AKGA 4LGYA 3CGWA 1ZAEA 3C9PA 4CJ6A 2QBYA 3KS8A 1VDLA 3RGPA 2X49A 2FN2A 1HQCA 4L78A 1J7KA 1MJGM 4LJ6A 2BWEA 4JI5M 1ZV1A 3J2PB 2XSZD 2GNOA 2G8LA 4I5SA 4YHHM 1Q02A 1G3IA 1JR3A 4LJ7A 5KPZA 1W1PA 1KYIA 4QNRA 3MMPA 2LBCA 4NZ4A 1YU2A 4MGYE 2O01F 2QENA 2QSFX 1SXJE 4KLNA 4WURA 2ZTDA 5IREB 1NSFA 3SHFA 3I04M 4DUYM 3TL4X 1AIWA 5BPVA 1JR3E 1KSFX 5DNYA 1J5EM 1L6JA 3EIEA 2QPAA 3K1JA 3DA1A 2GQFA 2JZ0A 5LMNM 4WW0A 2JXNA 7CATA 2CE7A 1E32A 2K9DA 2R0IA 1QQWA 1I94M 4JI6M 1DGGA 3MJ5A 2Y0TA 3B7NA 4X65M 3SAWA 1XMQM 3K8ZA 1YE9A 5LMUM 4NYYA 4BLCA 3MHVC 4KODA 1XNRM 2HKJA 3M7PA 3HGIA 3M7GA 5JI2E 2KZSA 3E9SA 3HHWA 3HHZA 2Y2JA 2R44A 3E21A 1SXJC 2BJWA 2JA2A 3LQQA 4GH9A 4L16A 2VQFM 1K82A 3T1YM 3SC3A 2FNAA 1OFIA 4TUWA 4LJ8A 1E6ZA 1E8BA 2MJ5B 1D2NA 4DV2M 2CV1A 2KA6B 4DR6M 2UU9M 2BJVA 1H0IA 1GABA 3U6EA 1QZEA 2B3TA 1DO2A 1Z59A 5EP4A 2R18A 3NBXX 1EE8A
chains in the Genus database with same CATH topology
2Y2MA 1Z5BA 4R7GA 2F5OA 2KEBA 2DZOB 4A3VB 4II7A 3HWSA 4JXJA 5ITRA 1PJJA 2Y2QA 3IG8A 5FLXS 2G5GX 4MM3B 4CGYB 1ORYB 3J80S 1VDDA 3KSXA 3NBIA 5FSWA 4M0DA 2AHMA 2LWXA 5KQDA 1L2CA 1XXHB 4LF6M 1HT2E 4IBGA 3HU2A 3A46A 4LF5M 3GPPA 3GQ3A 4G4OA 5EXPA 1IQPA 4GC9A 4GMQA 1MU5A 3CF6E 4IBFA 2F5PA 3B9PA 3DFZA 5C18A 2YR0A 4P16A 1NY6A 4FD2A 3GRRA 3GP1A 2Z4RA 3W0FA 5ITUA 2C9OA 3DOAA 2Q2EB 2RGOA 1N34M 2QZ4A 3U6LA 4FWDA 4OUIA 1QYRA 2IOUA 2E5LM 3VDUA 3T15A 2CHQA 1IM2A 3VK7A 3E4RA 4AZFA 5ITYA 4JV5M 3U6OA 3FD9A 1ZQ9A 3FTDA 2F5QA 1S3SA 3KOWE 2CV0A 5E26A 3SMSA 4LGMA 5IWAM 4DV0M 1IBLM 4AKHA 3QAUA 3TWLA 1DGBA 3WHLA 2BG1A 4GITA 4DR5M 3A98B 5E6JA 4RF0A 5EP2A 1J09A 2ZBKB 4KO8A 1YUBA 1Z5CA 5FTKA 4LFAM 1XC8A 4NZ1A 3DZDA 3VDPA 1TH2A 4OJLA 3HJSA 1YSYA 3FKEA 3K2LA 3HU1A 1I4WA 5EJCA 5DYIA 2Z4SA 1HNXM 4PT5A 4GKKM 1G8PA 1OJLA 3FUXA 3SMPA 3UZUA 1QAMA 2R4JA 3GLHA 2ZM6M 1HQYE 1IY1A 2Y21A 1L2DA 4B3RM 4G4NA 1QAQA 2L7HA 2ERCA 2UUAM 3KP1E 4IBJA 2QP9X 2I7NA 2QBYB 2DXIA 3GO8A 2HCBA 4QNMA 3SAUA 1WXQA 1XWIA 3U6MA 4QOSA 3VKGA 1GLNA 2XFTA 3GRVA 2R45A 4ZPXA 3FTFA 2R46A 1XXHA 3SYKA 1NJFA 3AFHA 1R7RA 4AQYM 1N77A 2LNHC 1FNNA 2EA0A 4HLQA 3KOYE 4IBEA 5BR8M 3U6DA 2FFFB 1NHGC 3I4YA 1IXZA 4R3DA 4Z8XA 3KFUG 4GIPA 5FTMA 3EIHA 2HHHM 4OX9M 4DR7M 4GHAA 3J27B 3LQRA 3D8LA 4QHSA 2OPFA 2C5RA 1IY2A 4BB9A 3KOZE 2XZUA 5FTJA 4NOOB 2Y2KA 4OU7A 3I51A 4NYUA 1NHWC 3GPXA 3N3FA 3GLFB 2V1CA 3U6QA 1YUEA 4HL4A 3KS4A 3GPUA 1N36M 1W5SA 3GRYA 2C9CA 2V6ZM 3HHYA 5IT9S 3C58A 1SXJA 2KXEA 3PFIA 3SAVA 3J7AS 4X66M 4OJ6A 5GKNA 1Z5AA 4CISA 1E9RA 3U61A 3U60B 3HHXA 3T1HM 5KPTA 3FUTA 1K3WA 5C1BA 1R6BX 4LF7M 2C96A 3PNVA 3AKZA 2CFOA 2RGHA 4FW9A 4DV4M 1HNWM 4JI1M 4NSOB 4I81A 2DVWB 4IBBA 3IG5A 3CTWB 4RNAA 5KPRA 3GQ5A 5FTNA 5FTLA 2KZUA 4QHTA 2H1RA 3KDSE 2XLJA 2X4AA 4LZZA 3RGSA 1Q3CA 4OVZA 4IJFA 2K47A 2JCHA 4LRTA 5KO3A 1IN5A 1X37A 4AW4A 4KHPM 3FUVA 3R8FA 4LJ5A 4NRWA 3FYCA 3JR4A 3FTEA 3WX7A 4NXMM 1L1ZA 3BOSA 4LF4M 4NL4H 1IN8A 3U6CA 4JI2M 3PXGA 2DHRA 2XD1A 2M60A 1L8QA 1QZMA 1SXJD 2R62A 3KVWA 3MK6A 4IBDA 2XZFA 3HONA 1L1TA 1GL6A 2LH0A 3U5ZA 4XGIA 3L27A 3VLFB 1GKIA 2XH9A 4D80A 2Y2NA 2Y2GA 4OJ5A 2D7HA 2XD5A 1TDZA 4FCVA 4FCWA 2KRUA 4I4LA 1TDHA 4DR3M 4B7GA 2EO2A 4YY3M 2CV2A 1NVMA 1PJIA 4PCZA 1HR0M 1XHBA 3L25A 2DWLA 4DV7M 2Z7JA 3L2AA 2EUCA 4I8OA 4NSRA 2QCUA 3R9XB 2Y2HA 2L7IA 2I7PA 3HKPA 4REZA 1Q39A 2Z3XA 1IN4A 8CATA 2NQ8C 2F5SA 5EP3A 1JR3D 3SHGB 4AKIA 1QANA 3GLGB 3GRUA 3NWLA 4RF1A 4QOZC 4B7FA 2O5RA 1E94E 3U6PA 1E9SA 4DV1M 2W82A 1IBMM 1YU3A 5EXXA 1YU1A 2KRKA 1SXJB 4AG6A 4D81A 3Q8XA 2X8AA 4MH0E 4IIWA 3AV0A 2D7GA 2C99A 2Y2PA 2Y2LA 1PM5A 2F5NA 1K3XA 2UXDM 4JI7M 3GQ4A 2CHGA 4AG5A 4NY2A 1NNJA 4M9XA 3LMMA 3FUWA 1HT1E 3HJ8A 4IJEA 3ZC7B 3J7BA 4NXNM 1IXRC 4ITQA 2UUCM 1IY0A 3D8BA 4NZ3A 3FUUA 2KW0A 4IBIA 5EQTA 3GPYA 1TH4A 2UXBM 4MB7A 3H4MA 1XNQM 4S12A 4D82A 3ZH9B 3VK8A 2FE8A 4LF9M 2UXCM 1IN6A 1GL7A 3HSHA 2YFQA 4FCTA 2YQZA 1N78A 2ZAOA 4LJ4A 4OJOA 4CHTB 3KW6A 4LRSA 3PVSA 1Q3BA 2Y0QA 5A2QS 3UMMA 4GRIA 3GLFA 1N32M 1R2YA 2C98A 1IXSB 4LCBA 4DV5M 4L8RC 1GVNA 1IBKM 4LFBM 1DGFA 4DV6M 2J7NA 4MGKE 4OW0A 4Z6YA 3CF2A 3UGJA 1JQJC 1FJGM 1C1KA 4LJ9A 4W5WA 2OQ4A 3M6AA 4DR4M 2UUBM 3W0LB 3QWLA 3A42A 2XF3A 4XBOA 3ZCBB 4K0KM 4LZJA 3CF0A 1DO0A 5JI3E 5IZ7D 1N33M 2DWZB 3TWKA 3SATA 3WHKA 1L2BA 4AI6A 5ITXA 2XFSA 4JN6A 3TWMA 1LV7A 4JYAM 3LVWA 4LF8M 2J7OA 3I4VA 4PDGA 4DV3M 3PNYA 1YU4A 4MGHA 2UWXA 5DYGA 4X64M 3UJNA 4DR2M 4G4RA 2D7EA 2F4VM 3KP0E 4G6ZA 4MGZE 3GLHB 4MGIE 5EP1A 3GLGA 5ITQA 3HJQA 3SARA 2DZNB 4GKJM 4LY6A 1MX0A 5KQ8A 4JI3M 3AL0C 2RKOA 3GLIA 1XMOM 1W5TA 2VIIA 4M9SA 1R2ZA 4JI4M 3L29A 4B3TM 3OTOM 2V1UA 4IBCA 4M9ZA 4IBKA 5EXTA 2L09A 2LXEA 3GLIB 3ILKA 3J81S 1HNZM 5ITXE 4B3MM 3UK6A 1KFVA 2XSZA 2DWNA 1TH3A 3HU3A 4FWHA 3TQSA 1DGHB 1T3TA 2A5YB 4FVMA 3AOEC 4LJAA 3K92A 4LFCM 4B08A 4M0WA 4DUZM 4PD2A 3KXEC 3L26A 2FFJA 3FYDA 1QVRA 3JAMS 2Y2OA 4NRVA 3LVVA 2R4EA 4JI0M 2M5ZA 1G59A 2BNKA 3T38A 4OJPA 1TGUA 2ZAMA 4L4UA 1N75A 4NZ5A 4GC5A 5F3WA 3AOGA 3L28A 1DGHA 1H6UA 2Y20A 3JR5A 4JI8M 2Y2IA 1IN7A 1NJGA 3SBJA 1Z6TA 3FTCA 4BBAA 4LG2A 3KOXE 2CHVA 3AOEA 4OVZB 4GHLA 3VKHA 3SFZA 3VFDA 3SASA 2R65A 2YNMD 4PDIA 2CUZA 4G4QA 3TPZA 1NNUC 4FWGA 3SYLA 3RFWA 2JE5A 5ITTA 1YU0A 1QAOA 3THGA 2P5TA 1G4AE 3RE8A 3TE6A 1OFHA 1UM8A 4B3SM 5EXSA 3A45A 2FOIC 3U5ZB 4EIWA 2HL7A 1G41A 2XEPA 2CEAA 4DR1M 4B7HA 2L6OA 4X62M 4QNLA 4L15A 5H37D 1NY5A 3KSJA 2DWMA 2VQEM 2XGNA 3U60A 2ZANA 3U61B 3AJIB 3M0EA 4AKGA 4LGYA 1ZAEA 2QBYA 3KS8A 3RGPA 2X49A 1HQCA 4L78A 1J7KA 4LJ6A 4JI5M 3J2PB 2XSZD 2G8LA 4I5SA 4YHHM 1G3IA 1JR3A 4LJ7A 5KPZA 1KYIA 4QNRA 4NZ4A 1YU2A 4MGYE 2QENA 4KLNA 1SXJE 4WURA 5IREB 1NSFA 3SHFA 4DUYM 3TL4X 5BPVA 1KSFX 5DNYA 1J5EM 3EIEA 2QPAA 3K1JA 3DA1A 5LMNM 4WW0A 7CATA 2CE7A 1E32A 1I94M 1QQWA 4JI6M 1DGGA 3MJ5A 2Y0TA 4X65M 3SAWA 1XMQM 3K8ZA 1YE9A 5LMUM 4NYYA 4BLCA 3MHVC 4KODA 1XNRM 2HKJA 3HGIA 3M7GA 5JI2E 2KZSA 3E9SA 3HHWA 3HHZA 2Y2JA 3LQQA 1SXJC 2BJWA 2JA2A 4GH9A 4L16A 2VQFM 1K82A 3T1YM 3SC3A 2FNAA 1OFIA 4TUWA 4LJ8A 1D2NA 4DV2M 2CV1A 2KA6B 4DR6M 2UU9M 2BJVA 3U6EA 1DO2A 1Z59A 5EP4A 2R18A 3U6SA 1EE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG2 A;  4GHA A;  4GHL A;  3KS8 A;  4IBD A;  4IBB A;  3FKE A;  3L26 A;  3L27 A;  3KS4 A;  4IJE A;  4GH9 A;  4IBG A;  4IJF A;  3L29 A;  4IBE A;  4IBC A;  4IBK A;  4IBI A;  4IBF A;  3L28 A;  3L25 A;  5BPV A;  4IBJ A;  3L2A A; 
#chains in the Genus database with same CATH topology
 2Y2M A;  1Z5B A;  4R7G A;  2F5O A;  2KEB A;  2DZO B;  4A3V B;  4II7 A;  3HWS A;  4JXJ A;  3W68 A;  5ITR A;  1PJJ A;  3IG8 A;  1QO6 A;  2Y2Q A;  5FLX S;  3LCU A;  2G5G X;  3B7Z A;  4MM3 B;  4CGY B;  3WD2 A;  1ORY B;  4HMD A;  3J80 S;  1VDD A;  3KSX A;  3LCV B;  1GXD A;  4Z2K A;  1EFU B;  3NBI A;  4DBG B;  5FSW A;  4M0D A;  2AHM A;  2LWX A;  5KQD A;  1L2C A;  2WSC F;  1XXH B;  3QYE A;  4LF6 M;  1HT2 E;  4IBG A;  3HU2 A;  3A46 A;  4LF5 M;  3GPP A;  3GQ3 A;  4G4O A;  5EXP A;  1IQP A;  4GC9 A;  4GMQ A;  1MU5 A;  1QUT A;  3CF6 E;  4IBF A;  2K0B X;  2F5P A;  1E15 A;  3B9P A;  3DFZ A;  5C18 A;  2YR0 A;  4P16 A;  1NY6 A;  3GRR A;  4FD2 A;  2JUJ A;  3GP1 A;  2Z4R A;  3W0F A;  5ITU A;  1XB2 B;  2C9O A;  3DOA A;  2Q2E B;  2RGO A;  2XZF A;  1IFY A;  1N34 M;  2QZ4 A;  3U6L A;  4FWD A;  4OUI A;  1QYR A;  1DV0 A;  2IOU A;  5L8R F;  2E5L M;  3VDU A;  2LVN C;  2CHQ A;  3T15 A;  1OKS A;  1IM2 A;  1XXH E;  2K6B A;  3VK7 A;  4KT0 F;  3E4R A;  4AZF A;  5ITY A;  4JV5 M;  3U6O A;  3FD9 A;  1WGN A;  1ZQ9 A;  3FTD A;  2F5Q A;  1S3S A;  3KOW E;  2CV0 A;  5E26 A;  1V92 A;  3SMS A;  2ZTC A;  4LGM A;  2J5Y A;  5IWA M;  3IEC A;  4DV0 M;  1IBL M;  4AKH A;  2N35 A;  3QAU A;  2L2D A;  1DGB A;  3TWL A;  1QDT A;  3WHL A;  2BG1 A;  3WD4 A;  4GIT A;  4DR5 M;  3A98 B;  1AUA A;  4RF0 A;  5E6J A;  5EP2 A;  1J09 A;  2ZBK B;  4KO8 A;  1YUB A;  5DFL A;  1Z5C A;  5FTK A;  4LFA M;  1XC8 A;  4NZ1 A;  3DZD A;  3VDP A;  1E6R A;  1TH2 A;  4OJL A;  3HJS A;  1YSY A;  3FKE A;  3K2L A;  1OTR A;  4RKU F;  3HU1 A;  1I4W A;  5EJC A;  5DYI A;  2Z4S A;  1HNX M;  1ZMW A;  4PT5 A;  4GKK M;  1G8P A;  1OJL A;  3C3D A;  3FUX A;  3SMP A;  3UZU A;  1QAM A;  2R4J A;  3GLH A;  2ZM6 M;  1HQY E;  1IY1 A;  2Y21 A;  1L2D A;  4B3R M;  1WHC A;  4G4N A;  1QAQ A;  2L7H A;  2ERC A;  2UUA M;  2KHH A;  3WD1 A;  3KP1 E;  4IBJ A;  2QP9 X;  2I7N A;  2QBY B;  2DXI A;  3GO8 A;  1WR1 B;  2HCB A;  4QNM A;  3SAU A;  1WXQ A;  1XWI A;  2G3Q A;  3E46 A;  1TTE A;  3U6M A;  2QHO B;  4QOS A;  1GLN A;  3VKG A;  2XFT A;  3GRV A;  2R45 A;  4ZPX A;  3FTF A;  2LVA A;  2R46 A;  2DKL A;  1XXH A;  3SYK A;  1NJF A;  3AFH A;  1R7R A;  4ANR A;  3GLF E;  2LNH C;  1GJT A;  4AQY M;  1N77 A;  1FNN A;  2EA0 A;  4HLQ A;  3KOY E;  4IBE A;  5BR8 M;  3U6D A;  2MH8 A;  4F2L A;  2FFF B;  1NHG C;  1PJT A;  3I4Y A;  1IXZ A;  4R3D A;  4Z8X A;  3GLI E;  2DAM A;  3KFU G;  2LVQ D;  4GIP A;  3EIH A;  5FTM A;  2HHH M;  4OX9 M;  1ZMV A;  4DR7 M;  4GHA A;  2R6F A;  3J27 B;  3LQR A;  3D8L A;  4QHS A;  1GJS A;  4MB3 A;  2OPF A;  2C5R A;  2KNZ A;  1IY2 A;  4Z2L A;  4BB9 A;  3KOZ E;  2XZU A;  5FTJ A;  4NOO B;  2Y2K A;  3MQL A;  1KS0 A;  1MN3 A;  2L4E A;  4OU7 A;  3I51 A;  4NYU A;  1NHW C;  3GPX A;  3N3F A;  3GLF B;  2V1C A;  1GOI A;  3U6Q A;  1YUE A;  4HL4 A;  3KS4 A;  3GPU A;  4Z2H A;  1RU3 A;  2LTU A;  1W5S A;  1N36 M;  3GRY A;  2C9C A;  2V6Z M;  3HHY A;  5IT9 S;  3C58 A;  1SXJ A;  2KXE A;  3PFI A;  3SAV A;  3J7A S;  1HJP A;  4X66 M;  4OJ6 A;  5GKN A;  1Z5A A;  4CIS A;  1E9R A;  3U61 A;  3U60 B;  3HHX A;  3T1H M;  1SG9 A;  5KPT A;  2QNJ A;  3FUT A;  1K3W A;  5C1B A;  1R6B X;  4LF7 M;  2C96 A;  3PNV A;  3AKZ A;  2CFO A;  2JY8 A;  2RGH A;  4FW9 A;  4DV4 M;  1TF0 B;  1HNW M;  4JI1 M;  1D0K A;  4NSO B;  4I81 A;  2DVW B;  4IBB A;  3IG5 A;  3CTW B;  4RNA A;  5KPR A;  3GQ5 A;  5FTN A;  5FTL A;  2KZU A;  1AIP C;  2OO9 A;  2LHC A;  4QHT A;  2H1R A;  3KDS E;  3HON A;  2XLJ A;  1V34 A;  2X4A A;  1OAO C;  4LZZ A;  3RGS A;  1Q3C A;  4OVZ A;  4IJF A;  2K47 A;  2EKK A;  2JCH A;  2HWJ A;  4LRT A;  5KO3 A;  1IN5 A;  1X37 A;  4AW4 A;  1WGL A;  4KHP M;  3FUV A;  1VEG A;  1GPF A;  3ZQJ A;  4LJ5 A;  3R8F A;  4NRW A;  3FYC A;  3JR4 A;  4UN2 B;  3FTE A;  3I01 M;  4NXM M;  1W1Y A;  3WX7 A;  1L1Z A;  3B89 A;  3BOS A;  4LF4 M;  4NL4 H;  1IN8 A;  3FRH A;  3U6C A;  4JI2 M;  3PXG A;  2DHR A;  2XD1 A;  2M60 A;  1L8Q A;  1P3Q Q;  1QZM A;  1SXJ D;  2DAK A;  2R62 A;  3KVW A;  2DEN A;  3MK6 A;  4IBD A;  2MRO B;  3K9O A;  1L1T A;  1GL6 A;  2RTS A;  2LH0 A;  3U5Z A;  1OIP A;  4XGI A;  3L27 A;  3VLF B;  1GKI A;  2XH9 A;  4D80 A;  2Y2N A;  2Y2G A;  4OJ5 A;  1VQ1 A;  2D7H A;  2XD5 A;  1TDZ A;  4FCV A;  4FCW A;  2KRU A;  3IHP A;  4HMC A;  4I4L A;  1TDH A;  4DR3 M;  4B7G A;  2EO2 A;  4YY3 M;  2CV2 A;  1UR8 A;  1NVM A;  1PJI A;  1JB0 F;  4PCZ A;  1HR0 M;  1XHB A;  3L25 A;  2DWL A;  4DV7 M;  2Z7J A;  3L2A A;  2EUC A;  2VF8 A;  4I8O A;  2O25 A;  2QCU A;  4NSR A;  3R9X B;  2Y2H A;  1LTM A;  2I7P A;  2L7I A;  3HKP A;  4REZ A;  3F92 A;  1Q39 A;  2Z3X A;  1IN4 A;  8CAT A;  2NQ8 C;  2F5S A;  5EP3 A;  1R5L A;  1JR3 D;  3SHG B;  4AKI A;  1EAK A;  2LVP C;  3HY5 A;  4Y28 F;  1QAN A;  3GLG B;  3GRU A;  3NWL A;  4RF1 A;  4Q7J A;  2OOA A;  2WSE F;  4B7F A;  4QOZ C;  2O5R A;  2VF7 A;  1E94 E;  3U6P A;  1E9S A;  4DV1 M;  2W82 A;  1IBM M;  1YU3 A;  5EXX A;  1YU1 A;  2KRK A;  1SXJ B;  4AG6 A;  4D81 A;  3Q8X A;  2X8A A;  4MH0 E;  1CXW A;  4IIW A;  3AV0 A;  2FH0 A;  2D7G A;  2C99 A;  2Y2P A;  2Y2L A;  1PM5 A;  2F5N A;  1ZMU A;  2JNH A;  1K3X A;  2UXD M;  4JI7 M;  3GQ4 A;  2CHG A;  2Z8Y M;  4AG5 A;  4NY2 A;  1NNJ A;  1D0M A;  2FS1 A;  4M9X A;  1NO1 A;  1C7Y A;  4MB4 A;  4HME A;  3LMM A;  1E88 A;  3FUW A;  3HZJ A;  1HT1 E;  3HJ8 A;  4IJE A;  3ZC7 B;  3J7B A;  2BWB A;  1IXR C;  2DZL A;  4NXN M;  2D49 A;  4ITQ A;  2UUC M;  3BXW A;  1IY0 A;  4G3O A;  3D8B A;  2CP8 A;  4NZ3 A;  2MR9 A;  3FUU A;  2KW0 A;  2LHG A;  3B7Q A;  4IBI A;  2DHY A;  5EQT A;  4R71 A;  3GPY A;  1TH4 A;  2UXB M;  2APL A;  1NV8 A;  1OQY A;  1UR9 A;  2DNA A;  4MB7 A;  3H4M A;  1XNQ M;  4Z2G A;  4XK8 F;  4S12 A;  4D82 A;  3ZH9 B;  4HEO A;  3VK8 A;  2FE8 A;  4LF9 M;  2UXC M;  1IN6 A;  1GL7 A;  1VEJ A;  4CIZ A;  2EJS A;  2WZJ A;  2YFQ A;  3GLH E;  4FCT A;  3HSH A;  2L4F A;  2YQZ A;  1IXS A;  1N78 A;  2ZAO A;  4LJ4 A;  4OJO A;  2H5X A;  4CHT B;  3KW6 A;  4LRS A;  3PVS A;  1H0G A;  1GO5 A;  1Q3B A;  2Y0Q A;  5A2Q S;  3UMM A;  4GRI A;  3GLF A;  1QUS A;  1N32 M;  1R2Y A;  2C98 A;  4TX8 A;  1IXS B;  4LCB A;  1PDC A;  4DV5 M;  4L8R C;  1GVN A;  1IBK M;  4LFB M;  1DGF A;  4Z2I A;  1R4G A;  4DV6 M;  2J7N A;  4F1I A;  4MGK E;  3V76 A;  4OW0 A;  2WSF F;  3CF2 A;  4Z6Y A;  1JQJ C;  3UGJ A;  3GLG E;  1FJG M;  1C1K A;  1D0L A;  4LJ9 A;  4W5W A;  2OQ4 A;  3FRI A;  3M6A A;  1WJ7 A;  4DR4 M;  2UUB M;  1A5T A;  3W0L B;  3QWL A;  3A42 A;  2XF3 A;  4XBO A;  3ZCB B;  1V33 A;  4K0K M;  4LZJ A;  2JY7 A;  3CF0 A;  1DO0 A;  2JY5 A;  5JI3 E;  5IZ7 D;  1N33 M;  2CRU A;  2DWZ B;  3TWK A;  3SAT A;  4P17 A;  3WHK A;  1TR8 A;  2DAG A;  1L2B A;  4AI6 A;  5ITX A;  2XFS A;  4JN6 A;  3TWM A;  1LV7 A;  4JYA M;  3LVW A;  2LVO C;  3QYB A;  4LF8 M;  1CUK A;  1CK7 A;  2J7O A;  3I4V A;  3BBZ A;  4PDG A;  4DV3 M;  1VEK A;  3PNY A;  1YU4 A;  3HX3 A;  4MGH A;  2UWX A;  5DYG A;  4X64 M;  1W1V A;  3T6P A;  3UJN A;  2DAE A;  4G4R A;  4DR2 M;  2D7E A;  2F4V M;  3KP0 E;  2DAI A;  3B74 A;  1PJQ A;  4G6Z A;  4MGZ E;  3GLH B;  4MGI E;  4GEW A;  2CWB A;  5EP1 A;  5ITQ A;  3GLG A;  3HJQ A;  3SAR A;  2KDL A;  2DZN B;  4L6V 6;  4GKJ M;  4LY6 A;  2DI0 A;  3K9P A;  1MX0 A;  4MB5 A;  3WD3 A;  5KQ8 A;  2KNV A;  1F4I A;  4JI3 M;  3AL0 C;  2VDB B;  3LW5 F;  3W67 A;  1T43 A;  2RKO A;  3GLI A;  1XMO M;  1BVS A;  1W5T A;  2VII A;  4M9S A;  1R2Z A;  4JI4 M;  3WD0 A;  3L29 A;  4B3T M;  3OTO M;  2V1U A;  4IBC A;  4M9Z A;  4IBK A;  5EXT A;  2L09 A;  3U6S A;  1OGG A;  1G71 A;  2LXE A;  1OAI A;  3GLI B;  3ILK A;  3J81 S;  1HNZ M;  5ITX E;  4B3M M;  3UK6 A;  1KFV A;  2XSZ A;  1O6I A;  2DWN A;  1W1T A;  1TH3 A;  3HU3 A;  4FWH A;  3TQS A;  1DGH B;  1T3T A;  1VG5 A;  2A5Y B;  2QQ8 A;  3AOE C;  1T6O A;  4FVM A;  3K92 A;  4LJA A;  4B08 A;  4LFC M;  1H8P A;  4M0W A;  4DUZ M;  4PD2 A;  2RRU A;  3KXE C;  3FE3 A;  1NV9 A;  3L26 A;  2FFJ A;  3FYD A;  1QVR A;  2JWS A;  3Q8G A;  3JAM S;  4NRV A;  2Y2O A;  3LVV A;  4NC6 A;  2R4E A;  1E6N A;  4JI0 M;  2M5Z A;  1G59 A;  2BNK A;  2MGW A;  3T38 A;  4OJP A;  1TGU A;  1Y8G A;  2ZAM A;  4L4U A;  1N75 A;  4NZ5 A;  2JZ1 A;  4GC5 A;  5F3W A;  3AOG A;  3L28 A;  1DGH A;  1H6U A;  2Y20 A;  3JR5 A;  4JI8 M;  2Y2I A;  1IN7 A;  1NJG A;  2OOB A;  3SBJ A;  1Z6T A;  3FTC A;  4BBA A;  4LG2 A;  3KOX E;  2CHV A;  2KNA A;  3AOE A;  4OVZ B;  4GHL A;  3VKH A;  3SFZ A;  3VFD A;  1UFZ A;  1OGB A;  3SAS A;  2R65 A;  2YNM D;  4PDI A;  2CUZ A;  2V5O A;  4G4Q A;  3C3E A;  1NNU C;  4FWG A;  1PRB A;  3RFW A;  3SYL A;  3TPZ A;  5ITT A;  2JE5 A;  2EKF A;  1J7M A;  1YU0 A;  1QAO A;  3THG A;  2P5T A;  1G4A E;  3RE8 A;  1YLA A;  3TE6 A;  1EIJ A;  1OFH A;  1UM8 A;  4B3S M;  1WIV A;  3A45 A;  2FOI C;  5EXS A;  3U5Z B;  4EIW A;  2HL7 A;  1G41 A;  2HAK A;  1PJS A;  2XEP A;  1ED7 A;  2CEA A;  4DR1 M;  4B7H A;  2L6O A;  4X62 M;  4QNL A;  1OIZ A;  2JP7 A;  2JY6 B;  4L15 A;  4Z2J A;  5H37 D;  1NY5 A;  3KSJ A;  2DWM A;  1QDR A;  2XGN A;  1PGY A;  2ZAN A;  4WP2 A;  2VQE M;  3U60 A;  3U61 B;  1E6P A;  3H4J A;  3AJI B;  3M0E A;  4AKG A;  4LGY A;  3CGW A;  1ZAE A;  3C9P A;  4CJ6 A;  2QBY A;  3KS8 A;  1VDL A;  3RGP A;  2X49 A;  2FN2 A;  1HQC A;  4L78 A;  1J7K A;  1MJG M;  4LJ6 A;  2BWE A;  4JI5 M;  1ZV1 A;  3J2P B;  2XSZ D;  2GNO A;  2G8L A;  4I5S A;  4YHH M;  1Q02 A;  1G3I A;  1JR3 A;  4LJ7 A;  5KPZ A;  1W1P A;  1KYI A;  4QNR A;  3MMP A;  2LBC A;  4NZ4 A;  1YU2 A;  4MGY E;  2O01 F;  2QEN A;  2QSF X;  1SXJ E;  4KLN A;  4WUR A;  2ZTD A;  5IRE B;  1NSF A;  3SHF A;  3I04 M;  4DUY M;  3TL4 X;  1AIW A;  5BPV A;  1JR3 E;  1KSF X;  5DNY A;  1J5E M;  1L6J A;  3EIE A;  2QPA A;  3K1J A;  3DA1 A;  2GQF A;  2JZ0 A;  5LMN M;  4WW0 A;  2JXN A;  7CAT A;  2CE7 A;  1E32 A;  2K9D A;  2R0I A;  1QQW A;  1I94 M;  4JI6 M;  1DGG A;  3MJ5 A;  2Y0T A;  3B7N A;  4X65 M;  3SAW A;  1XMQ M;  3K8Z A;  1YE9 A;  5LMU M;  4NYY A;  4BLC A;  3MHV C;  4KOD A;  1XNR M;  2HKJ A;  3M7P A;  3HGI A;  3M7G A;  5JI2 E;  2KZS A;  3E9S A;  3HHW A;  3HHZ A;  2Y2J A;  2R44 A;  3E21 A;  1SXJ C;  2BJW A;  2JA2 A;  3LQQ A;  4GH9 A;  4L16 A;  2VQF M;  1K82 A;  3T1Y M;  3SC3 A;  2FNA A;  1OFI A;  4TUW A;  4LJ8 A;  1E6Z A;  1E8B A;  2MJ5 B;  1D2N A;  4DV2 M;  2CV1 A;  2KA6 B;  4DR6 M;  2UU9 M;  2BJV A;  1H0I A;  1GAB A;  3U6E A;  1QZE A;  2B3T A;  1DO2 A;  1Z59 A;  5EP4 A;  2R18 A;  3NBX X;  1EE8 A; 
#chains in the Genus database with same CATH homology
 2Y2M A;  1Z5B A;  4R7G A;  2F5O A;  2KEB A;  2DZO B;  4A3V B;  4II7 A;  3HWS A;  4JXJ A;  5ITR A;  1PJJ A;  2Y2Q A;  3IG8 A;  5FLX S;  2G5G X;  4MM3 B;  4CGY B;  1ORY B;  3J80 S;  1VDD A;  3KSX A;  3NBI A;  5FSW A;  4M0D A;  2AHM A;  2LWX A;  5KQD A;  1L2C A;  1XXH B;  4LF6 M;  1HT2 E;  4IBG A;  3HU2 A;  3A46 A;  4LF5 M;  3GPP A;  3GQ3 A;  4G4O A;  5EXP A;  1IQP A;  4GC9 A;  4GMQ A;  1MU5 A;  3CF6 E;  4IBF A;  2F5P A;  3B9P A;  3DFZ A;  5C18 A;  2YR0 A;  4P16 A;  1NY6 A;  4FD2 A;  3GRR A;  3GP1 A;  2Z4R A;  3W0F A;  5ITU A;  2C9O A;  3DOA A;  2Q2E B;  2RGO A;  1N34 M;  2QZ4 A;  3U6L A;  4FWD A;  4OUI A;  1QYR A;  2IOU A;  2E5L M;  3VDU A;  3T15 A;  2CHQ A;  1IM2 A;  3VK7 A;  3E4R A;  4AZF A;  5ITY A;  4JV5 M;  3U6O A;  3FD9 A;  1ZQ9 A;  3FTD A;  2F5Q A;  1S3S A;  3KOW E;  2CV0 A;  5E26 A;  3SMS A;  4LGM A;  5IWA M;  4DV0 M;  1IBL M;  4AKH A;  3QAU A;  3TWL A;  1DGB A;  3WHL A;  2BG1 A;  4GIT A;  4DR5 M;  3A98 B;  5E6J A;  4RF0 A;  5EP2 A;  1J09 A;  2ZBK B;  4KO8 A;  1YUB A;  1Z5C A;  5FTK A;  4LFA M;  1XC8 A;  4NZ1 A;  3DZD A;  3VDP A;  1TH2 A;  4OJL A;  3HJS A;  1YSY A;  3FKE A;  3K2L A;  3HU1 A;  1I4W A;  5EJC A;  5DYI A;  2Z4S A;  1HNX M;  4PT5 A;  4GKK M;  1G8P A;  1OJL A;  3FUX A;  3SMP A;  3UZU A;  1QAM A;  2R4J A;  3GLH A;  2ZM6 M;  1HQY E;  1IY1 A;  2Y21 A;  1L2D A;  4B3R M;  4G4N A;  1QAQ A;  2L7H A;  2ERC A;  2UUA M;  3KP1 E;  4IBJ A;  2QP9 X;  2I7N A;  2QBY B;  2DXI A;  3GO8 A;  2HCB A;  4QNM A;  3SAU A;  1WXQ A;  1XWI A;  3U6M A;  4QOS A;  3VKG A;  1GLN A;  2XFT A;  3GRV A;  2R45 A;  4ZPX A;  3FTF A;  2R46 A;  1XXH A;  3SYK A;  1NJF A;  3AFH A;  1R7R A;  4AQY M;  1N77 A;  2LNH C;  1FNN A;  2EA0 A;  4HLQ A;  3KOY E;  4IBE A;  5BR8 M;  3U6D A;  2FFF B;  1NHG C;  3I4Y A;  1IXZ A;  4R3D A;  4Z8X A;  3KFU G;  4GIP A;  5FTM A;  3EIH A;  2HHH M;  4OX9 M;  4DR7 M;  4GHA A;  3J27 B;  3LQR A;  3D8L A;  4QHS A;  2OPF A;  2C5R A;  1IY2 A;  4BB9 A;  3KOZ E;  2XZU A;  5FTJ A;  4NOO B;  2Y2K A;  4OU7 A;  3I51 A;  4NYU A;  1NHW C;  3GPX A;  3N3F A;  3GLF B;  2V1C A;  3U6Q A;  1YUE A;  4HL4 A;  3KS4 A;  3GPU A;  1N36 M;  1W5S A;  3GRY A;  2C9C A;  2V6Z M;  3HHY A;  5IT9 S;  3C58 A;  1SXJ A;  2KXE A;  3PFI A;  3SAV A;  3J7A S;  4X66 M;  4OJ6 A;  5GKN A;  1Z5A A;  4CIS A;  1E9R A;  3U61 A;  3U60 B;  3HHX A;  3T1H M;  5KPT A;  3FUT A;  1K3W A;  5C1B A;  1R6B X;  4LF7 M;  2C96 A;  3PNV A;  3AKZ A;  2CFO A;  2RGH A;  4FW9 A;  4DV4 M;  1HNW M;  4JI1 M;  4NSO B;  4I81 A;  2DVW B;  4IBB A;  3IG5 A;  3CTW B;  4RNA A;  5KPR A;  3GQ5 A;  5FTN A;  5FTL A;  2KZU A;  4QHT A;  2H1R A;  3KDS E;  2XLJ A;  2X4A A;  4LZZ A;  3RGS A;  1Q3C A;  4OVZ A;  4IJF A;  2K47 A;  2JCH A;  4LRT A;  5KO3 A;  1IN5 A;  1X37 A;  4AW4 A;  4KHP M;  3FUV A;  3R8F A;  4LJ5 A;  4NRW A;  3FYC A;  3JR4 A;  3FTE A;  3WX7 A;  4NXM M;  1L1Z A;  3BOS A;  4LF4 M;  4NL4 H;  1IN8 A;  3U6C A;  4JI2 M;  3PXG A;  2DHR A;  2XD1 A;  2M60 A;  1L8Q A;  1QZM A;  1SXJ D;  2R62 A;  3KVW A;  3MK6 A;  4IBD A;  2XZF A;  3HON A;  1L1T A;  1GL6 A;  2LH0 A;  3U5Z A;  4XGI A;  3L27 A;  3VLF B;  1GKI A;  2XH9 A;  4D80 A;  2Y2N A;  2Y2G A;  4OJ5 A;  2D7H A;  2XD5 A;  1TDZ A;  4FCV A;  4FCW A;  2KRU A;  4I4L A;  1TDH A;  4DR3 M;  4B7G A;  2EO2 A;  4YY3 M;  2CV2 A;  1NVM A;  1PJI A;  4PCZ A;  1HR0 M;  1XHB A;  3L25 A;  2DWL A;  4DV7 M;  2Z7J A;  3L2A A;  2EUC A;  4I8O A;  4NSR A;  2QCU A;  3R9X B;  2Y2H A;  2L7I A;  2I7P A;  3HKP A;  4REZ A;  1Q39 A;  2Z3X A;  1IN4 A;  8CAT A;  2NQ8 C;  2F5S A;  5EP3 A;  1JR3 D;  3SHG B;  4AKI A;  1QAN A;  3GLG B;  3GRU A;  3NWL A;  4RF1 A;  4QOZ C;  4B7F A;  2O5R A;  1E94 E;  3U6P A;  1E9S A;  4DV1 M;  2W82 A;  1IBM M;  1YU3 A;  5EXX A;  1YU1 A;  2KRK A;  1SXJ B;  4AG6 A;  4D81 A;  3Q8X A;  2X8A A;  4MH0 E;  4IIW A;  3AV0 A;  2D7G A;  2C99 A;  2Y2P A;  2Y2L A;  1PM5 A;  2F5N A;  1K3X A;  2UXD M;  4JI7 M;  3GQ4 A;  2CHG A;  4AG5 A;  4NY2 A;  1NNJ A;  4M9X A;  3LMM A;  3FUW A;  1HT1 E;  3HJ8 A;  4IJE A;  3ZC7 B;  3J7B A;  4NXN M;  1IXR C;  4ITQ A;  2UUC M;  1IY0 A;  3D8B A;  4NZ3 A;  3FUU A;  2KW0 A;  4IBI A;  5EQT A;  3GPY A;  1TH4 A;  2UXB M;  4MB7 A;  3H4M A;  1XNQ M;  4S12 A;  4D82 A;  3ZH9 B;  3VK8 A;  2FE8 A;  4LF9 M;  2UXC M;  1IN6 A;  1GL7 A;  3HSH A;  2YFQ A;  4FCT A;  2YQZ A;  1N78 A;  2ZAO A;  4LJ4 A;  4OJO A;  4CHT B;  3KW6 A;  4LRS A;  3PVS A;  1Q3B A;  2Y0Q A;  5A2Q S;  3UMM A;  4GRI A;  3GLF A;  1N32 M;  1R2Y A;  2C98 A;  1IXS B;  4LCB A;  4DV5 M;  4L8R C;  1GVN A;  1IBK M;  4LFB M;  1DGF A;  4DV6 M;  2J7N A;  4MGK E;  4OW0 A;  4Z6Y A;  3CF2 A;  3UGJ A;  1JQJ C;  1FJG M;  1C1K A;  4LJ9 A;  4W5W A;  2OQ4 A;  3M6A A;  4DR4 M;  2UUB M;  3W0L B;  3QWL A;  3A42 A;  2XF3 A;  4XBO A;  3ZCB B;  4K0K M;  4LZJ A;  3CF0 A;  1DO0 A;  5JI3 E;  5IZ7 D;  1N33 M;  2DWZ B;  3TWK A;  3SAT A;  3WHK A;  1L2B A;  4AI6 A;  5ITX A;  2XFS A;  4JN6 A;  3TWM A;  1LV7 A;  4JYA M;  3LVW A;  4LF8 M;  2J7O A;  3I4V A;  4PDG A;  4DV3 M;  3PNY A;  1YU4 A;  4MGH A;  2UWX A;  5DYG A;  4X64 M;  3UJN A;  4DR2 M;  4G4R A;  2D7E A;  2F4V M;  3KP0 E;  4G6Z A;  4MGZ E;  3GLH B;  4MGI E;  5EP1 A;  3GLG A;  5ITQ A;  3HJQ A;  3SAR A;  2DZN B;  4GKJ M;  4LY6 A;  1MX0 A;  5KQ8 A;  4JI3 M;  3AL0 C;  2RKO A;  3GLI A;  1XMO M;  1W5T A;  2VII A;  4M9S A;  1R2Z A;  4JI4 M;  3L29 A;  4B3T M;  3OTO M;  2V1U A;  4IBC A;  4M9Z A;  4IBK A;  5EXT A;  2L09 A;  2LXE A;  3GLI B;  3ILK A;  3J81 S;  1HNZ M;  5ITX E;  4B3M M;  3UK6 A;  1KFV A;  2XSZ A;  2DWN A;  1TH3 A;  3HU3 A;  4FWH A;  3TQS A;  1DGH B;  1T3T A;  2A5Y B;  4FVM A;  3AOE C;  4LJA A;  3K92 A;  4LFC M;  4B08 A;  4M0W A;  4DUZ M;  4PD2 A;  3KXE C;  3L26 A;  2FFJ A;  3FYD A;  1QVR A;  3JAM S;  2Y2O A;  4NRV A;  3LVV A;  2R4E A;  4JI0 M;  2M5Z A;  1G59 A;  2BNK A;  3T38 A;  4OJP A;  1TGU A;  2ZAM A;  4L4U A;  1N75 A;  4NZ5 A;  4GC5 A;  5F3W A;  3AOG A;  3L28 A;  1DGH A;  1H6U A;  2Y20 A;  3JR5 A;  4JI8 M;  2Y2I A;  1IN7 A;  1NJG A;  3SBJ A;  1Z6T A;  3FTC A;  4BBA A;  4LG2 A;  3KOX E;  2CHV A;  3AOE A;  4OVZ B;  4GHL A;  3VKH A;  3SFZ A;  3VFD A;  3SAS A;  2R65 A;  2YNM D;  4PDI A;  2CUZ A;  4G4Q A;  3TPZ A;  1NNU C;  4FWG A;  3SYL A;  3RFW A;  2JE5 A;  5ITT A;  1YU0 A;  1QAO A;  3THG A;  2P5T A;  1G4A E;  3RE8 A;  3TE6 A;  1OFH A;  1UM8 A;  4B3S M;  5EXS A;  3A45 A;  2FOI C;  3U5Z B;  4EIW A;  2HL7 A;  1G41 A;  2XEP A;  2CEA A;  4DR1 M;  4B7H A;  2L6O A;  4X62 M;  4QNL A;  4L15 A;  5H37 D;  1NY5 A;  3KSJ A;  2DWM A;  2VQE M;  2XGN A;  3U60 A;  2ZAN A;  3U61 B;  3AJI B;  3M0E A;  4AKG A;  4LGY A;  1ZAE A;  2QBY A;  3KS8 A;  3RGP A;  2X49 A;  1HQC A;  4L78 A;  1J7K A;  4LJ6 A;  4JI5 M;  3J2P B;  2XSZ D;  2G8L A;  4I5S A;  4YHH M;  1G3I A;  1JR3 A;  4LJ7 A;  5KPZ A;  1KYI A;  4QNR A;  4NZ4 A;  1YU2 A;  4MGY E;  2QEN A;  4KLN A;  1SXJ E;  4WUR A;  5IRE B;  1NSF A;  3SHF A;  4DUY M;  3TL4 X;  5BPV A;  1KSF X;  5DNY A;  1J5E M;  3EIE A;  2QPA A;  3K1J A;  3DA1 A;  5LMN M;  4WW0 A;  7CAT A;  2CE7 A;  1E32 A;  1I94 M;  1QQW A;  4JI6 M;  1DGG A;  3MJ5 A;  2Y0T A;  4X65 M;  3SAW A;  1XMQ M;  3K8Z A;  1YE9 A;  5LMU M;  4NYY A;  4BLC A;  3MHV C;  4KOD A;  1XNR M;  2HKJ A;  3HGI A;  3M7G A;  5JI2 E;  2KZS A;  3E9S A;  3HHW A;  3HHZ A;  2Y2J A;  3LQQ A;  1SXJ C;  2BJW A;  2JA2 A;  4GH9 A;  4L16 A;  2VQF M;  1K82 A;  3T1Y M;  3SC3 A;  2FNA A;  1OFI A;  4TUW A;  4LJ8 A;  1D2N A;  4DV2 M;  2CV1 A;  2KA6 B;  4DR6 M;  2UU9 M;  2BJV A;  3U6E A;  1DO2 A;  1Z59 A;  5EP4 A;  2R18 A;  3U6S A;  1EE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...