3L27A

Crystal structure of zaire ebola vp35 interferon inhibitory domain r312a mutant
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
124
structure length
124
Chain Sequence
PDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLAPVPPSPKIDRGWVCVFQLQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.
pubmed doi rcsb
source organism Zaire ebolavirus
molecule tags Rna binding protein
molecule keywords Polymerase cofactor VP35
total genus 40
structure length 124
sequence length 124
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l27A01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l27A02
4LG2A 4IBDA 3L29A 4GHAA 4IBIA 4IBFA 3L2AA 4GHLA 4IBJA 5BPVA 4IBCA 3KS4A 3L27A 4IJEA 3L25A 4IBEA 3L28A 4IBGA 4IBBA 4GH9A 3KS8A 3L26A 3FKEA 4IJFA 4IBKA
chains in the Genus database with same CATH superfamily
3AV0A 4JI4M 1UM8A 1VG5A 2QHOB 4G4QA 2D7HA 1QDTA 3KFUG 2R6FA 3K2LA 4MGZE 4NYYA 2Y2NA 3KW6A 1L2BA 4GKJM 4IBCA 1E88A 3E9SA 4OVZA 4IJEA 2FS1A 1VQ1A 1YU1A 2D49A 1IN5A 2D7EA 1N78A 1YUEA 1VDDA 2C9CA 2QSFX 2V1UA 2GNOA 3E4RA 2MJ5B 1L1TA 2QNJA 3UGJA 2JWSA 4Z2IA 3LVWA 1OAIA 1H8PA 2C99A 3GRUA 3J7BA 4LRSA 1V92A 1IM2A 1I94M 2XFSA 2UU9M 1L6JA 4KHPM 1GVNA 3U6QA 3DZDA 4WW0A 2ZAOA 1QZMA 3K9PA 4IBIA 3H4MA 3GRYA 2LWXA 4LRTA 4HMDA 1ZAEA 2X4AA 4KODA 1W1PA 5ITRA 1V34A 3MQLA 1QDRA 3R8FA 1TH4A 1JR3E 1OTRA 3LMMA 2XH9A 4II7A 3LW5F 4L6V6 5C18A 4IIWA 3JAMS 4LF9M 1P3QQ 1TH2A 2JY5A 4M9SA 2YQZA 2XFTA 3B89A 4Z2KA 3A98B 3IECA 4GMQA 1OFIA 5BR8M 3A46A 2R45A 3VK7A 1QZEA 1Q39A 4P16A 1DO2A 2F5SA 2R62A 2DWLA 1D0KA 2EKFA 4LF6M 3HX3A 1NNUC 4AW4A 2LVQD 3GPXA 2CV0A 4M9ZA 4REZA 5FTJA 1Z6TA 4AZFA 1D2NA 1XXHE 3IG5A 4Y28F 4B7HA 3SAWA 1PGYA 2DAEA 4LF5M 1OJLA 2FN2A 4RF1A 4Z2LA 4AKHA 3M6AA 1QQWA 3THGA 2Y21A 3GLIE 3JR5A 2DWNA 1N34M 4F2LA 3TQSA 4QNRA 3UZUA 4MGYE 3QYBA 3OTOM 4OJPA 2APLA 2LBCA 3TWLA 2VQFM 4W5WA 4KO8A 3W0FA 1R2ZA 3W0LB 2L4EA 1N77A 4JI6M 2YR0A 2QENA 3D8BA 1OAOC 2DWMA 1KSFX 3CGWA 4YY3M 1T6OA 4LF4M 4FWGA 2KRKA 4AG6A 3HHXA 1PDCA 4X66M 3T6PA 4PDIA 1TTEA 2Z7JA 4JI1M 2H5XA 4GEWA 2M5ZA 3BOSA 3U6SA 3GLGA 1PJQA 3SFZA 1GPFA 2RRUA 2L2DA 3U5ZB 2N35A 2LVAA 5EP1A 2QCUA 1SXJD 3SATA 2ZAMA 5FTKA 4IBJA 3WD2A 3FRIA 1WIVA 1YE9A 4K0KM 1E6ZA 2XD5A 2DHYA 1MU5A 1DGGA 3L27A 2DAMA 3I01M 1EAKA 3L25A 4DBGB 1W1TA 2RKOA 1OQYA 2LXEA 3KP0E 3HWSA 3GQ4A 5FLXS 2CHQA 2EKKA 3U6OA 1YU3A 2CP8A 5DYIA 3PNVA 2MR9A 1KFVA 2UUCM 2RGHA 3ILKA 4FVMA 2JXNA 2VF7A 3GLHE 5JI2E 3GO8A 1C1KA 1X37A 2CHGA 2MGWA 3VKGA 3SARA 4DR2M 2B3TA 1IY0A 3PFIA 4LG2A 4MB3A 1L8QA 4GC9A 2OPFA 4Z2HA 1CXWA 1Z5BA 2QP9X 4LJ6A 2EA0A 4NXMM 1G3IA 1XB2B 2VDBB 4D80A 1L2CA 4XBOA 2R4JA 2K47A 3GLIA 2YNMD 4LJ9A 3TPZA 3U6CA 1J7MA 2K9DA 2XGNA 1NY5A 3GLGE 4JI5M 3I51A 2J5YA 2CWBA 1NSFA 2UUBM 3NWLA 2BNKA 2A5YB 2KRUA 4OW0A 3L28A 4QHTA 1NHGC 3HGIA 1AIWA 1L2DA 4AG5A 2JY7A 3FTCA 1CUKA 4FCVA 2ZM6M 3J80S 3GRVA 3U6DA 2E5LM 3SASA 1JQJC 1VEKA 2KA6B 4AQYM 2OOBA 4LJ7A 3TWMA 2C96A 1IBMM 1GKIA 3LQQA 2Y0QA 3VLFB 5EQTA 2UUAM 2BJWA 5C1BA 4ZPXA 1XHBA 1WXQA 1GLNA 1IXSB 3W68A 1DGHB 2V6ZM 1VEGA 3HHYA 1D0LA 3K1JA 2DVWB 4MH0E 1KYIA 1YLAA 1MX0A 3IHPA 5E6JA 1N36M 3R9XB 3GLGB 4LF7M 4DV7M 1WJ7A 1ZV1A 1W1YA 4LFAM 4FCTA 4FW9A 1HR0M 3FYDA 2RTSA 1IY1A 3Q8XA 2H1RA 3HHWA 4G4OA 2Y20A 4DV2M 3B9PA 1GXDA 3FUUA 2Y2JA 3LCUA 4B7FA 4Q7JA 4MGHA 1XC8A 4KLNA 3U61B 3J7AS 4JI2M 3GLHB 1NV8A 4QNMA 2Y2QA 3WD1A 2V1CA 1XWIA 4AI6A 3L29A 2Y2KA 1UFZA 2R18A 3HHZA 1TGUA 3WD3A 4L16A 1PM5A 4OJLA 1E8BA 1YU4A 5BPVA 1DGHA 2XEPA 2JUJA 2BG1A 4LGYA 3B74A 1PJIA 4GITA 1QVRA 2CV2A 3KS4A 1OIPA 4I4LA 2CHVA 3HZJA 4IBEA 3Q8GA 3NBIA 3C58A 1HQCA 5ITXA 4PDGA 3GQ5A 3FTEA 3BXWA 4QOZC 4XGIA 3LQRA 2I7NA 2R4EA 3KOWE 1IXRC 1S3SA 1GOIA 3K8ZA 2KW0A 1OFHA 1Y8GA 2CFOA 2KXEA 3QYEA 2EO2A 1C7YA 3F92A 3WX7A 3L26A 5LMNM 2JCHA 3T1HM 4L15A 3M7GA 1YU0A 3C3DA 4JI3M 1O6IA 1DGBA 4G6ZA 1TF0B 2HWJA 3FUVA 5EXSA 4CJ6A 1IBKM 4OUIA 1HNWM 2OO9A 4P17A 4JN6A 3PXGA 1IN8A 3SAVA 4GKKM 4OJ5A 1HQYE 3KOZE 3SAUA 4NSOB 1K3XA 5A2QS 2FH0A 1EE8A 3BBZA 4NY2A 2CRUA 5EP2A 1PJTA 4X62M 2VQEM 4KT0F 4G4NA 1IXZA 1NJGA 3E46A 3PVSA 4DV3M 3U6EA 4ANRA 2BWEA 3RGSA 4MB7A 4PD2A 4NZ1A 2JA2A 4RNAA 4DR1M 4QHSA 1N33M 3GP1A 3DFZA 4X64M 4AKIA 2P5TA 2JE5A 1GL6A 4L4UA 1SXJC 5ITQA 1WGLA 1OGBA 2YFQA 1NO1A 4R7GA 1ORYB 2OOAA 4B7GA 1UR8A 2JNHA 2LHCA 4OVZB 4RKUF 1XXHA 3HJSA 4B08A 3J81S 2CV1A 3AJIB 1TH3A 1QANA 2WZJA 1EIJA 1H0GA 2LVNC 3ZCBB 2ERCA 4X65M 1K82A 3AKZA 4B3SM 3M7PA 1IN4A 3U5ZA 1Q3CA 1GABA 1WR1B 4CGYB 4LZZA 1V33A 5ITUA 4NRWA 3SC3A 2Y2OA 1IQPA 2DWZB 4HL4A 2UXCM 1A5TA 4DR3M 4IBBA 4GH9A 3U6MA 4BLCA 2R65A 3MHVC 2C98A 4NSRA 2DXIA 3T1YM 3AFHA 3SYKA 2Y2LA 3GPUA 1ZMWA 3FTDA 4MB4A 5ITTA 2VIIA 2XSZD 3ZC7B 3ZQJA 1TDHA 1Z5AA 3FUXA 4GC5A 4R3DA 1D0MA 3HU3A 3GPYA 4B3MM 3LVVA 4Z8XA 1FJGM 3HSHA 1PRBA 2ZTCA 1QAQA 1JB0F 3FUTA 3KP1E 2KNZA 2QBYB 2JZ0A 4MB5A 1HNZM 3SBJA 4D81A 4DV6M 1W1VA 1QYRA 5KPRA 1QUSA 2DZNB 2EUCA 4JV5M 3A45A 4AKGA 2Q2EB 2KNAA 1HT2E 1XXHB 1W5TA 3NBXX 3ZH9B 2KEBA 3EIEA 3EIHA 2QPAA 3C9PA 4JI8M 1IFYA 1SXJA 2FNAA 2KNVA 1NV9A 4QNLA 5EXXA 4OJ6A 2I7PA 2L09A 3LCVB 4BB9A 2LVPC 4MGKE 1MN3A 3AOGA 1YUBA 5LMUM 2F5NA 5EXPA 3CF6E 4Z2GA 4FWDA 4HLQA 2K0BX 1MJGM 1T43A 3SMSA 1WHCA 1R5LA 2LHGA 3KXEC 1SXJB 2R0IA 5KPTA 4LY6A 2IOUA 4DV4M 4JYAM 2O25A 4NOOB 4HEOA 2WSFF 4OU7A 4G4RA 2V5OA 2UWXA 1YSYA 4R71A 3U6PA 1G59A 3E21A 4LJ5A 2ZTDA 1E6NA 1YU2A 4ITQA 1WGNA 1XNQM 1GJTA 8CATA 3SHFA 1E9RA 1BVSA 2XD1A 4NRVA 4TX8A 3HU2A 1R7RA 4PCZA 3GLFE 3MK6A 2QBYA 5KO3A 1G71A 5DFLA 4PT5A 1DO0A 2Z8YM 3JR4A 3VDUA 2Z4SA 4LFBM 1ZQ9A 1IN7A 2DENA 3QAUA 4DR5M 3GPPA 4RF0A 4IJFA 5FTLA 2G8LA 3C3EA 2F5PA 2LTUA 3WHKA 1E6PA 3FRHA 2Z3XA 2L6OA 4GHAA 4M0DA 1DV0A 2JZ1A 1LV7A 4S12A 1IBLM 3VDPA 3GLIB 1F4IA 4DR4M 3HONA 2C5RA 4NYUA 1FNNA 3T15A 1GL7A 3HY5A 1SXJE 3FD9A 1R2YA 4A3VB 2XZFA 3UJNA 1NJFA 2XZUA 1PJSA 1G41A 4WP2A 2KHHA 4YHHM 2XSZA 4FD2A 4NL4H 1XNRM 1NHWC 2QQ8A 3UMMA 4DUYM 3U61A 4IBGA 4MM3B 2F4VM 2Y0TA 4NZ3A 3B7QA 2FFJA 4DV5M 5EP3A 1EFUB 2FE8A 3AL0C 2UXBM 2LNHC 2Z4RA 2QZ4A 4JXJA 2M60A 2OQ4A 4XK8F 3M0EA 2G5GX 1DGFA 2LVOC 4NXNM 4CHTB 4DV0M 1NY6A 2Y2HA 2Y2MA 2JY6B 1SG9A 4IBDA 2Y2PA 1ED7A 3WHLA 2HHHM 1Z59A 2HAKA 2MH8A 2J7NA 5EP4A 2DAIA 1R6BX 2JP7A 3B7NA 3L2AA 4I8OA 3TWKA 2BJVA 3U60A 2AHMA 3RE8A 1I4WA 4D82A 5KQDA 4B3TM 4FWHA 4WURA 4DV1M 3KSJA 3KVWA 2HKJA 3U60B 4QOSA 3HKPA 4JI0M 1GJSA 1J09A 1W5SA 2DKLA 1N32M 2VF8A 1IY2A 1E32A 2X49A 2DAGA 3AOEA 2XLJA 5EXTA 4LJ8A 3DA1A 2D7GA 2L4FA 2W82A 1G8PA 4Z6YA 1J7KA 2JY8A 2ZANA 4G3OA 1QAOA 4UN2B 1NNJA 2FOIC 1HT1E 2KZUA 1UR9A 3W67A 4IBKA 4LCBA 1G4AE 2L7HA 3A42A 3CTWB 3K92A 4NZ4A 3SYLA 2CUZA 4DR7M 2GQFA 1JR3D 2WSEF 1OGGA 3J27B 3GLFA 5FTMA 2RGOA 2HL7A 4CISA 2FFFB 4M9XA 5L8RF 3KDSE 3T38A 4LF8M 2DNAA 4HMEA 1VDLA 5E26A 3WD4A 3WD0A 1ZMUA 3I04M 5EJCA 5GKNA 1RU3A 2CEAA 1HNXM 1NVMA 1PJJA 3IG8A 3V76A 4NZ5A 5H37D 3PNYA 4HMCA 1H6UA 3B7ZA 3KOYE 2J7OA 3GLHA 4OX9M 5FSWA 3RFWA 3SMPA 2MROB 3FKEA 2HCBA 2DHRA 3K9OA 5ITYA 5IREB 3KSXA 3CF2A 4BBAA 3GQ3A 1J5EM 4LFCM 3FTFA 1VEJA 1GO5A 4LGMA 3MMPA 1E9SA 5F3WA 1H0IA 3RGPA 5IT9S 1KS0A 1E94E 1K3WA 4IBFA 2R46A 3FUWA 2KDLA 1R4GA 2O5RA 4GRIA 4NC6A 1XMOM 3TE6A 4Z2JA 3HJ8A 3HJQA 5JI3E 2ZBKB 4DR6M 1TR8A 3AOEC 4OJOA 1HJPA 2XF3A 2WSCF 2Y2GA 5KPZA 4JI7M 4M0WA 2BWBA 5FTNA 1L1ZA 1Z5CA 1IXSA 2X8AA 1ZMVA 3FYCA 3J2PB 3SHGB 3VFDA 2F5OA 5KQ8A 1QO6A 1OKSA 1AUAA 4CIZA 2DZOB 4TUWA 3D8LA 2UXDM 1T3TA 2EJSA 3UK6A 2DI0A 3VKHA 1AIPC 1Q3BA 3KOXE 4F1IA 2CE7A 2Y2IA 4DUZM 2NQ8C 4LJ4A 3CF0A 1Q02A 3I4VA 3QWLA 4GIPA 4I5SA 3GRRA 2DZLA 7CATA 4L78A 4GHLA 1LTMA 1E15A 5DNYA 3DOAA 3MJ5A 3GLFB 3H4JA 2C9OA 1IN6A 3HU1A 1E6RA 5IZ7D 3FE3A 1QUTA 5DYGA 1N75A 1QAMA 3I4YA 2K6BA 2DAKA 4L8RC 2F5QA 2LH0A 2O01F 2R44A 1CK7A 2L7IA 4FCWA 4MGIE 3N3FA 4EIWA 2G3QA 3TL4X 1JR3A 4I81A 3VK8A 1OIZA 3U6LA 1TDZA 5IWAM 1XMQM 3KS8A 4B3RM 4LZJA 4LJAA 5ITXE 2KZSA
chains in the Genus database with same CATH topology
3AV0A 4JI4M 1UM8A 4G4QA 2D7HA 3KFUG 3K2LA 4MGZE 4NYYA 2Y2NA 3KW6A 1L2BA 4GKJM 4IBCA 3E9SA 4OVZA 4IJEA 1YU1A 1IN5A 2D7EA 1N78A 1YUEA 1VDDA 2C9CA 2V1UA 3E4RA 1L1TA 3UGJA 3LVWA 2C99A 3GRUA 3J7BA 4LRSA 1IM2A 1I94M 2XFSA 2UU9M 4KHPM 1GVNA 3U6QA 3DZDA 4WW0A 2ZAOA 1QZMA 4IBIA 3H4MA 3GRYA 2LWXA 4LRTA 1ZAEA 2X4AA 4KODA 5ITRA 3R8FA 1TH4A 3LMMA 4II7A 2XH9A 5C18A 4IIWA 3JAMS 4LF9M 1TH2A 4M9SA 2YQZA 2XFTA 3A98B 4GMQA 1OFIA 5BR8M 3A46A 2R45A 3VK7A 4P16A 1Q39A 2F5SA 1DO2A 4LF6M 2R62A 2DWLA 4GKKM 1NNUC 4AW4A 3GPXA 2CV0A 4M9ZA 4REZA 5FTJA 1Z6TA 4AZFA 1D2NA 3IG5A 4B7HA 3SAWA 4LF5M 1OJLA 4RF1A 4AKHA 3M6AA 1QQWA 3THGA 2Y21A 2DWNA 3JR5A 1N34M 3TQSA 4QNRA 3UZUA 4MGYE 3OTOM 4OJPA 3TWLA 2VQFM 4W5WA 4KO8A 3W0FA 1R2ZA 3W0LB 1N77A 4JI6M 2YR0A 2QENA 3D8BA 2DWMA 1KSFX 4YY3M 4LF4M 4FWGA 2KRKA 4AG6A 3HHXA 4X66M 4PDIA 2Z7JA 4JI1M 3U6SA 2M5ZA 3BOSA 3GLGA 3SFZA 3U5ZB 5EP1A 2QCUA 1SXJD 3SATA 2ZAMA 5FTKA 4IBJA 1YE9A 4K0KM 2XD5A 1MU5A 1DGGA 3L27A 3L25A 2RKOA 2LXEA 3KP0E 3HWSA 3GQ4A 5FLXS 2CHQA 1YU3A 3U6OA 5DYIA 3PNVA 1KFVA 2UUCM 2RGHA 3ILKA 4FVMA 3GO8A 5JI2E 1G59A 3VKGA 1C1KA 1X37A 2CHGA 3SARA 4DR2M 1IY0A 3PFIA 4LG2A 1L8QA 4GC9A 2OPFA 1Z5BA 2QP9X 4LJ6A 2EA0A 4NXMM 1G3IA 4D80A 1L2CA 4XBOA 2R4JA 2K47A 3GLIA 2YNMD 4LJ9A 3TPZA 3U6CA 2XGNA 1NY5A 4JI5M 3I51A 2UUBM 1NSFA 3NWLA 2BNKA 2A5YB 2KRUA 4OW0A 3L28A 4QHTA 1NHGC 3HGIA 1L2DA 4AG5A 3FTCA 4FCVA 2ZM6M 3J80S 3GRVA 3U6DA 2E5LM 3SASA 1JQJC 2KA6B 4AQYM 4LJ7A 3TWMA 2C96A 1IBMM 1GKIA 3LQQA 2Y0QA 3VLFB 5EQTA 2UUAM 2BJWA 5C1BA 4ZPXA 1XHBA 1WXQA 1GLNA 1IXSB 1DGHB 2V6ZM 3HHYA 3K1JA 2DVWB 4MH0E 1KYIA 1MX0A 5E6JA 1N36M 3R9XB 3GLGB 4LF7M 4DV7M 4LFAM 4FCTA 4FW9A 1HR0M 3FYDA 1IY1A 3Q8XA 2H1RA 3HHWA 4G4OA 2Y20A 4DV2M 3B9PA 3FUUA 2Y2JA 4B7FA 4MGHA 1XC8A 4KLNA 3U61B 3J7AS 4JI2M 3GLHB 4QNMA 2Y2QA 2V1CA 1XWIA 4AI6A 3L29A 2Y2KA 2R18A 3HHZA 1TGUA 4L16A 1PM5A 4OJLA 1YU4A 5BPVA 1DGHA 2XEPA 2BG1A 4LGYA 1PJIA 4GITA 1QVRA 2CV2A 3KS4A 4I4LA 2CHVA 4IBEA 3NBIA 3C58A 1HQCA 5ITXA 4PDGA 3GQ5A 3FTEA 4QOZC 4XGIA 3LQRA 2I7NA 2R4EA 3KOWE 1IXRC 1S3SA 3K8ZA 2KW0A 1OFHA 2CFOA 2KXEA 2EO2A 3WX7A 3L26A 5LMNM 2JCHA 3T1HM 4L15A 3M7GA 1YU0A 4JI3M 1DGBA 4G6ZA 4OUIA 3FUVA 5EXSA 1IBKM 1HNWM 4OJ5A 3PXGA 4JN6A 3SAVA 1IN8A 1HQYE 3KOZE 3SAUA 4NSOB 1K3XA 5A2QS 1EE8A 4NY2A 5EP2A 4X62M 2VQEM 4G4NA 1IXZA 1NJGA 3PVSA 4DV3M 4NZ1A 3U6EA 4PD2A 3RGSA 4MB7A 2JA2A 4RNAA 4DR1M 4QHSA 1N33M 3GP1A 3DFZA 4X64M 4AKIA 2P5TA 2JE5A 1GL6A 4L4UA 1SXJC 5ITQA 2YFQA 4R7GA 1ORYB 4B7GA 4OVZB 1XXHA 3HJSA 4B08A 3J81S 2CV1A 3AJIB 1TH3A 1QANA 3ZCBB 2ERCA 4X65M 1K82A 3AKZA 4B3SM 1IN4A 3U5ZA 1Q3CA 4CGYB 4LZZA 5ITUA 4NRWA 3SC3A 2Y2OA 1IQPA 2DWZB 4HL4A 2UXCM 4DR3M 4IBBA 4GH9A 3U6MA 4BLCA 2R65A 3MHVC 2C98A 4NSRA 2DXIA 3T1YM 3AFHA 3SYKA 2Y2LA 3GPUA 3FTDA 5ITTA 2VIIA 2XSZD 3ZC7B 1TDHA 1Z5AA 3FUXA 4GC5A 4R3DA 3HU3A 3GPYA 4B3MM 3LVVA 4Z8XA 1FJGM 3HSHA 1QAQA 3KP1E 3FUTA 2QBYB 1HNZM 3SBJA 4D81A 4DV6M 1QYRA 5KPRA 2DZNB 2EUCA 4JV5M 3A45A 4AKGA 2Q2EB 1HT2E 1XXHB 1W5TA 3ZH9B 2KEBA 3EIEA 3EIHA 2QPAA 4JI8M 1SXJA 2FNAA 4QNLA 5EXXA 4OJ6A 2I7PA 2L09A 2F5NA 4BB9A 4MGKE 5LMUM 3AOGA 1YUBA 5EXPA 3CF6E 4FWDA 4HLQA 3SMSA 3KXEC 1SXJB 5KPTA 4LY6A 2IOUA 4DV4M 4JYAM 4NOOB 4G4RA 4OU7A 2UWXA 1YSYA 3U6PA 4LJ5A 1YU2A 4ITQA 1XNQM 8CATA 3SHFA 1E9RA 2XD1A 4NRVA 3HU2A 1R7RA 4PCZA 2QBYA 3MK6A 5KO3A 3JR4A 4PT5A 1DO0A 3VDUA 2Z4SA 4LFBM 1ZQ9A 1IN7A 3QAUA 4DR5M 3GPPA 4RF0A 4IJFA 5FTLA 2G8LA 2F5PA 3WHKA 2Z3XA 2L6OA 4GHAA 4M0DA 1LV7A 4S12A 1IBLM 3VDPA 3GLIB 4DR4M 3HONA 2C5RA 4NYUA 1FNNA 3T15A 1GL7A 1SXJE 3FD9A 1R2YA 4A3VB 2XZFA 3UJNA 1NJFA 2XZUA 1G41A 4YHHM 2XSZA 4FD2A 4NL4H 1XNRM 1NHWC 4NZ3A 3UMMA 4DUYM 3U61A 4IBGA 4MM3B 2F4VM 2Y0TA 4DV5M 2FFJA 2UXBM 5EP3A 3AL0C 2FE8A 2LNHC 2Z4RA 2QZ4A 4JXJA 2M60A 2OQ4A 3M0EA 2G5GX 1DGFA 4NXNM 2Y2HA 4CHTB 4DV0M 1NY6A 2Y2MA 4IBDA 2Y2PA 3WHLA 2HHHM 1Z59A 5EP4A 2J7NA 3U60A 1R6BX 3TWKA 4I8OA 3L2AA 2BJVA 2AHMA 3RE8A 1I4WA 4D82A 5KQDA 4B3TM 4FWHA 4WURA 4DV1M 3KSJA 3KVWA 2HKJA 3U60B 4QOSA 3HKPA 4JI0M 1J09A 1W5SA 1N32M 1IY2A 1E32A 2X49A 3AOEA 2XLJA 5EXTA 4LJ8A 3DA1A 2D7GA 2W82A 1G8PA 4Z6YA 1J7KA 2ZANA 1QAOA 1NNJA 2FOIC 1HT1E 2KZUA 4IBKA 4LCBA 1G4AE 2L7HA 3A42A 3CTWB 3K92A 4NZ4A 3SYLA 2CUZA 4DR7M 1JR3D 3J27B 3GLFA 5FTMA 2RGOA 2HL7A 4CISA 2FFFB 4M9XA 4LF8M 3KDSE 3T38A 5E26A 5GKNA 5EJCA 2CEAA 1HNXM 1NVMA 1PJJA 3IG8A 4NZ5A 5H37D 3PNYA 1H6UA 3KOYE 2J7OA 3GLHA 4OX9M 5FSWA 3RFWA 3SMPA 3FKEA 2HCBA 2DHRA 4BBAA 5ITYA 5IREB 3KSXA 3CF2A 3GQ3A 4LFCM 1J5EM 3FTFA 4TUWA 4LGMA 5F3WA 1E9SA 3RGPA 5IT9S 1E94E 1K3WA 4IBFA 2R46A 3FUWA 4GRIA 2O5RA 1XMOM 3TE6A 3HJ8A 3HJQA 5JI3E 2ZBKB 4DR6M 3AOEC 4OJOA 2XF3A 2Y2GA 5KPZA 4JI7M 4M0WA 5FTNA 1L1ZA 1Z5CA 2X8AA 3FYCA 3J2PB 3SHGB 3VFDA 2F5OA 5KQ8A 2DZOB 3D8LA 2UXDM 1T3TA 3UK6A 3VKHA 1Q3BA 3KOXE 2Y2IA 2CE7A 4DUZM 2NQ8C 4LJ4A 3CF0A 3I4VA 3QWLA 4GIPA 4I5SA 3GRRA 4GHLA 7CATA 4L78A 5DNYA 3DOAA 3MJ5A 3GLFB 2C9OA 1IN6A 3HU1A 5IZ7D 5DYGA 1N75A 1QAMA 3I4YA 4L8RC 2F5QA 2LH0A 2L7IA 4FCWA 4MGIE 3N3FA 4EIWA 3TL4X 1JR3A 4I81A 3VK8A 1TDZA 3U6LA 5IWAM 1XMQM 3KS8A 4B3RM 4LZJA 4LJAA 5ITXE 2KZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG2 A;  4IBD A;  3L29 A;  4GHA A;  4IBI A;  4IBF A;  3L2A A;  4GHL A;  4IBJ A;  5BPV A;  4IBC A;  3KS4 A;  3L27 A;  4IJE A;  3L25 A;  4IBE A;  3L28 A;  4IBG A;  4IBB A;  4GH9 A;  3KS8 A;  3L26 A;  3FKE A;  4IJF A;  4IBK A; 
#chains in the Genus database with same CATH topology
 3AV0 A;  4JI4 M;  1UM8 A;  1VG5 A;  2QHO B;  4G4Q A;  2D7H A;  1QDT A;  3KFU G;  2R6F A;  3K2L A;  4MGZ E;  4NYY A;  2Y2N A;  3KW6 A;  1L2B A;  4GKJ M;  4IBC A;  1E88 A;  3E9S A;  4OVZ A;  4IJE A;  2FS1 A;  1VQ1 A;  1YU1 A;  2D49 A;  1IN5 A;  2D7E A;  1N78 A;  1YUE A;  1VDD A;  2C9C A;  2QSF X;  2V1U A;  2GNO A;  3E4R A;  2MJ5 B;  1L1T A;  2QNJ A;  3UGJ A;  2JWS A;  4Z2I A;  3LVW A;  1OAI A;  1H8P A;  2C99 A;  3GRU A;  3J7B A;  4LRS A;  1V92 A;  1IM2 A;  1I94 M;  2XFS A;  2UU9 M;  1L6J A;  4KHP M;  1GVN A;  3U6Q A;  3DZD A;  4WW0 A;  2ZAO A;  1QZM A;  3K9P A;  4IBI A;  3H4M A;  3GRY A;  2LWX A;  4LRT A;  4HMD A;  1ZAE A;  2X4A A;  4KOD A;  1W1P A;  5ITR A;  1V34 A;  3MQL A;  1QDR A;  3R8F A;  1TH4 A;  1JR3 E;  1OTR A;  3LMM A;  2XH9 A;  4II7 A;  3LW5 F;  4L6V 6;  5C18 A;  4IIW A;  3JAM S;  4LF9 M;  1P3Q Q;  1TH2 A;  2JY5 A;  4M9S A;  2YQZ A;  2XFT A;  3B89 A;  4Z2K A;  3A98 B;  3IEC A;  4GMQ A;  1OFI A;  5BR8 M;  3A46 A;  2R45 A;  3VK7 A;  1QZE A;  1Q39 A;  4P16 A;  1DO2 A;  2F5S A;  2R62 A;  2DWL A;  1D0K A;  2EKF A;  4LF6 M;  3HX3 A;  1NNU C;  4AW4 A;  2LVQ D;  3GPX A;  2CV0 A;  4M9Z A;  4REZ A;  5FTJ A;  1Z6T A;  4AZF A;  1D2N A;  1XXH E;  3IG5 A;  4Y28 F;  4B7H A;  3SAW A;  1PGY A;  2DAE A;  4LF5 M;  1OJL A;  2FN2 A;  4RF1 A;  4Z2L A;  4AKH A;  3M6A A;  1QQW A;  3THG A;  2Y21 A;  3GLI E;  3JR5 A;  2DWN A;  1N34 M;  4F2L A;  3TQS A;  4QNR A;  3UZU A;  4MGY E;  3QYB A;  3OTO M;  4OJP A;  2APL A;  2LBC A;  3TWL A;  2VQF M;  4W5W A;  4KO8 A;  3W0F A;  1R2Z A;  3W0L B;  2L4E A;  1N77 A;  4JI6 M;  2YR0 A;  2QEN A;  3D8B A;  1OAO C;  2DWM A;  1KSF X;  3CGW A;  4YY3 M;  1T6O A;  4LF4 M;  4FWG A;  2KRK A;  4AG6 A;  3HHX A;  1PDC A;  4X66 M;  3T6P A;  4PDI A;  1TTE A;  2Z7J A;  4JI1 M;  2H5X A;  4GEW A;  2M5Z A;  3BOS A;  3U6S A;  3GLG A;  1PJQ A;  3SFZ A;  1GPF A;  2RRU A;  2L2D A;  3U5Z B;  2N35 A;  2LVA A;  5EP1 A;  2QCU A;  1SXJ D;  3SAT A;  2ZAM A;  5FTK A;  4IBJ A;  3WD2 A;  3FRI A;  1WIV A;  1YE9 A;  4K0K M;  1E6Z A;  2XD5 A;  2DHY A;  1MU5 A;  1DGG A;  3L27 A;  2DAM A;  3I01 M;  1EAK A;  3L25 A;  4DBG B;  1W1T A;  2RKO A;  1OQY A;  2LXE A;  3KP0 E;  3HWS A;  3GQ4 A;  5FLX S;  2CHQ A;  2EKK A;  3U6O A;  1YU3 A;  2CP8 A;  5DYI A;  3PNV A;  2MR9 A;  1KFV A;  2UUC M;  2RGH A;  3ILK A;  4FVM A;  2JXN A;  2VF7 A;  3GLH E;  5JI2 E;  3GO8 A;  1C1K A;  1X37 A;  2CHG A;  2MGW A;  3VKG A;  3SAR A;  4DR2 M;  2B3T A;  1IY0 A;  3PFI A;  4LG2 A;  4MB3 A;  1L8Q A;  4GC9 A;  2OPF A;  4Z2H A;  1CXW A;  1Z5B A;  2QP9 X;  4LJ6 A;  2EA0 A;  4NXM M;  1G3I A;  1XB2 B;  2VDB B;  4D80 A;  1L2C A;  4XBO A;  2R4J A;  2K47 A;  3GLI A;  2YNM D;  4LJ9 A;  3TPZ A;  3U6C A;  1J7M A;  2K9D A;  2XGN A;  1NY5 A;  3GLG E;  4JI5 M;  3I51 A;  2J5Y A;  2CWB A;  1NSF A;  2UUB M;  3NWL A;  2BNK A;  2A5Y B;  2KRU A;  4OW0 A;  3L28 A;  4QHT A;  1NHG C;  3HGI A;  1AIW A;  1L2D A;  4AG5 A;  2JY7 A;  3FTC A;  1CUK A;  4FCV A;  2ZM6 M;  3J80 S;  3GRV A;  3U6D A;  2E5L M;  3SAS A;  1JQJ C;  1VEK A;  2KA6 B;  4AQY M;  2OOB A;  4LJ7 A;  3TWM A;  2C96 A;  1IBM M;  1GKI A;  3LQQ A;  2Y0Q A;  3VLF B;  5EQT A;  2UUA M;  2BJW A;  5C1B A;  4ZPX A;  1XHB A;  1WXQ A;  1GLN A;  1IXS B;  3W68 A;  1DGH B;  2V6Z M;  1VEG A;  3HHY A;  1D0L A;  3K1J A;  2DVW B;  4MH0 E;  1KYI A;  1YLA A;  1MX0 A;  3IHP A;  5E6J A;  1N36 M;  3R9X B;  3GLG B;  4LF7 M;  4DV7 M;  1WJ7 A;  1ZV1 A;  1W1Y A;  4LFA M;  4FCT A;  4FW9 A;  1HR0 M;  3FYD A;  2RTS A;  1IY1 A;  3Q8X A;  2H1R A;  3HHW A;  4G4O A;  2Y20 A;  4DV2 M;  3B9P A;  1GXD A;  3FUU A;  2Y2J A;  3LCU A;  4B7F A;  4Q7J A;  4MGH A;  1XC8 A;  4KLN A;  3U61 B;  3J7A S;  4JI2 M;  3GLH B;  1NV8 A;  4QNM A;  2Y2Q A;  3WD1 A;  2V1C A;  1XWI A;  4AI6 A;  3L29 A;  2Y2K A;  1UFZ A;  2R18 A;  3HHZ A;  1TGU A;  3WD3 A;  4L16 A;  1PM5 A;  4OJL A;  1E8B A;  1YU4 A;  5BPV A;  1DGH A;  2XEP A;  2JUJ A;  2BG1 A;  4LGY A;  3B74 A;  1PJI A;  4GIT A;  1QVR A;  2CV2 A;  3KS4 A;  1OIP A;  4I4L A;  2CHV A;  3HZJ A;  4IBE A;  3Q8G A;  3NBI A;  3C58 A;  1HQC A;  5ITX A;  4PDG A;  3GQ5 A;  3FTE A;  3BXW A;  4QOZ C;  4XGI A;  3LQR A;  2I7N A;  2R4E A;  3KOW E;  1IXR C;  1S3S A;  1GOI A;  3K8Z A;  2KW0 A;  1OFH A;  1Y8G A;  2CFO A;  2KXE A;  3QYE A;  2EO2 A;  1C7Y A;  3F92 A;  3WX7 A;  3L26 A;  5LMN M;  2JCH A;  3T1H M;  4L15 A;  3M7G A;  1YU0 A;  3C3D A;  4JI3 M;  1O6I A;  1DGB A;  4G6Z A;  1TF0 B;  2HWJ A;  3FUV A;  5EXS A;  4CJ6 A;  1IBK M;  4OUI A;  1HNW M;  2OO9 A;  4P17 A;  4JN6 A;  3PXG A;  1IN8 A;  3SAV A;  4GKK M;  4OJ5 A;  1HQY E;  3KOZ E;  3SAU A;  4NSO B;  1K3X A;  5A2Q S;  2FH0 A;  1EE8 A;  3BBZ A;  4NY2 A;  2CRU A;  5EP2 A;  1PJT A;  4X62 M;  2VQE M;  4KT0 F;  4G4N A;  1IXZ A;  1NJG A;  3E46 A;  3PVS A;  4DV3 M;  3U6E A;  4ANR A;  2BWE A;  3RGS A;  4MB7 A;  4PD2 A;  4NZ1 A;  2JA2 A;  4RNA A;  4DR1 M;  4QHS A;  1N33 M;  3GP1 A;  3DFZ A;  4X64 M;  4AKI A;  2P5T A;  2JE5 A;  1GL6 A;  4L4U A;  1SXJ C;  5ITQ A;  1WGL A;  1OGB A;  2YFQ A;  1NO1 A;  4R7G A;  1ORY B;  2OOA A;  4B7G A;  1UR8 A;  2JNH A;  2LHC A;  4OVZ B;  4RKU F;  1XXH A;  3HJS A;  4B08 A;  3J81 S;  2CV1 A;  3AJI B;  1TH3 A;  1QAN A;  2WZJ A;  1EIJ A;  1H0G A;  2LVN C;  3ZCB B;  2ERC A;  4X65 M;  1K82 A;  3AKZ A;  4B3S M;  3M7P A;  1IN4 A;  3U5Z A;  1Q3C A;  1GAB A;  1WR1 B;  4CGY B;  4LZZ A;  1V33 A;  5ITU A;  4NRW A;  3SC3 A;  2Y2O A;  1IQP A;  2DWZ B;  4HL4 A;  2UXC M;  1A5T A;  4DR3 M;  4IBB A;  4GH9 A;  3U6M A;  4BLC A;  2R65 A;  3MHV C;  2C98 A;  4NSR A;  2DXI A;  3T1Y M;  3AFH A;  3SYK A;  2Y2L A;  3GPU A;  1ZMW A;  3FTD A;  4MB4 A;  5ITT A;  2VII A;  2XSZ D;  3ZC7 B;  3ZQJ A;  1TDH A;  1Z5A A;  3FUX A;  4GC5 A;  4R3D A;  1D0M A;  3HU3 A;  3GPY A;  4B3M M;  3LVV A;  4Z8X A;  1FJG M;  3HSH A;  1PRB A;  2ZTC A;  1QAQ A;  1JB0 F;  3FUT A;  3KP1 E;  2KNZ A;  2QBY B;  2JZ0 A;  4MB5 A;  1HNZ M;  3SBJ A;  4D81 A;  4DV6 M;  1W1V A;  1QYR A;  5KPR A;  1QUS A;  2DZN B;  2EUC A;  4JV5 M;  3A45 A;  4AKG A;  2Q2E B;  2KNA A;  1HT2 E;  1XXH B;  1W5T A;  3NBX X;  3ZH9 B;  2KEB A;  3EIE A;  3EIH A;  2QPA A;  3C9P A;  4JI8 M;  1IFY A;  1SXJ A;  2FNA A;  2KNV A;  1NV9 A;  4QNL A;  5EXX A;  4OJ6 A;  2I7P A;  2L09 A;  3LCV B;  4BB9 A;  2LVP C;  4MGK E;  1MN3 A;  3AOG A;  1YUB A;  5LMU M;  2F5N A;  5EXP A;  3CF6 E;  4Z2G A;  4FWD A;  4HLQ A;  2K0B X;  1MJG M;  1T43 A;  3SMS A;  1WHC A;  1R5L A;  2LHG A;  3KXE C;  1SXJ B;  2R0I A;  5KPT A;  4LY6 A;  2IOU A;  4DV4 M;  4JYA M;  2O25 A;  4NOO B;  4HEO A;  2WSF F;  4OU7 A;  4G4R A;  2V5O A;  2UWX A;  1YSY A;  4R71 A;  3U6P A;  1G59 A;  3E21 A;  4LJ5 A;  2ZTD A;  1E6N A;  1YU2 A;  4ITQ A;  1WGN A;  1XNQ M;  1GJT A;  8CAT A;  3SHF A;  1E9R A;  1BVS A;  2XD1 A;  4NRV A;  4TX8 A;  3HU2 A;  1R7R A;  4PCZ A;  3GLF E;  3MK6 A;  2QBY A;  5KO3 A;  1G71 A;  5DFL A;  4PT5 A;  1DO0 A;  2Z8Y M;  3JR4 A;  3VDU A;  2Z4S A;  4LFB M;  1ZQ9 A;  1IN7 A;  2DEN A;  3QAU A;  4DR5 M;  3GPP A;  4RF0 A;  4IJF A;  5FTL A;  2G8L A;  3C3E A;  2F5P A;  2LTU A;  3WHK A;  1E6P A;  3FRH A;  2Z3X A;  2L6O A;  4GHA A;  4M0D A;  1DV0 A;  2JZ1 A;  1LV7 A;  4S12 A;  1IBL M;  3VDP A;  3GLI B;  1F4I A;  4DR4 M;  3HON A;  2C5R A;  4NYU A;  1FNN A;  3T15 A;  1GL7 A;  3HY5 A;  1SXJ E;  3FD9 A;  1R2Y A;  4A3V B;  2XZF A;  3UJN A;  1NJF A;  2XZU A;  1PJS A;  1G41 A;  4WP2 A;  2KHH A;  4YHH M;  2XSZ A;  4FD2 A;  4NL4 H;  1XNR M;  1NHW C;  2QQ8 A;  3UMM A;  4DUY M;  3U61 A;  4IBG A;  4MM3 B;  2F4V M;  2Y0T A;  4NZ3 A;  3B7Q A;  2FFJ A;  4DV5 M;  5EP3 A;  1EFU B;  2FE8 A;  3AL0 C;  2UXB M;  2LNH C;  2Z4R A;  2QZ4 A;  4JXJ A;  2M60 A;  2OQ4 A;  4XK8 F;  3M0E A;  2G5G X;  1DGF A;  2LVO C;  4NXN M;  4CHT B;  4DV0 M;  1NY6 A;  2Y2H A;  2Y2M A;  2JY6 B;  1SG9 A;  4IBD A;  2Y2P A;  1ED7 A;  3WHL A;  2HHH M;  1Z59 A;  2HAK A;  2MH8 A;  2J7N A;  5EP4 A;  2DAI A;  1R6B X;  2JP7 A;  3B7N A;  3L2A A;  4I8O A;  3TWK A;  2BJV A;  3U60 A;  2AHM A;  3RE8 A;  1I4W A;  4D82 A;  5KQD A;  4B3T M;  4FWH A;  4WUR A;  4DV1 M;  3KSJ A;  3KVW A;  2HKJ A;  3U60 B;  4QOS A;  3HKP A;  4JI0 M;  1GJS A;  1J09 A;  1W5S A;  2DKL A;  1N32 M;  2VF8 A;  1IY2 A;  1E32 A;  2X49 A;  2DAG A;  3AOE A;  2XLJ A;  5EXT A;  4LJ8 A;  3DA1 A;  2D7G A;  2L4F A;  2W82 A;  1G8P A;  4Z6Y A;  1J7K A;  2JY8 A;  2ZAN A;  4G3O A;  1QAO A;  4UN2 B;  1NNJ A;  2FOI C;  1HT1 E;  2KZU A;  1UR9 A;  3W67 A;  4IBK A;  4LCB A;  1G4A E;  2L7H A;  3A42 A;  3CTW B;  3K92 A;  4NZ4 A;  3SYL A;  2CUZ A;  4DR7 M;  2GQF A;  1JR3 D;  2WSE F;  1OGG A;  3J27 B;  3GLF A;  5FTM A;  2RGO A;  2HL7 A;  4CIS A;  2FFF B;  4M9X A;  5L8R F;  3KDS E;  3T38 A;  4LF8 M;  2DNA A;  4HME A;  1VDL A;  5E26 A;  3WD4 A;  3WD0 A;  1ZMU A;  3I04 M;  5EJC A;  5GKN A;  1RU3 A;  2CEA A;  1HNX M;  1NVM A;  1PJJ A;  3IG8 A;  3V76 A;  4NZ5 A;  5H37 D;  3PNY A;  4HMC A;  1H6U A;  3B7Z A;  3KOY E;  2J7O A;  3GLH A;  4OX9 M;  5FSW A;  3RFW A;  3SMP A;  2MRO B;  3FKE A;  2HCB A;  2DHR A;  3K9O A;  5ITY A;  5IRE B;  3KSX A;  3CF2 A;  4BBA A;  3GQ3 A;  1J5E M;  4LFC M;  3FTF A;  1VEJ A;  1GO5 A;  4LGM A;  3MMP A;  1E9S A;  5F3W A;  1H0I A;  3RGP A;  5IT9 S;  1KS0 A;  1E94 E;  1K3W A;  4IBF A;  2R46 A;  3FUW A;  2KDL A;  1R4G A;  2O5R A;  4GRI A;  4NC6 A;  1XMO M;  3TE6 A;  4Z2J A;  3HJ8 A;  3HJQ A;  5JI3 E;  2ZBK B;  4DR6 M;  1TR8 A;  3AOE C;  4OJO A;  1HJP A;  2XF3 A;  2WSC F;  2Y2G A;  5KPZ A;  4JI7 M;  4M0W A;  2BWB A;  5FTN A;  1L1Z A;  1Z5C A;  1IXS A;  2X8A A;  1ZMV A;  3FYC A;  3J2P B;  3SHG B;  3VFD A;  2F5O A;  5KQ8 A;  1QO6 A;  1OKS A;  1AUA A;  4CIZ A;  2DZO B;  4TUW A;  3D8L A;  2UXD M;  1T3T A;  2EJS A;  3UK6 A;  2DI0 A;  3VKH A;  1AIP C;  1Q3B A;  3KOX E;  4F1I A;  2CE7 A;  2Y2I A;  4DUZ M;  2NQ8 C;  4LJ4 A;  3CF0 A;  1Q02 A;  3I4V A;  3QWL A;  4GIP A;  4I5S A;  3GRR A;  2DZL A;  7CAT A;  4L78 A;  4GHL A;  1LTM A;  1E15 A;  5DNY A;  3DOA A;  3MJ5 A;  3GLF B;  3H4J A;  2C9O A;  1IN6 A;  3HU1 A;  1E6R A;  5IZ7 D;  3FE3 A;  1QUT A;  5DYG A;  1N75 A;  1QAM A;  3I4Y A;  2K6B A;  2DAK A;  4L8R C;  2F5Q A;  2LH0 A;  2O01 F;  2R44 A;  1CK7 A;  2L7I A;  4FCW A;  4MGI E;  3N3F A;  4EIW A;  2G3Q A;  3TL4 X;  1JR3 A;  4I81 A;  3VK8 A;  1OIZ A;  3U6L A;  1TDZ A;  5IWA M;  1XMQ M;  3KS8 A;  4B3R M;  4LZJ A;  4LJA A;  5ITX E;  2KZS A; 
#chains in the Genus database with same CATH homology
 3AV0 A;  4JI4 M;  1UM8 A;  4G4Q A;  2D7H A;  3KFU G;  3K2L A;  4MGZ E;  4NYY A;  2Y2N A;  3KW6 A;  1L2B A;  4GKJ M;  4IBC A;  3E9S A;  4OVZ A;  4IJE A;  1YU1 A;  1IN5 A;  2D7E A;  1N78 A;  1YUE A;  1VDD A;  2C9C A;  2V1U A;  3E4R A;  1L1T A;  3UGJ A;  3LVW A;  2C99 A;  3GRU A;  3J7B A;  4LRS A;  1IM2 A;  1I94 M;  2XFS A;  2UU9 M;  4KHP M;  1GVN A;  3U6Q A;  3DZD A;  4WW0 A;  2ZAO A;  1QZM A;  4IBI A;  3H4M A;  3GRY A;  2LWX A;  4LRT A;  1ZAE A;  2X4A A;  4KOD A;  5ITR A;  3R8F A;  1TH4 A;  3LMM A;  4II7 A;  2XH9 A;  5C18 A;  4IIW A;  3JAM S;  4LF9 M;  1TH2 A;  4M9S A;  2YQZ A;  2XFT A;  3A98 B;  4GMQ A;  1OFI A;  5BR8 M;  3A46 A;  2R45 A;  3VK7 A;  4P16 A;  1Q39 A;  2F5S A;  1DO2 A;  4LF6 M;  2R62 A;  2DWL A;  4GKK M;  1NNU C;  4AW4 A;  3GPX A;  2CV0 A;  4M9Z A;  4REZ A;  5FTJ A;  1Z6T A;  4AZF A;  1D2N A;  3IG5 A;  4B7H A;  3SAW A;  4LF5 M;  1OJL A;  4RF1 A;  4AKH A;  3M6A A;  1QQW A;  3THG A;  2Y21 A;  2DWN A;  3JR5 A;  1N34 M;  3TQS A;  4QNR A;  3UZU A;  4MGY E;  3OTO M;  4OJP A;  3TWL A;  2VQF M;  4W5W A;  4KO8 A;  3W0F A;  1R2Z A;  3W0L B;  1N77 A;  4JI6 M;  2YR0 A;  2QEN A;  3D8B A;  2DWM A;  1KSF X;  4YY3 M;  4LF4 M;  4FWG A;  2KRK A;  4AG6 A;  3HHX A;  4X66 M;  4PDI A;  2Z7J A;  4JI1 M;  3U6S A;  2M5Z A;  3BOS A;  3GLG A;  3SFZ A;  3U5Z B;  5EP1 A;  2QCU A;  1SXJ D;  3SAT A;  2ZAM A;  5FTK A;  4IBJ A;  1YE9 A;  4K0K M;  2XD5 A;  1MU5 A;  1DGG A;  3L27 A;  3L25 A;  2RKO A;  2LXE A;  3KP0 E;  3HWS A;  3GQ4 A;  5FLX S;  2CHQ A;  1YU3 A;  3U6O A;  5DYI A;  3PNV A;  1KFV A;  2UUC M;  2RGH A;  3ILK A;  4FVM A;  3GO8 A;  5JI2 E;  1G59 A;  3VKG A;  1C1K A;  1X37 A;  2CHG A;  3SAR A;  4DR2 M;  1IY0 A;  3PFI A;  4LG2 A;  1L8Q A;  4GC9 A;  2OPF A;  1Z5B A;  2QP9 X;  4LJ6 A;  2EA0 A;  4NXM M;  1G3I A;  4D80 A;  1L2C A;  4XBO A;  2R4J A;  2K47 A;  3GLI A;  2YNM D;  4LJ9 A;  3TPZ A;  3U6C A;  2XGN A;  1NY5 A;  4JI5 M;  3I51 A;  2UUB M;  1NSF A;  3NWL A;  2BNK A;  2A5Y B;  2KRU A;  4OW0 A;  3L28 A;  4QHT A;  1NHG C;  3HGI A;  1L2D A;  4AG5 A;  3FTC A;  4FCV A;  2ZM6 M;  3J80 S;  3GRV A;  3U6D A;  2E5L M;  3SAS A;  1JQJ C;  2KA6 B;  4AQY M;  4LJ7 A;  3TWM A;  2C96 A;  1IBM M;  1GKI A;  3LQQ A;  2Y0Q A;  3VLF B;  5EQT A;  2UUA M;  2BJW A;  5C1B A;  4ZPX A;  1XHB A;  1WXQ A;  1GLN A;  1IXS B;  1DGH B;  2V6Z M;  3HHY A;  3K1J A;  2DVW B;  4MH0 E;  1KYI A;  1MX0 A;  5E6J A;  1N36 M;  3R9X B;  3GLG B;  4LF7 M;  4DV7 M;  4LFA M;  4FCT A;  4FW9 A;  1HR0 M;  3FYD A;  1IY1 A;  3Q8X A;  2H1R A;  3HHW A;  4G4O A;  2Y20 A;  4DV2 M;  3B9P A;  3FUU A;  2Y2J A;  4B7F A;  4MGH A;  1XC8 A;  4KLN A;  3U61 B;  3J7A S;  4JI2 M;  3GLH B;  4QNM A;  2Y2Q A;  2V1C A;  1XWI A;  4AI6 A;  3L29 A;  2Y2K A;  2R18 A;  3HHZ A;  1TGU A;  4L16 A;  1PM5 A;  4OJL A;  1YU4 A;  5BPV A;  1DGH A;  2XEP A;  2BG1 A;  4LGY A;  1PJI A;  4GIT A;  1QVR A;  2CV2 A;  3KS4 A;  4I4L A;  2CHV A;  4IBE A;  3NBI A;  3C58 A;  1HQC A;  5ITX A;  4PDG A;  3GQ5 A;  3FTE A;  4QOZ C;  4XGI A;  3LQR A;  2I7N A;  2R4E A;  3KOW E;  1IXR C;  1S3S A;  3K8Z A;  2KW0 A;  1OFH A;  2CFO A;  2KXE A;  2EO2 A;  3WX7 A;  3L26 A;  5LMN M;  2JCH A;  3T1H M;  4L15 A;  3M7G A;  1YU0 A;  4JI3 M;  1DGB A;  4G6Z A;  4OUI A;  3FUV A;  5EXS A;  1IBK M;  1HNW M;  4OJ5 A;  3PXG A;  4JN6 A;  3SAV A;  1IN8 A;  1HQY E;  3KOZ E;  3SAU A;  4NSO B;  1K3X A;  5A2Q S;  1EE8 A;  4NY2 A;  5EP2 A;  4X62 M;  2VQE M;  4G4N A;  1IXZ A;  1NJG A;  3PVS A;  4DV3 M;  4NZ1 A;  3U6E A;  4PD2 A;  3RGS A;  4MB7 A;  2JA2 A;  4RNA A;  4DR1 M;  4QHS A;  1N33 M;  3GP1 A;  3DFZ A;  4X64 M;  4AKI A;  2P5T A;  2JE5 A;  1GL6 A;  4L4U A;  1SXJ C;  5ITQ A;  2YFQ A;  4R7G A;  1ORY B;  4B7G A;  4OVZ B;  1XXH A;  3HJS A;  4B08 A;  3J81 S;  2CV1 A;  3AJI B;  1TH3 A;  1QAN A;  3ZCB B;  2ERC A;  4X65 M;  1K82 A;  3AKZ A;  4B3S M;  1IN4 A;  3U5Z A;  1Q3C A;  4CGY B;  4LZZ A;  5ITU A;  4NRW A;  3SC3 A;  2Y2O A;  1IQP A;  2DWZ B;  4HL4 A;  2UXC M;  4DR3 M;  4IBB A;  4GH9 A;  3U6M A;  4BLC A;  2R65 A;  3MHV C;  2C98 A;  4NSR A;  2DXI A;  3T1Y M;  3AFH A;  3SYK A;  2Y2L A;  3GPU A;  3FTD A;  5ITT A;  2VII A;  2XSZ D;  3ZC7 B;  1TDH A;  1Z5A A;  3FUX A;  4GC5 A;  4R3D A;  3HU3 A;  3GPY A;  4B3M M;  3LVV A;  4Z8X A;  1FJG M;  3HSH A;  1QAQ A;  3KP1 E;  3FUT A;  2QBY B;  1HNZ M;  3SBJ A;  4D81 A;  4DV6 M;  1QYR A;  5KPR A;  2DZN B;  2EUC A;  4JV5 M;  3A45 A;  4AKG A;  2Q2E B;  1HT2 E;  1XXH B;  1W5T A;  3ZH9 B;  2KEB A;  3EIE A;  3EIH A;  2QPA A;  4JI8 M;  1SXJ A;  2FNA A;  4QNL A;  5EXX A;  4OJ6 A;  2I7P A;  2L09 A;  2F5N A;  4BB9 A;  4MGK E;  5LMU M;  3AOG A;  1YUB A;  5EXP A;  3CF6 E;  4FWD A;  4HLQ A;  3SMS A;  3KXE C;  1SXJ B;  5KPT A;  4LY6 A;  2IOU A;  4DV4 M;  4JYA M;  4NOO B;  4G4R A;  4OU7 A;  2UWX A;  1YSY A;  3U6P A;  4LJ5 A;  1YU2 A;  4ITQ A;  1XNQ M;  8CAT A;  3SHF A;  1E9R A;  2XD1 A;  4NRV A;  3HU2 A;  1R7R A;  4PCZ A;  2QBY A;  3MK6 A;  5KO3 A;  3JR4 A;  4PT5 A;  1DO0 A;  3VDU A;  2Z4S A;  4LFB M;  1ZQ9 A;  1IN7 A;  3QAU A;  4DR5 M;  3GPP A;  4RF0 A;  4IJF A;  5FTL A;  2G8L A;  2F5P A;  3WHK A;  2Z3X A;  2L6O A;  4GHA A;  4M0D A;  1LV7 A;  4S12 A;  1IBL M;  3VDP A;  3GLI B;  4DR4 M;  3HON A;  2C5R A;  4NYU A;  1FNN A;  3T15 A;  1GL7 A;  1SXJ E;  3FD9 A;  1R2Y A;  4A3V B;  2XZF A;  3UJN A;  1NJF A;  2XZU A;  1G41 A;  4YHH M;  2XSZ A;  4FD2 A;  4NL4 H;  1XNR M;  1NHW C;  4NZ3 A;  3UMM A;  4DUY M;  3U61 A;  4IBG A;  4MM3 B;  2F4V M;  2Y0T A;  4DV5 M;  2FFJ A;  2UXB M;  5EP3 A;  3AL0 C;  2FE8 A;  2LNH C;  2Z4R A;  2QZ4 A;  4JXJ A;  2M60 A;  2OQ4 A;  3M0E A;  2G5G X;  1DGF A;  4NXN M;  2Y2H A;  4CHT B;  4DV0 M;  1NY6 A;  2Y2M A;  4IBD A;  2Y2P A;  3WHL A;  2HHH M;  1Z59 A;  5EP4 A;  2J7N A;  3U60 A;  1R6B X;  3TWK A;  4I8O A;  3L2A A;  2BJV A;  2AHM A;  3RE8 A;  1I4W A;  4D82 A;  5KQD A;  4B3T M;  4FWH A;  4WUR A;  4DV1 M;  3KSJ A;  3KVW A;  2HKJ A;  3U60 B;  4QOS A;  3HKP A;  4JI0 M;  1J09 A;  1W5S A;  1N32 M;  1IY2 A;  1E32 A;  2X49 A;  3AOE A;  2XLJ A;  5EXT A;  4LJ8 A;  3DA1 A;  2D7G A;  2W82 A;  1G8P A;  4Z6Y A;  1J7K A;  2ZAN A;  1QAO A;  1NNJ A;  2FOI C;  1HT1 E;  2KZU A;  4IBK A;  4LCB A;  1G4A E;  2L7H A;  3A42 A;  3CTW B;  3K92 A;  4NZ4 A;  3SYL A;  2CUZ A;  4DR7 M;  1JR3 D;  3J27 B;  3GLF A;  5FTM A;  2RGO A;  2HL7 A;  4CIS A;  2FFF B;  4M9X A;  4LF8 M;  3KDS E;  3T38 A;  5E26 A;  5GKN A;  5EJC A;  2CEA A;  1HNX M;  1NVM A;  1PJJ A;  3IG8 A;  4NZ5 A;  5H37 D;  3PNY A;  1H6U A;  3KOY E;  2J7O A;  3GLH A;  4OX9 M;  5FSW A;  3RFW A;  3SMP A;  3FKE A;  2HCB A;  2DHR A;  4BBA A;  5ITY A;  5IRE B;  3KSX A;  3CF2 A;  3GQ3 A;  4LFC M;  1J5E M;  3FTF A;  4TUW A;  4LGM A;  5F3W A;  1E9S A;  3RGP A;  5IT9 S;  1E94 E;  1K3W A;  4IBF A;  2R46 A;  3FUW A;  4GRI A;  2O5R A;  1XMO M;  3TE6 A;  3HJ8 A;  3HJQ A;  5JI3 E;  2ZBK B;  4DR6 M;  3AOE C;  4OJO A;  2XF3 A;  2Y2G A;  5KPZ A;  4JI7 M;  4M0W A;  5FTN A;  1L1Z A;  1Z5C A;  2X8A A;  3FYC A;  3J2P B;  3SHG B;  3VFD A;  2F5O A;  5KQ8 A;  2DZO B;  3D8L A;  2UXD M;  1T3T A;  3UK6 A;  3VKH A;  1Q3B A;  3KOX E;  2Y2I A;  2CE7 A;  4DUZ M;  2NQ8 C;  4LJ4 A;  3CF0 A;  3I4V A;  3QWL A;  4GIP A;  4I5S A;  3GRR A;  4GHL A;  7CAT A;  4L78 A;  5DNY A;  3DOA A;  3MJ5 A;  3GLF B;  2C9O A;  1IN6 A;  3HU1 A;  5IZ7 D;  5DYG A;  1N75 A;  1QAM A;  3I4Y A;  4L8R C;  2F5Q A;  2LH0 A;  2L7I A;  4FCW A;  4MGI E;  3N3F A;  4EIW A;  3TL4 X;  1JR3 A;  4I81 A;  3VK8 A;  1TDZ A;  3U6L A;  5IWA M;  1XMQ M;  3KS8 A;  4B3R M;  4LZJ A;  4LJA A;  5ITX E;  2KZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...