3L2AA

Crystal structure of reston ebola vp35 interferon inhibitory domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
GKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural and Functional Characterization of Reston Ebola Virus VP35 Interferon Inhibitory Domain.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Rna binding protein
total genus 41
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l2aA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l2aA02
3L29A 4IBBA 3FKEA 4GHAA 4IJFA 4IBGA 4GH9A 3L2AA 4IBEA 3KS8A 4IBCA 3L26A 4IBIA 3L25A 3L27A 4IBJA 5BPVA 4IJEA 4LG2A 4IBKA 3L28A 4IBFA 3KS4A 4IBDA 4GHLA
chains in the Genus database with same CATH superfamily
1R4GA 1H0IA 1UR9A 1TH4A 3GLFE 4M9ZA 2Y2PA 2YFQA 2XF3A 2RKOA 3GQ3A 2Z3XA 3NBIA 1X37A 1XMOM 1FJGM 2F5QA 4B3RM 4A3VB 2JA2A 3VLFB 1GXDA 1MU5A 2CUZA 2MR9A 1K82A 2LHCA 2CV2A 1PJJA 2QZ4A 2WSEF 2BJWA 4JV5M 4HMDA 2KA6B 2LVOC 4NSRA 4RF1A 1NV9A 1V34A 5DFLA 3HHZA 1J5EM 1C7YA 2Y2IA 2DAGA 2CP8A 3SMPA 1SG9A 4EIWA 4ITQA 2Z8YM 2EUCA 3ZC7B 4NYUA 3KOXE 1PM5A 1N75A 1G59A 1HNXM 1DGGA 4R7GA 2L6OA 4MGKE 4IBDA 2YR0A 2KDLA 1IBLM 3B74A 1Z5BA 3I51A 3WHKA 3GRUA 2A5YB 3K9OA 1L2DA 1E94E 1EIJA 4HL4A 4MB5A 1G71A 2P5TA 4LCBA 2XZUA 2UUAM 2JY8A 1JR3D 4Z2KA 1UM8A 1ZMWA 3M6AA 4LGMA 4AKIA 2FS1A 1XHBA 1UR8A 3SAUA 1IN8A 2DNAA 2J7OA 3KSXA 3U6OA 1Q3BA 4X64M 1YU4A 2DHYA 1NHGC 1OGGA 4NZ3A 4IBIA 2MH8A 2Z4SA 3PNYA 4M9SA 2OPFA 3H4JA 2L7HA 4HMEA 1S3SA 1RU3A 3HU1A 4IJEA 4DV4M 4JN6A 1G4AE 5ITQA 4LG2A 1H8PA 4NZ5A 2XFSA 4WW0A 4PDGA 3M7PA 3CTWB 4R71A 2JE5A 4TX8A 2VQEM 3GRRA 1HNWM 3HZJA 7CATA 3TL4X 4GEWA 1HR0M 4CISA 2UXDM 1VEJA 2D7GA 3UJNA 4ANRA 3B9PA 4JI7M 2JZ1A 1D0LA 2LVQD 2R46A 2KW0A 1G41A 4D81A 4JI3M 3VKGA 1DV0A 1ORYB 3M0EA 4DR7M 4FCTA 4MGIE 4CIZA 3GLGE 3SBJA 3FUWA 2JWSA 4DR2M 1IN5A 4Z2GA 4NZ1A 4MB3A 2O5RA 2KZUA 3SYLA 4Z2JA 4L78A 1SXJB 3VK7A 2EJSA 2OOAA 3GLGA 4JXJA 2ZANA 3QWLA 3ZCBB 2UU9M 4I81A 4IBFA 4AI6A 3GLHE 4GKKM 4DV3M 2ZM6M 3R9XB 5JI2E 4B7GA 1OTRA 2QHOB 3B89A 2ZBKB 3AFHA 3E21A 1R2ZA 1K3XA 2BWEA 2KNVA 2Y0QA 3FRIA 1QO6A 4AW4A 3FYDA 3FUUA 4MM3B 4REZA 2Y2KA 2X49A 1JR3A 4NOOB 5KQ8A 1W1VA 5IT9S 2RRUA 3QAUA 3GPYA 3KOWE 2XH9A 1IXSB 2HCBA 2HWJA 3R8FA 3L26A 3E9SA 1GLNA 2YNMD 3AL0C 2C98A 3L25A 2H5XA 2QENA 4I4LA 5DYIA 4F1IA 3JR5A 2Y2NA 1NJFA 2L4EA 5E6JA 3HONA 1D2NA 1MJGM 3B7ZA 2JZ0A 4R3DA 2LNHC 1MN3A 3D8LA 4BLCA 2DWZB 2L2DA 1YLAA 3IG5A 3T1HM 3HHWA 4LJ4A 2F5OA 4DV5M 2UXCM 2Y20A 1GABA 1WR1B 3PXGA 4DV1M 1FNNA 1H6UA 4YHHM 5FTNA 3WD3A 3HJQA 3PVSA 3U60B 1E6RA 2NQ8C 4FVMA 4OW0A 3GPXA 4L16A 2YQZA 2CHQA 1W5SA 4IJFA 4P16A 2F5SA 1L8QA 2XSZD 3SAWA 5ITYA 2HL7A 1TDHA 3CF6E 3W68A 2O01F 4NSOB 2J7NA 2Y21A 5EJCA 1LTMA 1D0KA 3T1YM 1JQJC 5FLXS 2LVNC 2QSFX 2JXNA 2LHGA 4MGHA 4NL4H 1NNUC 3BOSA 3U61B 3WD2A 5IWAM 4GC9A 4FCWA 1P3QQ 2I7NA 2VF8A 1T3TA 1QQWA 1V33A 3IG8A 3KOYE 1DGHB 2VIIA 1W5TA 1DO2A 3SYKA 1NJGA 1E9SA 1OAIA 1TTEA 4PT5A 1J7MA 3CGWA 3Q8XA 2VDBB 4NXNM 2V1UA 2RTSA 4FWGA 1WXQA 3HU2A 3U6CA 4OUIA 1NY6A 2DAMA 2FH0A 1OFHA 4IBEA 4G4OA 3HHYA 1L6JA 4S12A 1MX0A 3BXWA 4DUYM 2X8AA 5ITXA 3AV0A 2KHHA 2ZTDA 1AIPC 5DYGA 4B7HA 1V92A 3UK6A 1NO1A 4DR3M 3AOEC 3RE8A 4KHPM 2G8LA 3SARA 3VKHA 1PJIA 5BPVA 2Q2EB 4LZJA 2RGHA 4IBKA 1GKIA 5JI3E 1QDTA 3CF0A 3V76A 3GP1A 4L15A 4JI6M 2Y2HA 1R6BX 4GRIA 3SC3A 2CFOA 2LWXA 1VQ1A 2DWMA 1IY1A 1N33M 3AOEA 1E15A 5FTKA 4FWDA 4G4QA 1IY0A 3J27B 1ZMUA 3W0FA 1OAOC 2WSFF 3EIHA 4OVZA 3GLGB 2V6ZM 4FW9A 5EP3A 5EQTA 2XSZA 1YU2A 3FE3A 1R7RA 2FFJA 2C5RA 5LMUM 2DZOB 1WJ7A 1VDLA 1KFVA 2KRUA 4GITA 4QNMA 4AKGA 3E4RA 1R5LA 3I4YA 4DBGB 3HHXA 2R4JA 3GQ4A 4B3SM 1XC8A 4B3TM 2J5YA 3AJIB 1W1PA 3GLHB 3HX3A 2XFTA 3WD4A 5E26A 1YU0A 2QP9X 3KW6A 1XNRM 1I4WA 2LH0A 2LVAA 1HQYE 4I5SA 4M0DA 4Z2HA 1QAOA 2QPAA 1ZQ9A 2W82A 3U6LA 5DNYA 2C96A 3VDPA 2MGWA 2Y2LA 3MMPA 3OTOM 3Q8GA 2V1CA 2FNAA 2L4FA 4QNLA 5BR8M 2KEBA 1BVSA 4AZFA 3E46A 3TWKA 4DV7M 1Q39A 2F5NA 3UZUA 1TDZA 2XZFA 4DR6M 3FTCA 2HKJA 3KDSE 5IZ7D 2UXBM 4P17A 5KQDA 1PDCA 5KO3A 2DZNB 4LF5M 1HT1E 4JYAM 4IBCA 3GLIE 1ED7A 4OJ6A 4KT0F 1GVNA 1QYRA 4UN2B 1ZMVA 1TF0B 1IXRC 2JCHA 2LVPC 1IFYA 3GLIA 4Q7JA 1R2YA 3MQLA 4LGYA 4QHTA 5FTMA 3THGA 2DXIA 4LFCM 1W1YA 5ITRA 1EE8A 3QYEA 2DHRA 4QOSA 2K47A 1IXZA 1JR3E 3TE6A 1LV7A 3RGSA 3SMSA 3JAMS 1SXJD 3U6MA 2D49A 2EA0A 3K2LA 4NYYA 1IN6A 4TUWA 1ZV1A 1OJLA 4II7A 3MK6A 4GH9A 3FUXA 1HJPA 5FTLA 3VK8A 2XEPA 1VEGA 1T43A 1L1TA 4JI1M 2BNKA 3C58A 3VDUA 1XXHE 1TGUA 3VFDA 2F4VM 1K3WA 3B7NA 3FTDA 1O6IA 3PFIA 4G4NA 1N77A 1GJTA 1XXHA 2KNZA 3H4MA 1VEKA 3LVWA 4G3OA 5EP1A 2VF7A 3RGPA 5C1BA 2DZLA 3SHGB 3ZH9B 4AG6A 3A46A 3TWLA 4LFBM 3D8BA 4LF7M 1PJTA 2BJVA 3KP0E 4RNAA 4FCVA 4Y28F 2F5PA 1NV8A 4B08A 1YU3A 4DV6M 1OGBA 1Q3CA 1L2BA 2OO9A 2UUBM 4NZ4A 1UFZA 4CJ6A 2G5GX 1H0GA 4DV0M 4YY3M 4LRSA 1J7KA 3M7GA 2OOBA 2R62A 1QANA 1G3IA 3KP1E 1IQPA 3U6EA 1KSFX 1Z5AA 2R65A 2R4EA 3C3DA 2JP7A 3L27A 2QCUA 3A42A 3KOZE 2QBYB 1QUTA 2WZJA 3SATA 3GPPA 1NVMA 1SXJC 1L1ZA 4JI0M 2G3QA 4M0WA 4LF4M 3TQSA 1N36M 1YU1A 2R6FA 2EKFA 2EKKA 4QOZC 5FTJA 4OJLA 1ZAEA 3GRVA 5EP4A 1SXJA 4KLNA 2DWNA 1XWIA 4GHAA 2O25A 2RGOA 5KPRA 5KPTA 1W1TA 3HJSA 3BBZA 2M60A 4HEOA 4L4UA 3GO8A 1XMQM 3SAVA 1WGNA 5ITXE 2XLJA 1GO5A 2Z7JA 2ZAOA 4NC6A 2HAKA 1L2CA 3J7AS 4CGYB 4DV2M 1IN7A 1CK7A 1QZMA 3KS8A 1EFUB 1WGLA 1TH2A 1C1KA 3UGJA 2X4AA 2M5ZA 1PRBA 1PGYA 3SHFA 4NY2A 3DZDA 3WD0A 2R0IA 2BG1A 1QDRA 4WURA 4RKUF 3L28A 4XK8F 4X65M 1NHWC 4AQYM 3KFUG 3KS4A 4M9XA 1DO0A 1HQCA 3QYBA 4B3MM 2IOUA 2Y2JA 3LCVB 4LJ7A 2D7HA 5LMNM 4GHLA 2CV0A 3J2PB 2C9OA 1GL6A 2BWBA 2K6BA 2AHMA 2R44A 3FUVA 4IBBA 4F2LA 4Z6YA 4MH0E 3W0LB 3K1JA 5F3WA 1N34M 4GMQA 3FTEA 2Y2GA 2XGNA 1OKSA 1OQYA 3GLIB 2CHVA 3ZQJA 4PDIA 3GLFA 2EO2A 2UUCM 4L8RC 2LTUA 3HJ8A 2D7EA 3A98B 3HSHA 4BBAA 4DR1M 4NRVA 2Y0TA 3I4VA 3U60A 1WIVA 3DFZA 3T15A 4LF9M 3WHLA 3F92A 3K92A 3RFWA 1OIZA 4GKJM 2DI0A 1Z5CA 1N32M 4DR4M 3HU3A 4K0KM 2I7PA 4JI8M 1E6PA 2E5LM 1E9RA 3U6SA 1NSFA 2C99A 5A2QS 2FFFB 4MB4A 4JI5M 4KO8A 3J80S 3K9PA 2Y2MA 2B3TA 4FD2A 2APLA 3LVVA 1A5TA 1OFIA 1Z6TA 4JI4M 4W5WA 1E32A 3U61A 4G4RA 2L09A 1IBKM 1XNQM 5ITUA 1XXHB 3U5ZB 1GJSA 3NBXX 5C18A 5KPZA 3AOGA 1AIWA 4XGIA 3B7QA 4Z2IA 1VDDA 2DAEA 4LJ6A 1DGHA 1Z59A 1E88A 1OIPA 1YSYA 1E6NA 2QBYA 4DUZM 4HMCA 4QHSA 1QUSA 3I01M 2OQ4A 2H1RA 3KVWA 4OX9M 3J7BA 4IBJA 3FUTA 4IIWA 2XD1A 2V5OA 2LXEA 1QAQA 2ERCA 5GKNA 4LRTA 4LY6A 4XBOA 3GRYA 2R45A 4AG5A 1KS0A 4Z8XA 5EXXA 4LJ9A 2LBCA 1F4IA 2FN2A 4MGYE 2DVWB 1IY2A 2JY6B 3FTFA 3LW5F 2N35A 4LJAA 2C9CA 4B7FA 3FKEA 4NXMM 3K8ZA 4LJ8A 2JY5A 1KYIA 3CF2A 3FRHA 3HGIA 3NWLA 1NNJA 2CV1A 3I04M 2CRUA 4LF6M 4GIPA 1D0MA 2KZSA 4MGZE 3J81S 4L6V6 2K0BX 4PD2A 4NRWA 2DAIA 5ITTA 4X62M 3IHPA 1G8PA 3PNVA 3A45A 1IN4A 2FOIC 1QZEA 3LMMA 2VQFM 2DWLA 2Y2OA 3AKZA 1Q02A 4RF0A 3WD1A 1DGBA 3DOAA 5H37D 4OJ5A 1T6OA 4D80A 3KXEC 4LZZA 3EIEA 4BB9A 1JB0F 2ZAMA 4OJPA 1VG5A 2QNJA 2CE7A 4QNRA 2CHGA 3GLHA 3FD9A 3C9PA 4FWHA 3GPUA 3U6QA 1EAKA 2CEAA 2GQFA 2KXEA 3TWMA 1IBMM 1CUKA 4G6ZA 3HKPA 1YE9A 4WP2A 1QAMA 4LJ5A 5EXSA 2XD5A 2L7IA 2CWBA 2JNHA 1AUAA 3HWSA 1TR8A 2GNOA 2WSCF 3MHVC 3MJ5A 1PJQA 2Z4RA 3T38A 5EXTA 2Y2QA 4OVZB 2KNAA 3TPZA 3DA1A 4HLQA 3ILKA 4ZPXA 2DAKA 3LQQA 4MB7A 4CHTB 3KSJA 3GLFB 2UWXA 3N3FA 3U6DA 3SFZA 1SXJE 1HNZM 4LF8M 2R18A 4X66M 4OJOA 3HY5A 3U6PA 1XB2B 2KRKA 3IECA 3L29A 3C3EA 3UMMA 8CATA 1E8BA 1I94M 4LFAM 4GC5A 3WX7A 1DGFA 4IBGA 4D82A 1Y8GA 3L2AA 5L8RF 1CXWA 1YUEA 2JUJA 3FYCA 1IM2A 4PCZA 4DR5M 2ZTCA 3U5ZA 3LCUA 2QQ8A 1GL7A 1NY5A 1HT2E 2FE8A 4I8OA 1N78A 1E6ZA 1GOIA 1J09A 3LQRA 5EP2A 4KODA 2DENA 2MROB 3GQ5A 3T6PA 3JR4A 1TH3A 3SASA 4AKHA 1PJSA 4OU7A 2JY7A 1GPFA 2MJ5B 5IREB 2DKLA 1WHCA 5FSWA 2K9DA 3W67A 1YUBA 1IXSA 5EXPA 4JI2M 1QVRA 4Z2LA 2HHHM
chains in the Genus database with same CATH topology
1TH4A 2Y2PA 4M9ZA 2YFQA 2XF3A 2RKOA 3GQ3A 2Z3XA 3NBIA 1X37A 1XMOM 1FJGM 2F5QA 4B3RM 4A3VB 2JA2A 3VLFB 1MU5A 2CUZA 1K82A 2CV2A 1PJJA 2QZ4A 4JV5M 2BJWA 2KA6B 4NSRA 4RF1A 3HHZA 1J5EM 2Y2IA 3SMPA 4EIWA 4ITQA 2EUCA 3ZC7B 4NYUA 3KOXE 1PM5A 1N75A 1G59A 1HNXM 1DGGA 4R7GA 2L6OA 4MGKE 4IBDA 2YR0A 1IBLM 1Z5BA 3I51A 3WHKA 3GRUA 2A5YB 1L2DA 1E94E 4HL4A 2P5TA 4LCBA 2XZUA 2UUAM 1JR3D 1UM8A 3M6AA 4LGMA 4AKIA 1XHBA 3SAUA 1IN8A 3KSXA 2J7OA 3U6OA 1Q3BA 4X64M 1YU4A 1NHGC 4NZ3A 4IBIA 2Z4SA 3PNYA 4M9SA 2OPFA 2L7HA 1S3SA 3HU1A 4DV4M 4IJEA 4JN6A 1G4AE 5ITQA 4LG2A 4NZ5A 2XFSA 4WW0A 4PDGA 3CTWB 2JE5A 2VQEM 3GRRA 1HNWM 7CATA 3TL4X 1HR0M 4CISA 2UXDM 2D7GA 3UJNA 3B9PA 4JI7M 2R46A 2KW0A 1G41A 4D81A 4JI3M 3VKGA 1ORYB 3M0EA 4DR7M 4FCTA 4MGIE 3SBJA 3FUWA 4DR2M 1IN5A 4NZ1A 2O5RA 2KZUA 3SYLA 4L78A 1SXJB 3VK7A 3GLGA 4JXJA 2ZANA 3QWLA 3ZCBB 2UU9M 4I81A 4IBFA 4AI6A 4GKKM 4DV3M 2ZM6M 3R9XB 5JI2E 4B7GA 1K3XA 1N78A 2ZBKB 3AFHA 1R2ZA 2Y0QA 4AW4A 3FYDA 3FUUA 4MM3B 4REZA 2Y2KA 2X49A 1JR3A 4NOOB 5KQ8A 5IT9S 3QAUA 3GPYA 3KOWE 2XH9A 1IXSB 2HCBA 3R8FA 3L26A 3E9SA 1GLNA 2YNMD 3AL0C 2C98A 3L25A 2QENA 4I4LA 5DYIA 3JR5A 2Y2NA 1NJFA 5E6JA 3HONA 1D2NA 4R3DA 2LNHC 3D8LA 4BLCA 2DWZB 3IG5A 3T1HM 3HHWA 4LJ4A 2F5OA 4DV5M 2UXCM 2Y20A 3PXGA 4DV1M 1FNNA 1H6UA 4YHHM 5FTNA 3HJQA 3PVSA 3U60B 2NQ8C 4FVMA 4OW0A 3GPXA 4L16A 2YQZA 2CHQA 1W5SA 4IJFA 4P16A 2F5SA 1L8QA 2XSZD 3SAWA 5ITYA 2HL7A 1TDHA 3CF6E 4NSOB 2J7NA 2Y21A 5EJCA 3T1YM 1JQJC 5FLXS 4MGHA 4NL4H 1NNUC 3BOSA 3U61B 5IWAM 4GC9A 4FCWA 2I7NA 1T3TA 1QQWA 3IG8A 3KOYE 1DGHB 2VIIA 1W5TA 1DO2A 3SYKA 1NJGA 1E9SA 4PT5A 3Q8XA 4NXNM 2V1UA 4FWGA 1WXQA 3HU2A 3U6CA 4OUIA 1NY6A 1OFHA 4IBEA 4G4OA 3HHYA 4S12A 1MX0A 4DUYM 2X8AA 5ITXA 3AV0A 5DYGA 4B7HA 3UK6A 4DR3M 3AOEC 3RE8A 4KHPM 2G8LA 3SARA 3VKHA 1PJIA 5BPVA 2Q2EB 4LZJA 2RGHA 4IBKA 1GKIA 5JI3E 3CF0A 3GP1A 4L15A 4JI6M 2Y2HA 1R6BX 4GRIA 3SC3A 2CFOA 2LWXA 1N33M 2DWMA 1IY1A 3AOEA 5FTKA 4FWDA 4G4QA 1IY0A 3J27B 3W0FA 3EIHA 4OVZA 3GLGB 2V6ZM 4FW9A 5EP3A 5EQTA 2XSZA 1YU2A 1R7RA 2FFJA 2C5RA 5LMUM 2DZOB 1KFVA 2KRUA 4GITA 4QNMA 4AKGA 3E4RA 3I4YA 3HHXA 2R4JA 3GQ4A 4B3SM 1XC8A 4B3TM 3AJIB 3GLHB 2XFTA 5E26A 1YU0A 2QP9X 3KW6A 1XNRM 1I4WA 2LH0A 4I5SA 1HQYE 4M0DA 1QAOA 2QPAA 1ZQ9A 2W82A 3U6LA 5DNYA 2C96A 3VDPA 2Y2LA 3OTOM 2V1CA 2FNAA 4QNLA 5BR8M 2KEBA 4AZFA 3TWKA 4DV7M 1Q39A 2F5NA 3UZUA 1TDZA 2XZFA 4DR6M 3FTCA 2HKJA 3KDSE 5IZ7D 2UXBM 5KQDA 5KO3A 2DZNB 4LF5M 1HT1E 4JYAM 4IBCA 4OJ6A 1GVNA 1QYRA 1IXRC 2JCHA 3GLIA 1R2YA 4LGYA 4QHTA 5FTMA 3THGA 2DXIA 4LFCM 5ITRA 1EE8A 2DHRA 4QOSA 2K47A 1IXZA 3TE6A 1LV7A 3RGSA 3SMSA 3JAMS 1SXJD 3U6MA 2EA0A 3K2LA 4NYYA 1IN6A 4TUWA 4II7A 1OJLA 3MK6A 4GH9A 3FUXA 5FTLA 3VK8A 2XEPA 1L1TA 4JI1M 2BNKA 3C58A 3VDUA 1TGUA 3VFDA 2F4VM 1K3WA 3FTDA 3PFIA 4G4NA 1N77A 1XXHA 3LVWA 3H4MA 3RGPA 3U5ZA 5EP1A 5C1BA 3SHGB 3ZH9B 4AG6A 3A46A 3TWLA 4LFBM 3D8BA 4LF7M 2BJVA 3KP0E 4RNAA 4FCVA 2F5PA 4B08A 1YU3A 4DV6M 1Q3CA 1L2BA 2UUBM 4NZ4A 2G5GX 4DV0M 4YY3M 4LRSA 1J7KA 3M7GA 2R62A 1QANA 1G3IA 3KP1E 1IQPA 3U6EA 1KSFX 1Z5AA 2R65A 2R4EA 3L27A 2QCUA 3A42A 3KOZE 2QBYB 3SATA 3GPPA 1NVMA 1SXJC 1L1ZA 4JI0M 4M0WA 4LF4M 3TQSA 1N36M 1YU1A 4QOZC 5FTJA 4OJLA 1ZAEA 3GRVA 5EP4A 1SXJA 4KLNA 2DWNA 1XWIA 4GHAA 2RGOA 5KPRA 5KPTA 3HJSA 4L4UA 2M60A 3GO8A 1XMQM 3SAVA 5ITXE 2XLJA 2Z7JA 2ZAOA 1L2CA 3J7AS 4CGYB 4DV2M 1IN7A 1QZMA 3KS8A 1TH2A 1C1KA 3UGJA 2X4AA 2M5ZA 3SHFA 4NY2A 3DZDA 2BG1A 4WURA 3L28A 4X65M 1NHWC 4AQYM 3KFUG 3KS4A 4M9XA 1DO0A 1HQCA 2Y2JA 4B3MM 2IOUA 4LJ7A 2D7HA 5LMNM 4GHLA 2CV0A 3J2PB 2C9OA 1GL6A 4IBBA 4Z6YA 2AHMA 3FUVA 5F3WA 1N34M 4MH0E 3W0LB 3K1JA 4GMQA 3FTEA 2Y2GA 2XGNA 3GLIB 2CHVA 4PDIA 3GLFA 2EO2A 2UUCM 4L8RC 3HJ8A 2D7EA 3A98B 3HSHA 4BBAA 4DR1M 4NRVA 2Y0TA 3I4VA 3U60A 3DFZA 3T15A 4LF9M 3WHLA 3RFWA 3K92A 4GKJM 1N32M 1Z5CA 4DR4M 3HU3A 4K0KM 2I7PA 4JI8M 2E5LM 1E9RA 3U6SA 1NSFA 2C99A 5A2QS 2FFFB 4JI5M 4KO8A 3J80S 2Y2MA 4FD2A 3LVVA 1OFIA 1Z6TA 4JI4M 4W5WA 1E32A 3U61A 4G4RA 2L09A 1IBKM 1XNQM 5ITUA 1XXHB 3U5ZB 5C18A 5KPZA 3AOGA 4XGIA 1VDDA 4LJ6A 1DGHA 1Z59A 1YSYA 2QBYA 4DUZM 4QHSA 2OQ4A 2H1RA 3KVWA 4OX9M 3J7BA 4IBJA 3FUTA 4IIWA 2XD1A 2LXEA 1QAQA 2ERCA 5GKNA 4LRTA 4LY6A 4XBOA 3GRYA 2R45A 4AG5A 4Z8XA 5EXXA 4LJ9A 4MGYE 2DVWB 1IY2A 3FTFA 4LJAA 4B7FA 2C9CA 3FKEA 4NXMM 3K8ZA 4LJ8A 3CF2A 1KYIA 3HGIA 3NWLA 1NNJA 2CV1A 4LF6M 4GIPA 2KZSA 4MGZE 3J81S 4PD2A 4NRWA 5ITTA 4X62M 1G8PA 3PNVA 3A45A 1IN4A 2FOIC 3LMMA 2VQFM 2DWLA 2Y2OA 3AKZA 4RF0A 1DGBA 3DOAA 5H37D 4OJ5A 4D80A 3KXEC 4LZZA 3EIEA 4BB9A 2ZAMA 4OJPA 2CE7A 4QNRA 2CHGA 3GLHA 3FD9A 3GPUA 4FWHA 3U6QA 2CEAA 2KXEA 1IBMM 3TWMA 4G6ZA 3HKPA 1YE9A 1QAMA 4LJ5A 5EXSA 2XD5A 2L7IA 3HWSA 3MJ5A 3MHVC 2Z4RA 3T38A 5EXTA 2Y2QA 4OVZB 3TPZA 3DA1A 4HLQA 3ILKA 4ZPXA 3LQQA 4MB7A 4CHTB 2UWXA 3KSJA 3GLFB 3N3FA 3U6DA 3SFZA 1SXJE 1HNZM 4LF8M 2R18A 4X66M 4OJOA 3U6PA 2KRKA 3L29A 3UMMA 8CATA 1I94M 4LFAM 4GC5A 3WX7A 1DGFA 4IBGA 4D82A 3L2AA 1YUEA 3FYCA 1IM2A 4PCZA 4DR5M 1GL7A 1NY5A 1HT2E 2FE8A 4I8OA 1J09A 3LQRA 5EP2A 4KODA 3GQ5A 3JR4A 1TH3A 3SASA 4AKHA 4OU7A 5IREB 5FSWA 1YUBA 5EXPA 4JI2M 1QVRA 2HHHM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L29 A;  4IBB A;  3FKE A;  4GHA A;  4IJF A;  4IBG A;  4GH9 A;  3L2A A;  4IBE A;  3KS8 A;  4IBC A;  3L26 A;  4IBI A;  3L25 A;  3L27 A;  4IBJ A;  5BPV A;  4IJE A;  4LG2 A;  4IBK A;  3L28 A;  4IBF A;  3KS4 A;  4IBD A;  4GHL A; 
#chains in the Genus database with same CATH topology
 1R4G A;  1H0I A;  1UR9 A;  1TH4 A;  3GLF E;  4M9Z A;  2Y2P A;  2YFQ A;  2XF3 A;  2RKO A;  3GQ3 A;  2Z3X A;  3NBI A;  1X37 A;  1XMO M;  1FJG M;  2F5Q A;  4B3R M;  4A3V B;  2JA2 A;  3VLF B;  1GXD A;  1MU5 A;  2CUZ A;  2MR9 A;  1K82 A;  2LHC A;  2CV2 A;  1PJJ A;  2QZ4 A;  2WSE F;  2BJW A;  4JV5 M;  4HMD A;  2KA6 B;  2LVO C;  4NSR A;  4RF1 A;  1NV9 A;  1V34 A;  5DFL A;  3HHZ A;  1J5E M;  1C7Y A;  2Y2I A;  2DAG A;  2CP8 A;  3SMP A;  1SG9 A;  4EIW A;  4ITQ A;  2Z8Y M;  2EUC A;  3ZC7 B;  4NYU A;  3KOX E;  1PM5 A;  1N75 A;  1G59 A;  1HNX M;  1DGG A;  4R7G A;  2L6O A;  4MGK E;  4IBD A;  2YR0 A;  2KDL A;  1IBL M;  3B74 A;  1Z5B A;  3I51 A;  3WHK A;  3GRU A;  2A5Y B;  3K9O A;  1L2D A;  1E94 E;  1EIJ A;  4HL4 A;  4MB5 A;  1G71 A;  2P5T A;  4LCB A;  2XZU A;  2UUA M;  2JY8 A;  1JR3 D;  4Z2K A;  1UM8 A;  1ZMW A;  3M6A A;  4LGM A;  4AKI A;  2FS1 A;  1XHB A;  1UR8 A;  3SAU A;  1IN8 A;  2DNA A;  2J7O A;  3KSX A;  3U6O A;  1Q3B A;  4X64 M;  1YU4 A;  2DHY A;  1NHG C;  1OGG A;  4NZ3 A;  4IBI A;  2MH8 A;  2Z4S A;  3PNY A;  4M9S A;  2OPF A;  3H4J A;  2L7H A;  4HME A;  1S3S A;  1RU3 A;  3HU1 A;  4IJE A;  4DV4 M;  4JN6 A;  1G4A E;  5ITQ A;  4LG2 A;  1H8P A;  4NZ5 A;  2XFS A;  4WW0 A;  4PDG A;  3M7P A;  3CTW B;  4R71 A;  2JE5 A;  4TX8 A;  2VQE M;  3GRR A;  1HNW M;  3HZJ A;  7CAT A;  3TL4 X;  4GEW A;  1HR0 M;  4CIS A;  2UXD M;  1VEJ A;  2D7G A;  3UJN A;  4ANR A;  3B9P A;  4JI7 M;  2JZ1 A;  1D0L A;  2LVQ D;  2R46 A;  2KW0 A;  1G41 A;  4D81 A;  4JI3 M;  3VKG A;  1DV0 A;  1ORY B;  3M0E A;  4DR7 M;  4FCT A;  4MGI E;  4CIZ A;  3GLG E;  3SBJ A;  3FUW A;  2JWS A;  4DR2 M;  1IN5 A;  4Z2G A;  4NZ1 A;  4MB3 A;  2O5R A;  2KZU A;  3SYL A;  4Z2J A;  4L78 A;  1SXJ B;  3VK7 A;  2EJS A;  2OOA A;  3GLG A;  4JXJ A;  2ZAN A;  3QWL A;  3ZCB B;  2UU9 M;  4I81 A;  4IBF A;  4AI6 A;  3GLH E;  4GKK M;  4DV3 M;  2ZM6 M;  3R9X B;  5JI2 E;  4B7G A;  1OTR A;  2QHO B;  3B89 A;  2ZBK B;  3AFH A;  3E21 A;  1R2Z A;  1K3X A;  2BWE A;  2KNV A;  2Y0Q A;  3FRI A;  1QO6 A;  4AW4 A;  3FYD A;  3FUU A;  4MM3 B;  4REZ A;  2Y2K A;  2X49 A;  1JR3 A;  4NOO B;  5KQ8 A;  1W1V A;  5IT9 S;  2RRU A;  3QAU A;  3GPY A;  3KOW E;  2XH9 A;  1IXS B;  2HCB A;  2HWJ A;  3R8F A;  3L26 A;  3E9S A;  1GLN A;  2YNM D;  3AL0 C;  2C98 A;  3L25 A;  2H5X A;  2QEN A;  4I4L A;  5DYI A;  4F1I A;  3JR5 A;  2Y2N A;  1NJF A;  2L4E A;  5E6J A;  3HON A;  1D2N A;  1MJG M;  3B7Z A;  2JZ0 A;  4R3D A;  2LNH C;  1MN3 A;  3D8L A;  4BLC A;  2DWZ B;  2L2D A;  1YLA A;  3IG5 A;  3T1H M;  3HHW A;  4LJ4 A;  2F5O A;  4DV5 M;  2UXC M;  2Y20 A;  1GAB A;  1WR1 B;  3PXG A;  4DV1 M;  1FNN A;  1H6U A;  4YHH M;  5FTN A;  3WD3 A;  3HJQ A;  3PVS A;  3U60 B;  1E6R A;  2NQ8 C;  4FVM A;  4OW0 A;  3GPX A;  4L16 A;  2YQZ A;  2CHQ A;  1W5S A;  4IJF A;  4P16 A;  2F5S A;  1L8Q A;  2XSZ D;  3SAW A;  5ITY A;  2HL7 A;  1TDH A;  3CF6 E;  3W68 A;  2O01 F;  4NSO B;  2J7N A;  2Y21 A;  5EJC A;  1LTM A;  1D0K A;  3T1Y M;  1JQJ C;  5FLX S;  2LVN C;  2QSF X;  2JXN A;  2LHG A;  4MGH A;  4NL4 H;  1NNU C;  3BOS A;  3U61 B;  3WD2 A;  5IWA M;  4GC9 A;  4FCW A;  1P3Q Q;  2I7N A;  2VF8 A;  1T3T A;  1QQW A;  1V33 A;  3IG8 A;  3KOY E;  1DGH B;  2VII A;  1W5T A;  1DO2 A;  3SYK A;  1NJG A;  1E9S A;  1OAI A;  1TTE A;  4PT5 A;  1J7M A;  3CGW A;  3Q8X A;  2VDB B;  4NXN M;  2V1U A;  2RTS A;  4FWG A;  1WXQ A;  3HU2 A;  3U6C A;  4OUI A;  1NY6 A;  2DAM A;  2FH0 A;  1OFH A;  4IBE A;  4G4O A;  3HHY A;  1L6J A;  4S12 A;  1MX0 A;  3BXW A;  4DUY M;  2X8A A;  5ITX A;  3AV0 A;  2KHH A;  2ZTD A;  1AIP C;  5DYG A;  4B7H A;  1V92 A;  3UK6 A;  1NO1 A;  4DR3 M;  3AOE C;  3RE8 A;  4KHP M;  2G8L A;  3SAR A;  3VKH A;  1PJI A;  5BPV A;  2Q2E B;  4LZJ A;  2RGH A;  4IBK A;  1GKI A;  5JI3 E;  1QDT A;  3CF0 A;  3V76 A;  3GP1 A;  4L15 A;  4JI6 M;  2Y2H A;  1R6B X;  4GRI A;  3SC3 A;  2CFO A;  2LWX A;  1VQ1 A;  2DWM A;  1IY1 A;  1N33 M;  3AOE A;  1E15 A;  5FTK A;  4FWD A;  4G4Q A;  1IY0 A;  3J27 B;  1ZMU A;  3W0F A;  1OAO C;  2WSF F;  3EIH A;  4OVZ A;  3GLG B;  2V6Z M;  4FW9 A;  5EP3 A;  5EQT A;  2XSZ A;  1YU2 A;  3FE3 A;  1R7R A;  2FFJ A;  2C5R A;  5LMU M;  2DZO B;  1WJ7 A;  1VDL A;  1KFV A;  2KRU A;  4GIT A;  4QNM A;  4AKG A;  3E4R A;  1R5L A;  3I4Y A;  4DBG B;  3HHX A;  2R4J A;  3GQ4 A;  4B3S M;  1XC8 A;  4B3T M;  2J5Y A;  3AJI B;  1W1P A;  3GLH B;  3HX3 A;  2XFT A;  3WD4 A;  5E26 A;  1YU0 A;  2QP9 X;  3KW6 A;  1XNR M;  1I4W A;  2LH0 A;  2LVA A;  1HQY E;  4I5S A;  4M0D A;  4Z2H A;  1QAO A;  2QPA A;  1ZQ9 A;  2W82 A;  3U6L A;  5DNY A;  2C96 A;  3VDP A;  2MGW A;  2Y2L A;  3MMP A;  3OTO M;  3Q8G A;  2V1C A;  2FNA A;  2L4F A;  4QNL A;  5BR8 M;  2KEB A;  1BVS A;  4AZF A;  3E46 A;  3TWK A;  4DV7 M;  1Q39 A;  2F5N A;  3UZU A;  1TDZ A;  2XZF A;  4DR6 M;  3FTC A;  2HKJ A;  3KDS E;  5IZ7 D;  2UXB M;  4P17 A;  5KQD A;  1PDC A;  5KO3 A;  2DZN B;  4LF5 M;  1HT1 E;  4JYA M;  4IBC A;  3GLI E;  1ED7 A;  4OJ6 A;  4KT0 F;  1GVN A;  1QYR A;  4UN2 B;  1ZMV A;  1TF0 B;  1IXR C;  2JCH A;  2LVP C;  1IFY A;  3GLI A;  4Q7J A;  1R2Y A;  3MQL A;  4LGY A;  4QHT A;  5FTM A;  3THG A;  2DXI A;  4LFC M;  1W1Y A;  5ITR A;  1EE8 A;  3QYE A;  2DHR A;  4QOS A;  2K47 A;  1IXZ A;  1JR3 E;  3TE6 A;  1LV7 A;  3RGS A;  3SMS A;  3JAM S;  1SXJ D;  3U6M A;  2D49 A;  2EA0 A;  3K2L A;  4NYY A;  1IN6 A;  4TUW A;  1ZV1 A;  1OJL A;  4II7 A;  3MK6 A;  4GH9 A;  3FUX A;  1HJP A;  5FTL A;  3VK8 A;  2XEP A;  1VEG A;  1T43 A;  1L1T A;  4JI1 M;  2BNK A;  3C58 A;  3VDU A;  1XXH E;  1TGU A;  3VFD A;  2F4V M;  1K3W A;  3B7N A;  3FTD A;  1O6I A;  3PFI A;  4G4N A;  1N77 A;  1GJT A;  1XXH A;  2KNZ A;  3H4M A;  1VEK A;  3LVW A;  4G3O A;  5EP1 A;  2VF7 A;  3RGP A;  5C1B A;  2DZL A;  3SHG B;  3ZH9 B;  4AG6 A;  3A46 A;  3TWL A;  4LFB M;  3D8B A;  4LF7 M;  1PJT A;  2BJV A;  3KP0 E;  4RNA A;  4FCV A;  4Y28 F;  2F5P A;  1NV8 A;  4B08 A;  1YU3 A;  4DV6 M;  1OGB A;  1Q3C A;  1L2B A;  2OO9 A;  2UUB M;  4NZ4 A;  1UFZ A;  4CJ6 A;  2G5G X;  1H0G A;  4DV0 M;  4YY3 M;  4LRS A;  1J7K A;  3M7G A;  2OOB A;  2R62 A;  1QAN A;  1G3I A;  3KP1 E;  1IQP A;  3U6E A;  1KSF X;  1Z5A A;  2R65 A;  2R4E A;  3C3D A;  2JP7 A;  3L27 A;  2QCU A;  3A42 A;  3KOZ E;  2QBY B;  1QUT A;  2WZJ A;  3SAT A;  3GPP A;  1NVM A;  1SXJ C;  1L1Z A;  4JI0 M;  2G3Q A;  4M0W A;  4LF4 M;  3TQS A;  1N36 M;  1YU1 A;  2R6F A;  2EKF A;  2EKK A;  4QOZ C;  5FTJ A;  4OJL A;  1ZAE A;  3GRV A;  5EP4 A;  1SXJ A;  4KLN A;  2DWN A;  1XWI A;  4GHA A;  2O25 A;  2RGO A;  5KPR A;  5KPT A;  1W1T A;  3HJS A;  3BBZ A;  2M60 A;  4HEO A;  4L4U A;  3GO8 A;  1XMQ M;  3SAV A;  1WGN A;  5ITX E;  2XLJ A;  1GO5 A;  2Z7J A;  2ZAO A;  4NC6 A;  2HAK A;  1L2C A;  3J7A S;  4CGY B;  4DV2 M;  1IN7 A;  1CK7 A;  1QZM A;  3KS8 A;  1EFU B;  1WGL A;  1TH2 A;  1C1K A;  3UGJ A;  2X4A A;  2M5Z A;  1PRB A;  1PGY A;  3SHF A;  4NY2 A;  3DZD A;  3WD0 A;  2R0I A;  2BG1 A;  1QDR A;  4WUR A;  4RKU F;  3L28 A;  4XK8 F;  4X65 M;  1NHW C;  4AQY M;  3KFU G;  3KS4 A;  4M9X A;  1DO0 A;  1HQC A;  3QYB A;  4B3M M;  2IOU A;  2Y2J A;  3LCV B;  4LJ7 A;  2D7H A;  5LMN M;  4GHL A;  2CV0 A;  3J2P B;  2C9O A;  1GL6 A;  2BWB A;  2K6B A;  2AHM A;  2R44 A;  3FUV A;  4IBB A;  4F2L A;  4Z6Y A;  4MH0 E;  3W0L B;  3K1J A;  5F3W A;  1N34 M;  4GMQ A;  3FTE A;  2Y2G A;  2XGN A;  1OKS A;  1OQY A;  3GLI B;  2CHV A;  3ZQJ A;  4PDI A;  3GLF A;  2EO2 A;  2UUC M;  4L8R C;  2LTU A;  3HJ8 A;  2D7E A;  3A98 B;  3HSH A;  4BBA A;  4DR1 M;  4NRV A;  2Y0T A;  3I4V A;  3U60 A;  1WIV A;  3DFZ A;  3T15 A;  4LF9 M;  3WHL A;  3F92 A;  3K92 A;  3RFW A;  1OIZ A;  4GKJ M;  2DI0 A;  1Z5C A;  1N32 M;  4DR4 M;  3HU3 A;  4K0K M;  2I7P A;  4JI8 M;  1E6P A;  2E5L M;  1E9R A;  3U6S A;  1NSF A;  2C99 A;  5A2Q S;  2FFF B;  4MB4 A;  4JI5 M;  4KO8 A;  3J80 S;  3K9P A;  2Y2M A;  2B3T A;  4FD2 A;  2APL A;  3LVV A;  1A5T A;  1OFI A;  1Z6T A;  4JI4 M;  4W5W A;  1E32 A;  3U61 A;  4G4R A;  2L09 A;  1IBK M;  1XNQ M;  5ITU A;  1XXH B;  3U5Z B;  1GJS A;  3NBX X;  5C18 A;  5KPZ A;  3AOG A;  1AIW A;  4XGI A;  3B7Q A;  4Z2I A;  1VDD A;  2DAE A;  4LJ6 A;  1DGH A;  1Z59 A;  1E88 A;  1OIP A;  1YSY A;  1E6N A;  2QBY A;  4DUZ M;  4HMC A;  4QHS A;  1QUS A;  3I01 M;  2OQ4 A;  2H1R A;  3KVW A;  4OX9 M;  3J7B A;  4IBJ A;  3FUT A;  4IIW A;  2XD1 A;  2V5O A;  2LXE A;  1QAQ A;  2ERC A;  5GKN A;  4LRT A;  4LY6 A;  4XBO A;  3GRY A;  2R45 A;  4AG5 A;  1KS0 A;  4Z8X A;  5EXX A;  4LJ9 A;  2LBC A;  1F4I A;  2FN2 A;  4MGY E;  2DVW B;  1IY2 A;  2JY6 B;  3FTF A;  3LW5 F;  2N35 A;  4LJA A;  2C9C A;  4B7F A;  3FKE A;  4NXM M;  3K8Z A;  4LJ8 A;  2JY5 A;  1KYI A;  3CF2 A;  3FRH A;  3HGI A;  3NWL A;  1NNJ A;  2CV1 A;  3I04 M;  2CRU A;  4LF6 M;  4GIP A;  1D0M A;  2KZS A;  4MGZ E;  3J81 S;  4L6V 6;  2K0B X;  4PD2 A;  4NRW A;  2DAI A;  5ITT A;  4X62 M;  3IHP A;  1G8P A;  3PNV A;  3A45 A;  1IN4 A;  2FOI C;  1QZE A;  3LMM A;  2VQF M;  2DWL A;  2Y2O A;  3AKZ A;  1Q02 A;  4RF0 A;  3WD1 A;  1DGB A;  3DOA A;  5H37 D;  4OJ5 A;  1T6O A;  4D80 A;  3KXE C;  4LZZ A;  3EIE A;  4BB9 A;  1JB0 F;  2ZAM A;  4OJP A;  1VG5 A;  2QNJ A;  2CE7 A;  4QNR A;  2CHG A;  3GLH A;  3FD9 A;  3C9P A;  4FWH A;  3GPU A;  3U6Q A;  1EAK A;  2CEA A;  2GQF A;  2KXE A;  3TWM A;  1IBM M;  1CUK A;  4G6Z A;  3HKP A;  1YE9 A;  4WP2 A;  1QAM A;  4LJ5 A;  5EXS A;  2XD5 A;  2L7I A;  2CWB A;  2JNH A;  1AUA A;  3HWS A;  1TR8 A;  2GNO A;  2WSC F;  3MHV C;  3MJ5 A;  1PJQ A;  2Z4R A;  3T38 A;  5EXT A;  2Y2Q A;  4OVZ B;  2KNA A;  3TPZ A;  3DA1 A;  4HLQ A;  3ILK A;  4ZPX A;  2DAK A;  3LQQ A;  4MB7 A;  4CHT B;  3KSJ A;  3GLF B;  2UWX A;  3N3F A;  3U6D A;  3SFZ A;  1SXJ E;  1HNZ M;  4LF8 M;  2R18 A;  4X66 M;  4OJO A;  3HY5 A;  3U6P A;  1XB2 B;  2KRK A;  3IEC A;  3L29 A;  3C3E A;  3UMM A;  8CAT A;  1E8B A;  1I94 M;  4LFA M;  4GC5 A;  3WX7 A;  1DGF A;  4IBG A;  4D82 A;  1Y8G A;  3L2A A;  5L8R F;  1CXW A;  1YUE A;  2JUJ A;  3FYC A;  1IM2 A;  4PCZ A;  4DR5 M;  2ZTC A;  3U5Z A;  3LCU A;  2QQ8 A;  1GL7 A;  1NY5 A;  1HT2 E;  2FE8 A;  4I8O A;  1N78 A;  1E6Z A;  1GOI A;  1J09 A;  3LQR A;  5EP2 A;  4KOD A;  2DEN A;  2MRO B;  3GQ5 A;  3T6P A;  3JR4 A;  1TH3 A;  3SAS A;  4AKH A;  1PJS A;  4OU7 A;  2JY7 A;  1GPF A;  2MJ5 B;  5IRE B;  2DKL A;  1WHC A;  5FSW A;  2K9D A;  3W67 A;  1YUB A;  1IXS A;  5EXP A;  4JI2 M;  1QVR A;  4Z2L A;  2HHH M; 
#chains in the Genus database with same CATH homology
 1TH4 A;  2Y2P A;  4M9Z A;  2YFQ A;  2XF3 A;  2RKO A;  3GQ3 A;  2Z3X A;  3NBI A;  1X37 A;  1XMO M;  1FJG M;  2F5Q A;  4B3R M;  4A3V B;  2JA2 A;  3VLF B;  1MU5 A;  2CUZ A;  1K82 A;  2CV2 A;  1PJJ A;  2QZ4 A;  4JV5 M;  2BJW A;  2KA6 B;  4NSR A;  4RF1 A;  3HHZ A;  1J5E M;  2Y2I A;  3SMP A;  4EIW A;  4ITQ A;  2EUC A;  3ZC7 B;  4NYU A;  3KOX E;  1PM5 A;  1N75 A;  1G59 A;  1HNX M;  1DGG A;  4R7G A;  2L6O A;  4MGK E;  4IBD A;  2YR0 A;  1IBL M;  1Z5B A;  3I51 A;  3WHK A;  3GRU A;  2A5Y B;  1L2D A;  1E94 E;  4HL4 A;  2P5T A;  4LCB A;  2XZU A;  2UUA M;  1JR3 D;  1UM8 A;  3M6A A;  4LGM A;  4AKI A;  1XHB A;  3SAU A;  1IN8 A;  3KSX A;  2J7O A;  3U6O A;  1Q3B A;  4X64 M;  1YU4 A;  1NHG C;  4NZ3 A;  4IBI A;  2Z4S A;  3PNY A;  4M9S A;  2OPF A;  2L7H A;  1S3S A;  3HU1 A;  4DV4 M;  4IJE A;  4JN6 A;  1G4A E;  5ITQ A;  4LG2 A;  4NZ5 A;  2XFS A;  4WW0 A;  4PDG A;  3CTW B;  2JE5 A;  2VQE M;  3GRR A;  1HNW M;  7CAT A;  3TL4 X;  1HR0 M;  4CIS A;  2UXD M;  2D7G A;  3UJN A;  3B9P A;  4JI7 M;  2R46 A;  2KW0 A;  1G41 A;  4D81 A;  4JI3 M;  3VKG A;  1ORY B;  3M0E A;  4DR7 M;  4FCT A;  4MGI E;  3SBJ A;  3FUW A;  4DR2 M;  1IN5 A;  4NZ1 A;  2O5R A;  2KZU A;  3SYL A;  4L78 A;  1SXJ B;  3VK7 A;  3GLG A;  4JXJ A;  2ZAN A;  3QWL A;  3ZCB B;  2UU9 M;  4I81 A;  4IBF A;  4AI6 A;  4GKK M;  4DV3 M;  2ZM6 M;  3R9X B;  5JI2 E;  4B7G A;  1K3X A;  1N78 A;  2ZBK B;  3AFH A;  1R2Z A;  2Y0Q A;  4AW4 A;  3FYD A;  3FUU A;  4MM3 B;  4REZ A;  2Y2K A;  2X49 A;  1JR3 A;  4NOO B;  5KQ8 A;  5IT9 S;  3QAU A;  3GPY A;  3KOW E;  2XH9 A;  1IXS B;  2HCB A;  3R8F A;  3L26 A;  3E9S A;  1GLN A;  2YNM D;  3AL0 C;  2C98 A;  3L25 A;  2QEN A;  4I4L A;  5DYI A;  3JR5 A;  2Y2N A;  1NJF A;  5E6J A;  3HON A;  1D2N A;  4R3D A;  2LNH C;  3D8L A;  4BLC A;  2DWZ B;  3IG5 A;  3T1H M;  3HHW A;  4LJ4 A;  2F5O A;  4DV5 M;  2UXC M;  2Y20 A;  3PXG A;  4DV1 M;  1FNN A;  1H6U A;  4YHH M;  5FTN A;  3HJQ A;  3PVS A;  3U60 B;  2NQ8 C;  4FVM A;  4OW0 A;  3GPX A;  4L16 A;  2YQZ A;  2CHQ A;  1W5S A;  4IJF A;  4P16 A;  2F5S A;  1L8Q A;  2XSZ D;  3SAW A;  5ITY A;  2HL7 A;  1TDH A;  3CF6 E;  4NSO B;  2J7N A;  2Y21 A;  5EJC A;  3T1Y M;  1JQJ C;  5FLX S;  4MGH A;  4NL4 H;  1NNU C;  3BOS A;  3U61 B;  5IWA M;  4GC9 A;  4FCW A;  2I7N A;  1T3T A;  1QQW A;  3IG8 A;  3KOY E;  1DGH B;  2VII A;  1W5T A;  1DO2 A;  3SYK A;  1NJG A;  1E9S A;  4PT5 A;  3Q8X A;  4NXN M;  2V1U A;  4FWG A;  1WXQ A;  3HU2 A;  3U6C A;  4OUI A;  1NY6 A;  1OFH A;  4IBE A;  4G4O A;  3HHY A;  4S12 A;  1MX0 A;  4DUY M;  2X8A A;  5ITX A;  3AV0 A;  5DYG A;  4B7H A;  3UK6 A;  4DR3 M;  3AOE C;  3RE8 A;  4KHP M;  2G8L A;  3SAR A;  3VKH A;  1PJI A;  5BPV A;  2Q2E B;  4LZJ A;  2RGH A;  4IBK A;  1GKI A;  5JI3 E;  3CF0 A;  3GP1 A;  4L15 A;  4JI6 M;  2Y2H A;  1R6B X;  4GRI A;  3SC3 A;  2CFO A;  2LWX A;  1N33 M;  2DWM A;  1IY1 A;  3AOE A;  5FTK A;  4FWD A;  4G4Q A;  1IY0 A;  3J27 B;  3W0F A;  3EIH A;  4OVZ A;  3GLG B;  2V6Z M;  4FW9 A;  5EP3 A;  5EQT A;  2XSZ A;  1YU2 A;  1R7R A;  2FFJ A;  2C5R A;  5LMU M;  2DZO B;  1KFV A;  2KRU A;  4GIT A;  4QNM A;  4AKG A;  3E4R A;  3I4Y A;  3HHX A;  2R4J A;  3GQ4 A;  4B3S M;  1XC8 A;  4B3T M;  3AJI B;  3GLH B;  2XFT A;  5E26 A;  1YU0 A;  2QP9 X;  3KW6 A;  1XNR M;  1I4W A;  2LH0 A;  4I5S A;  1HQY E;  4M0D A;  1QAO A;  2QPA A;  1ZQ9 A;  2W82 A;  3U6L A;  5DNY A;  2C96 A;  3VDP A;  2Y2L A;  3OTO M;  2V1C A;  2FNA A;  4QNL A;  5BR8 M;  2KEB A;  4AZF A;  3TWK A;  4DV7 M;  1Q39 A;  2F5N A;  3UZU A;  1TDZ A;  2XZF A;  4DR6 M;  3FTC A;  2HKJ A;  3KDS E;  5IZ7 D;  2UXB M;  5KQD A;  5KO3 A;  2DZN B;  4LF5 M;  1HT1 E;  4JYA M;  4IBC A;  4OJ6 A;  1GVN A;  1QYR A;  1IXR C;  2JCH A;  3GLI A;  1R2Y A;  4LGY A;  4QHT A;  5FTM A;  3THG A;  2DXI A;  4LFC M;  5ITR A;  1EE8 A;  2DHR A;  4QOS A;  2K47 A;  1IXZ A;  3TE6 A;  1LV7 A;  3RGS A;  3SMS A;  3JAM S;  1SXJ D;  3U6M A;  2EA0 A;  3K2L A;  4NYY A;  1IN6 A;  4TUW A;  4II7 A;  1OJL A;  3MK6 A;  4GH9 A;  3FUX A;  5FTL A;  3VK8 A;  2XEP A;  1L1T A;  4JI1 M;  2BNK A;  3C58 A;  3VDU A;  1TGU A;  3VFD A;  2F4V M;  1K3W A;  3FTD A;  3PFI A;  4G4N A;  1N77 A;  1XXH A;  3LVW A;  3H4M A;  3RGP A;  3U5Z A;  5EP1 A;  5C1B A;  3SHG B;  3ZH9 B;  4AG6 A;  3A46 A;  3TWL A;  4LFB M;  3D8B A;  4LF7 M;  2BJV A;  3KP0 E;  4RNA A;  4FCV A;  2F5P A;  4B08 A;  1YU3 A;  4DV6 M;  1Q3C A;  1L2B A;  2UUB M;  4NZ4 A;  2G5G X;  4DV0 M;  4YY3 M;  4LRS A;  1J7K A;  3M7G A;  2R62 A;  1QAN A;  1G3I A;  3KP1 E;  1IQP A;  3U6E A;  1KSF X;  1Z5A A;  2R65 A;  2R4E A;  3L27 A;  2QCU A;  3A42 A;  3KOZ E;  2QBY B;  3SAT A;  3GPP A;  1NVM A;  1SXJ C;  1L1Z A;  4JI0 M;  4M0W A;  4LF4 M;  3TQS A;  1N36 M;  1YU1 A;  4QOZ C;  5FTJ A;  4OJL A;  1ZAE A;  3GRV A;  5EP4 A;  1SXJ A;  4KLN A;  2DWN A;  1XWI A;  4GHA A;  2RGO A;  5KPR A;  5KPT A;  3HJS A;  4L4U A;  2M60 A;  3GO8 A;  1XMQ M;  3SAV A;  5ITX E;  2XLJ A;  2Z7J A;  2ZAO A;  1L2C A;  3J7A S;  4CGY B;  4DV2 M;  1IN7 A;  1QZM A;  3KS8 A;  1TH2 A;  1C1K A;  3UGJ A;  2X4A A;  2M5Z A;  3SHF A;  4NY2 A;  3DZD A;  2BG1 A;  4WUR A;  3L28 A;  4X65 M;  1NHW C;  4AQY M;  3KFU G;  3KS4 A;  4M9X A;  1DO0 A;  1HQC A;  2Y2J A;  4B3M M;  2IOU A;  4LJ7 A;  2D7H A;  5LMN M;  4GHL A;  2CV0 A;  3J2P B;  2C9O A;  1GL6 A;  4IBB A;  4Z6Y A;  2AHM A;  3FUV A;  5F3W A;  1N34 M;  4MH0 E;  3W0L B;  3K1J A;  4GMQ A;  3FTE A;  2Y2G A;  2XGN A;  3GLI B;  2CHV A;  4PDI A;  3GLF A;  2EO2 A;  2UUC M;  4L8R C;  3HJ8 A;  2D7E A;  3A98 B;  3HSH A;  4BBA A;  4DR1 M;  4NRV A;  2Y0T A;  3I4V A;  3U60 A;  3DFZ A;  3T15 A;  4LF9 M;  3WHL A;  3RFW A;  3K92 A;  4GKJ M;  1N32 M;  1Z5C A;  4DR4 M;  3HU3 A;  4K0K M;  2I7P A;  4JI8 M;  2E5L M;  1E9R A;  3U6S A;  1NSF A;  2C99 A;  5A2Q S;  2FFF B;  4JI5 M;  4KO8 A;  3J80 S;  2Y2M A;  4FD2 A;  3LVV A;  1OFI A;  1Z6T A;  4JI4 M;  4W5W A;  1E32 A;  3U61 A;  4G4R A;  2L09 A;  1IBK M;  1XNQ M;  5ITU A;  1XXH B;  3U5Z B;  5C18 A;  5KPZ A;  3AOG A;  4XGI A;  1VDD A;  4LJ6 A;  1DGH A;  1Z59 A;  1YSY A;  2QBY A;  4DUZ M;  4QHS A;  2OQ4 A;  2H1R A;  3KVW A;  4OX9 M;  3J7B A;  4IBJ A;  3FUT A;  4IIW A;  2XD1 A;  2LXE A;  1QAQ A;  2ERC A;  5GKN A;  4LRT A;  4LY6 A;  4XBO A;  3GRY A;  2R45 A;  4AG5 A;  4Z8X A;  5EXX A;  4LJ9 A;  4MGY E;  2DVW B;  1IY2 A;  3FTF A;  4LJA A;  4B7F A;  2C9C A;  3FKE A;  4NXM M;  3K8Z A;  4LJ8 A;  3CF2 A;  1KYI A;  3HGI A;  3NWL A;  1NNJ A;  2CV1 A;  4LF6 M;  4GIP A;  2KZS A;  4MGZ E;  3J81 S;  4PD2 A;  4NRW A;  5ITT A;  4X62 M;  1G8P A;  3PNV A;  3A45 A;  1IN4 A;  2FOI C;  3LMM A;  2VQF M;  2DWL A;  2Y2O A;  3AKZ A;  4RF0 A;  1DGB A;  3DOA A;  5H37 D;  4OJ5 A;  4D80 A;  3KXE C;  4LZZ A;  3EIE A;  4BB9 A;  2ZAM A;  4OJP A;  2CE7 A;  4QNR A;  2CHG A;  3GLH A;  3FD9 A;  3GPU A;  4FWH A;  3U6Q A;  2CEA A;  2KXE A;  1IBM M;  3TWM A;  4G6Z A;  3HKP A;  1YE9 A;  1QAM A;  4LJ5 A;  5EXS A;  2XD5 A;  2L7I A;  3HWS A;  3MJ5 A;  3MHV C;  2Z4R A;  3T38 A;  5EXT A;  2Y2Q A;  4OVZ B;  3TPZ A;  3DA1 A;  4HLQ A;  3ILK A;  4ZPX A;  3LQQ A;  4MB7 A;  4CHT B;  2UWX A;  3KSJ A;  3GLF B;  3N3F A;  3U6D A;  3SFZ A;  1SXJ E;  1HNZ M;  4LF8 M;  2R18 A;  4X66 M;  4OJO A;  3U6P A;  2KRK A;  3L29 A;  3UMM A;  8CAT A;  1I94 M;  4LFA M;  4GC5 A;  3WX7 A;  1DGF A;  4IBG A;  4D82 A;  3L2A A;  1YUE A;  3FYC A;  1IM2 A;  4PCZ A;  4DR5 M;  1GL7 A;  1NY5 A;  1HT2 E;  2FE8 A;  4I8O A;  1J09 A;  3LQR A;  5EP2 A;  4KOD A;  3GQ5 A;  3JR4 A;  1TH3 A;  3SAS A;  4AKH A;  4OU7 A;  5IRE B;  5FSW A;  1YUB A;  5EXP A;  4JI2 M;  1QVR A;  2HHH M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...