3L2AA

Crystal structure of reston ebola vp35 interferon inhibitory domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
GKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Characterization of Reston Ebola Virus VP35 Interferon Inhibitory Domain.
pubmed doi rcsb
molecule keywords Polymerase cofactor VP35
molecule tags Rna binding protein
source organism Reston ebolavirus
total genus 41
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l2aA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l2aA02
4IBJA 3L28A 4IBBA 3L27A 4IBKA 4IBFA 3FKEA 3L29A 4IBGA 4IJEA 4IJFA 5BPVA 4IBCA 4GHLA 4IBEA 3KS4A 4GH9A 4IBDA 3L26A 3KS8A 3L25A 4IBIA 3L2AA 4GHAA 4LG2A
chains in the Genus database with same CATH superfamily
1GL7A 1V33A 3QYEA 2C9CA 4PT5A 3NWLA 2QP9X 2UUAM 3TL4X 1L1TA 4X64M 1NO1A 3HJ8A 3L27A 4LFCM 4Z2KA 2ZBKB 2Y2JA 4G6ZA 5C1BA 4FCVA 2P5TA 1IY2A 4GITA 5H37D 2UXCM 3FKEA 3LCUA 2QBYA 1JB0F 1IBMM 2Y2OA 3KOYE 3FTEA 2C98A 2L4EA 1PJIA 5IZ7D 1VDDA 1ZAEA 3KSXA 3H4JA 3VLFB 4G4RA 3E46A 2FFJA 3GLHE 1VQ1A 3RE8A 3SAWA 3ZC7B 4G4OA 3HSHA 2JCHA 1XHBA 3FUTA 3PVSA 5LMUM 3AOEC 4KO8A 1BVSA 4DR7M 4OJOA 2Y2GA 1W5SA 3IECA 3L25A 3M7PA 2UUCM 1UR9A 3WD2A 4GHAA 4OJLA 2V1CA 2G3QA 1OFHA 4GC5A 4LJ5A 4AG5A 1J5EM 3WD3A 3HHXA 3L28A 4M9ZA 3EIEA 1X37A 2XFSA 2CV1A 1GABA 5KPTA 3UJNA 1Z5CA 2CRUA 4NSRA 3TQSA 2L7IA 4PD2A 4DV0M 4AQYM 1XC8A 4OX9M 1F4IA 3KXEC 3SHGB 1RU3A 4IBCA 4I5SA 3HY5A 4L4UA 1L1ZA 3Q8GA 1GVNA 1G4AE 1SXJB 3HU3A 2R46A 4G4QA 3U5ZB 1DGGA 2UU9M 2KHHA 4QHSA 1Q02A 2BJVA 4Z8XA 4KODA 3WD1A 2J7OA 4LZJA 2G5GX 4AW4A 4Z2HA 1DO0A 4NZ3A 2VIIA 3UGJA 4X66M 4IIWA 1PJSA 4NXNM 5ITQA 3SC3A 1I94M 3HGIA 3U6LA 3HHWA 3GO8A 1QANA 1GJSA 1OAOC 3TPZA 1H0IA 1DGFA 1C1KA 3PFIA 2Z4SA 3KW6A 4JI5M 2XGNA 1KYIA 2CWBA 2MR9A 3KVWA 4FW9A 1GOIA 3C58A 2V6ZM 5GKNA 4NOOB 3PXGA 3FYCA 4NYYA 4NYUA 2DAEA 5EXTA 4L16A 3U61A 1E6ZA 1T3TA 3SATA 1WJ7A 3DOAA 1YU1A 4B7FA 4LF7M 4QNLA 2JNHA 4OJPA 5FLXS 3IG8A 2Y2KA 1HT2E 2Q2EB 4LRTA 4QNMA 4LJ9A 5LMNM 4I4LA 5DYIA 5DNYA 3T1YM 1XMOM 4XGIA 3AL0C 3A42A 5E26A 4OW0A 3HHZA 3HX3A 3J7AS 2OO9A 2KNAA 2DAIA 4B3RM 1PJQA 3SFZA 2FH0A 2LVNC 4MB7A 2OPFA 3PNVA 3UMMA 1CUKA 2JA2A 1XNQM 2VF7A 5EP3A 5FTKA 1PGYA 4M0DA 1N34M 2DWZB 4DR3M 2LH0A 2QCUA 4S12A 3FUXA 3B9PA 4M9SA 1Y8GA 5FTMA 4NY2A 7CATA 3KP1E 4CHTB 3JR4A 2EKKA 4EIWA 5ITXE 3BOSA 2Y2NA 2JY5A 3M0EA 4FVMA 3ILKA 1NSFA 1R4GA 1Z6TA 5FTNA 5JI2E 1QO6A 3D8BA 3FRHA 1JR3D 2KZUA 1WXQA 1YU0A 3E9SA 2F5OA 2Y2IA 1E32A 3SAVA 1TH4A 4NSOB 4DR5M 4MH0E 4D81A 1DGHA 1QDTA 3J81S 4ZPXA 1PM5A 2DAMA 2LHCA 1V34A 1G41A 4DV3M 4B7GA 2XSZA 4JN6A 3SAUA 3JAMS 2DXIA 2V5OA 1Z5BA 1XXHA 1PJTA 4WP2A 3GLFA 4BLCA 3SHFA 3HJSA 4LJAA 4TX8A 1W1TA 2K0BX 2KW0A 3TWKA 2XD5A 4OJ6A 1ED7A 2K6BA 1W5TA 4G4NA 1L8QA 4DV1M 4LJ6A 4IJFA 1D0MA 4KHPM 4QHTA 1NJFA 1OKSA 2WSCF 5EP2A 2I7NA 5ITRA 4GHLA 1OQYA 2JP7A 4HL4A 2HHHM 2R45A 3I01M 3GPUA 1A5TA 1SG9A 2N35A 2UXBM 1QAQA 2X49A 5DYGA 3J27B 1TH3A 3KP0E 2DHYA 4M0WA 1IN7A 3GLGA 1DV0A 1L6JA 1LTMA 3C3DA 1IN5A 2RGOA 3KOXE 2L6OA 1N75A 4GEWA 3K8ZA 4B08A 1N36M 3AOGA 5A2QS 1O6IA 2ZTCA 2Y20A 3VKGA 2JZ0A 2WSEF 1W1YA 1AIPC 4IBJA 3EIHA 3U6SA 1OJLA 3QAUA 4IBBA 2ERCA 1WIVA 3VKHA 3LW5F 3AFHA 4MGZE 4ITQA 3R9XB 3A98B 4FCTA 1GL6A 2ZM6M 2O01F 3KSJA 4MGIE 2QHOB 3GLIA 1XB2B 3CGWA 3MJ5A 3U6CA 4LF6M 1HQYE 1XXHE 4B3TM 1QZEA 3GLFE 3GRYA 1YU3A 1GPFA 2KRUA 2R4JA 4DV2M 1PDCA 3FUWA 2CEAA 4IBDA 4D82A 1ORYB 1QVRA 4Z2GA 4NRVA 2HWJA 2XZFA 4Y28F 3B74A 3U6QA 2FE8A 3VFDA 3GRRA 3U61B 3K1JA 2YR0A 4R3DA 5IREB 1QUTA 1G59A 4X62M 4DV4M 2EUCA 3WD4A 3GLGE 1OGBA 5ITUA 3WHLA 4JI8M 2DWLA 1J09A 4FWHA 2XZUA 2KXEA 2QSFX 3GRUA 1E15A 3KOZE 4MGYE 3HKPA 3W67A 1IQPA 4NL4H 5EXXA 3T6PA 1E6RA 3ZCBB 1G3IA 1PRBA 3U60A 2CHQA 3FE3A 2A5YB 3K2LA 1IY1A 1XWIA 3GLIE 2OOAA 4OVZA 4L8RC 3FTCA 2V1UA 1J7KA 1HNWM 2BWBA 1WGLA 2DI0A 2R65A 2FS1A 5EXPA 2WSFF 1K82A 4AKHA 2DZOB 2X8AA 4IBIA 3WD0A 3GPYA 1NJGA 5ITYA 4LFBM 2DAGA 2IOUA 1R2ZA 2F4VM 1LV7A 2R18A 3CF2A 4LJ4A 5EP4A 2CP8A 4DR4M 1UFZA 3RGPA 4G3OA 3HU1A 3VK8A 1DGHB 1E94E 1GLNA 2JY6B 1S3SA 5ITXA 1DGBA 2XF3A 2K9DA 2Y2HA 4OUIA 5KO3A 4Z2IA 2R44A 2BJWA 2DENA 3I4VA 3T1HM 1GO5A 5F3WA 2Z3XA 5FTLA 2YQZA 3SMPA 1Q3BA 1XXHB 2JY8A 3GLFB 1Q3CA 2QENA 1Z5AA 4JI1M 2J5YA 3AV0A 4DBGB 2CV2A 3GLHB 4UN2B 2BNKA 2RRUA 2DHRA 1YU2A 3AKZA 2Y2MA 1JR3A 4AKIA 1OFIA 2Z8YM 4CISA 4QOZC 3Q8XA 2I7PA 2CHGA 3HONA 1NV9A 1G71A 1R6BX 4PDGA 5IT9S 3JR5A 3GQ3A 3GLGB 1HQCA 4GRIA 2FN2A 4HMEA 2QZ4A 1WHCA 4KT0F 1MN3A 2M5ZA 1IM2A 4IBKA 4IBFA 4P16A 1VDLA 3SARA 3FTDA 1ZMUA 4AKGA 4JI0M 2KA6B 4LGYA 5ITTA 4AZFA 2GQFA 4FCWA 1EFUB 3W68A 4F2LA 4GC9A 4IBEA 3B7QA 3KS4A 4LFAM 3LQRA 3MQLA 3BBZA 3GLIB 3SBJA 2QBYB 4B3MM 5KQDA 2DVWB 4YHHM 4MM3B 1Q39A 1CK7A 2UWXA 1IFYA 4P17A 4JI4M 1HNXM 1L2CA 2Y2LA 1E9SA 4GIPA 1YSYA 2LXEA 2R62A 3R8FA 4F1IA 1P3QQ 2YNMD 4LJ7A 2UUBM 1JR3E 4FWDA 1K3WA 2QNJA 1OTRA 2MGWA 2XSZD 4W5WA 4CJ6A 1NNJA 4LF5M 1DO2A 4B7HA 4OJ5A 2JZ1A 3U5ZA 4IBGA 4IJEA 4JI2M 4JI3M 1W1VA 4CGYB 1IN4A 1NHWC 4DR6M 4RF1A 1QQWA 3LCVB 1N77A 2H1RA 1E6NA 3K92A 3KFUG 5L8RF 2JY7A 2XFTA 1NHGC 4GH9A 2F5SA 1AUAA 1CXWA 1GJTA 1PJJA 2CUZA 2K47A 3UZUA 1YE9A 1QAOA 3HJQA 4DUYM 1K3XA 3LVWA 4LRSA 1C7YA 2QQ8A 4FD2A 2CV0A 1HR0M 1D0KA 3KOWE 1XNRM 3W0FA 4OVZB 3DFZA 1D0LA 2MROB 1XMQM 1E9RA 4ANRA 1HNZM 1OGGA 1UM8A 3U6DA 4NXMM 2Y0TA 3MK6A 3GP1A 4FWGA 3B89A 4NZ1A 1SXJD 5JI3E 2YFQA 2LVAA 2LVPC 3U6PA 4LF8M 1EIJA 4NZ4A 4RF0A 3TE6A 2KNZA 3RFWA 1T43A 1IXSA 2HKJA 2OOBA 4WW0A 2J7NA 3HHYA 2OQ4A 4DV5M 4DR1M 3FRIA 4JI6M 1TDHA 3SYKA 1H8PA 4TUWA 2KEBA 2NQ8C 3SMSA 3IHPA 2JE5A 2D7GA 2JWSA 2CFOA 1SXJE 1VEKA 3C9PA 2KRKA 2JXNA 4LJ8A 3T15A 3GPXA 4BBAA 3U6OA 2B3TA 2EA0A 1QAMA 1QYRA 4OU7A 2VQFM 3VK7A 1UR8A 2G8LA 4REZA 4LF4M 4HEOA 3I51A 1IXZA 2EKFA 4I81A 1TH2A 1ZMWA 3LMMA 2R4EA 3PNYA 1MX0A 1TTEA 1IBKM 1GKIA 2DAKA 1R7RA 1V92A 2W82A 3D8LA 1TGUA 2Y21A 3SYLA 4R7GA 4RKUF 5BPVA 3E4RA 3DZDA 4X65M 1NY6A 3WHKA 3C3EA 3K9PA 3FYDA 2MJ5B 3M6AA 2O5RA 3FD9A 3RGSA 2F5NA 3AJIB 3NBXX 4II7A 5EQTA 4L15A 3F92A 2FFFB 3A45A 4AG6A 2AHMA 2LHGA 3GPPA 4K0KM 2DZNB 2KNVA 2BG1A 2L4FA 4AI6A 2KDLA 4LG2A 1EAKA 1FNNA 5KPRA 2L2DA 2Z4RA 1ZMVA 4R71A 2X4AA 2FOIC 2RTSA 3B7NA 3HZJA 2F5QA 3ZQJA 3THGA 5KPZA 2FNAA 1YLAA 2XEPA 4BB9A 2WZJA 2C5RA 2XD1A 3FUVA 3GRVA 2DNAA 3I4YA 3FUUA 4WURA 1NNUC 4JXJA 4D80A 2O25A 1I4WA 2Y2QA 1ZQ9A 2RGHA 3TWLA 2M60A 5IWAM 4Z6YA 1D2NA 8CATA 3GQ4A 4LZZA 3OTOM 5DFLA 2L09A 2DZLA 2D7HA 3T38A 2HAKA 4Z2JA 1EE8A 2F5PA 4LGMA 2EO2A 5FSWA 3CTWB 2DKLA 4YY3M 1VEJA 4DR2M 1N32M 2H5XA 2Y2PA 4RNAA 1E88A 4LF9M 3A46A 2D49A 4HMCA 2D7EA 2Y0QA 1IN6A 1IBLM 4Z2LA 1R2YA 2VF8A 4Q7JA 2MH8A 2DWNA 4L6V6 1IXRC 2APLA 2QPAA 1T6OA 3K9OA 4MGHA 4DV7M 1YUBA 4MB5A 2C99A 4XBOA 3N3FA 5FTJA 3J2PB 2UXDM 1NY5A 3B7ZA 3H4MA 1NVMA 3KDSE 2VQEM 2Z7JA 3I04M 1IXSB 2EJSA 4KLNA 2C9OA 1H6UA 3HWSA 1R5LA 3U6MA 1L2DA 3KS8A 1TF0B 1JQJC 1WGNA 2HL7A 2KZSA 1E8BA 3M7GA 1N78A 2LNHC 4MGKE 4LY6A 2LVOC 4DV6M 3NBIA 2R0IA 3J7BA 5C18A 5EP1A 3VDUA 4NZ5A 3MMPA 1AIWA 4NRWA 2R6FA 1G8PA 4JYAM 3U6EA 2L7HA 2ZTDA 3MHVC 4L78A 4CIZA 2RKOA 4JV5M 2HCBA 2ZAOA 3TWMA 2LBCA 4DUZM 3E21A 5EXSA 1SXJA 4XK8F 4HMDA 4QOSA 1NV8A 4M9XA 3QWLA 2ZANA 2GNOA 3DA1A 3FTFA 3J80S 2ZAMA 4MB3A 4HLQA 3VDPA 2CHVA 1OIZA 4MB4A 1OIPA 2E5LM 4NC6A 2BWEA 4JI7M 1ZV1A 3CF6E 3IG5A 1E6PA 1TDZA 3LQQA 2XH9A 4I8OA 4A3VB 3L2AA 4PDIA 5KQ8A 1L2BA 3U60B 1KS0A 2JUJA 1Z59A 2LVQD 3QYBA 1QUSA 1HT1E 3LVVA 3AOEA 3W0LB 2DWMA 4B3SM 4GKKM 1H0GA 1KSFX 1GXDA 1YU4A 3GLHA 3ZH9B 2CE7A 1FJGM 3L29A 1VEGA 1MJGM 4QNRA 1IN8A 2LTUA 3HU2A 4GMQA 4GKJM 1MU5A 3WX7A 1TR8A 5BR8M 3V76A 2LWXA 1OAIA 4PCZA 5E6JA 3L26A 3GQ5A 1W1PA 1QZMA 5EJCA 1WR1B 3UK6A 1KFVA 1IY0A 1YUEA 1VG5A 3SASA 3BXWA 2C96A 2XLJA 1N33M 1HJPA 1J7MA 3CF0A 2VDBB 1SXJC 4LCBA 1QDRA
chains in the Genus database with same CATH topology
1GL7A 2C9CA 4PT5A 3NWLA 2QP9X 2UUAM 3TL4X 1L1TA 4X64M 3HJ8A 3L27A 4LFCM 2ZBKB 2Y2JA 4G6ZA 5C1BA 4FCVA 2P5TA 1IY2A 4GITA 5H37D 2UXCM 3FKEA 2QBYA 1IBMM 2Y2OA 3KOYE 3FTEA 2C98A 1PJIA 5IZ7D 1VDDA 1ZAEA 3KSXA 3VLFB 4G4RA 3SAWA 2FFJA 3RE8A 3ZC7B 4G4OA 3HSHA 2JCHA 1XHBA 3FUTA 3PVSA 5LMUM 3AOEC 4KO8A 4DR7M 4OJOA 2Y2GA 1W5SA 3L25A 2UUCM 4GHAA 4OJLA 2V1CA 1OFHA 4GC5A 4LJ5A 4AG5A 1J5EM 3HHXA 3L28A 4M9ZA 3EIEA 1X37A 2XFSA 2CV1A 5KPTA 3UJNA 1Z5CA 4NSRA 4PD2A 3TQSA 2L7IA 4DV0M 1XC8A 4AQYM 4OX9M 3KXEC 3SHGB 4I5SA 4IBCA 4L4UA 1L1ZA 1GVNA 1G4AE 1SXJB 3HU3A 2R46A 4G4QA 3U5ZB 1DGGA 2UU9M 4QHSA 2BJVA 4Z8XA 4KODA 2J7OA 4LZJA 2G5GX 4AW4A 1DO0A 4NZ3A 2VIIA 3UGJA 4X66M 4IIWA 5ITQA 4NXNM 3SC3A 1I94M 3HGIA 3U6LA 3HHWA 3GO8A 1QANA 3TPZA 1DGFA 1C1KA 3PFIA 2Z4SA 3KW6A 4JI5M 2XGNA 1KYIA 3KVWA 4FW9A 3C58A 2V6ZM 5GKNA 4NOOB 3PXGA 3FYCA 4NYYA 4NYUA 5EXTA 4L16A 3U61A 1T3TA 3SATA 3DOAA 1YU1A 4B7FA 4LF7M 4QNLA 4OJPA 5FLXS 3IG8A 2Y2KA 1HT2E 2Q2EB 4LRTA 4QNMA 4LJ9A 5LMNM 4I4LA 5DYIA 5DNYA 3T1YM 1XMOM 4XGIA 3AL0C 3A42A 5E26A 4OW0A 3HHZA 3J7AS 4B3RM 3SFZA 4MB7A 2OPFA 3PNVA 3UMMA 2JA2A 1XNQM 5EP3A 5FTKA 4M0DA 1N34M 2DWZB 4DR3M 2LH0A 2QCUA 4S12A 3FUXA 3B9PA 4M9SA 5FTMA 4NY2A 7CATA 3KP1E 4CHTB 3JR4A 4EIWA 5ITXE 3BOSA 2Y2NA 3M0EA 4FVMA 3ILKA 1NSFA 1Z6TA 5FTNA 5JI2E 3D8BA 1JR3D 2KZUA 1WXQA 1YU0A 3E9SA 2F5OA 2Y2IA 1E32A 3SAVA 1TH4A 4NSOB 4DR5M 4MH0E 4D81A 1DGHA 3J81S 4ZPXA 1PM5A 1G41A 4DV3M 4B7GA 2XSZA 4JN6A 3SAUA 3JAMS 2DXIA 1Z5BA 1XXHA 3GLFA 4BLCA 3SHFA 3HJSA 4LJAA 2KW0A 3TWKA 2XD5A 4OJ6A 1W5TA 4G4NA 1L8QA 4DV1M 4LJ6A 4IJFA 4KHPM 4QHTA 1NJFA 5ITRA 5EP2A 2I7NA 4GHLA 4HL4A 2HHHM 2R45A 3GPUA 2UXBM 1QAQA 2X49A 5DYGA 3J27B 1TH3A 3KP0E 4M0WA 3GLGA 1IN7A 1IN5A 2RGOA 3KOXE 2L6OA 1N75A 1N36M 3K8ZA 4B08A 3AOGA 5A2QS 2Y20A 3VKGA 4IBJA 3EIHA 3U6SA 1OJLA 3QAUA 4IBBA 2ERCA 3VKHA 3AFHA 4MGZE 4ITQA 3R9XB 3A98B 4FCTA 1GL6A 2ZM6M 3KSJA 4MGIE 3GLIA 3MJ5A 3U6CA 4LF6M 1HQYE 4B3TM 3GRYA 1YU3A 2KRUA 2R4JA 4DV2M 3FUWA 2CEAA 4IBDA 4D82A 1ORYB 1QVRA 4NRVA 2XZFA 3U6QA 2FE8A 3VFDA 3GRRA 3U61B 3K1JA 2YR0A 4R3DA 5IREB 1G59A 4X62M 4DV4M 2EUCA 5ITUA 3WHLA 4JI8M 2DWLA 1J09A 4FWHA 2XZUA 2KXEA 3GRUA 3KOZE 4MGYE 3HKPA 1IQPA 4NL4H 5EXXA 3ZCBB 1G3IA 3U60A 2CHQA 2A5YB 3K2LA 1IY1A 1XWIA 4OVZA 4L8RC 3FTCA 2V1UA 1J7KA 1HNWM 2R65A 5EXPA 1K82A 4AKHA 2DZOB 2X8AA 4IBIA 3GPYA 1NJGA 5ITYA 4LFBM 2IOUA 1R2ZA 2F4VM 1LV7A 2R18A 3CF2A 4LJ4A 5EP4A 4DR4M 3RGPA 3HU1A 3VK8A 1DGHB 1E94E 1GLNA 1HR0M 1S3SA 5ITXA 1DGBA 2XF3A 2Y2HA 4OUIA 5KO3A 2BJWA 3I4VA 3T1HM 5F3WA 2Z3XA 5FTLA 2YQZA 3SMPA 1Q3BA 1XXHB 3GLFB 1Q3CA 2QENA 1Z5AA 4JI1M 3AV0A 2CV2A 3GLHB 2BNKA 2DHRA 1YU2A 3AKZA 2Y2MA 1JR3A 4AKIA 1OFIA 4CISA 4QOZC 3Q8XA 2I7PA 2CHGA 3HONA 1R6BX 4PDGA 5IT9S 3JR5A 3GQ3A 3GLGB 1HQCA 4GRIA 2QZ4A 2M5ZA 1IM2A 4IBKA 4IBFA 4P16A 3SARA 3FTDA 4AKGA 4JI0M 2KA6B 4LGYA 5ITTA 4AZFA 4FCWA 4GC9A 4IBEA 4LFAM 3KS4A 3LQRA 3GLIB 3SBJA 2QBYB 4B3MM 5KQDA 2DVWB 4YHHM 4MM3B 1Q39A 2UWXA 4JI4M 1HNXM 1L2CA 2Y2LA 1E9SA 4GIPA 1YSYA 2LXEA 2R62A 3R8FA 2YNMD 4LJ7A 2UUBM 4FWDA 1K3WA 4W5WA 1NNJA 4LF5M 1DO2A 4B7HA 4OJ5A 3U5ZA 4JI2M 4IBGA 4IJEA 4JI3M 4CGYB 1IN4A 1NHWC 4DR6M 4RF1A 1QQWA 1N77A 2H1RA 3K92A 3KFUG 2XFTA 2F5SA 1NHGC 4GH9A 1PJJA 2CUZA 2K47A 3UZUA 1YE9A 1QAOA 3HJQA 4DUYM 1K3XA 3LVWA 4LRSA 4FD2A 2CV0A 3KOWE 1XNRM 3W0FA 4OVZB 3DFZA 1XMQM 1E9RA 1HNZM 1UM8A 3U6DA 4NXMM 2Y0TA 3MK6A 3GP1A 4FWGA 4NZ1A 1SXJD 5JI3E 2YFQA 3U6PA 4NZ4A 4LF8M 4RF0A 3TE6A 3RFWA 2HKJA 4WW0A 2OQ4A 2J7NA 3HHYA 4DV5M 4DR1M 4JI6M 1TDHA 3SYKA 4TUWA 2KEBA 2NQ8C 3SMSA 2JE5A 2D7GA 2CFOA 1SXJE 2KRKA 4LJ8A 3GPXA 3T15A 4BBAA 3U6OA 2EA0A 1QAMA 1QYRA 4OU7A 2VQFM 3VK7A 2G8LA 4REZA 4LF4M 3I51A 1IXZA 4I81A 1TH2A 3LMMA 2R4EA 3PNYA 1MX0A 1IBKM 1GKIA 1R7RA 2W82A 3D8LA 3SYLA 1TGUA 2Y21A 4R7GA 5BPVA 3E4RA 3DZDA 4X65M 1NY6A 3WHKA 3FYDA 3M6AA 2O5RA 3FD9A 3RGSA 2F5NA 3AJIB 4II7A 5EQTA 4L15A 2FFFB 3A45A 4AG6A 2AHMA 3GPPA 4K0KM 2DZNB 2BG1A 4AI6A 4LG2A 1FNNA 5KPRA 2Z4RA 2X4AA 2FOIC 2F5QA 3THGA 5KPZA 2FNAA 2XEPA 4BB9A 2C5RA 2XD1A 3FUVA 3GRVA 3I4YA 3FUUA 4WURA 1NNUC 4JXJA 4D80A 1I4WA 2Y2QA 1ZQ9A 2RGHA 3TWLA 2M60A 5IWAM 4Z6YA 1D2NA 8CATA 3GQ4A 4LZZA 3OTOM 2L09A 2D7HA 3T38A 1EE8A 2F5PA 4LGMA 2EO2A 5FSWA 3CTWB 4YY3M 4DR2M 1N32M 2Y2PA 4RNAA 4LF9M 3A46A 2D7EA 2Y0QA 1IN6A 1IBLM 1R2YA 2DWNA 1IXRC 2QPAA 4MGHA 4DV7M 1YUBA 2C99A 4XBOA 3N3FA 5FTJA 3J2PB 2UXDM 1NY5A 3H4MA 3KDSE 1NVMA 2VQEM 2Z7JA 4KLNA 1IXSB 2C9OA 1H6UA 3HWSA 3U6MA 1L2DA 3KS8A 1JQJC 2KZSA 2HL7A 3M7GA 1N78A 2LNHC 4MGKE 4LY6A 4DV6M 3NBIA 5C18A 3J7BA 5EP1A 3VDUA 4NZ5A 4NRWA 4JYAM 1G8PA 3U6EA 2L7HA 3MHVC 4L78A 2RKOA 4JV5M 2HCBA 2ZAOA 3TWMA 4DUZM 5EXSA 1SXJA 4QOSA 4M9XA 3QWLA 2ZANA 3DA1A 3FTFA 3J80S 2ZAMA 4HLQA 3VDPA 2CHVA 2E5LM 4JI7M 3CF6E 3IG5A 1TDZA 3LQQA 2XH9A 4I8OA 4A3VB 3L2AA 4PDIA 5KQ8A 1L2BA 3U60B 1Z59A 4GKKM 1HT1E 3LVVA 3AOEA 3W0LB 2DWMA 4B3SM 1KSFX 1YU4A 3GLHA 3ZH9B 2CE7A 1FJGM 3L29A 4QNRA 1IN8A 3HU2A 4GMQA 4GKJM 1MU5A 3WX7A 5BR8M 2LWXA 4PCZA 5E6JA 3L26A 3GQ5A 1QZMA 5EJCA 3UK6A 1KFVA 1IY0A 1YUEA 3SASA 2C96A 2XLJA 1N33M 3CF0A 2XSZD 1SXJC 4LCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBJ A;  3L28 A;  4IBB A;  3L27 A;  4IBK A;  4IBF A;  3FKE A;  3L29 A;  4IBG A;  4IJE A;  4IJF A;  5BPV A;  4IBC A;  4GHL A;  4IBE A;  3KS4 A;  4GH9 A;  4IBD A;  3L26 A;  3KS8 A;  3L25 A;  4IBI A;  3L2A A;  4GHA A;  4LG2 A; 
#chains in the Genus database with same CATH topology
 1GL7 A;  1V33 A;  3QYE A;  2C9C A;  4PT5 A;  3NWL A;  2QP9 X;  2UUA M;  3TL4 X;  1L1T A;  4X64 M;  1NO1 A;  3HJ8 A;  3L27 A;  4LFC M;  4Z2K A;  2ZBK B;  2Y2J A;  4G6Z A;  5C1B A;  4FCV A;  2P5T A;  1IY2 A;  4GIT A;  5H37 D;  2UXC M;  3FKE A;  3LCU A;  2QBY A;  1JB0 F;  1IBM M;  2Y2O A;  3KOY E;  3FTE A;  2C98 A;  2L4E A;  1PJI A;  5IZ7 D;  1VDD A;  1ZAE A;  3KSX A;  3H4J A;  3VLF B;  4G4R A;  3E46 A;  2FFJ A;  3GLH E;  1VQ1 A;  3RE8 A;  3SAW A;  3ZC7 B;  4G4O A;  3HSH A;  2JCH A;  1XHB A;  3FUT A;  3PVS A;  5LMU M;  3AOE C;  4KO8 A;  1BVS A;  4DR7 M;  4OJO A;  2Y2G A;  1W5S A;  3IEC A;  3L25 A;  3M7P A;  2UUC M;  1UR9 A;  3WD2 A;  4GHA A;  4OJL A;  2V1C A;  2G3Q A;  1OFH A;  4GC5 A;  4LJ5 A;  4AG5 A;  1J5E M;  3WD3 A;  3HHX A;  3L28 A;  4M9Z A;  3EIE A;  1X37 A;  2XFS A;  2CV1 A;  1GAB A;  5KPT A;  3UJN A;  1Z5C A;  2CRU A;  4NSR A;  3TQS A;  2L7I A;  4PD2 A;  4DV0 M;  4AQY M;  1XC8 A;  4OX9 M;  1F4I A;  3KXE C;  3SHG B;  1RU3 A;  4IBC A;  4I5S A;  3HY5 A;  4L4U A;  1L1Z A;  3Q8G A;  1GVN A;  1G4A E;  1SXJ B;  3HU3 A;  2R46 A;  4G4Q A;  3U5Z B;  1DGG A;  2UU9 M;  2KHH A;  4QHS A;  1Q02 A;  2BJV A;  4Z8X A;  4KOD A;  3WD1 A;  2J7O A;  4LZJ A;  2G5G X;  4AW4 A;  4Z2H A;  1DO0 A;  4NZ3 A;  2VII A;  3UGJ A;  4X66 M;  4IIW A;  1PJS A;  4NXN M;  5ITQ A;  3SC3 A;  1I94 M;  3HGI A;  3U6L A;  3HHW A;  3GO8 A;  1QAN A;  1GJS A;  1OAO C;  3TPZ A;  1H0I A;  1DGF A;  1C1K A;  3PFI A;  2Z4S A;  3KW6 A;  4JI5 M;  2XGN A;  1KYI A;  2CWB A;  2MR9 A;  3KVW A;  4FW9 A;  1GOI A;  3C58 A;  2V6Z M;  5GKN A;  4NOO B;  3PXG A;  3FYC A;  4NYY A;  4NYU A;  2DAE A;  5EXT A;  4L16 A;  3U61 A;  1E6Z A;  1T3T A;  3SAT A;  1WJ7 A;  3DOA A;  1YU1 A;  4B7F A;  4LF7 M;  4QNL A;  2JNH A;  4OJP A;  5FLX S;  3IG8 A;  2Y2K A;  1HT2 E;  2Q2E B;  4LRT A;  4QNM A;  4LJ9 A;  5LMN M;  4I4L A;  5DYI A;  5DNY A;  3T1Y M;  1XMO M;  4XGI A;  3AL0 C;  3A42 A;  5E26 A;  4OW0 A;  3HHZ A;  3HX3 A;  3J7A S;  2OO9 A;  2KNA A;  2DAI A;  4B3R M;  1PJQ A;  3SFZ A;  2FH0 A;  2LVN C;  4MB7 A;  2OPF A;  3PNV A;  3UMM A;  1CUK A;  2JA2 A;  1XNQ M;  2VF7 A;  5EP3 A;  5FTK A;  1PGY A;  4M0D A;  1N34 M;  2DWZ B;  4DR3 M;  2LH0 A;  2QCU A;  4S12 A;  3FUX A;  3B9P A;  4M9S A;  1Y8G A;  5FTM A;  4NY2 A;  7CAT A;  3KP1 E;  4CHT B;  3JR4 A;  2EKK A;  4EIW A;  5ITX E;  3BOS A;  2Y2N A;  2JY5 A;  3M0E A;  4FVM A;  3ILK A;  1NSF A;  1R4G A;  1Z6T A;  5FTN A;  5JI2 E;  1QO6 A;  3D8B A;  3FRH A;  1JR3 D;  2KZU A;  1WXQ A;  1YU0 A;  3E9S A;  2F5O A;  2Y2I A;  1E32 A;  3SAV A;  1TH4 A;  4NSO B;  4DR5 M;  4MH0 E;  4D81 A;  1DGH A;  1QDT A;  3J81 S;  4ZPX A;  1PM5 A;  2DAM A;  2LHC A;  1V34 A;  1G41 A;  4DV3 M;  4B7G A;  2XSZ A;  4JN6 A;  3SAU A;  3JAM S;  2DXI A;  2V5O A;  1Z5B A;  1XXH A;  1PJT A;  4WP2 A;  3GLF A;  4BLC A;  3SHF A;  3HJS A;  4LJA A;  4TX8 A;  1W1T A;  2K0B X;  2KW0 A;  3TWK A;  2XD5 A;  4OJ6 A;  1ED7 A;  2K6B A;  1W5T A;  4G4N A;  1L8Q A;  4DV1 M;  4LJ6 A;  4IJF A;  1D0M A;  4KHP M;  4QHT A;  1NJF A;  1OKS A;  2WSC F;  5EP2 A;  2I7N A;  5ITR A;  4GHL A;  1OQY A;  2JP7 A;  4HL4 A;  2HHH M;  2R45 A;  3I01 M;  3GPU A;  1A5T A;  1SG9 A;  2N35 A;  2UXB M;  1QAQ A;  2X49 A;  5DYG A;  3J27 B;  1TH3 A;  3KP0 E;  2DHY A;  4M0W A;  1IN7 A;  3GLG A;  1DV0 A;  1L6J A;  1LTM A;  3C3D A;  1IN5 A;  2RGO A;  3KOX E;  2L6O A;  1N75 A;  4GEW A;  3K8Z A;  4B08 A;  1N36 M;  3AOG A;  5A2Q S;  1O6I A;  2ZTC A;  2Y20 A;  3VKG A;  2JZ0 A;  2WSE F;  1W1Y A;  1AIP C;  4IBJ A;  3EIH A;  3U6S A;  1OJL A;  3QAU A;  4IBB A;  2ERC A;  1WIV A;  3VKH A;  3LW5 F;  3AFH A;  4MGZ E;  4ITQ A;  3R9X B;  3A98 B;  4FCT A;  1GL6 A;  2ZM6 M;  2O01 F;  3KSJ A;  4MGI E;  2QHO B;  3GLI A;  1XB2 B;  3CGW A;  3MJ5 A;  3U6C A;  4LF6 M;  1HQY E;  1XXH E;  4B3T M;  1QZE A;  3GLF E;  3GRY A;  1YU3 A;  1GPF A;  2KRU A;  2R4J A;  4DV2 M;  1PDC A;  3FUW A;  2CEA A;  4IBD A;  4D82 A;  1ORY B;  1QVR A;  4Z2G A;  4NRV A;  2HWJ A;  2XZF A;  4Y28 F;  3B74 A;  3U6Q A;  2FE8 A;  3VFD A;  3GRR A;  3U61 B;  3K1J A;  2YR0 A;  4R3D A;  5IRE B;  1QUT A;  1G59 A;  4X62 M;  4DV4 M;  2EUC A;  3WD4 A;  3GLG E;  1OGB A;  5ITU A;  3WHL A;  4JI8 M;  2DWL A;  1J09 A;  4FWH A;  2XZU A;  2KXE A;  2QSF X;  3GRU A;  1E15 A;  3KOZ E;  4MGY E;  3HKP A;  3W67 A;  1IQP A;  4NL4 H;  5EXX A;  3T6P A;  1E6R A;  3ZCB B;  1G3I A;  1PRB A;  3U60 A;  2CHQ A;  3FE3 A;  2A5Y B;  3K2L A;  1IY1 A;  1XWI A;  3GLI E;  2OOA A;  4OVZ A;  4L8R C;  3FTC A;  2V1U A;  1J7K A;  1HNW M;  2BWB A;  1WGL A;  2DI0 A;  2R65 A;  2FS1 A;  5EXP A;  2WSF F;  1K82 A;  4AKH A;  2DZO B;  2X8A A;  4IBI A;  3WD0 A;  3GPY A;  1NJG A;  5ITY A;  4LFB M;  2DAG A;  2IOU A;  1R2Z A;  2F4V M;  1LV7 A;  2R18 A;  3CF2 A;  4LJ4 A;  5EP4 A;  2CP8 A;  4DR4 M;  1UFZ A;  3RGP A;  4G3O A;  3HU1 A;  3VK8 A;  1DGH B;  1E94 E;  1GLN A;  2JY6 B;  1S3S A;  5ITX A;  1DGB A;  2XF3 A;  2K9D A;  2Y2H A;  4OUI A;  5KO3 A;  4Z2I A;  2R44 A;  2BJW A;  2DEN A;  3I4V A;  3T1H M;  1GO5 A;  5F3W A;  2Z3X A;  5FTL A;  2YQZ A;  3SMP A;  1Q3B A;  1XXH B;  2JY8 A;  3GLF B;  1Q3C A;  2QEN A;  1Z5A A;  4JI1 M;  2J5Y A;  3AV0 A;  4DBG B;  2CV2 A;  3GLH B;  4UN2 B;  2BNK A;  2RRU A;  2DHR A;  1YU2 A;  3AKZ A;  2Y2M A;  1JR3 A;  4AKI A;  1OFI A;  2Z8Y M;  4CIS A;  4QOZ C;  3Q8X A;  2I7P A;  2CHG A;  3HON A;  1NV9 A;  1G71 A;  1R6B X;  4PDG A;  5IT9 S;  3JR5 A;  3GQ3 A;  3GLG B;  1HQC A;  4GRI A;  2FN2 A;  4HME A;  2QZ4 A;  1WHC A;  4KT0 F;  1MN3 A;  2M5Z A;  1IM2 A;  4IBK A;  4IBF A;  4P16 A;  1VDL A;  3SAR A;  3FTD A;  1ZMU A;  4AKG A;  4JI0 M;  2KA6 B;  4LGY A;  5ITT A;  4AZF A;  2GQF A;  4FCW A;  1EFU B;  3W68 A;  4F2L A;  4GC9 A;  4IBE A;  3B7Q A;  3KS4 A;  4LFA M;  3LQR A;  3MQL A;  3BBZ A;  3GLI B;  3SBJ A;  2QBY B;  4B3M M;  5KQD A;  2DVW B;  4YHH M;  4MM3 B;  1Q39 A;  1CK7 A;  2UWX A;  1IFY A;  4P17 A;  4JI4 M;  1HNX M;  1L2C A;  2Y2L A;  1E9S A;  4GIP A;  1YSY A;  2LXE A;  2R62 A;  3R8F A;  4F1I A;  1P3Q Q;  2YNM D;  4LJ7 A;  2UUB M;  1JR3 E;  4FWD A;  1K3W A;  2QNJ A;  1OTR A;  2MGW A;  2XSZ D;  4W5W A;  4CJ6 A;  1NNJ A;  4LF5 M;  1DO2 A;  4B7H A;  4OJ5 A;  2JZ1 A;  3U5Z A;  4IBG A;  4IJE A;  4JI2 M;  4JI3 M;  1W1V A;  4CGY B;  1IN4 A;  1NHW C;  4DR6 M;  4RF1 A;  1QQW A;  3LCV B;  1N77 A;  2H1R A;  1E6N A;  3K92 A;  3KFU G;  5L8R F;  2JY7 A;  2XFT A;  1NHG C;  4GH9 A;  2F5S A;  1AUA A;  1CXW A;  1GJT A;  1PJJ A;  2CUZ A;  2K47 A;  3UZU A;  1YE9 A;  1QAO A;  3HJQ A;  4DUY M;  1K3X A;  3LVW A;  4LRS A;  1C7Y A;  2QQ8 A;  4FD2 A;  2CV0 A;  1HR0 M;  1D0K A;  3KOW E;  1XNR M;  3W0F A;  4OVZ B;  3DFZ A;  1D0L A;  2MRO B;  1XMQ M;  1E9R A;  4ANR A;  1HNZ M;  1OGG A;  1UM8 A;  3U6D A;  4NXM M;  2Y0T A;  3MK6 A;  3GP1 A;  4FWG A;  3B89 A;  4NZ1 A;  1SXJ D;  5JI3 E;  2YFQ A;  2LVA A;  2LVP C;  3U6P A;  4LF8 M;  1EIJ A;  4NZ4 A;  4RF0 A;  3TE6 A;  2KNZ A;  3RFW A;  1T43 A;  1IXS A;  2HKJ A;  2OOB A;  4WW0 A;  2J7N A;  3HHY A;  2OQ4 A;  4DV5 M;  4DR1 M;  3FRI A;  4JI6 M;  1TDH A;  3SYK A;  1H8P A;  4TUW A;  2KEB A;  2NQ8 C;  3SMS A;  3IHP A;  2JE5 A;  2D7G A;  2JWS A;  2CFO A;  1SXJ E;  1VEK A;  3C9P A;  2KRK A;  2JXN A;  4LJ8 A;  3T15 A;  3GPX A;  4BBA A;  3U6O A;  2B3T A;  2EA0 A;  1QAM A;  1QYR A;  4OU7 A;  2VQF M;  3VK7 A;  1UR8 A;  2G8L A;  4REZ A;  4LF4 M;  4HEO A;  3I51 A;  1IXZ A;  2EKF A;  4I81 A;  1TH2 A;  1ZMW A;  3LMM A;  2R4E A;  3PNY A;  1MX0 A;  1TTE A;  1IBK M;  1GKI A;  2DAK A;  1R7R A;  1V92 A;  2W82 A;  3D8L A;  1TGU A;  2Y21 A;  3SYL A;  4R7G A;  4RKU F;  5BPV A;  3E4R A;  3DZD A;  4X65 M;  1NY6 A;  3WHK A;  3C3E A;  3K9P A;  3FYD A;  2MJ5 B;  3M6A A;  2O5R A;  3FD9 A;  3RGS A;  2F5N A;  3AJI B;  3NBX X;  4II7 A;  5EQT A;  4L15 A;  3F92 A;  2FFF B;  3A45 A;  4AG6 A;  2AHM A;  2LHG A;  3GPP A;  4K0K M;  2DZN B;  2KNV A;  2BG1 A;  2L4F A;  4AI6 A;  2KDL A;  4LG2 A;  1EAK A;  1FNN A;  5KPR A;  2L2D A;  2Z4R A;  1ZMV A;  4R71 A;  2X4A A;  2FOI C;  2RTS A;  3B7N A;  3HZJ A;  2F5Q A;  3ZQJ A;  3THG A;  5KPZ A;  2FNA A;  1YLA A;  2XEP A;  4BB9 A;  2WZJ A;  2C5R A;  2XD1 A;  3FUV A;  3GRV A;  2DNA A;  3I4Y A;  3FUU A;  4WUR A;  1NNU C;  4JXJ A;  4D80 A;  2O25 A;  1I4W A;  2Y2Q A;  1ZQ9 A;  2RGH A;  3TWL A;  2M60 A;  5IWA M;  4Z6Y A;  1D2N A;  8CAT A;  3GQ4 A;  4LZZ A;  3OTO M;  5DFL A;  2L09 A;  2DZL A;  2D7H A;  3T38 A;  2HAK A;  4Z2J A;  1EE8 A;  2F5P A;  4LGM A;  2EO2 A;  5FSW A;  3CTW B;  2DKL A;  4YY3 M;  1VEJ A;  4DR2 M;  1N32 M;  2H5X A;  2Y2P A;  4RNA A;  1E88 A;  4LF9 M;  3A46 A;  2D49 A;  4HMC A;  2D7E A;  2Y0Q A;  1IN6 A;  1IBL M;  4Z2L A;  1R2Y A;  2VF8 A;  4Q7J A;  2MH8 A;  2DWN A;  4L6V 6;  1IXR C;  2APL A;  2QPA A;  1T6O A;  3K9O A;  4MGH A;  4DV7 M;  1YUB A;  4MB5 A;  2C99 A;  4XBO A;  3N3F A;  5FTJ A;  3J2P B;  2UXD M;  1NY5 A;  3B7Z A;  3H4M A;  1NVM A;  3KDS E;  2VQE M;  2Z7J A;  3I04 M;  1IXS B;  2EJS A;  4KLN A;  2C9O A;  1H6U A;  3HWS A;  1R5L A;  3U6M A;  1L2D A;  3KS8 A;  1TF0 B;  1JQJ C;  1WGN A;  2HL7 A;  2KZS A;  1E8B A;  3M7G A;  1N78 A;  2LNH C;  4MGK E;  4LY6 A;  2LVO C;  4DV6 M;  3NBI A;  2R0I A;  3J7B A;  5C18 A;  5EP1 A;  3VDU A;  4NZ5 A;  3MMP A;  1AIW A;  4NRW A;  2R6F A;  1G8P A;  4JYA M;  3U6E A;  2L7H A;  2ZTD A;  3MHV C;  4L78 A;  4CIZ A;  2RKO A;  4JV5 M;  2HCB A;  2ZAO A;  3TWM A;  2LBC A;  4DUZ M;  3E21 A;  5EXS A;  1SXJ A;  4XK8 F;  4HMD A;  4QOS A;  1NV8 A;  4M9X A;  3QWL A;  2ZAN A;  2GNO A;  3DA1 A;  3FTF A;  3J80 S;  2ZAM A;  4MB3 A;  4HLQ A;  3VDP A;  2CHV A;  1OIZ A;  4MB4 A;  1OIP A;  2E5L M;  4NC6 A;  2BWE A;  4JI7 M;  1ZV1 A;  3CF6 E;  3IG5 A;  1E6P A;  1TDZ A;  3LQQ A;  2XH9 A;  4I8O A;  4A3V B;  3L2A A;  4PDI A;  5KQ8 A;  1L2B A;  3U60 B;  1KS0 A;  2JUJ A;  1Z59 A;  2LVQ D;  3QYB A;  1QUS A;  1HT1 E;  3LVV A;  3AOE A;  3W0L B;  2DWM A;  4B3S M;  4GKK M;  1H0G A;  1KSF X;  1GXD A;  1YU4 A;  3GLH A;  3ZH9 B;  2CE7 A;  1FJG M;  3L29 A;  1VEG A;  1MJG M;  4QNR A;  1IN8 A;  2LTU A;  3HU2 A;  4GMQ A;  4GKJ M;  1MU5 A;  3WX7 A;  1TR8 A;  5BR8 M;  3V76 A;  2LWX A;  1OAI A;  4PCZ A;  5E6J A;  3L26 A;  3GQ5 A;  1W1P A;  1QZM A;  5EJC A;  1WR1 B;  3UK6 A;  1KFV A;  1IY0 A;  1YUE A;  1VG5 A;  3SAS A;  3BXW A;  2C96 A;  2XLJ A;  1N33 M;  1HJP A;  1J7M A;  3CF0 A;  2VDB B;  1SXJ C;  4LCB A;  1QDR A; 
#chains in the Genus database with same CATH homology
 1GL7 A;  2C9C A;  4PT5 A;  3NWL A;  2QP9 X;  2UUA M;  3TL4 X;  1L1T A;  4X64 M;  3HJ8 A;  3L27 A;  4LFC M;  2ZBK B;  2Y2J A;  4G6Z A;  5C1B A;  4FCV A;  2P5T A;  1IY2 A;  4GIT A;  5H37 D;  2UXC M;  3FKE A;  2QBY A;  1IBM M;  2Y2O A;  3KOY E;  3FTE A;  2C98 A;  1PJI A;  5IZ7 D;  1VDD A;  1ZAE A;  3KSX A;  3VLF B;  4G4R A;  3SAW A;  2FFJ A;  3RE8 A;  3ZC7 B;  4G4O A;  3HSH A;  2JCH A;  1XHB A;  3FUT A;  3PVS A;  5LMU M;  3AOE C;  4KO8 A;  4DR7 M;  4OJO A;  2Y2G A;  1W5S A;  3L25 A;  2UUC M;  4GHA A;  4OJL A;  2V1C A;  1OFH A;  4GC5 A;  4LJ5 A;  4AG5 A;  1J5E M;  3HHX A;  3L28 A;  4M9Z A;  3EIE A;  1X37 A;  2XFS A;  2CV1 A;  5KPT A;  3UJN A;  1Z5C A;  4NSR A;  4PD2 A;  3TQS A;  2L7I A;  4DV0 M;  1XC8 A;  4AQY M;  4OX9 M;  3KXE C;  3SHG B;  4I5S A;  4IBC A;  4L4U A;  1L1Z A;  1GVN A;  1G4A E;  1SXJ B;  3HU3 A;  2R46 A;  4G4Q A;  3U5Z B;  1DGG A;  2UU9 M;  4QHS A;  2BJV A;  4Z8X A;  4KOD A;  2J7O A;  4LZJ A;  2G5G X;  4AW4 A;  1DO0 A;  4NZ3 A;  2VII A;  3UGJ A;  4X66 M;  4IIW A;  5ITQ A;  4NXN M;  3SC3 A;  1I94 M;  3HGI A;  3U6L A;  3HHW A;  3GO8 A;  1QAN A;  3TPZ A;  1DGF A;  1C1K A;  3PFI A;  2Z4S A;  3KW6 A;  4JI5 M;  2XGN A;  1KYI A;  3KVW A;  4FW9 A;  3C58 A;  2V6Z M;  5GKN A;  4NOO B;  3PXG A;  3FYC A;  4NYY A;  4NYU A;  5EXT A;  4L16 A;  3U61 A;  1T3T A;  3SAT A;  3DOA A;  1YU1 A;  4B7F A;  4LF7 M;  4QNL A;  4OJP A;  5FLX S;  3IG8 A;  2Y2K A;  1HT2 E;  2Q2E B;  4LRT A;  4QNM A;  4LJ9 A;  5LMN M;  4I4L A;  5DYI A;  5DNY A;  3T1Y M;  1XMO M;  4XGI A;  3AL0 C;  3A42 A;  5E26 A;  4OW0 A;  3HHZ A;  3J7A S;  4B3R M;  3SFZ A;  4MB7 A;  2OPF A;  3PNV A;  3UMM A;  2JA2 A;  1XNQ M;  5EP3 A;  5FTK A;  4M0D A;  1N34 M;  2DWZ B;  4DR3 M;  2LH0 A;  2QCU A;  4S12 A;  3FUX A;  3B9P A;  4M9S A;  5FTM A;  4NY2 A;  7CAT A;  3KP1 E;  4CHT B;  3JR4 A;  4EIW A;  5ITX E;  3BOS A;  2Y2N A;  3M0E A;  4FVM A;  3ILK A;  1NSF A;  1Z6T A;  5FTN A;  5JI2 E;  3D8B A;  1JR3 D;  2KZU A;  1WXQ A;  1YU0 A;  3E9S A;  2F5O A;  2Y2I A;  1E32 A;  3SAV A;  1TH4 A;  4NSO B;  4DR5 M;  4MH0 E;  4D81 A;  1DGH A;  3J81 S;  4ZPX A;  1PM5 A;  1G41 A;  4DV3 M;  4B7G A;  2XSZ A;  4JN6 A;  3SAU A;  3JAM S;  2DXI A;  1Z5B A;  1XXH A;  3GLF A;  4BLC A;  3SHF A;  3HJS A;  4LJA A;  2KW0 A;  3TWK A;  2XD5 A;  4OJ6 A;  1W5T A;  4G4N A;  1L8Q A;  4DV1 M;  4LJ6 A;  4IJF A;  4KHP M;  4QHT A;  1NJF A;  5ITR A;  5EP2 A;  2I7N A;  4GHL A;  4HL4 A;  2HHH M;  2R45 A;  3GPU A;  2UXB M;  1QAQ A;  2X49 A;  5DYG A;  3J27 B;  1TH3 A;  3KP0 E;  4M0W A;  3GLG A;  1IN7 A;  1IN5 A;  2RGO A;  3KOX E;  2L6O A;  1N75 A;  1N36 M;  3K8Z A;  4B08 A;  3AOG A;  5A2Q S;  2Y20 A;  3VKG A;  4IBJ A;  3EIH A;  3U6S A;  1OJL A;  3QAU A;  4IBB A;  2ERC A;  3VKH A;  3AFH A;  4MGZ E;  4ITQ A;  3R9X B;  3A98 B;  4FCT A;  1GL6 A;  2ZM6 M;  3KSJ A;  4MGI E;  3GLI A;  3MJ5 A;  3U6C A;  4LF6 M;  1HQY E;  4B3T M;  3GRY A;  1YU3 A;  2KRU A;  2R4J A;  4DV2 M;  3FUW A;  2CEA A;  4IBD A;  4D82 A;  1ORY B;  1QVR A;  4NRV A;  2XZF A;  3U6Q A;  2FE8 A;  3VFD A;  3GRR A;  3U61 B;  3K1J A;  2YR0 A;  4R3D A;  5IRE B;  1G59 A;  4X62 M;  4DV4 M;  2EUC A;  5ITU A;  3WHL A;  4JI8 M;  2DWL A;  1J09 A;  4FWH A;  2XZU A;  2KXE A;  3GRU A;  3KOZ E;  4MGY E;  3HKP A;  1IQP A;  4NL4 H;  5EXX A;  3ZCB B;  1G3I A;  3U60 A;  2CHQ A;  2A5Y B;  3K2L A;  1IY1 A;  1XWI A;  4OVZ A;  4L8R C;  3FTC A;  2V1U A;  1J7K A;  1HNW M;  2R65 A;  5EXP A;  1K82 A;  4AKH A;  2DZO B;  2X8A A;  4IBI A;  3GPY A;  1NJG A;  5ITY A;  4LFB M;  2IOU A;  1R2Z A;  2F4V M;  1LV7 A;  2R18 A;  3CF2 A;  4LJ4 A;  5EP4 A;  4DR4 M;  3RGP A;  3HU1 A;  3VK8 A;  1DGH B;  1E94 E;  1GLN A;  1HR0 M;  1S3S A;  5ITX A;  1DGB A;  2XF3 A;  2Y2H A;  4OUI A;  5KO3 A;  2BJW A;  3I4V A;  3T1H M;  5F3W A;  2Z3X A;  5FTL A;  2YQZ A;  3SMP A;  1Q3B A;  1XXH B;  3GLF B;  1Q3C A;  2QEN A;  1Z5A A;  4JI1 M;  3AV0 A;  2CV2 A;  3GLH B;  2BNK A;  2DHR A;  1YU2 A;  3AKZ A;  2Y2M A;  1JR3 A;  4AKI A;  1OFI A;  4CIS A;  4QOZ C;  3Q8X A;  2I7P A;  2CHG A;  3HON A;  1R6B X;  4PDG A;  5IT9 S;  3JR5 A;  3GQ3 A;  3GLG B;  1HQC A;  4GRI A;  2QZ4 A;  2M5Z A;  1IM2 A;  4IBK A;  4IBF A;  4P16 A;  3SAR A;  3FTD A;  4AKG A;  4JI0 M;  2KA6 B;  4LGY A;  5ITT A;  4AZF A;  4FCW A;  4GC9 A;  4IBE A;  4LFA M;  3KS4 A;  3LQR A;  3GLI B;  3SBJ A;  2QBY B;  4B3M M;  5KQD A;  2DVW B;  4YHH M;  4MM3 B;  1Q39 A;  2UWX A;  4JI4 M;  1HNX M;  1L2C A;  2Y2L A;  1E9S A;  4GIP A;  1YSY A;  2LXE A;  2R62 A;  3R8F A;  2YNM D;  4LJ7 A;  2UUB M;  4FWD A;  1K3W A;  4W5W A;  1NNJ A;  4LF5 M;  1DO2 A;  4B7H A;  4OJ5 A;  3U5Z A;  4JI2 M;  4IBG A;  4IJE A;  4JI3 M;  4CGY B;  1IN4 A;  1NHW C;  4DR6 M;  4RF1 A;  1QQW A;  1N77 A;  2H1R A;  3K92 A;  3KFU G;  2XFT A;  2F5S A;  1NHG C;  4GH9 A;  1PJJ A;  2CUZ A;  2K47 A;  3UZU A;  1YE9 A;  1QAO A;  3HJQ A;  4DUY M;  1K3X A;  3LVW A;  4LRS A;  4FD2 A;  2CV0 A;  3KOW E;  1XNR M;  3W0F A;  4OVZ B;  3DFZ A;  1XMQ M;  1E9R A;  1HNZ M;  1UM8 A;  3U6D A;  4NXM M;  2Y0T A;  3MK6 A;  3GP1 A;  4FWG A;  4NZ1 A;  1SXJ D;  5JI3 E;  2YFQ A;  3U6P A;  4NZ4 A;  4LF8 M;  4RF0 A;  3TE6 A;  3RFW A;  2HKJ A;  4WW0 A;  2OQ4 A;  2J7N A;  3HHY A;  4DV5 M;  4DR1 M;  4JI6 M;  1TDH A;  3SYK A;  4TUW A;  2KEB A;  2NQ8 C;  3SMS A;  2JE5 A;  2D7G A;  2CFO A;  1SXJ E;  2KRK A;  4LJ8 A;  3GPX A;  3T15 A;  4BBA A;  3U6O A;  2EA0 A;  1QAM A;  1QYR A;  4OU7 A;  2VQF M;  3VK7 A;  2G8L A;  4REZ A;  4LF4 M;  3I51 A;  1IXZ A;  4I81 A;  1TH2 A;  3LMM A;  2R4E A;  3PNY A;  1MX0 A;  1IBK M;  1GKI A;  1R7R A;  2W82 A;  3D8L A;  3SYL A;  1TGU A;  2Y21 A;  4R7G A;  5BPV A;  3E4R A;  3DZD A;  4X65 M;  1NY6 A;  3WHK A;  3FYD A;  3M6A A;  2O5R A;  3FD9 A;  3RGS A;  2F5N A;  3AJI B;  4II7 A;  5EQT A;  4L15 A;  2FFF B;  3A45 A;  4AG6 A;  2AHM A;  3GPP A;  4K0K M;  2DZN B;  2BG1 A;  4AI6 A;  4LG2 A;  1FNN A;  5KPR A;  2Z4R A;  2X4A A;  2FOI C;  2F5Q A;  3THG A;  5KPZ A;  2FNA A;  2XEP A;  4BB9 A;  2C5R A;  2XD1 A;  3FUV A;  3GRV A;  3I4Y A;  3FUU A;  4WUR A;  1NNU C;  4JXJ A;  4D80 A;  1I4W A;  2Y2Q A;  1ZQ9 A;  2RGH A;  3TWL A;  2M60 A;  5IWA M;  4Z6Y A;  1D2N A;  8CAT A;  3GQ4 A;  4LZZ A;  3OTO M;  2L09 A;  2D7H A;  3T38 A;  1EE8 A;  2F5P A;  4LGM A;  2EO2 A;  5FSW A;  3CTW B;  4YY3 M;  4DR2 M;  1N32 M;  2Y2P A;  4RNA A;  4LF9 M;  3A46 A;  2D7E A;  2Y0Q A;  1IN6 A;  1IBL M;  1R2Y A;  2DWN A;  1IXR C;  2QPA A;  4MGH A;  4DV7 M;  1YUB A;  2C99 A;  4XBO A;  3N3F A;  5FTJ A;  3J2P B;  2UXD M;  1NY5 A;  3H4M A;  3KDS E;  1NVM A;  2VQE M;  2Z7J A;  4KLN A;  1IXS B;  2C9O A;  1H6U A;  3HWS A;  3U6M A;  1L2D A;  3KS8 A;  1JQJ C;  2KZS A;  2HL7 A;  3M7G A;  1N78 A;  2LNH C;  4MGK E;  4LY6 A;  4DV6 M;  3NBI A;  5C18 A;  3J7B A;  5EP1 A;  3VDU A;  4NZ5 A;  4NRW A;  4JYA M;  1G8P A;  3U6E A;  2L7H A;  3MHV C;  4L78 A;  2RKO A;  4JV5 M;  2HCB A;  2ZAO A;  3TWM A;  4DUZ M;  5EXS A;  1SXJ A;  4QOS A;  4M9X A;  3QWL A;  2ZAN A;  3DA1 A;  3FTF A;  3J80 S;  2ZAM A;  4HLQ A;  3VDP A;  2CHV A;  2E5L M;  4JI7 M;  3CF6 E;  3IG5 A;  1TDZ A;  3LQQ A;  2XH9 A;  4I8O A;  4A3V B;  3L2A A;  4PDI A;  5KQ8 A;  1L2B A;  3U60 B;  1Z59 A;  4GKK M;  1HT1 E;  3LVV A;  3AOE A;  3W0L B;  2DWM A;  4B3S M;  1KSF X;  1YU4 A;  3GLH A;  3ZH9 B;  2CE7 A;  1FJG M;  3L29 A;  4QNR A;  1IN8 A;  3HU2 A;  4GMQ A;  4GKJ M;  1MU5 A;  3WX7 A;  5BR8 M;  2LWX A;  4PCZ A;  5E6J A;  3L26 A;  3GQ5 A;  1QZM A;  5EJC A;  3UK6 A;  1KFV A;  1IY0 A;  1YUE A;  3SAS A;  2C96 A;  2XLJ A;  1N33 M;  3CF0 A;  2XSZ D;  1SXJ C;  4LCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...