3L2AA

Crystal structure of reston ebola vp35 interferon inhibitory domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
126
structure length
126
Chain Sequence
b'GKPYISAKDLKEIMYDHLPGFGTAFHQLVQVICKIGKDNNLLDTIHAEFQASLADGDSPQCALIQITKRVPIFQDVPPPIIHIRSRGDIPRACQKSLRPAPPSPKIDRGWVCLFKMQDGKTLGLKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase cofactor VP35
publication title Structural and Functional Characterization of Reston Ebola Virus VP35 Interferon Inhibitory Domain.
pubmed doi rcsb
source organism Reston ebolavirus
molecule tags Rna binding protein
total genus 41
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2009-12-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.950 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3l2aA01
2.10.10.70 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3l2aA02
4IBFA 4GH9A 3KS4A 4IBKA 4IBDA 4IBEA 4IBCA 3L27A 3L28A 4IBJA 3L2AA 4GHAA 3L26A 3KS8A 3L29A 4IBBA 4IJFA 4IBGA 4IBIA 3L25A 4IJEA 4GHLA 3FKEA 4LG2A 5BPVA
chains in the Genus database with same CATH superfamily
2JA2A 4GKJM 2ZBKB 4BB9A 1GL7A 4LCBA 5FSWA 3VK7A 4I4LA 2R65A 1L2CA 5EXSA 2LTUA 4MGHA 3TWLA 3DOAA 1UR9A 4L6V6 4B3MM 1ZMVA 3C9PA 3K9OA 2X8AA 3GLIB 4MB3A 3KOXE 4MB5A 3BBZA 4F1IA 3QWLA 4NRVA 4MB7A 3I51A 3U6LA 1W1YA 2XGNA 3FRHA 1A5TA 2BNKA 1DGHA 1QYRA 3N3FA 4LZJA 3PNYA 4NZ4A 4KHPM 4LZZA 2DENA 1MX0A 1XHBA 4NZ3A 1C1KA 5DFLA 1QO6A 2A5YB 3C3DA 8CATA 1W1TA 1QAQA 1IM2A 2WZJA 3D8BA 3K9PA 3TL4X 1SXJA 2Y2NA 4PT5A 2JZ1A 2APLA 2EKFA 2QHOB 4ZPXA 1ZMWA 3TWMA 4JI2M 2XF3A 5ITUA 2CWBA 2K6BA 2OOAA 2LBCA 4LF6M 1QAOA 2BWEA 2UU9M 3U60A 2XH9A 2XD1A 4NXNM 2OQ4A 3HKPA 1R2ZA 3RGPA 4P17A 4CJ6A 4PDIA 2DWNA 1Z5CA 4REZA 3E9SA 2LXEA 1Z5BA 4KO8A 4IBGA 3W68A 1NJGA 1E6RA 4HEOA 2UUCM 2L4EA 1YSYA 2L7HA 5KQ8A 2MGWA 2RRUA 2XSZA 3SFZA 2OO9A 3UGJA 2KXEA 2Z3XA 2D49A 2FOIC 1NSFA 3UMMA 1OKSA 4CGYB 1N36M 1MN3A 4JI1M 3PFIA 4DV3M 4JXJA 4B7HA 1E6NA 1SG9A 4R71A 1BVSA 2JY8A 3GRRA 4IBKA 2V1CA 4MGIE 3LQQA 1PJJA 1IBMM 4PD2A 2MR9A 3HGIA 4NOOB 2IOUA 4GMQA 2VQFM 4GHAA 4Z6YA 3HU3A 5DYGA 3FTCA 1MJGM 2K0BX 2R4EA 4GEWA 2KDLA 4LY6A 3UJNA 1GPFA 3Q8XA 1T3TA 3FUVA 1D2NA 4L16A 2HKJA 3I4VA 3GLFA 1V92A 4NYUA 4UN2B 3C3EA 3AKZA 2QENA 2XZUA 3JR4A 2Q2EB 3VKGA 2CHVA 1DO0A 2QP9X 3KSXA 3HHZA 5BPVA 3DZDA 3H4JA 1E6PA 3WD0A 1TH2A 2DZLA 2JNHA 3SATA 1T43A 1G71A 2YR0A 3Q8GA 4HMEA 2B3TA 2EKKA 1CXWA 1G41A 1V34A 3GP1A 3B7QA 2LVOC 4Z8XA 2WSFF 1IY2A 3W67A 4AQYM 3MQLA 5EP4A 1WJ7A 3WD3A 4AG5A 4NRWA 2FFFB 1WGNA 2C9OA 4WP2A 3HHYA 3LVWA 2KHHA 4NSRA 3KW6A 2MROB 4B3TM 4Z2LA 3SHGB 2P5TA 4JI7M 4GKKM 1IY1A 1W1VA 1K3WA 4M0WA 4HL4A 2F4VM 2UXBM 2F5PA 3LVVA 2XD5A 2DWLA 2JY6B 3M7PA 5LMNM 2R4JA 3GLGB 2VIIA 3WD4A 1J09A 4JI3M 4IBDA 1GO5A 2D7GA 5KPZA 4GIPA 4OJPA 1OFIA 5E6JA 2O25A 1ZV1A 2XZFA 2GNOA 3VDUA 2BWBA 3L29A 2DAGA 2R18A 1XWIA 5KPRA 3FTEA 4DR5M 4K0KM 4G4RA 3I4YA 2XFTA 3TPZA 3FUXA 3SBJA 4OUIA 1Q3BA 2CHQA 3B7NA 2UUBM 4LF4M 1DGFA 2JXNA 3KFUG 7CATA 4LFAM 1KSFX 4JI6M 2FFJA 1TDHA 2ERCA 1E6ZA 4B3RM 4IJEA 1PJQA 1JQJC 2Y20A 3UZUA 2Y21A 4GHLA 2R62A 1IN6A 2QZ4A 4ANRA 4B08A 2EA0A 2J5YA 3CGWA 2HWJA 1H6UA 1TGUA 3VLFB 2LNHC 1GKIA 3HU2A 2MJ5B 4GH9A 3HWSA 4DV5M 3TQSA 4LF5M 2CUZA 2VDBB 3A42A 4JV5M 1YUBA 2F5SA 3GQ5A 1YE9A 2Y2JA 3VKHA 1Z5AA 5KQDA 1IBKM 2RTSA 1PJTA 1IXSB 3LCVB 3J7BA 4IIWA 3FUWA 4RKUF 5IZ7D 3HX3A 3MK6A 3GLHB 3HHWA 3BOSA 3W0FA 2Y2QA 3RE8A 1Q39A 2ZTCA 1XXHB 5IREB 4X65M 4TX8A 3WD2A 1ZAEA 4IBIA 3T1YM 4BBAA 4ITQA 3CF6E 3U6EA 2J7OA 3U6PA 2Y2PA 3E46A 3E4RA 1Q3CA 2VF7A 4G6ZA 2QBYB 4LF9M 1S3SA 1NHGC 2DVWB 5EXXA 5LMUM 4AKGA 2AHMA 2F5QA 2Y2LA 1O6IA 2DHRA 4M0DA 3FE3A 2FH0A 1W1PA 4G3OA 1UM8A 1NVMA 1PJIA 2ZAMA 3HJQA 1SXJD 4LJ9A 4R7GA 2DI0A 2HL7A 3U6CA 2WSCF 2DNAA 3GQ4A 2V5OA 4I5SA 5DNYA 1NO1A 3K8ZA 4MM3B 3ILKA 1OIZA 5KO3A 3GLIA 1I4WA 3SHFA 4LGMA 3FTDA 4RNAA 2Z8YM 3GPXA 2CV1A 1JR3A 3GLIE 2DZNB 1X37A 2F5OA 2RGHA 3LCUA 3GPUA 1DV0A 1YUEA 4OVZB 4JYAM 4AG6A 4D82A 2CP8A 3GRUA 1JR3E 3E21A 3LMMA 1XXHE 2ZAOA 4HLQA 2V1UA 4Z2JA 1G59A 3K92A 1LTMA 4DR1M 3HJSA 2NQ8C 3THGA 3ZH9B 1GLNA 5C1BA 3KS4A 4GRIA 3LQRA 2XSZD 4QOSA 5FTNA 2R46A 3HJ8A 3GRYA 4RF1A 4DR2M 4AKIA 3RFWA 2R44A 2DAKA 4WW0A 1N33M 1IXZA 1E88A 4AI6A 1QQWA 3MHVC 3FYCA 2UXDM 1TH4A 2C9CA 1MU5A 2KNVA 2Y2IA 4DUZM 3HSHA 1EIJA 3SYLA 4KT0F 1XNRM 3AOEC 4LRSA 4DV4M 4BLCA 3JR5A 1QZEA 1WR1B 4RF0A 4DV1M 1NV8A 4JI4M 2KW0A 1HNWM 1OAIA 4OVZA 3HHXA 4LJAA 4W5WA 4DV0M 2Z4SA 4IBFA 1TH3A 1Y8GA 4IBCA 1I94M 2DAEA 4F2LA 1R2YA 3SYKA 4X64M 1XMOM 1PRBA 2KNZA 5JI2E 3MJ5A 4LJ8A 1XMQM 2C98A 2K9DA 4CISA 1Q02A 2EO2A 2Z4RA 4I8OA 1NNJA 4LFBM 1QDRA 3KVWA 3B89A 1N34M 4FWDA 5E26A 4LGYA 4EIWA 4OJ5A 3CTWB 1QUTA 4NSOB 2FS1A 4G4OA 1H8PA 3VFDA 2O5RA 2JY7A 1K82A 4MGKE 4PCZA 4DR7M 1HNXM 4Z2KA 2JE5A 2KZUA 2Y2HA 2KEBA 3FKEA 3BXWA 3AJIB 2QQ8A 1OTRA 3AOGA 1VDLA 3H4MA 1XC8A 4GITA 2FNAA 4NZ5A 3GPPA 1IN5A 4JI5M 3C58A 3KP1E 4FWGA 4DR4M 2HCBA 1QVRA 4DR6M 1WXQA 1IN4A 4QHSA 4D80A 3NWLA 1HQCA 2G5GX 3IHPA 3NBXX 2DHYA 5GKNA 3U6DA 1N32M 2JP7A 1F4IA 3K2LA 1D0KA 3A46A 2VQEM 3U6QA 2RKOA 3SAVA 4DUYM 1D0MA 1GOIA 4OJ6A 4LJ4A 2UUAM 1CK7A 2DKLA 3AL0C 2Y2OA 4LJ7A 1YU3A 2YQZA 1ORYB 1PGYA 4JI8M 1DGGA 4X66M 5JI3E 4DR3M 4CHTB 2DXIA 2XFSA 4OJOA 5ITXA 3J81S 1R5LA 5ITQA 4NXMM 2D7EA 2I7NA 1OFHA 3IG5A 5ITXE 3TE6A 4L78A 3J2PB 4QNRA 2HAKA 2H1RA 2H5XA 2OPFA 4NL4H 4GC5A 4LJ5A 3VDPA 2V6ZM 1SXJC 4LFCM 2Y2MA 3WHLA 1GABA 4PDGA 3DFZA 4IBEA 2X4AA 3D8LA 1L2BA 4B7GA 5EP2A 3GLGA 4A3VB 2JY5A 3L2AA 4DV2M 2RGOA 4OJLA 3DA1A 1P3QQ 3GLGE 1QUSA 3PNVA 1H0GA 1DGHB 1E94E 3ZQJA 2BG1A 1UFZA 3T1HM 1ED7A 1OGBA 3NBIA 3HZJA 1E32A 4GC9A 4LJ6A 2Y0QA 5A2QS 2LVPC 3FD9A 5IWAM 3M0EA 3MMPA 3KOYE 1N75A 5L8RF 2OOBA 1LV7A 1SXJB 1IBLM 4AW4A 3JAMS 4M9XA 1GJTA 2YNMD 2QCUA 2EUCA 1XNQM 1EE8A 2FN2A 1PDCA 3SMSA 3FUTA 3U60B 4FCVA 2DWZB 4JN6A 3IECA 3W0LB 2ZANA 1AIPC 2CRUA 4QNLA 3HONA 5ITTA 4FW9A 4DV7M 1EFUB 1L1ZA 4DV6M 3J27B 4HMCA 2JCHA 1H0IA 1IXSA 1VG5A 4Z2GA 2W82A 5FLXS 1RU3A 1XB2B 2R6FA 1IN7A 1QZMA 3GLHA 3QYBA 1Z59A 2G8LA 3GRVA 4NC6A 3U61B 2JWSA 3AV0A 4L15A 3VK8A 2Y2KA 2CHGA 1J7MA 1XXHA 1TR8A 3GLHE 4XGIA 4OX9M 1WHCA 3M6AA 2EJSA 4LG2A 1IFYA 3L25A 2L6OA 1QAMA 2L2DA 4D81A 1JR3D 4LF7M 1L1TA 5FTJA 4FD2A 1CUKA 3FUUA 2JUJA 1QDTA 3KOZE 2N35A 2QBYA 1SXJE 2LVNC 3L27A 2QSFX 3EIEA 2KZSA 4IBJA 3T38A 4P16A 1N77A 3LW5F 2BJWA 3L26A 1GXDA 2WSEF 1V33A 4FWHA 4IBBA 4FCWA 4II7A 4MH0E 4L4UA 2CE7A 1R7RA 3KP0E 4MGYE 3GLFB 2M5ZA 1YU1A 3T6PA 2MH8A 2DAIA 3TWKA 1FJGM 3R8FA 4MB4A 1G3IA 3ZC7B 1WGLA 5EP1A 1E8BA 2XEPA 3GO8A 1R6BX 1OAOC 3KOWE 3I04M 4KLNA 3J7AS 4HMDA 1HJPA 2O01F 5IT9S 2CV2A 2L7IA 1YU0A 5FTLA 4Z2IA 3U61A 3FTFA 1DO2A 3R9XB 3WHKA 4YY3M 1AUAA 4X62M 1OQYA 3M7GA 1PM5A 1IXRC 2VF8A 1TTEA 1NY6A 5FTKA 1VQ1A 4DBGB 3ZCBB 2LH0A 2L09A 3U6MA 4AKHA 1YU4A 2Y2GA 1KYIA 4FCTA 2X49A 1OIPA 3CF2A 2K47A 1HR0M 2R45A 4WURA 3U6SA 3FRIA 1HT1E 2DAMA 5DYIA 1NNUC 1ZMUA 2LHCA 3PVSA 4QNMA 2ZM6M 1GJSA 1C7YA 1E9SA 4FVMA 1NV9A 2DZOB 4M9ZA 5KPTA 3A45A 2BJVA 2E5LM 2C96A 1NY5A 2D7HA 4I81A 2J7NA 4M9SA 1E15A 4YHHM 3SAUA 4LRTA 4QOZC 1D0LA 3GLFE 5FTMA 3J80S 3T15A 4AZFA 4NY2A 3I01M 1NJFA 1T6OA 4MGZE 5EXPA 5ITYA 3PXGA 2KRKA 4Z2HA 1G8PA 2DWMA 1QANA 2XLJA 5EXTA 2LWXA 3HY5A 3SAWA 2YFQA 3U5ZB 2CV0A 3RGSA 2F5NA 2CEAA 1L2DA 3QAUA 4Y28F 1L6JA 2UXCM 1J7KA 1L8QA 3AFHA 5F3WA 3V76A 2L4FA 4G4NA 1IN8A 2LVAA 2QNJA 3L28A 4XK8F 1R4GA 1UR8A 3F92A 4OW0A 4R3DA 3UK6A 3U6OA 3WX7A 3B7ZA 1W5SA 4IJFA 3OTOM 3SASA 3CF0A 1VDDA 1PJSA 1NHWC 1Z6TA 2Z7JA 4OU7A 1WIVA 4NYYA 4TUWA 1TF0B 4B7FA 3KDSE 1DGBA 3AOEA 3QYEA 2Y0TA 3WD1A 3KXEC 1E9RA 3A98B 1GVNA 4S12A 2KA6B 1VEKA 4G4QA 2C99A 2KNAA 1KFVA 3KS8A 1K3XA 3SMPA 2LVQD 2LHGA 4CIZA 4KODA 3U5ZA 1IQPA 2I7PA 2ZTDA 5H37D 2M60A 5EP3A 2UWXA 1YU2A 3GQ3A 3GPYA 4Q7JA 1AIWA 3B9PA 3K1JA 3KSJA 2GQFA 5BR8M 4B3SM 1VEJA 1OJLA 1W5TA 1HT2E 2QPAA 3IG8A 1YLAA 4QHTA 1KS0A 1JB0F 1ZQ9A 2G3QA 1HNZM 5EQTA 4XBOA 2JZ0A 1HQYE 1N78A 4JI0M 5ITRA 1J5EM 4LF8M 3HU1A 2C5RA 3EIHA 1EAKA 2FE8A 4NZ1A 1OGGA 2CFOA 3FYDA 3B74A 5EJCA 1IY0A 1TDZA 1FNNA 3SARA 3SC3A 4L8RC 1G4AE 2KRUA 2R0IA 1GL6A 2HHHM 5C18A 1VEGA
chains in the Genus database with same CATH topology
2JA2A 4GKJM 2ZBKB 4BB9A 1GL7A 4LCBA 5FSWA 3VK7A 4I4LA 2R65A 1L2CA 5EXSA 4MGHA 3TWLA 3DOAA 4B3MM 2X8AA 3GLIB 3KOXE 3QWLA 4NRVA 4MB7A 3I51A 3U6LA 2XGNA 2BNKA 1DGHA 1QYRA 3N3FA 4LZJA 3PNYA 4NZ4A 4KHPM 4LZZA 1MX0A 1XHBA 4NZ3A 1C1KA 2A5YB 8CATA 1QAQA 1IM2A 3TL4X 3D8BA 2Y2NA 1SXJA 4PT5A 4ZPXA 3TWMA 4JI2M 2XF3A 5ITUA 4LF6M 2XD1A 1QAOA 2UU9M 3U60A 2XH9A 4NXNM 2OQ4A 3HKPA 1R2ZA 3RGPA 4PDIA 2DWNA 1Z5CA 4REZA 3E9SA 2LXEA 1Z5BA 4KO8A 4IBGA 1NJGA 2UUCM 1YSYA 2L7HA 5KQ8A 3SFZA 2XSZA 3UGJA 2Z3XA 2KXEA 2FOIC 1NSFA 3UMMA 1N36M 4CGYB 4JI1M 3PFIA 4DV3M 4JXJA 4B7HA 3GRRA 4IBKA 4MGIE 2V1CA 1PJJA 3LQQA 1IBMM 2IOUA 4PD2A 3HGIA 4NOOB 4GMQA 2VQFM 4GHAA 4Z6YA 3HU3A 5DYGA 3FTCA 2R4EA 4LY6A 3UJNA 3Q8XA 1T3TA 3FUVA 1D2NA 4L16A 2HKJA 3I4VA 3GLFA 4NYUA 3AKZA 2QENA 2XZUA 3JR4A 2Q2EB 3VKGA 2CHVA 1DO0A 2QP9X 3KSXA 3HHZA 5BPVA 3DZDA 1TH2A 3SATA 2YR0A 1G41A 3GP1A 4Z8XA 1IY2A 4AQYM 5EP4A 4AG5A 4NRWA 2FFFB 2C9OA 3HHYA 3LVWA 4NSRA 3KW6A 4B3TM 3SHGB 2P5TA 4JI7M 4GKKM 1IY1A 1K3WA 4M0WA 4HL4A 2F4VM 2UXBM 2F5PA 3LVVA 2XD5A 2DWLA 5LMNM 2R4JA 3GLGB 2VIIA 1J09A 4JI3M 4IBDA 2D7GA 5KPZA 4GIPA 4OJPA 1OFIA 5E6JA 2XZFA 3VDUA 3L29A 2R18A 1XWIA 5KPRA 3FTEA 4DR5M 4K0KM 4G4RA 3I4YA 2XFTA 3TPZA 3FUXA 3SBJA 4OUIA 1Q3BA 2CHQA 2UUBM 4LF4M 1DGFA 3KFUG 7CATA 4LFAM 1KSFX 4JI6M 2FFJA 1TDHA 2ERCA 4B3RM 4IJEA 1JQJC 2Y20A 3UZUA 2Y21A 4GHLA 2R62A 1IN6A 2QZ4A 4B08A 2EA0A 1H6UA 1TGUA 3VLFB 2LNHC 1GKIA 3HU2A 4GH9A 3HWSA 4DV5M 3TQSA 4LF5M 2CUZA 3A42A 4JV5M 1YUBA 2F5SA 3GQ5A 1YE9A 2Y2JA 3VKHA 1Z5AA 5KQDA 1IBKM 1IXSB 4IIWA 3J7BA 5IZ7D 3FUWA 3MK6A 3GLHB 3HHWA 3BOSA 3W0FA 2Y2QA 3RE8A 1Q39A 4X65M 1XXHB 5IREB 1ZAEA 4IBIA 3T1YM 4BBAA 4ITQA 3CF6E 3U6EA 2J7OA 3U6PA 2Y2PA 3E4RA 1Q3CA 4G6ZA 2QBYB 4LF9M 1S3SA 1NHGC 2DVWB 5EXXA 5LMUM 4AKGA 2AHMA 2F5QA 2Y2LA 2DHRA 4M0DA 1UM8A 1PJIA 2ZAMA 3HJQA 1SXJD 4LJ9A 4R7GA 2HL7A 3U6CA 3GQ4A 4I5SA 5DNYA 3K8ZA 4MM3B 3ILKA 5KO3A 3GLIA 1I4WA 3SHFA 4LGMA 3FTDA 4RNAA 3GPXA 2CV1A 1JR3A 2F5OA 2DZNB 1X37A 1YUEA 2RGHA 3GPUA 4OVZB 4JYAM 4AG6A 4D82A 3GRUA 4HLQA 3LMMA 2ZAOA 2V1UA 1G59A 3K92A 4DR1M 3HJSA 2NQ8C 3THGA 3ZH9B 1GLNA 5C1BA 3KS4A 4GRIA 3LQRA 2XSZD 4QOSA 5FTNA 2R46A 3HJ8A 3GRYA 4RF1A 4DR2M 4AKIA 3RFWA 1N33M 4WW0A 1IXZA 4AI6A 1QQWA 3MHVC 3FYCA 2UXDM 1TH4A 2C9CA 1MU5A 2Y2IA 4DUZM 3HSHA 3SYLA 1XNRM 3AOEC 4LRSA 4DV4M 4BLCA 3JR5A 4RF0A 4DV1M 4JI4M 2KW0A 1HNWM 4OVZA 3HHXA 4LJAA 4W5WA 4DV0M 2Z4SA 4IBFA 1TH3A 4IBCA 1I94M 1R2YA 3SYKA 4X64M 1XMOM 5JI2E 3MJ5A 4LJ8A 1XMQM 2C98A 4CISA 2EO2A 2Z4RA 4I8OA 1NNJA 4LFBM 1N34M 3KVWA 4FWDA 5E26A 4LGYA 4EIWA 4OJ5A 3CTWB 4NSOB 4G4OA 3VFDA 2O5RA 1K82A 4MGKE 4PCZA 4DR7M 1HNXM 2JE5A 2KZUA 2Y2HA 2KEBA 3FKEA 3AJIB 3AOGA 3H4MA 1XC8A 4GITA 2FNAA 4NZ5A 3GPPA 1IN5A 4JI5M 3C58A 3KP1E 4FWGA 4DR4M 2HCBA 1QVRA 4DR6M 1WXQA 1IN4A 4QHSA 4D80A 3NWLA 1HQCA 2G5GX 3U6DA 5GKNA 1N32M 3K2LA 3A46A 3U6QA 2VQEM 4OJ6A 2RKOA 3SAVA 4DUYM 4LJ4A 2UUAM 3AL0C 2Y2OA 4LJ7A 1YU3A 2YQZA 1ORYB 4JI8M 1DGGA 4X66M 5JI3E 4DR3M 4CHTB 2DXIA 2XFSA 4OJOA 5ITXA 3J81S 5ITQA 4NXMM 2D7EA 2I7NA 1OFHA 3IG5A 5ITXE 3TE6A 4L78A 3J2PB 4QNRA 2H1RA 2OPFA 4NL4H 4GC5A 4LJ5A 3VDPA 2V6ZM 1SXJC 4LFCM 2Y2MA 3WHLA 4PDGA 3DFZA 4IBEA 2X4AA 3D8LA 1L2BA 4B7GA 5EP2A 3GLGA 4A3VB 3L2AA 4DV2M 2RGOA 4OJLA 3DA1A 3PNVA 1DGHB 1E94E 2BG1A 3T1HM 3NBIA 4LJ6A 1E32A 4GC9A 5A2QS 2Y0QA 3FD9A 5IWAM 3M0EA 3KOYE 1N75A 1LV7A 1SXJB 1IBLM 4AW4A 3JAMS 4M9XA 2YNMD 2QCUA 2EUCA 1XNQM 1EE8A 3SMSA 3FUTA 3U60B 4FCVA 2DWZB 4JN6A 3W0LB 2ZANA 4QNLA 3HONA 5ITTA 4FW9A 4DV7M 1L1ZA 4DV6M 3J27B 2JCHA 2W82A 5FLXS 1IN7A 1QZMA 3GLHA 1Z59A 2G8LA 3GRVA 3U61B 3AV0A 4L15A 2Y2KA 3VK8A 2CHGA 1XXHA 4OX9M 4XGIA 3M6AA 4LG2A 3L25A 2L6OA 1QAMA 4D81A 1JR3D 4LF7M 1L1TA 5FTJA 4FD2A 3FUUA 3KOZE 2QBYA 1SXJE 3L27A 3EIEA 2KZSA 4IBJA 3T38A 4P16A 1N77A 2BJWA 3L26A 4FWHA 4IBBA 4MH0E 4FCWA 4II7A 4L4UA 2CE7A 1R7RA 3KP0E 4MGYE 3GLFB 2M5ZA 1YU1A 3TWKA 1FJGM 3R8FA 1G3IA 3ZC7B 5EP1A 2XEPA 3GO8A 1R6BX 3J7AS 3KOWE 4KLNA 5IT9S 2CV2A 2L7IA 1YU0A 5FTLA 3U61A 3FTFA 1DO2A 3R9XB 3WHKA 4YY3M 4X62M 3M7GA 1PM5A 1IXRC 1NY6A 5FTKA 3ZCBB 2LH0A 2L09A 3U6MA 4AKHA 1YU4A 2Y2GA 1KYIA 4FCTA 2X49A 3CF2A 2K47A 1HR0M 2R45A 4WURA 3U6SA 1HT1E 5DYIA 1NNUC 3PVSA 4QNMA 2ZM6M 1E9SA 4FVMA 2DZOB 4M9ZA 5KPTA 3A45A 2BJVA 2E5LM 2C96A 1NY5A 2D7HA 4I81A 2J7NA 4M9SA 4YHHM 3SAUA 4LRTA 4QOZC 4NY2A 5FTMA 3J80S 3T15A 4AZFA 4MGZE 1NJFA 5ITYA 5EXPA 3PXGA 2KRKA 1G8PA 2DWMA 1QANA 2XLJA 5EXTA 2LWXA 3SAWA 2YFQA 3U5ZB 2CV0A 3RGSA 2F5NA 2CEAA 1L2DA 3QAUA 2UXCM 1J7KA 1L8QA 3AFHA 5F3WA 4G4NA 1IN8A 3L28A 4OW0A 4R3DA 3UK6A 3U6OA 3WX7A 1W5SA 4IJFA 3OTOM 3SASA 3CF0A 1VDDA 1Z6TA 1NHWC 4OU7A 2Z7JA 4NYYA 4TUWA 4B7FA 3KDSE 1DGBA 3AOEA 2Y0TA 3KXEC 1E9RA 3A98B 1GVNA 4S12A 2KA6B 4G4QA 2C99A 1KFVA 3KS8A 1K3XA 3SMPA 4KODA 3U5ZA 1IQPA 2I7PA 5H37D 2UWXA 2M60A 5EP3A 1YU2A 3GQ3A 3GPYA 3B9PA 3K1JA 3KSJA 5BR8M 4B3SM 1OJLA 1W5TA 1HT2E 2QPAA 3IG8A 4QHTA 1ZQ9A 1HNZM 5EQTA 4XBOA 1HQYE 1N78A 4JI0M 5ITRA 1J5EM 4LF8M 3HU1A 2C5RA 3EIHA 2FE8A 4NZ1A 2CFOA 3FYDA 1TDZA 5EJCA 1IY0A 3SARA 1FNNA 3SC3A 4L8RC 1G4AE 2KRUA 1GL6A 2HHHM 5C18A 1NVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IBF A;  4GH9 A;  3KS4 A;  4IBK A;  4IBD A;  4IBE A;  4IBC A;  3L27 A;  3L28 A;  4IBJ A;  3L2A A;  4GHA A;  3L26 A;  3KS8 A;  3L29 A;  4IBB A;  4IJF A;  4IBG A;  4IBI A;  3L25 A;  4IJE A;  4GHL A;  3FKE A;  4LG2 A;  5BPV A; 
#chains in the Genus database with same CATH topology
 2JA2 A;  4GKJ M;  2ZBK B;  4BB9 A;  1GL7 A;  4LCB A;  5FSW A;  3VK7 A;  4I4L A;  2R65 A;  1L2C A;  5EXS A;  2LTU A;  4MGH A;  3TWL A;  3DOA A;  1UR9 A;  4L6V 6;  4B3M M;  1ZMV A;  3C9P A;  3K9O A;  2X8A A;  3GLI B;  4MB3 A;  3KOX E;  4MB5 A;  3BBZ A;  4F1I A;  3QWL A;  4NRV A;  4MB7 A;  3I51 A;  3U6L A;  1W1Y A;  2XGN A;  3FRH A;  1A5T A;  2BNK A;  1DGH A;  1QYR A;  3N3F A;  4LZJ A;  3PNY A;  4NZ4 A;  4KHP M;  4LZZ A;  2DEN A;  1MX0 A;  1XHB A;  4NZ3 A;  1C1K A;  5DFL A;  1QO6 A;  2A5Y B;  3C3D A;  8CAT A;  1W1T A;  1QAQ A;  1IM2 A;  2WZJ A;  3D8B A;  3K9P A;  3TL4 X;  1SXJ A;  2Y2N A;  4PT5 A;  2JZ1 A;  2APL A;  2EKF A;  2QHO B;  4ZPX A;  1ZMW A;  3TWM A;  4JI2 M;  2XF3 A;  5ITU A;  2CWB A;  2K6B A;  2OOA A;  2LBC A;  4LF6 M;  1QAO A;  2BWE A;  2UU9 M;  3U60 A;  2XH9 A;  2XD1 A;  4NXN M;  2OQ4 A;  3HKP A;  1R2Z A;  3RGP A;  4P17 A;  4CJ6 A;  4PDI A;  2DWN A;  1Z5C A;  4REZ A;  3E9S A;  2LXE A;  1Z5B A;  4KO8 A;  4IBG A;  3W68 A;  1NJG A;  1E6R A;  4HEO A;  2UUC M;  2L4E A;  1YSY A;  2L7H A;  5KQ8 A;  2MGW A;  2RRU A;  2XSZ A;  3SFZ A;  2OO9 A;  3UGJ A;  2KXE A;  2Z3X A;  2D49 A;  2FOI C;  1NSF A;  3UMM A;  1OKS A;  4CGY B;  1N36 M;  1MN3 A;  4JI1 M;  3PFI A;  4DV3 M;  4JXJ A;  4B7H A;  1E6N A;  1SG9 A;  4R71 A;  1BVS A;  2JY8 A;  3GRR A;  4IBK A;  2V1C A;  4MGI E;  3LQQ A;  1PJJ A;  1IBM M;  4PD2 A;  2MR9 A;  3HGI A;  4NOO B;  2IOU A;  4GMQ A;  2VQF M;  4GHA A;  4Z6Y A;  3HU3 A;  5DYG A;  3FTC A;  1MJG M;  2K0B X;  2R4E A;  4GEW A;  2KDL A;  4LY6 A;  3UJN A;  1GPF A;  3Q8X A;  1T3T A;  3FUV A;  1D2N A;  4L16 A;  2HKJ A;  3I4V A;  3GLF A;  1V92 A;  4NYU A;  4UN2 B;  3C3E A;  3AKZ A;  2QEN A;  2XZU A;  3JR4 A;  2Q2E B;  3VKG A;  2CHV A;  1DO0 A;  2QP9 X;  3KSX A;  3HHZ A;  5BPV A;  3DZD A;  3H4J A;  1E6P A;  3WD0 A;  1TH2 A;  2DZL A;  2JNH A;  3SAT A;  1T43 A;  1G71 A;  2YR0 A;  3Q8G A;  4HME A;  2B3T A;  2EKK A;  1CXW A;  1G41 A;  1V34 A;  3GP1 A;  3B7Q A;  2LVO C;  4Z8X A;  2WSF F;  1IY2 A;  3W67 A;  4AQY M;  3MQL A;  5EP4 A;  1WJ7 A;  3WD3 A;  4AG5 A;  4NRW A;  2FFF B;  1WGN A;  2C9O A;  4WP2 A;  3HHY A;  3LVW A;  2KHH A;  4NSR A;  3KW6 A;  2MRO B;  4B3T M;  4Z2L A;  3SHG B;  2P5T A;  4JI7 M;  4GKK M;  1IY1 A;  1W1V A;  1K3W A;  4M0W A;  4HL4 A;  2F4V M;  2UXB M;  2F5P A;  3LVV A;  2XD5 A;  2DWL A;  2JY6 B;  3M7P A;  5LMN M;  2R4J A;  3GLG B;  2VII A;  3WD4 A;  1J09 A;  4JI3 M;  4IBD A;  1GO5 A;  2D7G A;  5KPZ A;  4GIP A;  4OJP A;  1OFI A;  5E6J A;  2O25 A;  1ZV1 A;  2XZF A;  2GNO A;  3VDU A;  2BWB A;  3L29 A;  2DAG A;  2R18 A;  1XWI A;  5KPR A;  3FTE A;  4DR5 M;  4K0K M;  4G4R A;  3I4Y A;  2XFT A;  3TPZ A;  3FUX A;  3SBJ A;  4OUI A;  1Q3B A;  2CHQ A;  3B7N A;  2UUB M;  4LF4 M;  1DGF A;  2JXN A;  3KFU G;  7CAT A;  4LFA M;  1KSF X;  4JI6 M;  2FFJ A;  1TDH A;  2ERC A;  1E6Z A;  4B3R M;  4IJE A;  1PJQ A;  1JQJ C;  2Y20 A;  3UZU A;  2Y21 A;  4GHL A;  2R62 A;  1IN6 A;  2QZ4 A;  4ANR A;  4B08 A;  2EA0 A;  2J5Y A;  3CGW A;  2HWJ A;  1H6U A;  1TGU A;  3VLF B;  2LNH C;  1GKI A;  3HU2 A;  2MJ5 B;  4GH9 A;  3HWS A;  4DV5 M;  3TQS A;  4LF5 M;  2CUZ A;  2VDB B;  3A42 A;  4JV5 M;  1YUB A;  2F5S A;  3GQ5 A;  1YE9 A;  2Y2J A;  3VKH A;  1Z5A A;  5KQD A;  1IBK M;  2RTS A;  1PJT A;  1IXS B;  3LCV B;  3J7B A;  4IIW A;  3FUW A;  4RKU F;  5IZ7 D;  3HX3 A;  3MK6 A;  3GLH B;  3HHW A;  3BOS A;  3W0F A;  2Y2Q A;  3RE8 A;  1Q39 A;  2ZTC A;  1XXH B;  5IRE B;  4X65 M;  4TX8 A;  3WD2 A;  1ZAE A;  4IBI A;  3T1Y M;  4BBA A;  4ITQ A;  3CF6 E;  3U6E A;  2J7O A;  3U6P A;  2Y2P A;  3E46 A;  3E4R A;  1Q3C A;  2VF7 A;  4G6Z A;  2QBY B;  4LF9 M;  1S3S A;  1NHG C;  2DVW B;  5EXX A;  5LMU M;  4AKG A;  2AHM A;  2F5Q A;  2Y2L A;  1O6I A;  2DHR A;  4M0D A;  3FE3 A;  2FH0 A;  1W1P A;  4G3O A;  1UM8 A;  1NVM A;  1PJI A;  2ZAM A;  3HJQ A;  1SXJ D;  4LJ9 A;  4R7G A;  2DI0 A;  2HL7 A;  3U6C A;  2WSC F;  2DNA A;  3GQ4 A;  2V5O A;  4I5S A;  5DNY A;  1NO1 A;  3K8Z A;  4MM3 B;  3ILK A;  1OIZ A;  5KO3 A;  3GLI A;  1I4W A;  3SHF A;  4LGM A;  3FTD A;  4RNA A;  2Z8Y M;  3GPX A;  2CV1 A;  1JR3 A;  3GLI E;  2DZN B;  1X37 A;  2F5O A;  2RGH A;  3LCU A;  3GPU A;  1DV0 A;  1YUE A;  4OVZ B;  4JYA M;  4AG6 A;  4D82 A;  2CP8 A;  3GRU A;  1JR3 E;  3E21 A;  3LMM A;  1XXH E;  2ZAO A;  4HLQ A;  2V1U A;  4Z2J A;  1G59 A;  3K92 A;  1LTM A;  4DR1 M;  3HJS A;  2NQ8 C;  3THG A;  3ZH9 B;  1GLN A;  5C1B A;  3KS4 A;  4GRI A;  3LQR A;  2XSZ D;  4QOS A;  5FTN A;  2R46 A;  3HJ8 A;  3GRY A;  4RF1 A;  4DR2 M;  4AKI A;  3RFW A;  2R44 A;  2DAK A;  4WW0 A;  1N33 M;  1IXZ A;  1E88 A;  4AI6 A;  1QQW A;  3MHV C;  3FYC A;  2UXD M;  1TH4 A;  2C9C A;  1MU5 A;  2KNV A;  2Y2I A;  4DUZ M;  3HSH A;  1EIJ A;  3SYL A;  4KT0 F;  1XNR M;  3AOE C;  4LRS A;  4DV4 M;  4BLC A;  3JR5 A;  1QZE A;  1WR1 B;  4RF0 A;  4DV1 M;  1NV8 A;  4JI4 M;  2KW0 A;  1HNW M;  1OAI A;  4OVZ A;  3HHX A;  4LJA A;  4W5W A;  4DV0 M;  2Z4S A;  4IBF A;  1TH3 A;  1Y8G A;  4IBC A;  1I94 M;  2DAE A;  4F2L A;  1R2Y A;  3SYK A;  4X64 M;  1XMO M;  1PRB A;  2KNZ A;  5JI2 E;  3MJ5 A;  4LJ8 A;  1XMQ M;  2C98 A;  2K9D A;  4CIS A;  1Q02 A;  2EO2 A;  2Z4R A;  4I8O A;  1NNJ A;  4LFB M;  1QDR A;  3KVW A;  3B89 A;  1N34 M;  4FWD A;  5E26 A;  4LGY A;  4EIW A;  4OJ5 A;  3CTW B;  1QUT A;  4NSO B;  2FS1 A;  4G4O A;  1H8P A;  3VFD A;  2O5R A;  2JY7 A;  1K82 A;  4MGK E;  4PCZ A;  4DR7 M;  1HNX M;  4Z2K A;  2JE5 A;  2KZU A;  2Y2H A;  2KEB A;  3FKE A;  3BXW A;  3AJI B;  2QQ8 A;  1OTR A;  3AOG A;  1VDL A;  3H4M A;  1XC8 A;  4GIT A;  2FNA A;  4NZ5 A;  3GPP A;  1IN5 A;  4JI5 M;  3C58 A;  3KP1 E;  4FWG A;  4DR4 M;  2HCB A;  1QVR A;  4DR6 M;  1WXQ A;  1IN4 A;  4QHS A;  4D80 A;  3NWL A;  1HQC A;  2G5G X;  3IHP A;  3NBX X;  2DHY A;  5GKN A;  3U6D A;  1N32 M;  2JP7 A;  1F4I A;  3K2L A;  1D0K A;  3A46 A;  2VQE M;  3U6Q A;  2RKO A;  3SAV A;  4DUY M;  1D0M A;  1GOI A;  4OJ6 A;  4LJ4 A;  2UUA M;  1CK7 A;  2DKL A;  3AL0 C;  2Y2O A;  4LJ7 A;  1YU3 A;  2YQZ A;  1ORY B;  1PGY A;  4JI8 M;  1DGG A;  4X66 M;  5JI3 E;  4DR3 M;  4CHT B;  2DXI A;  2XFS A;  4OJO A;  5ITX A;  3J81 S;  1R5L A;  5ITQ A;  4NXM M;  2D7E A;  2I7N A;  1OFH A;  3IG5 A;  5ITX E;  3TE6 A;  4L78 A;  3J2P B;  4QNR A;  2HAK A;  2H1R A;  2H5X A;  2OPF A;  4NL4 H;  4GC5 A;  4LJ5 A;  3VDP A;  2V6Z M;  1SXJ C;  4LFC M;  2Y2M A;  3WHL A;  1GAB A;  4PDG A;  3DFZ A;  4IBE A;  2X4A A;  3D8L A;  1L2B A;  4B7G A;  5EP2 A;  3GLG A;  4A3V B;  2JY5 A;  3L2A A;  4DV2 M;  2RGO A;  4OJL A;  3DA1 A;  1P3Q Q;  3GLG E;  1QUS A;  3PNV A;  1H0G A;  1DGH B;  1E94 E;  3ZQJ A;  2BG1 A;  1UFZ A;  3T1H M;  1ED7 A;  1OGB A;  3NBI A;  3HZJ A;  1E32 A;  4GC9 A;  4LJ6 A;  2Y0Q A;  5A2Q S;  2LVP C;  3FD9 A;  5IWA M;  3M0E A;  3MMP A;  3KOY E;  1N75 A;  5L8R F;  2OOB A;  1LV7 A;  1SXJ B;  1IBL M;  4AW4 A;  3JAM S;  4M9X A;  1GJT A;  2YNM D;  2QCU A;  2EUC A;  1XNQ M;  1EE8 A;  2FN2 A;  1PDC A;  3SMS A;  3FUT A;  3U60 B;  4FCV A;  2DWZ B;  4JN6 A;  3IEC A;  3W0L B;  2ZAN A;  1AIP C;  2CRU A;  4QNL A;  3HON A;  5ITT A;  4FW9 A;  4DV7 M;  1EFU B;  1L1Z A;  4DV6 M;  3J27 B;  4HMC A;  2JCH A;  1H0I A;  1IXS A;  1VG5 A;  4Z2G A;  2W82 A;  5FLX S;  1RU3 A;  1XB2 B;  2R6F A;  1IN7 A;  1QZM A;  3GLH A;  3QYB A;  1Z59 A;  2G8L A;  3GRV A;  4NC6 A;  3U61 B;  2JWS A;  3AV0 A;  4L15 A;  3VK8 A;  2Y2K A;  2CHG A;  1J7M A;  1XXH A;  1TR8 A;  3GLH E;  4XGI A;  4OX9 M;  1WHC A;  3M6A A;  2EJS A;  4LG2 A;  1IFY A;  3L25 A;  2L6O A;  1QAM A;  2L2D A;  4D81 A;  1JR3 D;  4LF7 M;  1L1T A;  5FTJ A;  4FD2 A;  1CUK A;  3FUU A;  2JUJ A;  1QDT A;  3KOZ E;  2N35 A;  2QBY A;  1SXJ E;  2LVN C;  3L27 A;  2QSF X;  3EIE A;  2KZS A;  4IBJ A;  3T38 A;  4P16 A;  1N77 A;  3LW5 F;  2BJW A;  3L26 A;  1GXD A;  2WSE F;  1V33 A;  4FWH A;  4IBB A;  4FCW A;  4II7 A;  4MH0 E;  4L4U A;  2CE7 A;  1R7R A;  3KP0 E;  4MGY E;  3GLF B;  2M5Z A;  1YU1 A;  3T6P A;  2MH8 A;  2DAI A;  3TWK A;  1FJG M;  3R8F A;  4MB4 A;  1G3I A;  3ZC7 B;  1WGL A;  5EP1 A;  1E8B A;  2XEP A;  3GO8 A;  1R6B X;  1OAO C;  3KOW E;  3I04 M;  4KLN A;  3J7A S;  4HMD A;  1HJP A;  2O01 F;  5IT9 S;  2CV2 A;  2L7I A;  1YU0 A;  5FTL A;  4Z2I A;  3U61 A;  3FTF A;  1DO2 A;  3R9X B;  3WHK A;  4YY3 M;  1AUA A;  4X62 M;  1OQY A;  3M7G A;  1PM5 A;  1IXR C;  2VF8 A;  1TTE A;  1NY6 A;  5FTK A;  1VQ1 A;  4DBG B;  3ZCB B;  2LH0 A;  2L09 A;  3U6M A;  4AKH A;  1YU4 A;  2Y2G A;  1KYI A;  4FCT A;  2X49 A;  1OIP A;  3CF2 A;  2K47 A;  1HR0 M;  2R45 A;  4WUR A;  3U6S A;  3FRI A;  1HT1 E;  2DAM A;  5DYI A;  1NNU C;  1ZMU A;  2LHC A;  3PVS A;  4QNM A;  2ZM6 M;  1GJS A;  1C7Y A;  1E9S A;  4FVM A;  1NV9 A;  2DZO B;  4M9Z A;  5KPT A;  3A45 A;  2BJV A;  2E5L M;  2C96 A;  1NY5 A;  2D7H A;  4I81 A;  2J7N A;  4M9S A;  1E15 A;  4YHH M;  3SAU A;  4LRT A;  4QOZ C;  1D0L A;  3GLF E;  5FTM A;  3J80 S;  3T15 A;  4AZF A;  4NY2 A;  3I01 M;  1NJF A;  1T6O A;  4MGZ E;  5EXP A;  5ITY A;  3PXG A;  2KRK A;  4Z2H A;  1G8P A;  2DWM A;  1QAN A;  2XLJ A;  5EXT A;  2LWX A;  3HY5 A;  3SAW A;  2YFQ A;  3U5Z B;  2CV0 A;  3RGS A;  2F5N A;  2CEA A;  1L2D A;  3QAU A;  4Y28 F;  1L6J A;  2UXC M;  1J7K A;  1L8Q A;  3AFH A;  5F3W A;  3V76 A;  2L4F A;  4G4N A;  1IN8 A;  2LVA A;  2QNJ A;  3L28 A;  4XK8 F;  1R4G A;  1UR8 A;  3F92 A;  4OW0 A;  4R3D A;  3UK6 A;  3U6O A;  3WX7 A;  3B7Z A;  1W5S A;  4IJF A;  3OTO M;  3SAS A;  3CF0 A;  1VDD A;  1PJS A;  1NHW C;  1Z6T A;  2Z7J A;  4OU7 A;  1WIV A;  4NYY A;  4TUW A;  1TF0 B;  4B7F A;  3KDS E;  1DGB A;  3AOE A;  3QYE A;  2Y0T A;  3WD1 A;  3KXE C;  1E9R A;  3A98 B;  1GVN A;  4S12 A;  2KA6 B;  1VEK A;  4G4Q A;  2C99 A;  2KNA A;  1KFV A;  3KS8 A;  1K3X A;  3SMP A;  2LVQ D;  2LHG A;  4CIZ A;  4KOD A;  3U5Z A;  1IQP A;  2I7P A;  2ZTD A;  5H37 D;  2M60 A;  5EP3 A;  2UWX A;  1YU2 A;  3GQ3 A;  3GPY A;  4Q7J A;  1AIW A;  3B9P A;  3K1J A;  3KSJ A;  2GQF A;  5BR8 M;  4B3S M;  1VEJ A;  1OJL A;  1W5T A;  1HT2 E;  2QPA A;  3IG8 A;  1YLA A;  4QHT A;  1KS0 A;  1JB0 F;  1ZQ9 A;  2G3Q A;  1HNZ M;  5EQT A;  4XBO A;  2JZ0 A;  1HQY E;  1N78 A;  4JI0 M;  5ITR A;  1J5E M;  4LF8 M;  3HU1 A;  2C5R A;  3EIH A;  1EAK A;  2FE8 A;  4NZ1 A;  1OGG A;  2CFO A;  3FYD A;  3B74 A;  5EJC A;  1IY0 A;  1TDZ A;  1FNN A;  3SAR A;  3SC3 A;  4L8R C;  1G4A E;  2KRU A;  2R0I A;  1GL6 A;  2HHH M;  5C18 A;  1VEG A; 
#chains in the Genus database with same CATH homology
 2JA2 A;  4GKJ M;  2ZBK B;  4BB9 A;  1GL7 A;  4LCB A;  5FSW A;  3VK7 A;  4I4L A;  2R65 A;  1L2C A;  5EXS A;  4MGH A;  3TWL A;  3DOA A;  4B3M M;  2X8A A;  3GLI B;  3KOX E;  3QWL A;  4NRV A;  4MB7 A;  3I51 A;  3U6L A;  2XGN A;  2BNK A;  1DGH A;  1QYR A;  3N3F A;  4LZJ A;  3PNY A;  4NZ4 A;  4KHP M;  4LZZ A;  1MX0 A;  1XHB A;  4NZ3 A;  1C1K A;  2A5Y B;  8CAT A;  1QAQ A;  1IM2 A;  3TL4 X;  3D8B A;  2Y2N A;  1SXJ A;  4PT5 A;  4ZPX A;  3TWM A;  4JI2 M;  2XF3 A;  5ITU A;  4LF6 M;  2XD1 A;  1QAO A;  2UU9 M;  3U60 A;  2XH9 A;  4NXN M;  2OQ4 A;  3HKP A;  1R2Z A;  3RGP A;  4PDI A;  2DWN A;  1Z5C A;  4REZ A;  3E9S A;  2LXE A;  1Z5B A;  4KO8 A;  4IBG A;  1NJG A;  2UUC M;  1YSY A;  2L7H A;  5KQ8 A;  3SFZ A;  2XSZ A;  3UGJ A;  2Z3X A;  2KXE A;  2FOI C;  1NSF A;  3UMM A;  1N36 M;  4CGY B;  4JI1 M;  3PFI A;  4DV3 M;  4JXJ A;  4B7H A;  3GRR A;  4IBK A;  4MGI E;  2V1C A;  1PJJ A;  3LQQ A;  1IBM M;  2IOU A;  4PD2 A;  3HGI A;  4NOO B;  4GMQ A;  2VQF M;  4GHA A;  4Z6Y A;  3HU3 A;  5DYG A;  3FTC A;  2R4E A;  4LY6 A;  3UJN A;  3Q8X A;  1T3T A;  3FUV A;  1D2N A;  4L16 A;  2HKJ A;  3I4V A;  3GLF A;  4NYU A;  3AKZ A;  2QEN A;  2XZU A;  3JR4 A;  2Q2E B;  3VKG A;  2CHV A;  1DO0 A;  2QP9 X;  3KSX A;  3HHZ A;  5BPV A;  3DZD A;  1TH2 A;  3SAT A;  2YR0 A;  1G41 A;  3GP1 A;  4Z8X A;  1IY2 A;  4AQY M;  5EP4 A;  4AG5 A;  4NRW A;  2FFF B;  2C9O A;  3HHY A;  3LVW A;  4NSR A;  3KW6 A;  4B3T M;  3SHG B;  2P5T A;  4JI7 M;  4GKK M;  1IY1 A;  1K3W A;  4M0W A;  4HL4 A;  2F4V M;  2UXB M;  2F5P A;  3LVV A;  2XD5 A;  2DWL A;  5LMN M;  2R4J A;  3GLG B;  2VII A;  1J09 A;  4JI3 M;  4IBD A;  2D7G A;  5KPZ A;  4GIP A;  4OJP A;  1OFI A;  5E6J A;  2XZF A;  3VDU A;  3L29 A;  2R18 A;  1XWI A;  5KPR A;  3FTE A;  4DR5 M;  4K0K M;  4G4R A;  3I4Y A;  2XFT A;  3TPZ A;  3FUX A;  3SBJ A;  4OUI A;  1Q3B A;  2CHQ A;  2UUB M;  4LF4 M;  1DGF A;  3KFU G;  7CAT A;  4LFA M;  1KSF X;  4JI6 M;  2FFJ A;  1TDH A;  2ERC A;  4B3R M;  4IJE A;  1JQJ C;  2Y20 A;  3UZU A;  2Y21 A;  4GHL A;  2R62 A;  1IN6 A;  2QZ4 A;  4B08 A;  2EA0 A;  1H6U A;  1TGU A;  3VLF B;  2LNH C;  1GKI A;  3HU2 A;  4GH9 A;  3HWS A;  4DV5 M;  3TQS A;  4LF5 M;  2CUZ A;  3A42 A;  4JV5 M;  1YUB A;  2F5S A;  3GQ5 A;  1YE9 A;  2Y2J A;  3VKH A;  1Z5A A;  5KQD A;  1IBK M;  1IXS B;  4IIW A;  3J7B A;  5IZ7 D;  3FUW A;  3MK6 A;  3GLH B;  3HHW A;  3BOS A;  3W0F A;  2Y2Q A;  3RE8 A;  1Q39 A;  4X65 M;  1XXH B;  5IRE B;  1ZAE A;  4IBI A;  3T1Y M;  4BBA A;  4ITQ A;  3CF6 E;  3U6E A;  2J7O A;  3U6P A;  2Y2P A;  3E4R A;  1Q3C A;  4G6Z A;  2QBY B;  4LF9 M;  1S3S A;  1NHG C;  2DVW B;  5EXX A;  5LMU M;  4AKG A;  2AHM A;  2F5Q A;  2Y2L A;  2DHR A;  4M0D A;  1UM8 A;  1PJI A;  2ZAM A;  3HJQ A;  1SXJ D;  4LJ9 A;  4R7G A;  2HL7 A;  3U6C A;  3GQ4 A;  4I5S A;  5DNY A;  3K8Z A;  4MM3 B;  3ILK A;  5KO3 A;  3GLI A;  1I4W A;  3SHF A;  4LGM A;  3FTD A;  4RNA A;  3GPX A;  2CV1 A;  1JR3 A;  2F5O A;  2DZN B;  1X37 A;  1YUE A;  2RGH A;  3GPU A;  4OVZ B;  4JYA M;  4AG6 A;  4D82 A;  3GRU A;  4HLQ A;  3LMM A;  2ZAO A;  2V1U A;  1G59 A;  3K92 A;  4DR1 M;  3HJS A;  2NQ8 C;  3THG A;  3ZH9 B;  1GLN A;  5C1B A;  3KS4 A;  4GRI A;  3LQR A;  2XSZ D;  4QOS A;  5FTN A;  2R46 A;  3HJ8 A;  3GRY A;  4RF1 A;  4DR2 M;  4AKI A;  3RFW A;  1N33 M;  4WW0 A;  1IXZ A;  4AI6 A;  1QQW A;  3MHV C;  3FYC A;  2UXD M;  1TH4 A;  2C9C A;  1MU5 A;  2Y2I A;  4DUZ M;  3HSH A;  3SYL A;  1XNR M;  3AOE C;  4LRS A;  4DV4 M;  4BLC A;  3JR5 A;  4RF0 A;  4DV1 M;  4JI4 M;  2KW0 A;  1HNW M;  4OVZ A;  3HHX A;  4LJA A;  4W5W A;  4DV0 M;  2Z4S A;  4IBF A;  1TH3 A;  4IBC A;  1I94 M;  1R2Y A;  3SYK A;  4X64 M;  1XMO M;  5JI2 E;  3MJ5 A;  4LJ8 A;  1XMQ M;  2C98 A;  4CIS A;  2EO2 A;  2Z4R A;  4I8O A;  1NNJ A;  4LFB M;  1N34 M;  3KVW A;  4FWD A;  5E26 A;  4LGY A;  4EIW A;  4OJ5 A;  3CTW B;  4NSO B;  4G4O A;  3VFD A;  2O5R A;  1K82 A;  4MGK E;  4PCZ A;  4DR7 M;  1HNX M;  2JE5 A;  2KZU A;  2Y2H A;  2KEB A;  3FKE A;  3AJI B;  3AOG A;  3H4M A;  1XC8 A;  4GIT A;  2FNA A;  4NZ5 A;  3GPP A;  1IN5 A;  4JI5 M;  3C58 A;  3KP1 E;  4FWG A;  4DR4 M;  2HCB A;  1QVR A;  4DR6 M;  1WXQ A;  1IN4 A;  4QHS A;  4D80 A;  3NWL A;  1HQC A;  2G5G X;  3U6D A;  5GKN A;  1N32 M;  3K2L A;  3A46 A;  3U6Q A;  2VQE M;  4OJ6 A;  2RKO A;  3SAV A;  4DUY M;  4LJ4 A;  2UUA M;  3AL0 C;  2Y2O A;  4LJ7 A;  1YU3 A;  2YQZ A;  1ORY B;  4JI8 M;  1DGG A;  4X66 M;  5JI3 E;  4DR3 M;  4CHT B;  2DXI A;  2XFS A;  4OJO A;  5ITX A;  3J81 S;  5ITQ A;  4NXM M;  2D7E A;  2I7N A;  1OFH A;  3IG5 A;  5ITX E;  3TE6 A;  4L78 A;  3J2P B;  4QNR A;  2H1R A;  2OPF A;  4NL4 H;  4GC5 A;  4LJ5 A;  3VDP A;  2V6Z M;  1SXJ C;  4LFC M;  2Y2M A;  3WHL A;  4PDG A;  3DFZ A;  4IBE A;  2X4A A;  3D8L A;  1L2B A;  4B7G A;  5EP2 A;  3GLG A;  4A3V B;  3L2A A;  4DV2 M;  2RGO A;  4OJL A;  3DA1 A;  3PNV A;  1DGH B;  1E94 E;  2BG1 A;  3T1H M;  3NBI A;  4LJ6 A;  1E32 A;  4GC9 A;  5A2Q S;  2Y0Q A;  3FD9 A;  5IWA M;  3M0E A;  3KOY E;  1N75 A;  1LV7 A;  1SXJ B;  1IBL M;  4AW4 A;  3JAM S;  4M9X A;  2YNM D;  2QCU A;  2EUC A;  1XNQ M;  1EE8 A;  3SMS A;  3FUT A;  3U60 B;  4FCV A;  2DWZ B;  4JN6 A;  3W0L B;  2ZAN A;  4QNL A;  3HON A;  5ITT A;  4FW9 A;  4DV7 M;  1L1Z A;  4DV6 M;  3J27 B;  2JCH A;  2W82 A;  5FLX S;  1IN7 A;  1QZM A;  3GLH A;  1Z59 A;  2G8L A;  3GRV A;  3U61 B;  3AV0 A;  4L15 A;  2Y2K A;  3VK8 A;  2CHG A;  1XXH A;  4OX9 M;  4XGI A;  3M6A A;  4LG2 A;  3L25 A;  2L6O A;  1QAM A;  4D81 A;  1JR3 D;  4LF7 M;  1L1T A;  5FTJ A;  4FD2 A;  3FUU A;  3KOZ E;  2QBY A;  1SXJ E;  3L27 A;  3EIE A;  2KZS A;  4IBJ A;  3T38 A;  4P16 A;  1N77 A;  2BJW A;  3L26 A;  4FWH A;  4IBB A;  4MH0 E;  4FCW A;  4II7 A;  4L4U A;  2CE7 A;  1R7R A;  3KP0 E;  4MGY E;  3GLF B;  2M5Z A;  1YU1 A;  3TWK A;  1FJG M;  3R8F A;  1G3I A;  3ZC7 B;  5EP1 A;  2XEP A;  3GO8 A;  1R6B X;  3J7A S;  3KOW E;  4KLN A;  5IT9 S;  2CV2 A;  2L7I A;  1YU0 A;  5FTL A;  3U61 A;  3FTF A;  1DO2 A;  3R9X B;  3WHK A;  4YY3 M;  4X62 M;  3M7G A;  1PM5 A;  1IXR C;  1NY6 A;  5FTK A;  3ZCB B;  2LH0 A;  2L09 A;  3U6M A;  4AKH A;  1YU4 A;  2Y2G A;  1KYI A;  4FCT A;  2X49 A;  3CF2 A;  2K47 A;  1HR0 M;  2R45 A;  4WUR A;  3U6S A;  1HT1 E;  5DYI A;  1NNU C;  3PVS A;  4QNM A;  2ZM6 M;  1E9S A;  4FVM A;  2DZO B;  4M9Z A;  5KPT A;  3A45 A;  2BJV A;  2E5L M;  2C96 A;  1NY5 A;  2D7H A;  4I81 A;  2J7N A;  4M9S A;  4YHH M;  3SAU A;  4LRT A;  4QOZ C;  4NY2 A;  5FTM A;  3J80 S;  3T15 A;  4AZF A;  4MGZ E;  1NJF A;  5ITY A;  5EXP A;  3PXG A;  2KRK A;  1G8P A;  2DWM A;  1QAN A;  2XLJ A;  5EXT A;  2LWX A;  3SAW A;  2YFQ A;  3U5Z B;  2CV0 A;  3RGS A;  2F5N A;  2CEA A;  1L2D A;  3QAU A;  2UXC M;  1J7K A;  1L8Q A;  3AFH A;  5F3W A;  4G4N A;  1IN8 A;  3L28 A;  4OW0 A;  4R3D A;  3UK6 A;  3U6O A;  3WX7 A;  1W5S A;  4IJF A;  3OTO M;  3SAS A;  3CF0 A;  1VDD A;  1Z6T A;  1NHW C;  4OU7 A;  2Z7J A;  4NYY A;  4TUW A;  4B7F A;  3KDS E;  1DGB A;  3AOE A;  2Y0T A;  3KXE C;  1E9R A;  3A98 B;  1GVN A;  4S12 A;  2KA6 B;  4G4Q A;  2C99 A;  1KFV A;  3KS8 A;  1K3X A;  3SMP A;  4KOD A;  3U5Z A;  1IQP A;  2I7P A;  5H37 D;  2UWX A;  2M60 A;  5EP3 A;  1YU2 A;  3GQ3 A;  3GPY A;  3B9P A;  3K1J A;  3KSJ A;  5BR8 M;  4B3S M;  1OJL A;  1W5T A;  1HT2 E;  2QPA A;  3IG8 A;  4QHT A;  1ZQ9 A;  1HNZ M;  5EQT A;  4XBO A;  1HQY E;  1N78 A;  4JI0 M;  5ITR A;  1J5E M;  4LF8 M;  3HU1 A;  2C5R A;  3EIH A;  2FE8 A;  4NZ1 A;  2CFO A;  3FYD A;  1TDZ A;  5EJC A;  1IY0 A;  3SAR A;  1FNN A;  3SC3 A;  4L8R C;  1G4A E;  2KRU A;  1GL6 A;  2HHH M;  5C18 A;  1NVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...