3L2BA

Crystal structure of the cbs and drtgg domains of the regulatory region of clostridium perfringens pyrophosphatase complexed with activator, diadenosine tetraphosphate
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
233
structure length
233
Chain Sequence
MVKLKVEDLEMDKIAPLAPEVSLKMAWNIMRDKNLKSIPVADGNNHLLGMLSTSNITATYMDIWDSNILAKSATSLDNILDTLSAEAQNINEERKVFPGKVVVAAMQAESLKEFISEGDIAIAGDRAEIQAELIELKVSLLIVTGGHTPSKEIIELAKKNNITVITTPHDSFTASRLIVQSLPVDYVMTKDNLVAVSTDDLVEDVKVTMSETRYSNYPVIDENNKVVGSIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable manganase-dependent inorganic pyrophosphatase
publication title Crystal Structures of the CBS and DRTGG Domains of the Regulatory Region of Clostridiumperfringens Pyrophosphatase Complexed with the Inhibitor, AMP, and Activator, Diadenosine Tetraphosphate.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 71
structure length 233
sequence length 233
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF07085 DRTGG DRTGG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3l2bA01
3.40.1390.20 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 HprK N-terminal domain-like 3l2bA02
2QRCE 2ZY9A 1PBJA 3OCMA 3L31A 4P1OA 3L2BA 2PFIA 1KO7A 4NOCA 4COOA 4L0DA 4FXSA 3KXRA 3SL7A 2QR1E 5K22B 3HF7A 4IY4A 4O9KA 1XKFA 3LQNA 4L28A 3GBYA 4FRYA 2OOYE 2QLVC 2YZIA 3KPCA 3KPDA 4UUUA 5MMZA 2D4ZA 4P1GA 3FNAA 4IYSA 4PCUA 3PC4A 3K2VA 3KPBA 4IY0A 3LV9A 2P9MA 1Y5HA 1YAVA 5IIPA 3LHHA 2RIHA 2QREE 2UV6A 2NYCA 2YVZA 1PVMA 2OOXE 2O16A 4ESYB 3FWSA 2UV4A 3T4NC 3OCOA 3PC3A 4GQYA 4IY2A 1O50A 5LXQA 3DDJA 2EF7A 4L3VA 2UV7A 5K23C 1KNXA 4IY3A 3FHMA 2QH1A 2QRDE 4GQVA 2OUXA 3FV6A 2EMQA 3FWRA 5K24C 2YVXA 3OI8A 2RIFA 3TDHC 4HG0A 2UV5A 3KH5A 5K25C 4GQWA 3LFZA 3TE5C 2NYEA 4ESYA 3ORGA 2IOJA 3K6EA 4DQWA 2YZQA 3I8NA 2YVYA 2RC3A 4L27A 3PC2A 5KS7A
chains in the Genus database with same CATH superfamily
2QRCE 3EH0A 2ZY9A 1PBJA 3OCMA 2FYWA 4IHFA 3L31A 4P1OA 3L2BA 2PFIA 1KO7A 4NOCA 4COOA 4L0DA 4FXSA 3KXRA 3SL7A 2QR1E 5K22B 3HF7A 4IY4A 4O9KA 3WSEA 1XKFA 4QF5A 3WSFA 4CVMA 3LQNA 4L28A 3GBYA 3WSHA 2IU8A 4IHGA 4FRYA 3PMOA 2OOYE 2QLVC 2YZIA 3KPCA 2XJAA 3KPDA 2J9LA 4UUUA 5MMZA 2D4ZA 4P1GA 3FNAA 4IYSA 4PCUA 2IUAA 1E8CA 1NMPA 3PC4A 3K2VA 3KPBA 4IY0A 2WTZA 3LV9A 2P9MA 4QDIA 1Y5HA 1YAVA 5IIPA 3LHHA 2AM2A 3WSDA 2AM1A 2RIHA 2YYBA 2QREE 2UV6A 2NYCA 2YVZA 1PVMA 2OOXE 4CVKA 2O16A 4ESYB 3FWSA 2UV4A 2IU9A 3T4NC 3OCOA 4E79A 3PC3A 4GQYA 4IY2A 1O50A 5LXQA 3DDJA 4E75A 2EF7A 4L3VA 4IWGA 2UV7A 5K23C 1KNXA 3ZL8A 4IY3A 3FHMA 2QH1A 2QRDE 4GQVA 4IWMA 2OUXA 3FV6A 2EMQA 3FWRA 4CVLA 4BUBA 5K24C 4C13A 2YVXA 3OI8A 2RIFA 3WSGA 3TDHC 4HG0A 3ZM6A 4ZIYA 4C12A 3EEQA 2UV5A 3KH5A 5K25C 4IHHA 4GQWA 1GG4A 3LFZA 1NMOA 3TE5C 2NYEA 4ESYA 3ORGA 3ZM5A 2IOJA 3K6EA 3WSIA 4DQWA 2JA3A 2YZQA 3I8NA 2YVYA 2RC3A 4L27A 3PC2A 5KS7A
chains in the Genus database with same CATH topology
2QRCE 2ZY9A 1PBJA 3OCMA 3L31A 4P1OA 3L2BA 2PFIA 1KO7A 4NOCA 4COOA 4L0DA 4FXSA 3KXRA 3SL7A 2QR1E 5K22B 3HF7A 4IY4A 4O9KA 1XKFA 3LQNA 4L28A 3GBYA 4FRYA 2OOYE 2QLVC 2YZIA 3KPCA 3KPDA 2J9LA 4UUUA 5MMZA 2D4ZA 4P1GA 3FNAA 4IYSA 4PCUA 3PC4A 3K2VA 3KPBA 4IY0A 3LV9A 2P9MA 1Y5HA 1YAVA 5IIPA 3LHHA 2RIHA 2QREE 2UV6A 2NYCA 2YVZA 1PVMA 2OOXE 2O16A 4ESYB 3FWSA 2UV4A 3T4NC 3OCOA 3PC3A 4GQYA 4IY2A 1O50A 5LXQA 3DDJA 2EF7A 4L3VA 2UV7A 5K23C 1KNXA 4IY3A 3FHMA 2QH1A 2QRDE 4GQVA 2OUXA 3FV6A 2EMQA 3FWRA 5K24C 2YVXA 3OI8A 2RIFA 3TDHC 4HG0A 2UV5A 3KH5A 5K25C 4GQWA 3LFZA 3TE5C 2NYEA 4ESYA 3ORGA 2IOJA 3K6EA 4DQWA 2JA3A 2YZQA 3I8NA 2YVYA 2RC3A 4L27A 3PC2A 5KS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QRC E;  2ZY9 A;  1PBJ A;  3OCM A;  3L31 A;  4P1O A;  3L2B A;  2PFI A;  1KO7 A;  4NOC A;  4COO A;  4L0D A;  4FXS A;  3KXR A;  3SL7 A;  2QR1 E;  5K22 B;  3HF7 A;  4IY4 A;  4O9K A;  1XKF A;  3LQN A;  4L28 A;  3GBY A;  4FRY A;  2OOY E;  2QLV C;  2YZI A;  3KPC A;  3KPD A;  4UUU A;  5MMZ A;  2D4Z A;  4P1G A;  3FNA A;  4IYS A;  4PCU A;  3PC4 A;  3K2V A;  3KPB A;  4IY0 A;  3LV9 A;  2P9M A;  1Y5H A;  1YAV A;  5IIP A;  3LHH A;  2RIH A;  2QRE E;  2UV6 A;  2NYC A;  2YVZ A;  1PVM A;  2OOX E;  2O16 A;  4ESY B;  3FWS A;  2UV4 A;  3T4N C;  3OCO A;  3PC3 A;  4GQY A;  4IY2 A;  1O50 A;  5LXQ A;  3DDJ A;  2EF7 A;  4L3V A;  2UV7 A;  5K23 C;  1KNX A;  4IY3 A;  3FHM A;  2QH1 A;  2QRD E;  4GQV A;  2OUX A;  3FV6 A;  2EMQ A;  3FWR A;  5K24 C;  2YVX A;  3OI8 A;  2RIF A;  3TDH C;  4HG0 A;  2UV5 A;  3KH5 A;  5K25 C;  4GQW A;  3LFZ A;  3TE5 C;  2NYE A;  4ESY A;  3ORG A;  2IOJ A;  3K6E A;  4DQW A;  2YZQ A;  3I8N A;  2YVY A;  2RC3 A;  4L27 A;  3PC2 A;  5KS7 A; 
#chains in the Genus database with same CATH topology
 2QRC E;  3EH0 A;  2ZY9 A;  1PBJ A;  3OCM A;  2FYW A;  4IHF A;  3L31 A;  4P1O A;  3L2B A;  2PFI A;  1KO7 A;  4NOC A;  4COO A;  4L0D A;  4FXS A;  3KXR A;  3SL7 A;  2QR1 E;  5K22 B;  3HF7 A;  4IY4 A;  4O9K A;  3WSE A;  1XKF A;  4QF5 A;  3WSF A;  4CVM A;  3LQN A;  4L28 A;  3GBY A;  3WSH A;  2IU8 A;  4IHG A;  4FRY A;  3PMO A;  2OOY E;  2QLV C;  2YZI A;  3KPC A;  2XJA A;  3KPD A;  2J9L A;  4UUU A;  5MMZ A;  2D4Z A;  4P1G A;  3FNA A;  4IYS A;  4PCU A;  2IUA A;  1E8C A;  1NMP A;  3PC4 A;  3K2V A;  3KPB A;  4IY0 A;  2WTZ A;  3LV9 A;  2P9M A;  4QDI A;  1Y5H A;  1YAV A;  5IIP A;  3LHH A;  2AM2 A;  3WSD A;  2AM1 A;  2RIH A;  2YYB A;  2QRE E;  2UV6 A;  2NYC A;  2YVZ A;  1PVM A;  2OOX E;  4CVK A;  2O16 A;  4ESY B;  3FWS A;  2UV4 A;  2IU9 A;  3T4N C;  3OCO A;  4E79 A;  3PC3 A;  4GQY A;  4IY2 A;  1O50 A;  5LXQ A;  3DDJ A;  4E75 A;  2EF7 A;  4L3V A;  4IWG A;  2UV7 A;  5K23 C;  1KNX A;  3ZL8 A;  4IY3 A;  3FHM A;  2QH1 A;  2QRD E;  4GQV A;  4IWM A;  2OUX A;  3FV6 A;  2EMQ A;  3FWR A;  4CVL A;  4BUB A;  5K24 C;  4C13 A;  2YVX A;  3OI8 A;  2RIF A;  3WSG A;  3TDH C;  4HG0 A;  3ZM6 A;  4ZIY A;  4C12 A;  3EEQ A;  2UV5 A;  3KH5 A;  5K25 C;  4IHH A;  4GQW A;  1GG4 A;  3LFZ A;  1NMO A;  3TE5 C;  2NYE A;  4ESY A;  3ORG A;  3ZM5 A;  2IOJ A;  3K6E A;  3WSI A;  4DQW A;  2JA3 A;  2YZQ A;  3I8N A;  2YVY A;  2RC3 A;  4L27 A;  3PC2 A;  5KS7 A; 
#chains in the Genus database with same CATH homology
 2QRC E;  2ZY9 A;  1PBJ A;  3OCM A;  3L31 A;  4P1O A;  3L2B A;  2PFI A;  1KO7 A;  4NOC A;  4COO A;  4L0D A;  4FXS A;  3KXR A;  3SL7 A;  2QR1 E;  5K22 B;  3HF7 A;  4IY4 A;  4O9K A;  1XKF A;  3LQN A;  4L28 A;  3GBY A;  4FRY A;  2OOY E;  2QLV C;  2YZI A;  3KPC A;  3KPD A;  2J9L A;  4UUU A;  5MMZ A;  2D4Z A;  4P1G A;  3FNA A;  4IYS A;  4PCU A;  3PC4 A;  3K2V A;  3KPB A;  4IY0 A;  3LV9 A;  2P9M A;  1Y5H A;  1YAV A;  5IIP A;  3LHH A;  2RIH A;  2QRE E;  2UV6 A;  2NYC A;  2YVZ A;  1PVM A;  2OOX E;  2O16 A;  4ESY B;  3FWS A;  2UV4 A;  3T4N C;  3OCO A;  3PC3 A;  4GQY A;  4IY2 A;  1O50 A;  5LXQ A;  3DDJ A;  2EF7 A;  4L3V A;  2UV7 A;  5K23 C;  1KNX A;  4IY3 A;  3FHM A;  2QH1 A;  2QRD E;  4GQV A;  2OUX A;  3FV6 A;  2EMQ A;  3FWR A;  5K24 C;  2YVX A;  3OI8 A;  2RIF A;  3TDH C;  4HG0 A;  2UV5 A;  3KH5 A;  5K25 C;  4GQW A;  3LFZ A;  3TE5 C;  2NYE A;  4ESY A;  3ORG A;  2IOJ A;  3K6E A;  4DQW A;  2JA3 A;  2YZQ A;  3I8N A;  2YVY A;  2RC3 A;  4L27 A;  3PC2 A;  5KS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...