3L2UA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and gs9137 (elvitegravir)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2uA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2uA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2uA03
1XHXA 4CE9A 4DS5A 2RJEA 3MEWA 1S1UA 4DTJA 4FJKA 4ICLA 1ASVA 1GOBA 4FJMA 4C5HA 2G3RA 2HHXA 1RBSA 4II1A 3AO5A 3V6DA 1RT6A 2YNGA 1VK0A 2MWOA 3CG7A 4O55A 4Q0BA 1N27A 4OGCA 2R7YA 1NK6A 2GFAA 3ZSOA 3MAQA 3SZ2A 1CXUA 4CEBA 4F2SA 5HBMA 4FM1A 4ZTJA 4Q5VA 2P0KA 3WNFA 3RR8A 4TSXA 4CJ4A 3HM9A 1SL0A 4O5BA 1UWBA 1EP4A 3B6PA 3AA3A 2VWKA 3OYNA 3TAFA 4YNQA 1RBVA 3I0RA 3AO2A 3SYZA 3VN5A 3SD4A 4KAZA 2KTQA 2R58A 3DRRA 3MP6A 4Z0UA 2OZSA 4DSLA 2GFUA 3HPOA 4FJ9A 4M3WA 3E9FA 2RHYA 1ZBFA 3E9GA 2HNYA 2OPSA 4CHOA 1JXEA 4NS5A 3DMJA 3KLEA 3T1AA 2HHTA 3RMBA 4CJEA 4CJPA 3K5LA 4FJGA 3QERA 2RHZA 4CGJA 3AVAA 1U47A 2YV0X 3I8DA 3L8BA 3QBYA 3LWMA 4Z4FA 4BE0A 2RN2A 4CJFA 4DSKA 1DTTA 4KTQA 3H8ZA 4F3TA 1KFDA 1IO2A 1FKPA 1WSEA 2R5MA 3L2QA 1C0TA 3CM5A 2VG7A 3IS9A 1TKDA 3KK2A 2GF7A 3AVCA 3ZSZA 3K5OA 4FJIA 4DSEA 4Z4HA 3M8RA 1LAWA 1N6QA 2PZSA 3DOLA 4M3RA 4K8XA 1QE1A 1RBUA 2HNDA 2X4YA 2P1JA 4LSLA 4CEAA 4Z4GA 2OYQA 4XIUA 2OZMA 4E3SA 4E7KA 3C6TA 2YRVA 4RW4A 4JS5A 3T19A 4C5GA 5KE3A 3LH0A 1YTUA 4FK4A 4FLVA 4FZXC 1WAFA 4OPJA 1W9HA 1RDDA 1BQNA 4CK1A 3L2WA 1I3AA 4DLEA 5J2MA 3NH0A 3CFRA 1X9WA 1WSFA 2HNZA 4M41A 1UA0A 4I9LA 4CEFA 1NK7A 4M3XA 3P83D 3S3MA 4DTSA 4DTMA 2BE2A 3LZJA 2QQRA 4CFCA 2LTOA 2LCCA 3LALA 3HO1A 4KI4A 1GOAA 1TK0A 4N4GA 4KV8A 4LH5A 4NYFA 4AHVA 3KLGA 4C8OA 4JRQA 4PY5A 1D8YA 3BDLA 4GY5A 4DSFA 1BCOA 4LH4A 2JTFA 3O3FA 1EETA 3DRPA 4FJ8A 2IOCA 4NYNA 4ELVA 3MP1A 1RBTA 1JL1A 4DTXA 2D9TA 3OYCA 2YKNA 3AVFA 2HQXA 3KJVA 4DQQA 1X1PA 3RTVA 5HP1A 1S1VA 3SPZA 1NOYA 2G8HA 3HPGA 4A4FA 3DI6A 4H4MA 2EX3A 2HQEA 3VQ9A 4CEZA 3IG1A 4DLGA 1VSHA 1DTQA 4CF2A 2HVIA 3QKJA 4IUTA 3MECA 2PYJA 1OZ2A 3NF9A 1S6PA 4CJ5A 2VYTA 2KFNA 3LP0A 3QNNA 1JLBA 3IAYA 4PWDA 3AVLA 3KLIA 4DFMA 3TI0A 5D3GA 3FDRA 2RI3A 5J2QA 4EZ6A 3L2VA 2L3RA 1TL1A 1ITGA 1BQMA 5HRNA 2YNIA 4CJWA 1U48A 2F5KA 1RT1A 3ALYA 3ITHA 1KVBA 4KHQA 4HUFA 2PY5A 4NCBA 3K5NA 3S3NA 1B92A 4N47A 3OJUA 3SUQA 1RT5A 3RRHA 4PL6A 4Z02A 4B9XA 2G8UA 4F2RA 3TANA 4F3OA 4DTPA 1JLGA 1WJQA 3NHGA 4M3UA 3QEXA 1BL3A 4DSIA 3NGZA 3NH1A 1VSIA 2ETJA 5KGWA 1BI4A 3NDKA 2XY6A 1LWCA 1WLJA 3P1GA 4E1MA 2EFIA 4QOZB 4FLXA 2O4XA 2IS3A 3BDPA 3V9XA 3LDSA 1HYSA 2EQUA 3VQCA 3ZT2A 2WONA 3ZT0A 4PA1A 1KRPA 4IUQA 2KQ2A 3HVRA 1L3VA 1BCMA 3NGYA 4CIFA 4FLYA 1LV5A 3M9QA 1J9AA 2O4GA 3VQQA 4E19A 1L3SA 4CHPA 2YKMA 3MXIA 4CK3A 3K5MA 1IKWA 5C25A 1SSFA 4B9SA 4HVJA 1VSJA 1VRTA 2GBZA 2RKIA 1JLFA 4AHCA 5HRSA 3F73A 2LVMA 3CM6A 4HUEA 2A1SA 3DOKA 4CFDA 3A2FA 3V9WA 4FJLA 2KW4A 4CF0A 3OMCA 2IG0A 3QESA 1TK5A 4B9MA 2E6LA 3CEYA 3AVGA 4R5PA 4IKFA 3TARA 1NK5A 5JS2A 2HMIA 4KB0A 4AH9A 1J53A 3TWHA 2ZD1A 2XY8A 4FJXA 4L59A 1HJRA 1WJSA 2X4XA 4OPKA 1CZ9A 1WJRA 4N5SA 4BDZA 3NTIA 2QQSA 3AVHA 3F9KA 4Y1DA 1D9DA 3DLBA 4J2EA 3D45A 3LZIA 2G8IA 1B9FA 1QSYA 4AHTA 1O1WA 1X9SA 3LAKA 1ZBLA 1BHLA 4DF4A 4KHWA 4I2QA 1TAUA 1S9EA 2QXFA 4CK2A 1G5VA 4QAGA 2R57A 3L42A 3LPTA 3K59A 3P8DA 3CFPA 3MO8A 4DFJA 4AILC 3AA5X 3K57A 3O4NA 4W5RA 4DS4A 3MEVA 3AO4A 3RMDA 4NCGA 4HCBA 1SL1A 4AHSA 3QEPA 2F8SA 1HNIA 3G0ZA 2M16A 4KTWA 3OYKA 5HROA 2EQJA 1U4BA 5C42A 4AHUA 4E1NA 5KRTA 3OYGA 3EAEA 1WSIA 4HHTA 2EQKA 4A4HA 2AJQA 5J26A 4DTOA 3V1OA 4IUPA 2FBVA 5KRSA 4OVLA 3RMCA 3HP6A 2R5AA 2M0OA 3UWNA 2B6AA 3D0PA 1QSSA 1XHZA 1UA1A 4FZYA 4PUOA 4QQGA 1IKVA 3VQ4A 3DLGA 3TAEA 3ZSXA 2X35A 3VQEA 3V9ZA 3L3VA 3PUFA 1KTQA 3AVMA 1NJZA 2RJCA 2FBTA 1NK9A 3DLRA 3O3GA 4E7IA 4GVMA 3KD5E 3META 1CXQA 4KI6A 4DF8A 3NNQA 4F8RA 1RTDA 4KB1A 3RMAA 4CJQA 2M1HA 4IUUA 4UC4A 3NH2A 5D6XA 1C6VA 3O4QA 3UIQA 1IKXA 3KK1A 4BDPA 4B9LA 1RNHA 4C5IA 4O44A 1C1BA 3B6OA 3L2UA 4CJTA 1IH7A 1SV5A 3NF6A 1CLQA 2NUBA 3QETA 3NF7A 4CGDA 4RW8A 2G8FA 3SUPA 4RW9A 4OKKA 3K2PA 2L8DA 4FM2A 4CJVA 3OY9A 3V4IA 4KHNA 2ZQBA 5K14A 3JSMA 3LP2A 3SQ1A 2KZZA 1IKYA 2D0CA 4W5NA 3MEUA 5CZ2A 1T05A 3L2RA 1I39A 5EU7A 3TAGA 1JL2A 1VSEA 2G8WA 3U3GA 2KZMA 4HTUA 4BDYA 1C1CA 2X78A 4NCAA 1J54A 1Q9XA 1A5WA 3LLRA 1ASUA 3QEIA 3AVKA 4ZTFA 5J2NA 3AO1A 3DLHA 5KCHA 4QCLA 1WSHA 1JLAA 3KKRA 4JLHA 4LSNA 5CY4A 3LX7A 3MXJA 1S5JA 3LWLA 3EYZA 4B9VA 4W5TA 2BIVA 3RWUA 2RHUA 4L8RB 4CJKA 2HVHA 3MP8A 5CYQA 4FLZA 3SQ4A 3RR7A 3C4SA 4IUVA 1RT7A 2YHAA 1TK8A 4KPYA 2K3XA 4IURA 3DRSA 4CERA 4Z4CA 3ZSQA 4CHNA 2B5JA 2Z1JA 1U49A 4HUGA 4M42A 2D5RA 2YNHA 1KLMA 1QS4A 1RBRA 2RO0A 4IG0A 3C94A 5FRMA 1JLEA 5C0MA 3LAMA 1L5UA 4DWIA 1T03A 3KKSA 1L3TA 1QTMA 2WACA 1VSKA 1Q9YA 3WNGA 4O4GA 2RF2A 2HHQA 1LWFA 3ZSYA 2X6SA 1HYZA 5FROA 4E89A 2GV9A 3T3FA 1KVCA 2XK0A 1XI1A 3V9UA 4DTNA 3CYMA 1SUQA 4CJUA 4UQGA 3VQAA 2NLUA 3MEAA 2VG6A 1TKTA 4ID5A 1KHCA 4KTZA 4QQDA 5J2PA 1RT2A 3KD1E 2HHVA 1KSPA 1WAJA 2LRQA 1RDBA 3HJFA 1TKXA 1KVAA 4E7JA 4DQPA 4FXDA 3SV4A 2RI5A 3OYLA 1LW2A 4MFBA 4FVMA 3ZT1A 4FJ5A 1TAQA 1NKEA 3AVIA 1ZBHA 1C0UA 1EX4A 2IDOA 3HL8A 5FDLA 2MWPA 4CEDA 2HHWA 3NTKA 1BGXT 2E4LA 5KI6A 4CFAA 2BKDN 5D6YA 1HMVA 1VRUA 4IFVA 4OGEA 3OYHA 5CIUA 1UOCA 1NK8A 3HXMA 1FK9A 3ZEHA 1TV6A 4W5QA 3PMTA 2OA8A 2DFFA 4E7HA 1VSDA 3QINA 3OYFA 1YT3A 3KUFA 4BWMA 4FLWA 4KHSA 3SQ0A 2HHUA 3NE6A 1LW0A 4B9TA 4ELTA 4N4HA 2HHSA 2QK9A 4C5EA 3H08A 4QW2A 4KKOA 4AHRA 4FJHA 2XDPA 3NFAA 2BGGA 5KCOA 3ME9A 4W5OA 2DTUA 2QKBA 3HT3A 2LDMA 5KTQA 2X74A 3H6ZA 2RJDA 1YVUA 3VQDA 3OB9A 3ZT4A 4IDKA 2Z1GA 3PX4A 1RT3A 4CJLA 1HQEA 3VA0A 2CKKA 1RTHA 5CYMA 3PX6A 2GUIA 1L3UA 3MEGA 1CZBA 3V81A 2OPQA 2FBYA 4J2DA 1RILA 3LPUA 3HYFA 4YFUA 3NGIA 3VQ6A 3ZCMA 3OJSA 1HRHA 1WSGA 4F4KA 4N56A 3OYDA 3HPHA 5HRPA 3OYIA 2XRIA 3ZT3A 4HCCA 3PX0A 2OPRA 4FW2A 3SQ2A 4C8LA 4FJJA 4CEOA 1C1AA 1S9GA 4QQ6A 1JLCA 4BWJA 4EZ9A 4E7LA 1RDAA 4DQIA 3WNEA 3P5JA 5FRNA 1KCFA 1WSJA 3NF8A 2XY7A 2P5OA 2FHDA 2BDPA 3LYIA 2XY5A 1JKHA 4PQUA 2HW3A 4CESA 2IGIA 1NOZA 4IG3A 4O0JA 3E01A 2E6NA 1D5AA 1RT4A 4DTUA 1NJYA 1NKCA 4CGFA 1TKZA 1ZBUA 2ZE2A 3SV3A 2OPPA 4DQSA 3AV9A 3HSTB 2JGUA 1S1XA 3DB3A 1SKRA 4CIEA 1OZ3A 3QJ6A 1MU2A 1H3ZA 1DLOA 1Q8IA 5T7BA 4B9WA 4BE1A 5C6SA 1A5XA 1F21A 1FXXA 1Z26A 4GW6A 4H8KA 4B8AB 4DFPA 3QEWA 2G8VA 3KTQA 4J2AA 5JS1A 4CIGA 1QHTA 3OQ5A 3JYTA 3SNNA 3C6UA 3QIOA 4IBNA 3LGLA 4RW6A 4CJ3A 2B8AA 5SWMA 4OVAA 1REVA 1S6QA 3VQ5A 4I9QA 3QEVA 2DIGA 2RI2A 4B08A 3TABA 1KFSA 4C8NA 2D0AA 1R0AA 3EY1A 3LP1A 3O8VA 1U04A 1VSMA 4FK0A 4B3OA 3ZSWA 3V9SA 3CQ8A 5J1EA 2DFEA 3L3UA 4OKJA 3PMIA 4FCYA 2ATQA 2F8TA 1QQCA 1BISA 3QIPA 1T7PA 4CHQA 4Z4EA 1WN7A 3V1QA 4CGHA 4C8MA 4FLTA 4GMJB 1ZYQA 4O0IA 3PO4A 1T8EA 1B9DA 3KK3A 4Z4IA 3NTHA 4LD6A 5KH6A 4JRPA 3SI6A 5I3UA 2F96A 5D6WA 3I0SA 3NCIA 1QSLA 4M3ZA 2Z1IA 3U3YA 5KGXA 2W42A 4RG8A 3S6WA 1HPZA 4RW7A 5CZ1A 1XC9A 5HRRA 3MXMA 1OI1A 3DLMA 3TAQA 1N5YA 4N76A 3F70A 3NAEA 4DU3A 3OYEA 2RHIA 4FJ7A 4FM0A 1A5VA 4CRIA 3MEEA 4FW1A 3OYJA 2EKOA 4OKEA 4QVZA 3QNOA 1NJWA 3VA3A 4KFBA 1S1TA 3AA4A 4CEQA 2E5QA 2YNFA 2IC3A 3ZSVA 1TVRA 2FBXA 4CHYA 1HNVA 2EQMA 3TR8A 2XHBA 3SJJA 4M3YA 4KHUA 1HYVA 1WNSA 2O4IA 1UAXA 4CGGA 4Q5WA 4EP5A 1HQUA 1RDCA 3OYMA 3OYAA 1WGSA 2VG5A 3FFIA 4KO0A 4CEEA 4CECA 4B9UA 1G15A 1NK4A 2O4XB 1NK0A 3S3OA 4N41A 3FEOA 3ISNC 4DFKA 3IRXA 2HB5A 2PYLA 3Q1JA 4BD3A 4C8KA 4KHYA 2L89A 4KREA 3OYBA 2BANA 2Q3SA 1W0HA 3ULDA 4J2BA 2DY4A 1X9MA 4PLIA 2FC0A 1EXQA 4CF1A 1NKBA 1NJXA 2G8KA 4B9NA 2VWJA 2DAQA 2WOMA 5SZTA 3O3HA 5M9OA 4DTRA 4CF8A 3OS0A 2D0BA 4DMNA 1D9FA 2PQWA 2RJFA 3OVNA 4M3TA 3KLFA 2P51A 4FJNA 1OYXA 3DB4A 1JXBA 1VSLA 4I2PA 1MHNA 2RHXA 1SKWA 3PO5A 4H4OA 4CJSA 4DQRA 3FLGA 4Y1CA 4LD0A 2DIQA 5IAYA 3LANA 2Y1IA 4DU1A 3CFOA 3VQPA 3PY8A 1RTIA 4DSJA 5I42A 4CFBA 1SKSA 1RTJA 4I7FA 5DMRA 3PV8A 3WNHA 3SPYA 1RCHA 2A1RA 4FL6A 3FC3A 1TGOA 2Z1HA 3P8HA 3S9HA 3OA6A 3MEDA 5J39A 3G10A 1U45A 3HK2A 1VSFA 1SL2A 4CCHA 3PFSA 3ASMA 4FLUA 4MQ3A 2RPIA 1J5OA 1ZBIA 2DFHA 4DG1A 4BE2A 3BGRA 3NBPA 4G1QA 4A4EA 3TAMA 4RG2A 4OJRA 4EDUA 2JZ2A 2QKKA 1LWEA 3GOXA 3QO9A 4FYDA 2BUDA 3DLEA 5E41A 4X34A 3UT1A 4ZHRA 3OS1A 4HCZA 3VQ7A 4EP4A 1XWLA 5C24A 3U6FA 1ASWA 1LAVA 2JLEA 3SUNA 4JS4A 2E6MA 4IFYA 3PNWC 3M8QA 4PLLA 2Y1JA 4ID1A 2X6NA 4WE1A 3LGFA 4CGIA 3THVA 3KLHA 1RI0A 4M45A 3LP3A 2I5JA 1KLNA 3DM2A 3TAPA 1EKEA 4B8CA 1TL3A 3VQBA 3SUOA 2B4JA 3OMGA 2X4WA 1BIZA 2IAJA 1BIUA 2YHBA 3HVTA 4DU4A 4CF9A 3V1RA 3M8SA 2XO7A 2KFZA 1K6YA 3QIIA 3ASKA 1Z25A 4A4GA 3AVBA 3DLKA 3M8PA 3VQ8A 1GOCA 3ZSRA 4CJRA 3SCXA 5HLFA 3RRGA 2LSNA 3AVNA 4NZGA 4N4IA 1YTAA 5DK5A 2P5GA 4ELUA 4K8ZA 4FZZA 3DYAA 3KIOA 4LY7A 4CHZA 1C0MA 1S1WA 3K58A 1Y97A 3OS2A 3HP9A 4BACA 3AA2A 3QLHA 4E0DA 2ITGA 4OLAA 2EHGA 4FU6A 4FK2A 3EZ5A 1FKOA 3AVJA 5KE2A 1JLQA 1XNIA 4OLBA 4KRFA 1IG9A 5IN1A 3AO3A 1BI4B 2K3YA 3C95A
chains in the Genus database with same CATH superfamily
1XHXA 4FJKA 1GOBA 1O7LA 4FJMA 3V6DA 5KAIC 6PAXA 4FX0A 5HLTA 3VYRB 4O8UA 4CJ4A 2WA0A 1UWBA 5HY6A 5GMKh 3QICA 4CCMA 2VC0A 1WHJA 2KISA 5DPKA 2FBHA 2IGKA 3ULEB 1Q82U 4BQZA 1R7JA 4NQWB 4C3JJ 2JPSA 2CRGA 4J9GA 4S04A 1T3SA 2HNDA 4CEAA 1IXRC 3HRMA 3AARA 1IB8A 4C5GA 4BY1J 3O1WA 3K9TA 5F64A 4ZC3A 4J6YA 3VSLA 5AYFA 5LMUK 4U67L 3M5AA 2OAUA 4AHVA 2EPDA 4GY5A 3PFIA 2FSWA 2D9TA 1X1PA 4XTXA 1SC7A 1DTQA 4A54A 4IUTA 2PYJA 1S22A 1S6PA 4BXUA 1RZ4A 1VQMQ 4OB2B 3IAYA 2F5FA 1Y0NA 4CJWA 3SDZA 5L3FA 2BHZA 2ZGYA 2QSGX 3SEZA 1RKTA 4FVUA 1VSIA 3G6EN 2DLPA 5DV5A 3E0JB 2O4XA 4FLXA 1W4MA 1LOJA 3HVRA 4CZMA 1FIPA 4FLYA 3EKUA 3W6JB 4UVCA 4HPQA 1WFWA 4LOCA 3PQJA 3I0WA 1WI7A 2KW4A 2QWMA 3ZN0A 3PIPA 3THYA 5D4SA 1JJ2S 3AGRA 1V55H 4JI7K 1UHWA 2ZD1A 3H0GJ 4MMKA 1HJRA 1KQSP 1UAAA 3PQKA 3JRAA 1NGFA 1M4ZA 3QAHA 2NRXA 2KEAA 5CQEA 1M2VA 3RKQA 3M57A 3CJ1A 1HKGA 3GPLA 1XPXA 4Y3OA 4YDUC 4Y15A 3H6EA 4YPHA 3R6OA 5JMVA 3RMQA 3ZQQA 3JCMb 3UWNA 2P9SB 2Y90A 1UA1A 5C2DA 4J6WA 3A0BC 3QP5A 1KQ1A 3DWLE 2EGCA 4N4NB 2LD5A 1QGPA 2BOLA 3IUOA 3T0YA 3E6CC 5DLQE 3CIPA 2G8FA 5JLWA 1FJLA 3PNTA 5FWBA 2LY2A 3JSMA 1N5ZA 5CZ2A 2MGQA 1OKRA 5KYYA 4BDYA 3OBWA 2NUPB 1ZG5A 1JLAA 5AQKA 4BI8B 4M42A 4GO1A 1V4RA 2JMAA 3C94A 1W5TA 3PL8A 4DWIA 1CQTA 3ATUA 4CBWA 1T03A 1QTMA 1YIJT 4O4GA 2XGEA 1T3VA 1S7OA 4XTUA 2AXLA 3THXA 3V9UA 4F16A 5AQFA 4IEIA 5BMZA 4XLCA 1Y96A 1KVAA 4JD2B 1LDJA 3OYLA 5FDLA 2BGCA 1KD1R 2HHWA 2RM4A 2J05A 3OYHA 3E6BA 2M9HA 2V1NA 4E7HA 3OYFA 3KUFA 3IMXA 4I99C 1HPMA 1HF0A 4QT7A 3NFAA 3ZXSA 4DEXA 1UHSA 3OB9A 5H20A 4Z8AA 2FBYA 3OJSA 3N05A 3JRBA 1I50J 3MJXA 2E2NA 4QS7A 3VESA 1S9GA 3RESA 3FXRA 3NF8A 1U9NA 5CLSA 2DK8A 2IGIA 2E6NA 1WKMA 4CGFA 3DBRB 1NG9A 4YIIA 3TU4K 4EMKC 1Q86O 2WY7Q 2O03A 2KY9A 2QXLA 3A8LB 2AHJB 4GW6A 3G1MA 2BW3B 2G8VA 2RH2A 3FE1A 4RTVA 5LGNA 3QEVA 3H46O 4HX7A 1VTNC 4FK0A 4K43A 5KPRA 2H8WA 3RR6A 5IYBJ 3MDQA 2ATQA 1TBXA 1QQCA 3QIPA 2YX7A 4O0IA 3KK3A 4LDWA 3K9KA 4DK9A 1VQ6Q 2OCCH 5FD5A 3O80A 1GVJA 3KFVA 5CJ9A 2VJ5A 4DU3A 3JREA 4FM0A 4GV9A 4J83A 3N0UA 2CJJA 4QVZA 3ZQCA 2DXUA 4ZYHA 2HOSA 1OULA 1UAXA 4CGGA 2JA2A 2W25A 4PSXA 3PGGA 3CD6T 3FDYA 2Y31A 2AZVA 3ABUA 4J01A 4BR0A 1SD5A 1NKBA 1RAGB 4C92C 4F04B 1PDNC 1YI2T 2JRTA 2F2XA 4PL7A 4A3FJ 3D5LA 3OVNA 2R7XA 3MK6A 3GFLA 3O9QA 1R77A 1UHCA 3JB9F 1I27A 4OPHA 3LANA 2YWWA 1MGTA 1QVFP 3X2QH 3LCNA 1T38A 1TGOA 4XKBA 4KB1A 2EFNA 2A36A 1SAZA 4DR4K 2QWWA 4ZN1A 1S72N 5AQXA 3MFKA 2NRTA 5HNFA 4BEHA 2COMA 2O31A 1UTIA 3ZOBA 3CVTA 3U6FA 2IEKA 3NRVA 3VENA 2IJLA 3CCMI 2MIOA 3LP3A 1TQIA 2HMAA 1R8OB 2LY9A 1TL3A 3ZEUA 1OV3A 2B4JA 3I0TA 3IAM2 4Y52J 4EV0A 4N0AA 3KBGA 1U4BA 2DO3A 4DSJA 3ZSRA 1YO5C 5EC7A 2YX6A 2GEMA 1Y97A 1JI8A 2RQVA 1UHMA 2ETHA 2C6YA 1XOVA 2Q2EB 2EHGA 4FK2A 3EH1A 3U4LA 5D8KB 2GUPA 5M1OA 3VEVA 2DA2A 4L5EA 3M55A 2YNGA 5F0XA 4E6KG 1EJ9A 3TTFA 3UA7A 3J8AA 2R7YA 1X58A 3SZ2A 2W04A 3OGDA 4C8QA 3ML6A 2CFXA 2Q8KA 1DUXC 3IUCA 4XN3A 3QDFA 3VN5A 3AAQA 3QOEA 4PJOG 1WJ5A 4RLFA 2XGXA 3LWMA 4BE0A 4KTQA 1KFDA 1IO2A 1WSEA 2K7LA 2O8BB 1MMGA 3CPWS 4WQ5A 1KG5A 3HKSA 4ZH4F 1EV7A 2F2WA 2YRVA 1ZHFA 4U7DA 1ZLJA 4H0OA 2P6SA 5AQSA 4LFAK 2HYJA 1OH7A 3TPQA 1YJWT 1W2BP 4JJCA 1NM7A 2ED1A 4G9ZA 1QQNA 1KK7A 3HO1A 1GLAG 4C8OA 4Y4RA 4JI8K 4ELVA 3DLBA 1JL1A 5AZIA 2GZWA 1PG5B 4H4MA 2XVCA 5B5EC 3CUQC 2VWBA 3MECA 2R7DA 2VYTA 2KFNA 2OTJQ 5IXBA 2ZXWH 4OOIA 5J4YA 3SUQA 4X65K 2VV5A 3HOSA 1BL3A 3EUHA 1J2XA 1VHXA 3WT0A 1WDXA 1D3BB 2EBIA 2VJIA 3ZT0A 3L1AA 2FL7A 3JRIA 2GLOA 4E19A 1U2VA 3TOAA 1YTYA 3EKSA 3M5RA 2QBYA 1ZLMA 1YITA 4B3XA 3MZ8A 2FB7A 2LVMA 1G4DA 2KMTA 3M0QA 3TBIA 2P9KA 4X6AJ 2DMOA 5KYWA 1IN6A 2MFZA 2JRMA 5JI6A 1FYKA 3AVGA 2M87A 5HDGA 4R5PA 4IKFA 2OTJA 4IJAA 1WJSA 1ZLKA 1BU6O 2D1VA 2B86A 2XRNA 4BRCA 3PIOF 3OOPA 1GFCA 4CZHA 3MN6A 3F8NA 4CK2A 3L42A 3ZETB 1GUUA 3RMDA 4IHWA 4C23A 5GMKl 1HNIA 2FXUA 5HROA 2Q2RA 2IRFG 4E1NA 5KRTA 4OWRB 1WSIA 1WI9A 4DTOA 1HJDA 3GYHX 4WXDA 2V52B 4IUPA 2K4BA 2CMPA 3TEEA 5LHGA 5K1YA 1MWMA 5FLXE 3CCLI 2VKDA 3O3GA 4LK0F 3CCMN 1UB9A 3CCRT 3S1QJ 3F0ZA 1IBKK 1RETA 3O4QA 1SF9A 1IKXA 3RKYA 3CCJT 4BR5A 5IH2A 2D6FA 2L8DA 1Q86C 2Y69H 1VFCA 5EU7A 1FSEA 1QA6A 1SMYF 4C0GA 1QVFA 2O8FA 4IRHA 2HKNA 3RWUA 1WHHA 3ZYYX 2K3XA 2PG4A 4M78C 2JTVA 3CPFA 1PUEE 1NPRA 3QU3A 1HYZA 2GV9A 4HCKA 3CCLN 2Q2EA 2DZCA 3MHXA 1ZREA 1JO8A 4G6TB 1ZG1A 2HSPA 1TAQA 1NKEA 1J09A 2E4LA 1B1BA 5LRSA 5M5XJ 4NC6A 2C0TA 1VSDA 1UGSB 4FLWA 5DYMA 2O61A 3SQ0A 3VYSB 3H9QA 2DA9A 3H08A 4FJHA 1WBDA 4M78G 3RBBB 1IBMK 1TWCJ 3VV0A 4DJAA 1N8RC 3ZT4A 1NJIR 3EEQA 3EHQA 1RNLA 1BOAA 1M1EB 1W36D 3VEPA 1YIJN 5J6XA 5M3MJ 4C8LA 4CEOA 2Z3YA 3CXCP 1UG0A 5C44J 4UNOA 1KD1U 3MZYA 3SMSA 4D5CA 3W6KB 4HDVA 3GTMJ 2GGRA 1B8IA 3HSTB 4CI6A 2Z99A 4M78A 1SRLA 3QEWA 3ZQGA 4BEHB 2RD1A 1ORPA 5EJCA 4LFBK 3LMMA 1RRQA 4MDXA 1ETOA 4DZJA 4B08A 1H89C 1YXQA 1VSMA 2NYXA 3JSCA 4GXOA 2RNGA 2EA2A 3MKZA 1GLNA 2TCTA 2L54A 3M53A 3QU6A 3ZQHA 2W42A 4RG8A 4M74A 1ZGWA 2A5WA 3DLMA 4KHYA 4XTZA 3ECOA 4DA4A 4RMNA 3NMUA 1FJGK 1YP5A 1JCFA 5ADXA 2HVQA 4ZGDB 4P5OA 2F5DA 4IQJA 4KFBA 1HLVA 3PSFA 4F7ZA 4KHUA 4CZZA 2HL5C 4U7BA 3SK3A 2O4IA 3KX2A 1WXBA 3OYAA 3FFIA 1W36C 2BYVE 1DPUA 2VL8A 2HB5A 4C2UA 1T0HA 5EX5A 1EXQA 3I64A 2L7ZA 2CU7A 2E65A 1KFZA 2JTMA 3CCEN 3GUDA 4QS8A 4Q4ZF 1MHNA 3BROA 4OMFB 2VE8A 4C3IJ 1X3ZB 1GHCA 2YRDA 3PY8A 5I42A 2OZ6A 2Z1HA 5E3MA 2H6BA 2OTLT 1VSFA 3MKDA 1YI2N 5B8HA 4R1HA 4A4EA 4OJRA 1YRNA 2L7KA 1AOYA 3QJYA 3GNFB 4J7IA 5GAN4 1XWLA 1TQPA 1R4MB 4GYGA 2KHOA 3F23A 3CLQA 2OAWA 4DR2K 1PRLC 2DMNA 2FOKA 2P9UB 1WXUA 5FU7C 3M0UA 3COAC 4M3EA 3BF1A 3ISPA 1Q1VA 3OL3A 3AVBA 4CJRA 4PJOE 2ESHA 4PFOA 2W1OA 1M8VA 3I53A 3LSKA 4A0ZA 1C0MA 3DU6A 1Y7XA 1XGSA 1ZBXA 4OLBA 3AVJA 1JLQA 2KROA 4PZJA 3CBMA 4MQVA 2K3YA 5FLMJ 3I56T 2I5WA 1NGNA 1NLVA 3VPZA 2EH3A 2RVCA 3CG7A 2RHKA 4OGCA 3SQNA 2ASMA 1XDUA 2XGCA 1EP4A 2P5VA 1I5LA 4X64K 1TUYA 3B02A 3M9AA 3OIOA 2NAZA 1M1GA 2GFUA 2RK1A 5C15A 3O9TA 2XD0A 4HVUA 5AQWA 1Z9CA 3DXMA 3AVAA 3OA9A 4Z4FA 3FIFA 1M1KC 2LTPA 1Y8RB 5F0HA 2VG7A 3FKJA 4I2OA 3PIOL 3M58A 3SBGA 1N6QA 4LITA 1RBUA 4LSLA 5ICGA 1LEAA 1MMDA 4LUEA 3CPWP 1PYVA 1TLHB 5GAHJ 3FZLA 5I21A 4XOPA 1WAFA 1BN5A 1I3AA 1X9WA 2XAFA 1U8BA 1W0UA 2VODA 3S3MA 3VU3C 1VQ4I 1V5EA 1WJCA 4EHUA 4N4GA 4NYFA 4O5VA 1BCOA 3MP1A 2ZSIB 2LY1A 1BI0A 4IEJA 1ETWA 4PWDA 1X1AA 2D5VA 2KYBA 3QZ5B 2QGGA 3ITHA 4A59A 4HUFA 4KYWA 4LD5A 5LJ5h 2CH4W 3BP8A 4PDKA 2A40A 4J19A 1WJQA 5LEKA 2K9NA 4E1MA 3JCMh 4M63C 4DIQA 1TNSA 1LV5A 2LJ0A 1HC8A 2O4GA 3A98A 1R5ID 1LPLA 5CVJA 4AHCA 4LLNA 3ECHA 2XPVA 3OMCA 5DM7L 1ZGJA 4V19K 3P38A 2LMDA 5D5XB 3TCJA 1N32K 3VETA 4BBRJ 4MFDA 3M59A 4AH9A 3NTIA 3TW7A 2QQSA 3LH5A 4BRMA 2CSIA 2A42A 2W57A 4EVVA 3CCSN 3FXOA 3K59A 3P8DA 2VB6A 3C12A 4M3DA 4OAYA 3AO4A 3A5MC 4NCGA 2ZAEA 2ELKA 1WHGA 5DCMB 3R0JA 1W2BA 1K9MC 1TTHB 1OPKA 2KR3A 2R7UA 1O75A 2FBVA 1KGSA 2B6AA 1TU0B 2RN8A 1G3TA 4LK1F 3R8EA 4XLAA 3RSEA 1YWOA 3C7NB 5D6XA 4KN4X 2KI7A 4OFHA 3HGYA 1GT0C 2R0QC 3CJTB 4OKKA 1JEGA 1HSTA 4MEYF 1GXIE 3QODA 5HCKA 1VOMA 1VQ5N 3HRSA 4A4KA 1KZHA 4IJNA 1KD1C 2ZXHA 2BTFA 1V5GA 4W5TA 3MP8A 4KUIA 5GIPA 2PFUA 2FPFA 4U0YA 5LHHA 2OJED 3ZBDA 2QWQA 2KT0A 3PNYA 2HHQA 2GBQA 2DL5A 2UXDK 4HYEA 3NARA 2R5ZA 3WGIA 2LCSA 3JTHA 2VJ4A 2LRQA 1TKXA 2A6EF 1FBUA 4LFCK 3S2HJ 5EF6A 3NHNA 1NLPC 4W5QA 4KJZA 4BWMA 4LFUA 3ME9A 5M1PA 1K6OA 3CCEA 2DN0A 1FC3A 3BR1A 1OYWA 2D1XA 1E7OA 3H9GA 4M75D 1AWXA 1DT9A 4X9CA 5J8CA 2Z16A 2P5KA 4B23A 1HRHA 3OYDA 5LBQA 3OYIA 4M7DA 1XX5A 5A2QK 4EZ9A 2DJQA 5ED4A 1KCFA 4GDFA 1JKHA 3L4QA 5GPCA 4DTUA 1QZ6A 4EM2A 1M3CA 3VODA 4PK4A 4WFNL 2OPPA 3CCVI 1YI2Q 3DB3A 1E2XA 1SKRA 1Q8IA 4WF9L 4BE1A 2KTQA 2JTEA 5A0DA 1HW5A 1AKHA 3O8MA 3CC2I 3J81O 4C1NK 1YQMA 2KJCA 3OW2M 1HOMA 3CF5F 1AZGB 3C0BA 2HR3A 3HSRA 4CHQA 1VQKN 2UUBK 2FPEA 1Q81U 3NCIA 2VQGA 3U9GA 1GLBG 3CCMQ 2CP3A 3VEXA 1W5SA 4YORA 3OYEA 3N5NX 3VYTB 5HDNA 2LC2A 3MEEA 5GMKm 4FSVA 3OYJA 3MN2A 4CGZA 3GNGA 4Y7NJ 2RKHA 4P9FA 1MUYA 1Q7YU 2P9LA 1T44A 3TR8A 2RNJA 5AIQA 1KG3A 1NK4A 4H0EA 5CKBA 1LNXA 2IVOA 5E3LA 3FB9A 3X26B 5E8GA 3U1KA 3LAJA 1JJ8C 2X4JA 4M75A 2P51A 5CO7A 1VSLA 3GWZA 4KT6A 2JT1A 5IHIA 5DM7R 4CFBA 2Y2ZA 1U6ZA 3CMET 1YHQN 5LGTA 4WCGA 2DFHA 2IVWA 3CCJI 3SFZA 2CUZA 3PTAA 2GNCA 1K8KA 3EGDB 2D1KA 3WU2C 4MZMA 3DKWA 5GAN3 1VQ5I 3CCLT 1BI1A 3O6WA 3M8QA 2OQGA 2UUCK 1LVAA 1N77A 4IWVA 2ATCB 4W1UA 4I09A 1IRZA 2LBFB 4II3A 4ZYEA 3JR9A 3AVNA 2K9QA 4FZZA 3JCMf 2H1LA 3WODF 2R7RA 1S1WA 1MGQA 4A62A 2LF8A 4P9UA 1JJ6C 4BRLA 4HV6A 3FSPA 2P9PB 1I1GA 5DUKA 4C92E 1DJ7B 3CCJN 1BI2A 4O55A 2QA4I 3F0CA 4X1EA 1XC3A 4JKDA 1NK6A 1KQSA 4LF6K 1OOTA 4CZJA 4AFSC 3AA3A 5A0GA 1SAUA 1AWJA 2OZSA 3HPOA 4C1NI 4RS8A 1JXEA 3MX5A 3T1AA 4M7DB 5D6FA 2YV0X 3I8DA 2K6DA 1DTTA 4PNOA 3ZEUB 2COZA 2WB1N 1Q82C 1OPLA 2A0FB 4BY6B 3AVCA 4DSEA 1CKAA 4M3BA 3EUKL 1KIKA 4BL0B 3QYHB 3W2AA 3Q9SA 2DA7A 5EG0A 4C92B 4AIAA 4B3MK 2COBA 3BOQA 4IHXA 5F1JA 4FM4B 4WCEL 4C8QG 4CEFA 5BREA 3VKIA 4IFEA 3C7NA 2LTOA 2YS9A 5H6RA 1LOTB 1Q1HA 2ZF5O 4CDGA 4PY5A 4XH4A 4DSFA 4F14A 3CQYA 4NYNA 5GAHP 2ZPIB 3PUBA 4BB7A 3FZHA 3G4SQ 2FMYA 2L2OA 3LQQA 1VSHA 3BCBA 3KP4A 2DL4A 2A61A 4CJ5A 4F3QA 1I1SA 1KQJA 4EZ6A 3L2VA 2E1MC 1JCEA 1WLPB 2YNIA 3S3NA 4MDAA 2M1BA 5GAEJ 4F2RA 5CQXA 4XN0A 4AIKA 1DU6A 3QEXA 3NDKA 4GLKA 2KIMA 3OL4A 2J6FA 1YJ9T 1QLYA 3UATA 2EK5A 4KNYA 2LNVA 3QYBA 4XRFA 2A7YA 1J9AA 1PVEA 3ESWB 2YT6A 3ONQA 3MN5A 3KLNA 3I33A 4LGWA 3F73A 2DD5A 2E4HA 3KEYA 4CICA 2R5YB 1OU9A 4S0HB 4O3MA 5LJ3f 5JS2A 3DEUA 4RLQA 3F9KA 2HQNA 4A3DJ 4RTTA 1YJWN 3D45A 2JVGA 2G8IA 2HBLA 3J80K 1R1TA 4LE9A 1NJIO 4MLHA 3QEPA 4NQWA 3MMVA 3UE5A 1Y07A 2OTJN 1YIJA 4HV5A 5EEGA 4Y33A 5FKKA 5J40A 1VQMI 2X35A 4HX4A 1Y64A 3BZKA 4IRGA 4DF8A 4MO4A 1Z6TA 2M2EA 3K1MA 1YLFA 2AO9A 5GMKe 3L2UA 2NUTA 1E17A 3QETA 2V9VA 4ASNA 1MBGA 5IPAA 2CO5A 2QSHX 5MLCQ 3AO1A 4G12A 2KJBA 1S5JA 2BIVA 2NXNB 3IAS2 4LLLA 2QEXN 3HOUJ 2UXCK 1KQ9A 1GV2A 1N8RR 2R7OA 3ZMZA 4YPRA 3ULQB 4PJ0C 5C3EJ 3CD6I 2NLUA 1F1BB 1MJAA 1TKTA 2VG6A 2HHVA 5J2PA 2L7FP 4E7JA 4FVMA 2IDOA 1G6NA 2MWPA 2ZJ2A 1BOTO 1BA0A 3ZQIA 4FWSA 5GJWB 2HZYA 2IIRA 4UV9A 1CF7A 1MMSA 3J7ZI 3FHZA 3CJCA 4FOIA 4QW2A 4M7AE 3F6VA 1SS6A 3PE0A 4B3AA 3CMEA 5B1BH 3PX4A 1YQRA 1U3EM 4XH1A 4CJLA 3VEWA 2GIZA 2CKKA 1K76A 1L0OC 5CK9A 3CCST 1NK3P 2DNUA 2I5UA 2E2HJ 2MI6A 4JQFA 1KAYA 4HSRA 1MDUB 3T69A 1RDAA 2K86A 4DQIA 2XSJC 3J7YP 1I5OB 1NKCA 1NJYA 1QZ5A 1S7EA 3CCRQ 2ZE2A 1Y39A 4JKFA 3LL7A 2GA2A 1E6HA 4DYRA 3BJAA 1QHTA 1A6IA 5CHIA 1IDYA 3KCCA 3CCVN 3VQ5A 1GLLO 4UB8C 5DD4A 2NOZA 2HSTA 4IOAF 4MGRA 3E5QA 2DA1A 5J1EA 1BBYA 2M4KA 3ZX2A 4PJLA 3M3ZA 3SI6A 1GBQA 2F96A 2Z1IA 1R49A 4KH5A 2UXXA 4RW7A 2P9IB 1FOKA 5AJ3K 4QLCU 1UG2A 4J9CA 2VBYA 3VA3A 3B73A 1WJBA 4BRPA 2DQRA 3SJJA 3C3WA 3RPUD 5JVGF 4EJTA 1ONVA 4LUDA 4K11A 4KO0A 2VG5A 4L6V5 1XGMA 3I8BA 1H641 1X3WB 3S3OA 3ISNC 3F9MA 3E5XA 2Q3SA 3WU1B 4KGVB 4DQ8A 3ULDA 3W2WA 1ENHA 1AWOA 1FBSA 4B43A 4AUXA 2DAQA 3TVTA 4XQ3A 1KYZA 2LJ3A 3E66A 3MCPA 2H8RA 5FFZA 3IKTA 4H4OA 1NGAA 4Y1CA 4GBQA 3U21A 2I0NA 4D0PA 2BXZA 3R4KA 1R71A 3VYHB 2OUMA 2ZJQL 4I7FA 2XB5A 4ESFA 2R92J 1NYFA 1RCHA 1QW1A 3P8HA 3S9HA 3G10A 4KN7X 1J5OA 2GQIA 3NPFA 2KPMA 1SD4A 2XGDA 3E2UA 3JCMX 2LR8A 4WXCA 4XIDA 1U84A 3FJPA 3QO9A 4YG2F 2BUDA 3P8BB 2ID6A 2NVUB 1ZQ3P 4ZZDA 2LQKA 3FXKA 1FP1D 4JV5K 4A3LJ 4ID1A 4A0XA 1RI0A 1P4AA 4A3MJ 1N78A 1TUUA 1IN7A 3JB9J 2MC4A 3SUOA 3INZA 2QEXI 3ZN1A 1BIUA 1NK2P 4KHPK 5AZJB 2J7IA 3DEWA 4DKWA 4N4IA 3HHHA 1FOXA 1VQ7T 3UKRA 4WFBL 3G4SN 3E19A 1FOWA 3DLAA 1FKOA 2HBWA 3AO3A 1YX3A 2AP1A 2K5IA 2RJEA 3MEWA 1UJ0A 3AO5A 3G7ZA 3WU0A 4EMGA 4H0VB 3SFIA 3AAFA 4M9XA 2QGFB 5DM6F 2F9WA 3KP6A 4UUTA 2MH9A 1X6GA 3TAFA 1TWFJ 4OB3B 3SD4A 3EGUA 3M0PA 5K5OA 1KC8C 2IP2A 2FZGB 2OPSA 5HL7L 1ZAOA 2E5ZA 4Y91A 1YN8A 3I4PA 3CBPA 4B47A 3CBOA 2QUFA 2V1UA 4IVNA 1SD7A 1RACB 4PL8A 4BQAA 2D0PA 1JXOA 3ERED 4OPJA 1WEIA 4KUDK 1H92A 3ULRB 4A69C 2NZTA 4Q47A 1NK7A 4NO7A 1ZR2A 2BE5F 1XJWB 1V5FA 3MVPA 4JRQA 2ZPHB 1M3AA 2JTFA 3H92A 5E1ZB 5GAOq 2EJGA 4JI4K 2ABLA 4UB6C 3RMAA 2ME6A 2HQXA 2OFKA 3CD6A 1I1JA 1E6GA 3VQ9A 1HSQA 1YS6A 1HLUA 1W7PD 3G2BA 1IJJA 1P8ZA 1VQ8N 2KRSA 3K4JA 1B4AA 1U5SA 4HVWA 1X3UA 2E7WA 2Q97A 1TL1A 3GIBA 4KMUX 1QHGA 1NMDA 3SAHA 3CVSA 1J5YA 4BR4A 2Y30A 4CCNA 2XY6A 2E2JJ 3VJPA 1VQPN 4ON0A 2DPNA 2BH1A 5HLHA 2FUG2 1MMNA 1YWPA 1KQSM 2YKMA 3ID6A 2M4GA 2P9NA 3D5SC 1EIFA 2R7QA 1TWAJ 2L9SA 2A1SA 1C0WA 1TK5A 3KZZA 3G6EI 1ZSGA 1TP4A 2EKHA 4FJXA 1D9DA 3CESA 4EJWA 2LDUA 3VYUB 4KIFA 4KHWA 1VAZA 3ZMUA 1BO5O 4PSWA 3EFOA 3VERA 5EEHA 2FRYA 2HQRA 3LPTA 3LWFA 4AILC 3DEEA 4Y17A 3TTDA 3BZCA 4RGRA 2CQXA 1YJWI 3G0ZA 4KTWA 3OYKA 2P5LC 4AHUA 5AQVA 2QDYB 1MBFA 4CSWA 4FWKA 5A0LA 2L5QA 3GDQA 4J00A 3CP8A 3DCFA 1HNZK 1P59A 4XORA 2LF7A 3TAEA 1FNNA 1KQ0A 2OTJI 8AT1B 3ABTA 1QQMA 1BC8C 3THYB 2PJRA 3BC8A 1VQPQ 1X1CA 5FKNA 1QZEA 3QYEA 3B6OA 4CJTA 4E9EA 3A8MB 3LSTA 1W0TA 2CZ1B 4FE4A 1XMOK 3ATVA 1M27C 4XKWA 2H8HA 2EYQA 2KZMA 4B21A 1T08B 1O7FA 2R5YA 4FYYB 1Q9XA 3EH2A 3I55Q 2ESNA 1I0CA 5LFAA 4BVPA 1SVMA 3PJRA 2E2QA 5F27A 5JHFA 4C2TA 4CHNA 2HTSA 3H3ZA 3I59B 2ECCA 1NGDA 1JLEA 4XRMA 4ANJA 3KKSA 2DQLA 2UUAK 1WJAA 3BE3A 2DM1A 1F4KA 4BU2A 4OP0A 1RUNA 4WQ5C 4AG1C 2BY3A 1UZCA 3HJFA 2WWYA 3CCMT 3ZX0A 4MFBA 3K0SA 3HL8A 3CC7Q 1TW3A 3I9QA 4CFAA 2O8BA 4HT9A 3WQTA 4IOCF 1NK8A 3PVLA 4IIOA 1W7PA 2VXZA 2H6CA 4KHSA 9ATCB 2HHUA 1KG4A 3GG4A 1LFPA 4WQ4C 1A0NB 5CKHA 2E1ZA 4W5OA 2LKXA 4BR2A 2I10A 1T98A 3HXLA 3CPWA 2QTDA 5GANf 1RRJA 4XTWA 4CVNE 3LDPA 4N56A 2BV6A 2JN0A 2HBJA 3A02A 3TO6A 3EETA 4M71A 1RL2A 4QQ6A 3P9IA 1VQLQ 1YJ9I 2NRRA 3SWNA 4CI0C 2ZFWA 2P5OA 2DLLA 1XUPO 5HK0A 1T95A 3EFOB 3J81E 5J3BA 2JGUA 1S1XA 1FXXA 5J1UA 3CCUT 2KMUA 4GCVA 4CIGA 1RKWA 1W97L 2P7CB 1KHIA 3NQOA 5GTHC 2HOEA 4M7DD 4F91B 2Z9OA 2A6HF 4A5AA 1U6GA 4LLGF 1UJYA 4IXCA 2QLZA 3O2PE 4DNCA 5KH6A 4AI4A 4UUSB 1AA7A 3IC7A 3HEFA 1MD0A 2E1MB 2QQBA 3ZQLA 4RB3C 5CZ1A 4YHHK 2DYSH 4YFKF 3ZQ7A 4I76A 3VF4A 3RJPA 5KCMA 3IQLA 4BY9C 4DV5K 3GTOJ 1VQKA 4H4KC 2V75A 2DT5A 1XSDA 5F1XA 2V51B 3IRXA 4C8KA 2L89A 2M0YA 3ZX3A 1U1SA 2DRMA 2DY4A 1LUJB 2JS0A 5AQYA 4ENNA 2D0BA 1USSA 4HNVA 3TL4X 1OYXA 2VI6A 2QA4T 4XLHA 1RTIA 3NAUA 4OMQA 2ROLA 3JB9H 3JB9D 3HK2A 1O3RA 3ASMA 4FISA 3BG7A 2G7HA 5M5YJ 3TDZC 3HTRA 2JZ2A 5AFUH 5E41A 3GVAA 3OS1A 1F9NA 1DPRA 3HRTA 4B1XB 2DU9A 1S3XA 3FMRA 5LL6S 4JX4A 2I5JA 2E1CA 3TQNA 2ACJA 3WUHA 2ED0A 3TSUA 3EYIA 1HNWK 1BIZA 2PVOB 4M75B 3M8SA 2KFZA 3AFHA 3URGA 3ASKA 3N5BB 3M0TA 3CCYA 2QM1A 2F5CA 2NOIA 4E0DA 2KKOA 3FKIJ 4OFAA 2Y4XA 1KQSS 4XQFA 5HODA 3FBNB 3VUZA 4F7UA 2CH0A 4PKCC 2E35A 4YOWA 4CD1A 1G2HA 1PP8F 2IT0A 1AD5A 3WNFA 2PQ8A 4KUMA 3I0RA 2CS3A 2STWA 2Y0MA 2R58A 2H3GX 5C4XJ 3QSUA 4DSLA 1ZBFA 4XNFA 4NS5A 4CJEA 3H35A 3G1LA 2E70A 1W2BM 3S32A 1JTYA 4IX7A 5FPMA 4M3RA 1TW2A 2P1JA 2OYQA 2F2VA 2M3AA 1X19A 5LJ3d 4JHDA 3CCQQ 3CP2A 2FVUA 1W9HA 3I56Q 4CK1A 1GXQA 4EEFG 3WTUC 4XTVA 3HOYJ 1WH7A 3DFGA 4PJOA 3EYYA 4MIMA 3TSQA 5JVGL 1D8YA 4UNFA 1KG6A 1NLOC 2P0WA 1GVDA 2PI0A 2Y75A 3WEEA 2E2IJ 5GAOn 4Y13A 2XDBA 1T6CA 4BHCA 1DQUA 3FDRA 1J9IA 2JHJA 4B1ZA 1C0FA 3WTXC 3OJUA 1Q95G 1WQ2A 1K4TA 3I55T 2R7ZJ 3OS5A 4X66K 4IOAL 3DF8A 4HSTA 2VIXA 2NS7A 4QOZB 2EFIA 2PMHA 1F5TA 4II2A 4IZZA 2FMLA 5LJ5g 2M34A 3X25B 1L3VA 2PN6A 2X4HA 5F1RA 1NBWA 2E1OA 1ZELA 2XC7A 1IKWA 5GAN6 1JJ2P 1FTTA 3IV5A 1VRTA 2GBZA 5F0FA 1B72A 4J9DA 4A2AA 1JHHA 2PMUA 2WAQA 2MC3A 1SEMA 1OH8A 5CQYA 4O5FA 3CF5L 3G1OA 2MW8A 4M6XA 1UB4A 3JRCA 2EIFA 4JNEA 1P2FA 3LZIA 1B9FA 1E4FT 4H5VA 5IP6A 1TAUA 2W48A 2OF7A 3GZNB 1D1AA 1SPKA 3H0FA 2XAGA 1LMZA 1D8KA 3MEVA 1NM1A 2H1KA 4IZ9A 3VTIA 2M16A 3JRZA 3Q5FA 3F8CA 1ZRDA 5GANh 2DL3A 1QVGA 3RCOA 4HHTA 5J26A 1U06A 2O9LA 2V1RA 3I56A 5ILSA 3RMCA 2CP2A 2R5AA 3D0PA 3QYFA 1E3PA 3MN7A 1KD1O 2AKLA 2FBIA 3CMEQ 3D2EB 2ZXIA 3G71N 1MJBA 4E7IA 1G83A 1YFHA 4JKGB 3NH2A 2J5OA 2MBFA 1I6HJ 1BA1A 4A57A 3KK1A 1RPWA 2EYZA 2EFWA 1C1BA 3QOPA 4YRVA 1MNMC 1YJ9A 2MPXC 3SUPA 4CYCB 1PU6A 1VQ8A 4F7UB 1UJ8A 1IKYA 2D0QB 1FMWA 2K9GA 3LLRA 3WG7H 5IHKA 2W82A 4PIIA 5FWCA 3AG4H 4M9SA 4L8RB 3RQIA 3RR7A 2E41A 3U9ZA 2OFIA 1U49A 5GAGP 2D5RA 2RQWA 2HEOA 1RADB 1P4XA 2DL8A 2EFQA 2HZDA 4ENMA 1L3TA 4M77D 4OMNA 2K79A 2P9SA 1NZ9A 3T3FA 2F4IA 3DLLF 1ZUYA 3L2CA 2OTLN 2G6FX 2HAXA 4ID5A 1SG5A 4KTZA 4QQDA 1SHGA 2D8JA 5EZHA 2E1NA 2DTIA 9ANTA 4B1UB 4LF5K 4BVOA 2F5EA 2HOAA 3ZEHA 1NMNA 2BEOA 3TEDA 3NE6A 1U8RA 2DOFA 2ZCWA 5KTQA 4M73A 2QA4N 3ZCOA 3GEZA 2DVJA 3KZBA 3C18A 3F8MA 4RB1A 2LLKA 1TS9A 1WUAA 1CKBA 3ZT3A 3R6NA 1K73O 4AVPA 2YRCA 5I2SA 5E1XA 3I35A 4TV7A 2PJPA 3KVGA 2AZSA 3I5RA 5BS6A 3SV3A 4PKHA 5CVRA 1G3WA 1MU2A 2GXGA 2LC4A 1EH6A 1L3LA 1HKTA 2V79A 3JYTA 4IBNA 2IA0A 4AU7A 2XDVA 2B8AA 1VQON 1OX9A 4KBOA 3S14J 3IHOA 2AA4A 1NH3A 1SANA 2HZTA 3V9SA 2F8TA 1R4NB 5LRRA 1WN7A 3HSFA 4C8MA 4M77G 3E97A 1HPZA 5M1KA 1BUPA 1BM9A 1V4SA 3EN9A 4FOEA 3P39A 4RB0A 3T1BA 1GCQC 1AT1B 1S1TA 4LDUA 2IC3A 3ZSVA 1JUPA 4YOVA 2DJNA 2PBDA 3BLYA 3IWZA 2KRCA 1WGSA 3EGXA 4B9UA 1DGRM 1VYTA 1OH6A 3MZHA 1OR7C 3G71T 3CETA 3WVDB 3EGDA 2H27A 2E64A 4JZ3A 4KT5C 2BVMA 2FYKA 1FYLA 2DCEA 5KYNA 3ZMSA 4DQRA 4YFXF 4LD0A 3SBTA 1WX6A 3AKZA 3UF4A 4D9JA 3J7AY 3LW5E 2OV7A 2E60A 2CUEA 4FL6A 1M3BA 4BY7J 3RSNA 4HRIA 1MH3A 2C0OA 2NNYA 4IXAA 2CUDA 3BGRA 3RNJA 3N97A 2DOEA 4L18B 3DLEA 4X34A 1DGWY 4HCZA 5KYUB 1SFEA 1IW7F 2QENA 2CV0A 4FHTA 1IXCA 1WB9A 5C0YA 1SAXA 4A5NA 1K0SA 2YUOA 1Y6IA 1PSEA 1W70A 4C2MJ 1QVFM 4BQOA 1AZEA 3RRGA 4ELUA 3HKZA 2L9NA 3KIOA 4HXJA 4LY7A 4L0YB 4BACA 2ITGA 2CH4A 1Q81O 2O7OA 2CGPA 1JBMA 2OD5A 1DGKN 3A03A 1JGSA 3E1SA 1SVLA 2WBMA 3DTIA 2E5LK 2F8SA 3CC4I 3VF2A 3M4OJ 2BY2A 2YG9A 4HVVA 4Z0UA 1U2WA 3E9GA 1MWKA 3CMAQ 4FJGA 2RHZA 2YR2A 3NWSA 4A5BA 4NHJA 3M8EA 1TKDA 3WHBA 3QB0A 4FJIA 2O9SA 2J6OA 1QE1A 2EQIA 1NG7A 4RW4A 2P6TA 2AS5F 1S7AA 1X2QA 2L0KA 1HYOA 1UFFA 3A8YA 2VPRA 2EQRA 3PT9A 1G3SA 2LCCA 3LALA 1VQNT 4KV8A 2GAUA 1ZRFA 2DI3A 3KE2A 3U8XA 3VS3A 1EETA 2VBZA 3BY5A 1O3QA 4LJZF 2JN6A 1DP7P 3QKJA 3BZ6A 1HU0A 2KRNA 3FM5A 2O8CB 2SRCA 5D3GA 2P4RA 4EJUA 4BRKA 4U0WA 2L3RA 1ITGA 3DKXA 3HM5A 1ABQA 5FLVA 2EIKH 3I71A 1B92A 4N47A 2G8UA 2EVRA 2DDBA 5EVZA 2FOWA 5IOZA 2VKHA 3NGZA 1Q81R 3NH1A 3JCMe 1LWCA 2LOOA 3UPUA 3LDSA 2AHQA 2O8FB 1YJNA 1KU2A 2YX4A 1PJRA 5LLQA 1JUMA 3NGYA 4H5TA 3W3DA 4LG0B 3RTRA 4XU1A 4DUZK 1ZBJA 3FLCO 2H56A 3CC4A 5AQUA 3DOKA 1ZX6A 2JWKA 2JPBA 2HTJA 2QWOA 5TKYA 3S6IA 2W6KA 2VXFA 2ZGWA 2HXOA 3H1CA 5KN8A 1Q81C 4N5SA 1UCRA 2YI1A 3AVHA 5GAMf 1O1WA 2Y48A 1ZBLA 4XAXB 1S9EA 1G5VA 2F4MB 3M0RA 3CFPA 3E3VA 2F4OB 3BG3A 4M78F 2W41A 2KNBB 1ON2A 3EDPA 3OYGA 2HNIA 1KC8O 4A4HA 1TZLA 3H0DA 2EGAA 2IS1A 1VYUA 3EL2A 1IKVA 2ELJA 3V9ZA 1KTQA 1QVGM 4I7HA 1D4XA 4CJQA 4XSZF 4BRIA 3GMEA 2QA4Q 3UIQA 4C3HJ 3LWHA 2LG4A 2KDOA 2ZB9A 3NFCA 3JCMJ 3O8HA 3SQ1A 4R0KA 1T05A 5HDKA 1EF4A 3L2RA 1VIFA 4CCJA 2R4GA 3Q9VA 3D6RA 2HU9A 3ASOH 4D1QA 2JT4A 3CCRI 1OVQA 3M6GA 2Z33A 3HM8A 4YOUA 2QM3A 3LWLA 2HQ5A 1I3QJ 1RAIB 2YU9J 1R6RA 2DJZA 1TOVA 2W40A 4I6ZA 1TK8A 4Z4CA 4M3FA 4G8XA 4UVAA 1BJAA 4YIRX 5J4VA 3HTUA 2JWLA 3ZSYA 5LJWA 2OAZA 4UQGA 4CJUA 1EH8A 1KHCA 1QCFA 1ZGAA 1RT2A 4CC4B 3LDQA 2QA4A 1BDGA 1WAJA 4NB4A 1J75A 4M7DF 4FXDA 4M7DG 2FQ3A 4Z94A 3G25A 2PAVA 1PP7U 4IF4A 2O8XA 3GCMA 2DXTA 3PMTA 3SXYA 1PU7A 3CCUQ 1WVRA 3CDHA 1VQNN 1M1FA 4WQ4A 3A2KA 1RUOA 3EQLF 3HT3A 2LDMA 4JEPA 4MQ9F 2X74A 3VQDA 1M3QA 1FT9A 2RQPA 1B07A 3PX6A 1HSJA 3ASNH 3ELKA 2XAHA 2MCNA 3WE2A 1RR8C 4JX5A 5CR4A 4FW2A 1K8AC 2K3PA 2EWSA 3SZTA 1NKUA 2VXDA 4HAMA 4H0PA 4G6QA 4IQ4A 2DBBA 3THWB 3LYIA 2RQRA 4DV4K 4AF1A 1ZBUA 3W3CA 4RB2C 4ESRA 4F3TA 3NEUA 4AFQC 4B8AB 4MO5A 1IC8A 4J2AA 2ABKA 2GM4A 2NVTJ 4JI5K 2MABA 5BN8A 2N8GA 3HHTB 4EMSA 3KP2A 4C8NA 1R0AA 3EY1A 3LP1A 1PKTA 1IN8A 4ESBA 3J81K 3WGGA 1X3NA 3FK7A 4MZTA 3N4QA 1SRMA 5IYCJ 3E5UA 1QP3A 4M7AA 1N5YA 3M56A 5TJJA 1N9RA 1SKUB 3W6VA 1R5HA 2CV2A 3SZPA 2OC6A 4PJOC 2MA3A 2OQRA 4CHYA 2FBXA 1HNVA 4O8KA 1KJWA 5IT9O 2LK2A 1B9MA 4CXFA 3CCQN 1BIAA 2FSJA 4V2FA 1TT5B 3TO9A 1NJXA 4PLIA 4U0VA 5M9OA 3OS0A 1UFMA 2WB1A 2LP0A 1XDSA 3JW4A 4JJDA 2CSOA 1M1KO 4CJSA 2HDCA 2CGHA 1TQMA 5FKMA 4XSXF 3JCMd 5DMRA 4PHTX 4V2GA 2XG8D 4R56A 2GQVA 3REAB 1KC8R 1PWTA 1VQ7A 3CC7A 2YHYA 3CO7C 3TAMA 1FY7A 4DCHA 1DKGD 3JSPA 2LP5A 1WZ2A 1Y96B 1QVFS 5BPIA 2X85A 3VEZA 3VGKA 4JJNK 3CXCM 1KG1A 2DAOA 4BJ5C 4WE1A 1VQMT 1U78A 2CGKA 3S15J 2XKOC 1KXPA 2EIMH 2SEMA 1XS9A 1RAFB 3J80E 1X27A 3CC2Q 4DU4A 4P55A 2A5YB 2DK3A 1G8XA 5E18F 2P5GA 1ZKGA 2KQRA 4ILHA 4EJZA 3KYLA 2F48A 1I94K 1EWQA 4FU6A 4JP0A 4D8KA 4KRFA 1YNZA 4R55A 5LJ5e 3M0SA 3CLOA 2YCHA 1ASVA 5GAN7 1VK0A 1H88C 1XTDA 4XKVA 2VBWA 3ZSOA 3MAQA 3CWTA 1BOBA 3MWTA 1KU9A 3B6PA 3OYNA 3H3VK 3ZRGA 2ASOA 3G4SA 2HQHA 2RHYA 2Q1NA 2JVVA 1QRYA 2KIFA 2HHTA 3KETA 1ZH5A 1KYWA 1T0JA 2OTJT 2M02A 3WXJA 3RDVA 1ETYA 2L4AA 4Z4GA 3FXMA 1IHVA 1VQ8I 4EA5A 2JUGA 4LD9K 2X0LA 1ULYA 3EUAA 2ECZA 2HNZA 4KH6A 1FX7A 4J5YA 3BTJA 1XC5A 3BDDA 4AIHA 2OTLI 1YJWQ 2LRDA 3OH6A 4RGXA 3UKRB 4B1RA 2QW9A 4PCQA 2YKNA 1KO9A 3DI6A 2HQEA 2DTOA 2PMZA 3G6ET 1UEBA 1W2BS 3TSZA 3FF5A 2LQNA 1R1UA 2JHNA 1XQOA 1E3OC 1W6XA 3ZP5A 2XROA 4NCBA 2M51A 3RRHA 2XIGA 4Z02A 4XU0A 4DTPA 1WJEA 5DY9A 4NOYA 3NMZC 2K85A 5FO5A 2GX9A 5LMNK 3ZT2A 5IWAK 1O57A 2HF4A 1ZUKA 1VNDA 4PFZA 2WTEA 1AU7A 2VJJA 2H09A 4YDUA 4M78B 4IDHA 3MXIA 5LL6Z 1Z3YA 2UXBK 2DMQA 3E6DA 1YQLA 4RMOA 2PEXA 3DXKA 3VPRA 2E19A 5J3LA 1Y0MA 2JA7J 3WE3A 5DDGA 3QESA 4CCOA 4HWIA 3TARA 3F3XA 1XGNA 2EV5A 4N76A 1TXQA 1FOYA 1WJRA 4BDZA 2DL7A 1ZTRA 1QSYA 3LFKA 4B09A 1VQNA 3K57A 4HG2A 2W10A 2UUZA 3WXIA 1WEFA 2JMWA 3JCMc 3CJRB 4H03B 2NOJB 3PIPF 3BFMA 3DLGA 4EA4A 3A8OB 3BWGA 2MK5A 3DLRA 1KA8A 4YTLA 4M77E 2M1HA 1P9QC 1BIBA 3IWFA 2XMFA 1PVSA 2KZVA 1SV5A 1ETXA 4JDSA 3WTVC 4LIUA 4IO8A 2NS0A 1SFOJ 1RUWA 4W5NA 2F7TA 1N3AA 1I4K1 4CHUA 2X78A 2W6LA 4B9VA 4LSNA 3SFMA 3FM3A 4NL2A 2KHMA 1W7AA 1O3SA 2VC1A 2YHAA 1H9GA 3FZFA 1R22A 1O13A 1R23A 2IA1A 3HTSB 2RF2A 1NJIC 1SUQA 3HFNA 2EZKA 2LVSA 2X1EA 4FT8A 3R3LA 4FQGA 3SYTA 4BRAA 2M30A 4QPOA 3BF3A 5J8FA 3F72A 3HJEA 3CC7I 1RDBA 4DQPA 3L2ZA 2MLGA 8ATCB 1LW2A 4BROA 4FJ5A 2E36A 1EX4A 1YI2A 1HKBA 3S16J 5D5WB 1K1ZA 5D6YA 3CCQA 1FK9A 4CC7A 5M1QA 4DBHA 4HDUA 4AHRA 2DDAA 2L3QA 2Z1GA 1Q7YC 4DYCA 3K70C 1NPPA 2P0QA 1XSXA 1RTHA 5GAOr 1WH5A 2CUJA 4P1WA 5LJ3g 1G99A 1RLPC 5AQIA 1WSGA 2AXTC 3TDUC 3CCEQ 2IPQX 1YOVB 4BWJA 1VI0A 2Z5UA 3ZMTA 5IXFA 1WHKA 4A2UA 2XY7A 4MEXF 2JJ7A 3RPUA 4L9NA 1IJWC 4PQUA 3C6AA 1IGUA 1D5AA 3A5OC 1IZ1A 1EBMA 3OSGA 2JZYA 1Q7YR 4IHVA 3SNNA 4FSXA 2XICA 3K70D 1ZG3A 3G73A 4B24A 3V1QA 4LDXA 2V1XA 2JMCA 2I2LA 1XQSC 2DMUA 3RI4A 1NNEA 1WOQA 3JRHA 1HUXA 5GP9A 1BA5A 3I59A 2CYYA 1NJWA 2OTLA 3A5LC 3O8GA 4LMYA 4B4CA 3OH9A 3H9JA 4L9VA 3VS7A 4RTZA 4A3IJ 4FLTA 2CH5A 4N41A 3LM9A 1XCVA 2VGMA 2O8EB 2F2EA 4MLOA 3CQTA 3Q1JA 5CYVA 3Q3SA 1FN7A 3J7AF 1HR0K 1YUWA 1GLEG 1KONA 4CZEA 3ZGKA 1BW5A 2VKEA 4ZDLA 2B9SA 3LDNA 1WHUA 4AC0A 2XPUA 3JV3A 4M3GA 1K8AO 1D0ZA 3R0AA 1X4PA 2A68F 4JKHA 2Y1IA 4DU1A 2EWNA 2H94A 4TVRA 1P92A 1PSFA 4YIFA 1VQKI 4EQQA 5ERIA 3PFSA 1WBBA 4DG1A 3P9KA 4BE2A 4PJNA 3NBPA 1NGCA 1VQPT 1PUFB 4ZHRA 3CTAA 3FWEA 3CMYA 5ADXH 3HB9A 2VPLA 3PNWC 2DXCA 3THVA 1UGVA 3ZQFA 1RAAB 2RA2A 2RAEA 1YS7A 2DBKA 4CZGA 1JE8A 2YHBA 4A3GJ 3REBB 1Z25A 1JHFA 3AG3H 2DYIA 1YTAA 2IGOA 3HL2A 2V9PA 4MZPA 3C6HA 4F7UE 3EZ5A 1XNIA 1W4SA 1WPKA 4Q5SF 2CG4A 3OBYA 4DYQA 4Q5VA 3CCUN 2VUBA 1SSHA 4YNQA 1RBVA 1NBEB 2AKKA 2MD5A 5HS7A 2HFHA 2X9DA 2B63J 3DMJA 4CJPA 2PX9A 1XSVA 2R7FA 4LF8K 5JFRA 4CW7B 1LNWA 2AT1B 5KVRA 2WTUA 3K4KA 2Y9YA 3DXKB 3LA7A 1TYQB 4E3SA 3C6TA 2L3SA 2O8DA 5EGOA 4FLVA 3KZIC 3CFRA 5AQTA 2BVLA 4M41A 4DTSA 3KK7A 3I54A 1A5JA 5D7UA 2NRAC 3C1DA 5BPLA 4QVDA 2KGTA 4LH5A 2ZFUA 3RYRA 4RAZA 4JK9A 3OSVA 3V4GA 2FG0A 2J5PA 1O4XA 1P6RA 3CCSA 1M90U 2NOEA 2QSFX 3M7GA 2D45A 4UOBA 1OZ2A 1RAEB 4L5GA 5BNGA 4DFMA 2QDLA 5EDNA 5AQMA 1LPQA 1IUFA 1OLTA 3ALYA 2ISYA 2DX1A 3O08A 3BY6A 3DKYA 1HDDC 1WCMJ 3QYGB 1AWCA 5CCAA 4B9XA 3TANA 1JLGA 3NHGA 3TSWA 2CW8A 3BR5A 4KULA 1NEGA 4B48A 2FNAA 4JKGA 4RTXA 4B3SK 4JPBW 1TL8A 1XD7A 3A0IX 4XM3A 1VQ6A 1OEBA 3M9QA 4CK3A 1QU3A 1VQOI 3G1JA 3ABMH 1D8JA 2RKIA 4HUEA 1X01A 3A01A 5CPRB 5BQTA 5J1RA 2E5KA 2V6EA 4CBXA 1F1ZA 5AZJA 2K02A 4EGYA 4RWTA 2BZYA 4M7AD 4G94A 4B8XA 4Y1DA 1M1KU 3MX2A 3I56I 1FIAA 2EPFA 3T8RA 2MH2A 3AA5X 2E88A 4OIRF 3I5SA 3FR0A 1OCTC 4CZIA 2EQJA 1WQWA 2ZPGB 3LSPA 1Z7LA 3CXCA 1WWXA 4JZ4A 4ZGJB 4QS9A 1QSSA 2M0OA 2K27A 3S1NJ 2NS8A 5AQLA 3OR2C 2L3DA 4GVMA 3QPLA 4NC8A 4L5IA 4B9LA 1OCZH 1G2BA 2HEQA 3LSGA 1LWVA 1Y1VJ 3I56N 3V4IA 3K10A 2ZPEB 3Q7CA 2I7NA 2DFUA 4BAYA 1N39A 1PNJA 5L8RE 1YX5A 3LWIA 3JB9I 4FK4A 4C92D 4XBFA 5KYYB 2CFOA 2FRHA 2VQFK 1G3YA 2KL4A 4C0DB 1I5ZA 2YDLA 2XAUA 2FLOA 4DV6K 4I98B 3X24B 5DD8A 1YAGA 4BRQA 2CW7A 2DKGA 1TG0A 4M7DC 4PKIA 4XLEA 5EGOB 4E6RA 2NVQJ 1B6AA 3OR1C 3JRGA 2VE9A 4OLAA 3KP5A 4N9HA 1BGXT 3HOTA 1I81A 2F5VA 2FZKB 1VRUA 2Y9ZA 4OGEA 1UOCA 3HXMA 3B6CA 2P9UA 1B59A 4C5EA 4DR3K 1NGJA 3A8GB 4JHDB 1ARKA 1LEBA 2QKBA 2VN2A 5GIOA 3CMEI 4ATOA 1RI9A 1L3UA 4JLGA 1QCOA 2CH6A 3V81A 3LPUA 3HYFA 4U87A 2CUBA 3T5XA 4LXCA 3RZOJ 2LKPA 3HPHA 4FJJA 2MLKA 3LSHA 4LB6B 2W03A 4AMCA 1WSJA 3A01B 3EG1A 4JN4A 4UVBA 4IRIA 5T7BA 1QWEA 2XU8A 3EPZA 1ZSZC 5JS1A 3FX3A 3MAJA 2XPWA 2DIGA 3R6MA 4PUSA 3EFSA 2EZHA 5AQJA 2DA5A 2FF3B 2H3JA 3ZSWA 1IRXA 3EGXB 3QO3A 1XMKA 4X1VA 4C0ZA 1ZYQA 3PO4A 3G4ST 1LQ1A 4JRPA 2DPPB 4GV3A 3V7RA 4BRFA 3VGLA 2DEUA 4DW6A 2DBMA 2IS6A 1JTXA 1A5VA 4R8HA 2XKOA 1T39A 1TUDA 4OU0A 1PD1A 2XHBA 4A6DA 3H0HA 3EE9A 4OIPF 1YITN 2WSEE 1NK0A 3FEOA 3WTTC 2BANA 2L01A 3BCAA 2E2PA 1FW6A 4HOBA 5DUIA 3LNQA 1JCGA 2XDDA 2ZJPL 2WAQN 1MBHA 2CWEA 1K73C 2Q0UA 5FPDA 3OWTA 7AT1B 1WXTA 5EOYA 3WQUA 2EYYA 3HFOA 2IIMA 1U45A 5IYDJ 4FLUA 4MQ3A 1NTCA 3QWYA 2O5RA 1WHLA 4EDUA 1J59A 1EH7A 3F5TA 4IO9L 4LF4K 4PKGA 2F6CA 1GDTA 2ZNZA 3DPLC 1H8AC 3KXTA 1QQIA 4F7UG 4K41A 2O8KA 1T6SA 4NLBA 2A69F 1ETVA 4M75G 2RREA 3VMFB 2X6YA 1YJNI 4OMPA 4K2EA 3TAPA 2VWFA 4KH0B 1LB2A 2WAEA 4RGUA 2IVNA 3JAME 4CHZA 1PD0A 1MKMA 3EG2A 1IG9A 1P4WA 2QYZA 2W4SA 5KQDA 3K6GA 5M1FA 4DTJA 3M8JA 1MBKA 2DE0X 5IT9K 2VBXA 3O4WA 4RAFA 2HHXA 1RBSA 5I9EB 1RT6A 2MWOA 2DTRA 1CXUA 2NOGA 4CEBA 5HBMA 2P0KA 2ME0A 3SHFA 1N34K 1VQ9T 1MNDA 1W1FA 3BJ6A 2WFBA 5FW9A 4LIVA 3ZLJA 4J9FA 3VRYA 3RKXA 5M1NA 3D1NI 1SEUA 3K5LA 3G71Q 3CMEN 4F7UF 1ZSZB 4YOXA 2KDZA 2DTHA 1KSWA 3H5NA 5KNLA 1LE8B 1JT0A 2R5MA 3L2QA 3O9RA 1X6BA 2WADA 3KK2A 5GADJ 2FSKA 4WYBA 2L4MA 4E7KA 5AQOA 1MH4A 3BR0A 1JKQC 5IP7J 1HKCA 1WSFA 5J1YA 1MA9B 3HOVJ 1QPIA 2O01E 5BN9A 3C0CA 5FGMA 1HBXG 2QQRA 5GJVB 4CFCA 4C9YA 3M3YJ 1VZ0A 1CF7B 1T0FC 5HS9A 1FTZA 5FJ8J 3CQXA 5GANj 4ZNXA 4LH4A 2E34A 4DQQA 5C2FA 1MBJA 2JQ7A 1S1VA 2HWVA 4ENJA 3R2XC 5GMKj 2HXIA 1XQHA 4Y0WA 2XKPA 3GLXA 3EG9A 2ZZDA 4ZYGA 3AVLA 3KLIA 1QCNA 1PKSA 5D5UB 1YHQI 2RI3A 5HRNA 1U48A 5KYUA 5BPDA 4ZGEB 3HUGA 3KYCB 3BQYA 2NVXJ 4F3OA 1UGQB 1FBQA 4NUBA 1BI4A 1WLJA 3ENHA 4B3TK 4CIFA 5CVIA 1L3SA 2RNAA 2JNGA 3BPVA 2YJEA 2Z1DA 1FMKA 4KIGA 4KITB 4XK8E 1U5TB 1YITI 3DBLB 1X1BA 3CM6A 3FXLA 2YLCA 5AT1B 3B8AX 5A2QO 4F92B 2IG0A 4J7FA 2E6LA 3CEYA 3OIQA 2LX7A 4KB0A 4MNUA 3A4CA 4L59A 4DBFA 4J2EA 5EYRA 2QKMB 4WXHA 3HSEA 3QFUA 1X9SA 3BY7A 2P4TA 2KQWA 3ENOA 1VQ4T 1SMTA 4WTOB 4JYKA 2RF0A 1UECA 3FJ5A 5EEAA 3CCVA 2AJQA 3IP4B 2XUBA 4J9BA 3F21A 3V1OA 4GGGA 1A31A 4A61A 4BR9A 1Y57A 4FYVB 3ZSXA 2LBFA 1JJ2M 3JAMZ 3NNQA 1YJNN 3GL1A 2QWPA 4UC4A 4BDPA 4C5IA 1NWKA 4ISGA 3GX4X 1JUSA 4RW9A 5FD6A 5BOXA 1EA3A 1QVUA 4KHNA 4BQQA 3CCEI 2X9HA 4EJVA 3L09A 1JL2A 1VSEA 4BUGA 3U3GA 1A5WA 3GFMA 1ASUA 1P7MA 3DLHA 4QCLA 1WSHA 1Q82R 3GTPJ 3TO7A 4UHTA 2RHUA 2QWNA 4LF7K 5IP9J 4HUGA 1YI2I 3CCVQ 2YNHA 2RO0A 2LX9A 1L5UA 1Y56A 2YG8A 4EW0A 1Z3XA 4J8OA 3O6BB 1TSFA 1K9MR 4AFUC 2GWKA 3H3UA 5FU6B 1UGRB 2GWRA 1YW7A 2X1CA 3DPTA 2A3ZA 4AYBN 4FYXB 1UHFA 3Q0WA 1S72T 2M8EA 1R00A 2IPOB 1A6QA 1EQYA 3H5AA 3GZ5A 3QINA 3HOZJ 4ZYDA 3HBLA 2KSSA 4JK8A 1JXMA 4NXNK 3SJMA 1I07A 3VA0A 4XMYA 2DPDA 4ELZC 2JA8J 2OPQA 1OR7A 1VQ5A 1K4US 1IN4A 5HRPA 4MLEA 2DJIA 3V8KA 2CREA 2DXIA 1S1NA 3DKMA 5FKOA 1HKSA 2ELHA 1H8KA 4O0JA 1GCQA 3ER0A 3HZJA 1RT4A 1TKZA 1XN7A 4QIWN 3GFIA 4M7AF 1H3ZA 1VQ9N 1F21A 2BY1A 1BK2A 1BW6A 2KXDA 1MPGA 2HDAA 4OMOA 1BB9A 3THXB 1REVA 2VT2A 5LJ3h 1BR2A 2DFIA 2H3EB 3WTZA 5L3DA 1U1TA 4Y92A 2STTA 2DFEA 3T9NA 1BISA 1XB4A 4Z4EA 4AM7A 2IGMA 4G7OF 3NTHA 1YTUA 1QSLA 4A5MA 3I0SA 2V9KA 2VKNA 4HT8A 5KGXA 1AWWA 2YLBA 3TAQA 5C10A 4FJ7A 2YSRA 4F93B 3I58A 4CRIA 2EKOA 2VC8A 1A35A 4RAYA 1PHTA 3N4PA 3R1XA 2E5QA 1TVRA 1QQOA 2EQMA 1R5GA 3SDGA 3V7CA 5IT9Z 4CECA 2IXSA 2LFBA 4E9HA 4BD3A 5LGUA 1YIJI 3QWLA 4BKXA 3HOXJ 3W2VA 4BGDA 3CI5A 1RGIA 5D4RA 2VQEK 1IZ6A 4XONA 3QHSA 3O3HA 3CD6N 1YRNB 1D9FA 1U5TC 4JI1K 4B9QA 3HUGB 2OPTA 1YHQT 4FWMA 3OHRA 2BZTA 3L7WA 5B1AH 2OU2A 1YHQA 4UXNA 2ZNYA 3U1DA 5IAYA 1X3MA 3I4MJ 5GAEP 1SKSA 3MWPA 4BRNA 2A1RA 1KC8U 2K2MA 5FFXA 4ETSA 4HKEA 3FHNA 4G1QA 4RAGA 3KWIA 3U9DA 2ZM6K 3THKA 1LWEA 4JD2A 2EV0A 2ZJQF 2K5FA 2KAFA 1ASWA 1LAVA 5GANg 5E20A 4BRGA 1SD6A 4IFYA 3K4MA 2Y1JA 4JKCA 2EB7A 3LGFA 4M7YA 4N0BA 4B8CA 4JK7A 1TWHJ 5JHUA 5GANd 2BY0A 2HPMA 3OMGA 2IW5A 3KPHA 3DP7A 3DLKA 5HLFA 4I02A 4NZGA 3Q0UA 3KZYA 5GAN5 2RQQA 4XTYA 2XRLA 5IN1A 1CGPA 4CE9A 2O3FA 5D8LB 1GLJO 2G3RA 4BREA 5M3FJ 1GLDG 5H6QA 4ABZA 4ZTJA 3VW4A 3RR8A 3V8JA 1K9MO 3AO2A 3BJOA 4FJ9A 3ZR8X 2LCLA 4WCIA 2E20A 3CO6C 1OKJA 1Q7YO 4DSKA 3CUOA 3H8ZA 3MN9A 4GNIA 1XQPA 3ZSZA 4CZCA 2G9WA 1LAWA 2PZSA 1TTYA 4PGGA 4YOTA 4ESJA 1S72Q 1B34B 1RDDA 4DLEA 4PJOF 2BE2A 2KXCA 2QKLB 4QKUA 4M75C 4GV6A 2VKVA 1TK0A 3VS4A 3KLGA 3SMPA 3MCZA 2BW3A 2DYRH 1ETKA 5HP1A 2Q1ZB 3HPGA 4A4FA 3WXLA 2B7EA 1GXPA 5CE3A 3LP0A 3EFRA 2DETA 1BQMA 3O9UA 2F5KA 4C8QE 5BR8K 2ZGZA 2BBYA 2ASPA 1X43A 3K0LA 1RT5A 2GA1A 4H5NA 5JLHA 2JM9A 2EQUA 3BPXA 5GAMe 3RYPA 4FWLA 3SAGA 4CHPA 2Q0OA 4WWCA 1SSFA 4B9SA 1PM3A 2ZO4A 1VQMN 1KG2A 1XNQK 3C65A 4CF0A 5AQQA 2MAMA 3JCMg 4I0BA 2YHTA 2HDWA 1HK9A 3TWHA 3TW6A 2CQQA 1OYIA 1SKWA 1CZ9A 4NNJA 5E3OA 4AHTA 4DR6K 4Z88A 2DODA 2QXFA 4RTUA 2R57A 1ATNA 1YYVA 2L9RA 4DS4A 2K2VA 1X6OA 5C42A 5CKTA 5L3CA 3GF5A 1X4OA 3LM2A 1GBRA 3H9NA 3QG1A 2NWMA 4XK4A 4XL9A 1NJZA 3D5RC 4CH7A 4IPAA 3CC4Q 3J80O 4JI0K 2ISZA 2HKOA 4FWPA 3CUQB 1RNHA 1OJLA 3BG5A 2KT1A 3NF6A 3K2PA 4V19S 4M9ZA 2ZQBA 3VEYA 4DBRA 2JW4A 3SLCA 1XCBA 3CC7N 3M8FA 4GRIA 5AQNA 4Y28E 2NRWA 2HF3A 3CJNA 4HX8A 1IV6A 2HVHA 5CR2A 5CYQA 4IUVA 1RT7A 4KPYA 3DRSA 2X6OA 3Q7BA 2B5JA 5L3GA 1QS4A 4IG0A 1JRIA 4EAHD 5GAMd 5FROA 2XK0A 2JXBA 4CZLA 4M7DE 3VQAA 2MOXA 1EZZB 1KSPA 2K3FA 1VQ4A 3B6AA 3DJCA 3KP7A 2EZIA 3VWBA 3LL3A 2O88A 3NTKA 5KI6A 1HMVA 4KT0E 5HKCA 3DTEA 1D5VA 1F43A 2DFFA 2AQFA 2ECBA 4B9TA 5IT9E 4ELTA 4GVEA 3AAPA 4N9IA 4KKOA 1SVOA 2XDPA 1HW2A 2BGGA 2O6GE 2DTUA 4G6DA 2MG4A 2RJDA 2M8GX 1U3OA 1HQEA 4NXMK 1NGEA 4A3EJ 1CZBA 1RILA 1MSEC 2COWA 1K78B 1FZPB 4K42A 4GY2B 3HKZN 3JCMP 2BZ8A 4RCBA 2BDPA 1Z7UA 5JLXA 3G71A 4CESA 4M7AG 1D1BA 1HX1A 3I3LA 4WF2A 2OZUA 1ZA2B 3C2BA 2EIJH 1Z26A 3TOBA 4LG0A 3TKYA 4EM0B 2CQKA 4IOXA 1G59A 1D3YA 3LDLA 3QIOA 3HRUA 3LGLA 2M0CA 1QVGS 4CO8A 1VUBA 4HZFA 3TABA 4CCKA 1S5LC 2D0AA 2HCKA 1UMQA 1U04A 3H5RA 4XOTA 1H0MA 2VCPA 1K8AR 1YW8A 2D8HA 2VT3A 3PMIA 1T7PA 4ZZLA 2DD4A 3MWMA 5C4JJ 2ITMA 1T8EA 2IBDA 1TNTA 2V8JA 2XF7A 1NGHA 2DF6A 4RTWA 1VQ5Q 1YVNA 1B8IB 1YJNQ 5HRRA 2QG9B 4P5NA 3NAEA 3K1NA 3M54A 1VQPA 2JS2A 3S41A 1KAXA 3GW2A 4FW1A 4JX6A 1ERDA 2KLOA 3OW2P 3GE1A 1LKXA 5K7ZA 4OMYA 3LSMA 2K40A 1FMVA 4OB0B 2ZBKA 4CUGA 1TUGB 3QZ9B 3KHYA 4CEEA 2R7TA 5GANe 4V2SA 2OA4A 3CQZJ 1YHQQ 3L00A 3CDLA 2LYCA 1V4TA 1T6DA 1S72A 2PQWA 3IH3A 1S6LA 1ZQ1A 1TC3C 3FLGA 2CYZB 4FPBA 4LC9B 2KDSA 1SFUA 4ILGB 1NE8A 1BJZA 3OW2A 3FC3A 4MFEA 1J7KA 3OA6A 3MEDA 1ZR4A 2E6ZA 3CCET 1VQNQ 2JA6J 2RPIA 1DIZA 3KEQA 4BGAA 1KG7A 4D5FA 3RPQA 2MSYA 5K5QA 4DV0K 3GOXA 3BG9A 5L3BA 4XLPF 2EFPA 4UY8I 3CMAA 2WUSA 2O8EA 1STZA 4FT2A 2KE9A 2IA2A 4BUPA 1RABB 2D1HA 2VQCA 4BQNA 4HA8A 3QLHA 1Y8QB 3I5UA 5HS8A 1PUFA 2NNNA 3V7SA 5IOYA 3C95A 5F0CA 4AD9A 4II1A 3CJBA 3UKUA 4Q0BA 3LFUA 2GFAA 4XICA 5ECAA 1D5YA 4O5BA 2HYFA 3R60A 2CQ7A 4FO0A 1LE8A 2BZXA 3E9FA 2ZMEB 2HNYA 5TISC 2E8AA 2NRHA 4CJFA 5CQGA 1Z91A 1YBYA