3L2UA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and gs9137 (elvitegravir)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
b'AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2uA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2uA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2uA03
3LP2A 4O0IA 1Y97A 1QS4A 3ZT4A 3K59A 3SJJA 4DWIA 3CM6A 4MFBA 1KLNA 4AHVA 4NYNA 4DTSA 1S1WA 1MU2A 1Q9XA 2OPRA 3SUNA 4X34A 4FXDA 4KTWA 1JLFA 3QLHA 1RBSA 3MEGA 1KVCA 3QNNA 3MP8A 3AV9A 2YNHA 2E6NA 4BACA 4CFCA 5FDLA 1BQMA 2GUIA 1NJWA 3QEIA 3EY1A 4CJPA 2HB5A 4C8KA 5KE2A 2RI3A 1W9HA 1BCOA 1WAFA 3LZJA 1D9DA 3QETA 1TKTA 4IURA 3VQAA 3HPHA 3TR8A 3K5LA 2RJCA 3TI0A 2E5QA 3THVA 2VWJA 5E41A 4PUOA 1LAWA 3AVMA 4DSIA 1KFSA 2E6MA 4BDPA 4IG0A 2QXFA 2B6AA 2FBYA 3QEVA 4I2QA 1HRHA 4CGIA 2OPPA 4OKEA 2QKBA 3Q1JA 3FLGA 2KQ2A 1TGOA 3L2WA 1RDAA 4IUTA 3PMTA 4W5TA 1JLBA 1UOCA 5HRNA 1RT4A 5SWMA 1HNVA 2F8TA 4PLIA 1HYVA 3F9KA 1RDBA 3WNEA 2F5KA 1OZ2A 2BDPA 2ATQA 4DU4A 3DM2A 1VSMA 2X74A 3LANA 4OLBA 3ASKA 3SYZA 3K58A 4B9WA 3SQ2A 4KFBA 4FLZA 1S1VA 2RJEA 4Y1DA 4OLAA 3E9GA 2M0OA 1WSIA 4DQRA 4EDUA 2YRVA 2P1JA 5J2QA 3MEEA 3QESA 2BGGA 4EZ9A 3O4NA 4KTZA 3JYTA 4F4KA 1RT5A 4CEAA 4M3TA 3RRHA 2XY6A 1J53A 4HVJA 4RW6A 4GVMA 4DTRA 5CY4A 2F8SA 2A1SA 1BQNA 3L42A 1SL1A 3SPYA 3OYLA 4DFJA 3IRXA 2GBZA 2EX3A 3ZSWA 3LZIA 3ZSVA 4TSXA 4Q5WA 1IKVA 3K2PA 1LW0A 3VQ5A 4FJLA 4CE9A 4OGCA 3OYAA 3NH2A 1VK0A 1VSHA 1IKYA 4K8XA 3MAQA 2HNYA 2KZZA 4GW6A 4B9VA 2DIGA 1VSKA 4NCAA 4HCZA 4PL6A 3OJSA 3AVAA 1FKPA 1NKCA 4N5SA 1TVRA 3VQQA 4II1A 4HUEA 2IG0A 3C6TA 3P5JA 4CEEA 3I0SA 5FRMA 4E1NA 4CIFA 2NLUA 4DSEA 3NNQA 2GF7A 1RI0A 2JZ2A 1TL3A 3MXIA 4FJNA 2D0AA 4KTQA 3TANA 2YKNA 4CEOA 4HUFA 2RHUA 4DU3A 4LY7A 4DSLA 4H4OA 2QQRA 2D0CA 1KVBA 2M16A 4FJJA 1RT1A 4RG8A 5D6WA 4CJ5A 4CHZA 4QAGA 4C5HA 4DLGA 4HCBA 1GOBA 4CJFA 4FJXA 4LH5A 4FLVA 3OVNA 4KHNA 2RJFA 4CJLA 2HHWA 2G8UA 2PZSA 2HVHA 5CIUA 3AVBA 4A4FA 1C1CA 1BISA 4FLWA 4CHYA 4DTPA 4FJ8A 2WACA 1VSIA 4O44A 3AVNA 2Y1IA 1NKBA 4M3RA 3HPGA 2KFZA 1KTQA 1L3UA 1J54A 5FROA 1WSFA 1C1AA 1BHLA 2Z1JA 3TAGA 2ETJA 2YNGA 4KB1A 3LGFA 1CLQA 1D9FA 4B9TA 2QKKA 4JS4A 1S5JA 4H8KA 4DTXA 1RBVA 3C6UA 2XK0A 4M3YA 4HCCA 2O4XB 1WGSA 5KGXA 5HP1A 2HW3A 1NKEA 3FC3A 3PO5A 4AILC 3KD1E 3OYHA 4OVLA 1JLEA 1IG9A 2P5OA 2BIVA 1VRUA 2KFNA 1KSPA 2AJQA 4B3OA 3VA0A 3CQ8A 1ZBHA 3ISNC 3NHGA 1TAQA 3L3UA 2HHVA 3KKRA 1Z25A 4B9XA 1ZBIA 4LD0A 4M45A 4IUPA 4OJRA 3AA4A 3F70A 5I3UA 4OPKA 4CRIA 1KHCA 1JLCA 3FEOA 4CGGA 3L2RA 4E0DA 4M3XA 5K14A 2G8WA 4BE0A 4CK2A 3TAQA 3RRGA 2PY5A 4L59A 3V9UA 3PX0A 4RW8A 3O3FA 3LYIA 3DB3A 4B9NA 3GOXA 3ZT0A 2KW4A 3O4QA 3TAFA 2R5AA 4AH9A 1WNSA 3NH1A 4BDYA 2FBXA 1CXUA 3OYKA 3HYFA 3AVHA 4FLTA 1OZ3A 4DFMA 3MEAA 3MXJA 3DI6A 2L8DA 4M41A 2LCCA 3AVKA 2XHBA 2Y1JA 3M8PA 5I42A 4KHWA 4J2DA 4OKJA 3VQ4A 1VRTA 3AVCA 3K5MA 5HROA 4UC4A 1SV5A 1KLMA 3DRPA 4OPJA 4FZYA 1W0HA 3AVJA 3P8DA 4E1MA 4FW1A 3MEWA 1I39A 2X4XA 4F2SA 3ZT3A 2RHIA 4FLUA 4R5PA 4EP5A 3QIIA 2K3YA 4IDKA 1X9SA 4N4HA 3EZ5A 3BDPA 2D9TA 3NGIA 4KAZA 2B5JA 3NTKA 2MWPA 3VQ9A 2K3XA 3NGZA 4DU1A 3RMCA 1T8EA 4FJIA 4QQGA 3EYZA 3QIPA 2ZQBA 3LWLA 1F21A 1QQCA 3LLRA 4FJKA 3QIOA 3AO2A 1JLGA 4DQIA 1RNHA 1NOYA 4BWMA 3KUFA 3K5OA 2YHBA 4IG3A 2I5JA 3RR7A 4W5QA 3V9SA 3DRRA 2WOMA 3U3YA 4CK3A 1L3VA 1HQUA 3KD5E 1MHNA 4CFAA 1S1XA 4E7IA 2JLEA 3ZSXA 3CFRA 3H8ZA 4Z4FA 1YVUA 4KO0A 5D3GA 3DB4A 2XY5A 3CG7A 1SKSA 4PLLA 3OMGA 1UA1A 3U3GA 4AHRA 1OYXA 1RTJA 4KPYA 4BE1A 4I9QA 1VSLA 3LP0A 1LV5A 4AHTA 3SD4A 1SSFA 1CZ9A 4FYDA 1SL0A 4QVZA 2EFIA 2R7YA 3IAYA 4F3OA 2FBVA 1T05A 1RBTA 4DF4A 3LDSA 1Q9YA 2YHAA 1ZBUA 5HBMA 3BDLA 2G8HA 2IDOA 5CYQA 4PQUA 1B92A 2DAQA 1RILA 2OZSA 3RMAA 3LPUA 3AA3A 4E7KA 3V81A 1ASWA 1TKXA 5CZ1A 1LWEA 4PWDA 3QO9A 2G8IA 3MP1A 3DLRA 1X9MA 4C8OA 2IS3A 1JKHA 1GOAA 1HMVA 4YFUA 4FM0A 1TK8A 4QQ6A 2G3RA 1FK9A 1J5OA 3V6DA 1G15A 4CF2A 4M3WA 2FHDA 1S1UA 4ELTA 2JGUA 1UWBA 2DFEA 1VSDA 4LSNA 2RPIA 1XHXA 4HTUA 3OYEA 3LWMA 4DFKA 3S3NA 3M9QA 4CFBA 2HHUA 1CZBA 4Z4GA 4N47A 1FKOA 2DFHA 3LAKA 2NUBA 5HRSA 1RDCA 5J39A 1EKEA 3DMJA 2B8AA 3UT1A 4FK2A 3DLBA 1S6QA 3AVFA 3KLFA 4OVAA 2GV9A 2P51A 3DOLA 1RTIA 3HSTB 1HYSA 4KKOA 5HRRA 3NDKA 3LP1A 3S6WA 3LAMA 1ASVA 3KLIA 4Y1CA 4DTUA 3C94A 3HT3A 4KRFA 3VQ7A 4CHNA 3WNHA 2B4JA 1WAJA 4CGJA 4F8RA 3VQCA 3RMDA 1WSHA 3VQEA 4QQDA 1XI1A 1JL1A 2O4XA 5C25A 2X78A 3VQPA 3OA6A 2XY8A 1HNIA 2R58A 3PFSA 3V1OA 1TAUA 3AVGA 3CM5A 2LVMA 4ELUA 4A4EA 1D8YA 2IAJA 2VYTA 2O4IA 4C8MA 4C8LA 4FJ9A 4JLHA 3HM9A 3RTVA 4FZXC 3D0PA 4E7HA 2M1HA 3PV8A 2XRIA 3HVTA 4RW9A 3SV4A 4DQPA 1IKXA 3ALYA 4J2BA 2F96A 3ZEHA 3DOKA 3ZT1A 4E7LA 4DF8A 5EU7A 3M8RA 4DTOA 4EP4A 1I3AA 3K5NA 1X1PA 3HO1A 3KK1A 3PUFA 1EP4A 2DFFA 4F3TA 1A5XA 1XNIA 3K57A 1C0MA 3UIQA 5JS2A 3BGRA 1RT6A 2Q3SA 1L3SA 4ID1A 2YNIA 4Z4CA 1RTHA 4CFDA 3HP6A 3V1RA 4DTMA 2KTQA 1JL2A 4QCLA 4N4GA 3ME9A 3KK3A 3LGLA 3DLMA 1HYZA 3ZSQA 4KI6A 3NE6A 4CERA 1KVAA 5KTQA 4IFVA 3C4SA 1J9AA 4LD6A 4DTNA 3ZSRA 2FBTA 3U6FA 2ZE2A 3OYNA 2VG7A 2X4YA 4CIEA 3T19A 3S9HA 2HQEA 2HMIA 5KRTA 1L5UA 3B6PA 3MEDA 3ZSYA 3PNWC 3SUQA 4N56A 3KKSA 3TARA 4JS5A 3I8DA 3OMCA 5C6SA 3OYDA 2P0KA 1NK9A 2X35A 4BDZA 3E01A 1NJXA 3IG1A 1ITGA 3OYCA 3M8QA 4DFPA 3OS0A 1L3TA 1HJRA 4IUQA 3QNOA 1ZBFA 1U48A 5C0MA 4E3SA 3E9FA 1QSSA 3G10A 3MEUA 2Z1IA 3LALA 4WE1A 5KI6A 3T1AA 4CESA 3NFAA 1DLOA 5IN1A 4FM1A 1JLAA 1EX4A 4B8AB 3I0RA 4EZ6A 4FZZA 2RKIA 4GY5A 3G0ZA 5J2PA 3LH0A 3IS9A 3NCIA 4ZHRA 3SPZA 5FRNA 1C0TA 2HNZA 2YKMA 1G5VA 1VSFA 2OYQA 2LSNA 3ASMA 1B9FA 2X6SA 3PX4A 1RT3A 4CGDA 4M3ZA 4NCGA 3KLHA 3TABA 4UQGA 3MEVA 2XY7A 3VQ6A 1TK0A 2BUDA 1U45A 2YV0X 5M9OA 1NOZA 4M42A 3HVRA 4RW7A 2BKDN 2W42A 4IKFA 2HHXA 1IH7A 2RJDA 4LH4A 2EQJA 4IUVA 4FU6A 4CJUA 3L2VA 3TAEA 1LAVA 5KE3A 4C8NA 1O1WA 2O4GA 1WN7A 3MP6A 2VG5A 1IO2A 1BI4A 1BIZA 1X9WA 1U49A 4ZTFA 3T3FA 1EETA 4NCBA 4H4MA 2EQKA 3OJUA 2DTUA 5CZ2A 4CEDA 4DTJA 3JSMA 1S9EA 4KV8A 2YNFA 1S6PA 1Q8IA 4DS5A 4FLXA 5J2MA 3QBYA 3WNFA 3TAPA 3O8VA 1WSJA 3O3GA 3PO4A 1ZBLA 4N4IA 4QOZB 3RWUA 1JLQA 4DMNA 1B9DA 1N5YA 3PY8A 4NS5A 3SV3A 2CKKA 4E89A 3DRSA 4Q5VA 4RG2A 3NF6A 4B9UA 2FC0A 4CHPA 4W5OA 2PYLA 1YTUA 2RF2A 2EKOA 4CK1A 2QK9A 3V9XA 4I9LA 4N41A 4QW2A 4CF8A 2OZMA 1A5WA 5DK5A 2RN2A 4K8ZA 4CEZA 1U04A 3L8BA 4CIGA 4XIUA 4J2AA 4PA1A 1YT3A 4CHQA 2VWKA 1Z26A 1RT7A 3SQ4A 1CXQA 4I2PA 1LWCA 4CJKA 3SQ0A 4OGEA 1N27A 5T7BA 1BGXT 4DS4A 3OB9A 3AVLA 2P5GA 4RW4A 3LP3A 3F73A 3NH0A 1N6QA 3SUPA 4JRQA 2MWOA 4KHYA 5JS1A 2LDMA 4CGHA 3PMIA 1LWFA 2OPSA 5HRPA 4B9MA 2RI2A 3QEWA 2L89A 3VA3A 4FL6A 3LX7A 1NK5A 4DLEA 2D0BA 4C5IA 4DSJA 2HQXA 3AO5A 3WNGA 1RT2A 4Z4IA 3VQBA 3L2QA 3VQ8A 1NJYA 1BI4B 2ZD1A 1UAXA 4F2RA 2L3RA 1HPZA 4N76A 5KH6A 5CYMA 2G8FA 3NBPA 4CJ4A 4CCHA 3OYIA 1K6YA 4JRPA 4FJGA 3OYMA 2IC3A 1WLJA 4Z4EA 1WJRA 2PQWA 4A4HA 4FLYA 3NGYA 4FVMA 3RMBA 1TV6A 2RHYA 1JXEA 1C6VA 4ID5A 1VSJA 4CJEA 3L2UA 4CF1A 4CJWA 3MO8A 4Q0BA 3CEYA 4BWJA 3MXMA 4Z0UA 5IAYA 3H08A 4CJ3A 4GMJB 3S3MA 3ITHA 3DLKA 3V9WA 3SUOA 3OYGA 5J1EA 3P83D 1IKWA 2HNDA 4FJ5A 4FJHA 2HHSA 2D5RA 3DLGA 2LTOA 3NTIA 4AHSA 2HHTA 1DTQA 3CYMA 4L8RB 5KCHA 1RTDA 1KRPA 2VG6A 3NAEA 4FK4A 3SI6A 1QSLA 3KLEA 2PYJA 3UWNA 3AO4A 4CECA 4G1QA 5J2NA 4FW2A 1RDDA 4O55A 4DSKA 1XWLA 3MECA 4HHTA 4J2EA 4CGFA 4KI4A 2ITGA 3VQDA 4Z4HA 4FJMA 3KJVA 4CJSA 4A4GA 1VSEA 3ULDA 3HJFA 3AO1A 3ZCMA 2GFUA 2Z1HA 1WJSA 3OY9A 1WSEA 1OI1A 4KHQA 3META 3QJ6A 3AVIA 4BD3A 4CEQA 4O4GA 2KZMA 3SCXA 3FFIA 4CF9A 2WONA 5C42A 1UA0A 3OS1A 4NYFA 3NF8A 3VN5A 1XC9A 1R0AA 1U47A 5KCOA 1C0UA 1XHZA 4Z02A 3HP9A 5C24A 3OYBA 1TKDA 4E19A 2IOCA 1LW2A 3V4IA 4CEBA 3S3OA 2DY4A 1BIUA 3HXMA 2DIQA 1H3ZA 4HUGA 2OA8A 4B8CA 4I7FA 3H6ZA 2RI5A 2RO0A 3O3HA 1A5VA 3AO3A 1YTAA 4DQSA 4KHSA 3OYFA 2JTFA 3TWHA 3EAEA 3QEPA 3AA5X 3P1GA 1JXBA 4KREA 4O0JA 4O5BA 3P8HA 4LSLA 3DLEA 4W5RA 4DSFA 2HVIA 1T7PA 3PX6A 1BL3A 4M3UA 2EHGA 2E4LA 2G8KA 1TKZA 5SZTA 2XO7A 1SKWA 2EQMA 3KTQA 4AHUA 3TAMA 4B9LA 4B9SA 1KCFA 1WSGA 4CF0A 4IBNA 4NZGA 1NJZA 1KFDA 3KK2A 3FDRA 2BANA 3ZSOA 3QKJA 4E7JA 2LRQA 4DG1A 5J26A 3LPTA 4CHOA 3DLHA 4C5EA 1D5AA 4KB0A 1RBRA 1QE1A 1SKRA 4YNQA 3ZT2A 1FXXA 1ZYQA 3OS2A 1NK0A 4IFYA 3DYAA 4ELVA 1SUQA 4FM2A 3B6OA 5KRSA 1REVA 5DMRA 4DQQA 2EQUA 4AHCA 3HPOA 3L3VA 3QERA 2A1RA 2X4WA 2G8VA 4BE2A 3QINA 1QHTA 4IUUA 1NK4A 4CJTA 1DTTA 3SNNA 1RBUA 5D6YA 1TL1A 4FK0A 3KIOA 1S9GA 3NTHA 2XDPA 1C1BA 3OQ5A 1RCHA 5D6XA 2HHQA 3KLGA 3HL8A 3NF9A 3M8SA 3C95A 3NF7A 4PY5A 3SZ2A 3V9ZA 3A2FA 1WJQA 3HK2A 4MQ3A 2OPQA 1SL2A 2RHZA 1NK7A 4B08A 5HLFA 4FCYA 3RR8A 3OYJA 1HQEA 2Z1GA 3AA2A 1NK6A 3ZSZA 4CJRA 4ZTJA 4KHUA 4CEFA 3SQ1A 1EXQA 1U4BA 4W5NA 1TK5A 2QQSA 4CJVA 2E6LA 3D45A 5KGWA 2GFAA 1QTMA 1GOCA 3CFOA 1T03A 4FJ7A 1NK8A 4CJQA 2R5MA 4ICLA 1BCMA 3V1QA 2IGIA 2R57A 3QEXA 4OKKA 1QSYA 4C5GA 2BE2A 1ASUA 3CFPA 2RHXA 1S1TA 2X6NA
chains in the Genus database with same CATH superfamily
3AL0B 5JFRA 1GVJA 3RYRA 5GAN7 3ZT4A 2K7AA 3DPUA 3DP7A 4DWIA 1BBZA 4AHVA 2JHJA 4NYNA 4FX4A 3V7CA 5HNHA 1PU6A 3THXB 4CCLA 3W3DA 4H0YB 4FXDA 2I5WA 2HBMA 2AIRB 1RBSA 2KJCA 3K69A 2DPPB 4BHCA 2GTJA 3WHBA 4F7UF 4H5NA 4F52A 2EZKA 1Z67A 1R5HA 2ZZDA 2DQRA 1BQMA 5AONA 5ICEA 1NJWA 4FT8A 2E2HJ 4CJPA 1FZPB 1R0BG 2RQPA 1WEGA 5E18F 1Q7YU 1VFCA 1O75A 3S1RJ 5TISC 3LAJA 4ZYHA 4BREA 1VYVA 5AR0A 4P1WA 3ERED 3K5LA 3CC2T 1Q81C 2LBFB 2VWJA 1BI1A 5EJCA 4MZMA 4UY8O 5F0HA 4WQ4C 2IA1A 2LVSA 3SWNC 2V52B 3AVMA 1M1KO 5L3FA 5GAOn 3CO7C 2ME6A 2WTEA 2CV2A 4J8FA 2K5FA 1GCQA 1IN7A 4BQQA 3CO6C 2NUTB 5CQXA 3WTSC 4YELA 3FXOA 2RF0A 5TJJA 2QKBA 2C0OA 2AA4A 1XD7A 1CF7B 1ESVA 3BUZB 3GG4A 3BR5A 4C3HJ 1VQ6N 4BHPA 2VE8A 2JZYA 2O9VA 3I4PA 4BRIA 1HNVA 2F48A 2ZJRF 3SJMA 3K7AJ 4OMFB 3JB9I 5BN9A 1U06A 1HU0A 2HQRA 3KETA 4UUSB 3CHWA 4BAYA 3WNEA 1MJAA 1SD5A 1WFWA 2H6CA 4XKVA 2PMUA 3HBTA 4S0HB 4OMPA 4UVAA 1VSMA 1V3FA 1YX3A 2JNGA 1HNXK 5K7ZA 3OIQA 2IA0A 1D1CA 1HSTA 4PGGA 3AGRA 5HLGA 2NOEA 1NGNA 2IT0A 2MYSA 1GLCG 2ZJQL 1FJLA 3RPUA 4CUGA 3M0SA 3P9KA 1WJAA 1IB8A 1BC7C 3RKXA 4M7AG 3F23A 1QVFM 1PYVA 3HOSA 4AD9A 1N25A 5LJ3j 1XGNA 2TRTA 2X6OA 2LF7A 2GCXA 3HTVA 3VOEA 3G4SI 1PDNC 3JYTA 2QCOA 3QPLA 5GPAA 1YLFA 3QP6A 2B9SA 4IQJA 4GVMA 3CUQA 1QVGM 2Y90A 2Q97A 4J9HA 1KFZA 1R4NB 4RGRA 4KH1B 3J7ZI 1IGNA 5K7HA 1ZA2B 2GBZA 2DTRA 3G1JA 4YEJA 4HAMA 3KTUA 6AT1B 4Q5WA 4HOBA 1LW0A 2E70A 3CMAI 4FJLA 4XORA 4RLQA 2D1KA 3OYAA 5L3BA 3BG7A 1QCFA 3ESWB 4NHJA 2I0NA 3FM5A 2V8JA 3WE3A 2HNHA 3CJBA 1RAAB 3KP5A 2VJ5A 2YLCA 2DIGA 1VSKA 2J7IA 4ME7A 3JSPA 4EJWA 4A4KA 4PL6A 1ZYRF 1GLJO 3AVAA 3MZYA 3NVMA 2CZ7B 3VGMA 5M1OA 1XN7A 4JKGA 1XGMA 3C6TA 2K02A 4ELZC 2E1CA 3P5JA 2GBQA 3I0SA 4CW7B 2FPFA 4A3KJ 2KZGA 3L9FA 3H9QA 3SZPA 4ANJA 3NNQA 3WXMB 4OF1A 1HXDA 5JVHL 3REBB 2TDXA 5GIPA 3X2QH 3S1NJ 4J9FA 3TANA 3LSJA 2YKNA 3OW2P 4UNOA 2WAQA 3HYIA 4A0YA 2YHTA 3GTQJ 2JA6J 2KKOA 4QAGA 1W70A 1WXBA 1U2VB 4A69C 3LDOA 1J2XA 4JEPA 4FWOA 2OAUA 3E6CC 3BCBA 4M7DG 2X4JA 1GXIE 5ICGA 2XPWA 1XJWB 2FQ3A 4A4FA 1V5FA 3TO7A 3GBQA 3JCMb 2WACA 2PJRB 4O44A 1MGQA 4J9IA 3FMQA 3J81O 4GRIA 1NMDA 1NKBA 3F3XA 2KFZA 4LOCA 3EFRA 1L3UA 3MX5A 1MUZA 1YQRA 3Q7CA 2A42A 3EGUA 2ETJA 2YNGA 4KB1A 2OV7A 3G1LA 1KU9A 1CLQA 4HVUA 3CUQB 2H3EB 3GTGJ 1X3MA 3HRUA 2COMA 4BS9A 2A41A 4D1QA 4YHHK 1WHKA 1JE8A 3PE0A 5AQWA 4PHTX 2JMWA 1VQ6I 3HG9A 1V29B 4OOIA 4M3YA 2PUKB 1VQMA 2VPRA 4KICA 1WGSA 2O4XB 3OBWA 3IH3A 2R7UA 4M78B 2V1NA 5BPLA 2X9DA 3DEWA 2DMOA 1LOTB 3VETA 2YS9A 1IV6A 3QMLA 3FX3A 5FJ8J 5GAMe 1LVAA 4RAZA 1V4SA 3FKIJ 3CW7A 2P5OA 3GTPJ 1BI3A 1FOYA 1XMAA 3FXKA 3HIFA 2PVDB 1KSPA 4A0XA 5A0GA 3BZKA 2D0QB 1RAHB 3PTAA 3ZPLA 3CC4Q 3A1YA 3ZGKA 3M1EA 3K70D 3ML6A 4LLNA 1B72A 3KKRA 4JKGB 2FZKB 3WVDB 4MFEA 2PFUA 1P7IA 4OJRA 1TC3C 3AA4A 5DTDA 4OPKA 1KHCA 3BTLA 3C3WA 5K14A 2G8WA 4CK2A 3K10A 3TVTA 1IHVA 3M0TA 4HSRA 3RRGA 4L59A 2ZKZA 4CCMA 3WTXC 4D7NA 3PX0A 1QZYA 1KQ9A 3JCMW 2VB6A 3PNVA 1KYZA 3BFMA 3I53A 1YFHA 5C4JJ 1BYMA 2YRCA 1NGCA 2F9TA 3ZT0A 2KYMA 2M1BA 4ATOA 2R5AA 4BDYA 5GMKe 4XTWA 3BG6A 4BXXJ 2O8DA 2EINH 5FU7C 3WE2A 2V51B 3K0LA 1CXUA 4D8DA 3OYKA 2K4YA 3E19A 2UYTA 3AVHA 1OZ3A 3DI6A 4XKWA 2IXSA 1N39A 2LCCA 3AVKA 2Y0MA 1MBGA 3M8PA 2A68F 5I42A 4XNFA 2W85A 4ENKA 4A3MJ 3K5MA 4QKUA 3HM5A 3CPWP 4RKUE 1JJ6C 4V2SA 1DKGD 2QQ9A 2RHKA 4A53A 3HKSA 4FE4A 3AVJA 4FW1A 3J81K 2E35A 4JZ3A 4AWXB 2CUEA 5CPRB 2MSYA 1KG1A 1WSUA 4EP5A 3PLAA 3HOZJ 4OB3B 3VYUB 4OB2B 2K3YA 4AI4A 4IDKA 4B4CA 1ABOA 1X9SA 2E5LK 2DFUA 3AG4H 2UXNA 1U84A 3PJRA 1P7JA 5BRDA 2YG9A 3TDZC 3JV3A 3J80O 2MWPA 3I55N 4WQ5C 1T8IA 2VT3A 3VQ9A 2P7CB 3EG9A 1I6XA 3RMCA 4BEHA 1RNLA 3KFVA 3SAGA 1R1TA 1MH3A 3BG9A 5J1RA 4KGZB 3EYYA 1WA7A 4ETSA 2P9SA 3AO2A 4FWPA 4BWMA 2WSFE 4PL7A 3EGXB 3RR7A 5AQTA 3AG1H 5K7FA 2WOMA 5L23A 2RD1A 2MA3A 1NK3P 3KD5E 4CFAA 1QQMA 4FWMA 4UOBA 2JLEA 1D8JA 2A28A 3B6AA 2HOTA 1FN7A 1LOJA 3CFRA 4BQAA 1S72Q 2F5FA 5LD2C 1OH6A 1OVQA 1MMDA 2XY5A 1SKSA 1JUMA 4PLLA 2DW4A 2ZPEB 4KPYA 4BRHA 3P38A 1YRNA 5AN4A 1FP1D 1VQ5N 4OX9K 5GAGP 3JSCA 2YJEA 2EFIA 2CJJA 3CLQA 2Q0OA 3A02A 4PJOD 2FBVA 5EG2A 1X6OA 3BQYA 2CT4A 3RIRA 3MCPA 4M7AE 4DF4A 3LDSA 3ID8A 2BE5F 4J9BA 3BDLA 2G8HA 5EGOA 2DO7A 3GF2A 1YHQA 2JMCA 2AO9A 3ABUA 2XF5A 4E7KA 2O8DB 2M0CA 1LKXA 5E79C 3V81A 4M7AC 1ASWA 1H9TA 4C2MJ 3LWHA 3PT9A 2QQ8A 5CZ1A 2H3GX 1LDKB 1D5YA 3QO9A 1QVFA 2FOWA 1TH7A 4N4OB 4IF4A 1Y57A 3AAPA 2G8IA 3GXOA 2G6FX 4PFZA 3DLRA 1X9MA 1B1BA 1SAXA 1UELB 3REOA 2DPNA 3O9TA 2FE3A 1HMVA 3KP6A 4YFUA 2VKNA 2WAEA 1CKBA 4FM0A 2NAZA 1TK8A 4XTZA 2CQKA 2BY2A 2GWJA 4EJVA 2DPUA 1YJNI 2QEXA 1J5OA 3EHRA 5C2DA 1KO9A 3K6GA 1UWBA 2DFEA 4LN2A 4LG0A 1X4OA 4CZIA 5C15A 4EJUA 4LSNA 4WCGA 2V75A 1U2WA 3CCSA 3OV8A 3LAPA 4DR3K 3OYEA 2W4SA 1I81A 3J80K 3B8AX 4EHTA 1Q82C 5IT9Z 5DM7L 4FHTA 3FISA 2NNNA 3EG9B 3HOUJ 3HSFA 1QQIA 4Y0WA 1K0XA 3G6EI 4BEHB 4CHUA 2WFBA 3I4MJ 2D45A 1HLVA 3NWTA 1LVKA 3A0IX 1VA7A 1S6QA 3AVFA 3KLFA 2ACJA 4J83A 2EPDA 2P9SB 3H5NA 4FYWB 1RRSA 1ABQA 3DOLA 3VKIA 3CCRQ 3PQJA 4CI6A 3HSTB 5EVZA 3CJCA 3RSEA 4CCOA 1AKHA 1AWWA 3HB9A 3RYPA 4ZYGA 3ZQIA 2JXBA 1ASVA 1K61A 3KLIA 4EJTA 4Y1CA 4A3DJ 3VQ7A 4AUXA 3ULEB 4CGJA 3RDIA 3K0SA 3VQCA 3RMDA 4QQDA 4DKWA 1XI1A 4LIVA 3IAS2 2XY8A 2R58A 2OX7A 3CM5A 5GAOr 2KYBA 2LVMA 1X3WB 1MBKA 1OU8A 4CDGA 1YBYA 2VYTA 2KXDA 1Y6IA 2AQEA 1OV3A 5A0DA 3LDNA 1K1ZA 4PJMA 2FYKA 3CCUQ 1OJLA 2ZCWA 3CBPA 1Q7YC 4M7DE 3I55T 2QTVA 3RTVA 3H1QA 4FZXC 1EIFA 2W84A 4XTUA 1TT5B 4BI4A 3ZOBA 5MLCQ 1YJWA 3S2WA 1QBJA 1A6QA 3I5SA 3PVQA 4H5TA 2D5VA 4XU1A 1BR1A 2GA2A 4L5JA 3TSWA 4V2FA 3P39A 4RW9A 2Q1NA 5E1ZB 3K2ZA 2X48A 2EYYA 3ALYA 4WWCA 3R8EA 2JA2A 5E20A 1ZUKA 2KSSA 4M75E 1BUPA 1T39A 1NGBA 1LWWA 1OX9A 1ZGJA 2KPMA 4E7LA 5BOXA 3WXJA 1U3OA 1RAFB 1XNIA 2QGUA 4JI6K 1C0MA 4YFNF 3C0CA 1JQQA 3LFKA 1RT6A 2HTSA 1L3SA 2FL7A 2OTJQ 2EBPA 1C0GA 4JJCA 2MG4A 1XS9A 2H27A 4J19A 2M30A 4LG0B 1RTHA 1R1VA 3R3LA 2ITMA 2QW9A 1BOTO 3V1RA 5CKFA 3RDVA 1VQ5T 3CF5L 2PJPA 2WAQN 4X64K 5AQLA 4BQZA 2ZXWH 3KPHA 3LGLA 4CC7A 4KI6A 3NE6A 4C1NK 3C4SA 3T69A 4LD6A 1TZLA 2HAXA 3CCMA 2DTHA 3NGPA 4B44A 3OYNA 5KYWA 1K9AA 1UE9A 2E2QA 2VG7A 4DV1K 1BJAA 2X4YA 2NOGA 3JCMc 2NOLA 4WXDA 2IVOA 2DK5A 4YG2F 1L5UA 4LUDA 1QCNA 2FOKA 4N56A 4NC8A 3ZX2A 4MLHA 1OCRH 3HZ6A 2QSFX 4DR6K 3M58A 1NJXA 1MUNA 1G8XA 1IAWA 4DV3K 2E1ZA 2HF4A 4DR5K 2LLKA 3C2GA 4NDLA 1MMGA 5E3OA 4NUBA 9ATCB 3OS0A 3DXMA 1OVYA 3I0XA 3EETA 1JI8A 3RERA 3HOVJ 1ATRA 2QWNA 4E3SA 1NNEA 3MEUA 2Z1IA 3LA7A 2EWNA 4FISA 4WE1A 3T1AA 3NFAA 1PKTA 5HS9A 4UB6C 3DF8A 4FM1A 1BBYA 4LF7K 3R6NA 4B8AB 4CICA 4AFSC 2ABKA 4LK1F 3VYGA 4GY5A 3TSQA 5J4VA 5J2PA 4EMGA 1PKSA 3IS9A 3BCAA 5TGTA 2OFIA 3NCIA 4F16A 2QWLA 5KHDA 3ZCOA 3JCMh 3VYHB 2YKMA 1PD0A 1VSFA 2DJZA 1NBEB 2NUZA 3OA9A 4OU0A 5E84A 1ZHIA 4XTVA 4CGDA 1GV2A 5LGNA 2ISYA 2M02A 1NJIU 1T33A 3EPZA 2X6XA 4JKBA 2BUDA 2JHNA 2LDUA 2XRLA 4RW7A 2LMJA 2BKDN 1PC0A 1IH7A 2COWA 2Z3YA 3H3VK 2EQJA 4RA2A 2L3QA 4BC3A 3TAEA 2PX9A 4CYCA 1LAVA 3LSMA 2ZJQF 5KE3A 3A5ZB 1VQPQ 2NRVA 3LM2A 1YIJA 1O1WA 2O4GA 4F7UA 5M1NA 2LJ0A 2VG5A 1YIOA 1O7FA 4O5FA 5M5WJ 4ISGA 4WXHA 4VUBA 2CWEA 1IJWC 4NCBA 4V2GA 1EWQA 2CH4A 1VZ0A 3IH7A 4F9OA 5HDNA 2DTUA 4MQ9F 2WY7Q 2W57A 1SHGA 4DTJA 1DDNA 3BR6A 1W5SA 2C6YA 3RCOA 4H0PA 3S16J 2DMNA 3VS2A 1VAZA 5ED4A 3JS6A 4EW0A 1Q8IA 4FLXA 1HW1A 1PJRA 1T0FC 3WNFA 2A6EF 3MN7A 4BR2A 3O3GA 4YPHA 5BN8A 1MDUB 4RCCA 3CJ7A 2HTJA 4DMNA 2HL5C 1S3JA 1B9DA 2ADUA 4CXFA 2P9LB 1M8MA 4NS5A 3IDHA 1Q7YR 3DRSA 2I7NA 1ATNA 4RG2A 3NF6A 3EZWA 2E1NA 3FZLA 4B9UA 3DXMB 4AG2C 4W1UA 3GTOJ 2COZA 2QGGA 3PIOF 2PYLA 3EH1A 1RUNA 1SS6A 3DLLL 1X19A 3CCJN 2MPXC 2Y9YA 4O8UA 1EQYA 4I9LA 1TWFJ 5F1JA 2W1OA 1B8IA 4CF8A 2VI6A 1JTXA 1YQAA 1OQKA 2AHQA 5GAMf 2XF6A 5E3MA 4FVUA 3FMSA 4ZN3A 1PSFA 4XIUA 2MBFA 2R3SA 4J2AA 3RMSA 1Z26A 2P9KA 5LJ5j 1CXQA 1FNNA 4I2PA 4B3AA 3VSLA 2WB1A 3SQ0A 3FLCO 3PGGA 2CQQA 1YITT 4DS4A 2V26A 3OB9A 2HOAA 1M1KU 2P5GA 5FKLA 3X26B 4BY7J 4IEEA 3LP3A 2PLYA 3DU6A 3NH0A 4GCVA 2AZVA 3FJPA 3SUPA 4JRQA 2MWOA 2LYCA 4AVZA 1W5TA 5AQOA 5EZHA 4L18B 2IRFG 1IZ1A 2A69F 3CCQA 3JRAA 1BL0A 2DOFA 4BRPA 4DLEA 4NO7A 2D0BA 4C5IA 2RNGA 4QWQA 2HQXA 2ZC2A 3ROUA 5F27A 2CH0A 2I10A 1VQKQ 2V79A 2YSQA 2EJGA 3KYDB 1YG2A 3MKDA 1RPWA 3VQ8A 3HKZA 2ZD1A 1UAXA 2HCKA 4F2RA 1HPZA 4N76A 5AQFA 4CJ7A 2KT1A 3NBPA 3VGLA 2IW5A 3OYIA 4FASD 4JRPA 2DBBA 4Z4EA 1N8RO 2L7MP 1WJRA 2LCLA 1SG5A 5KK1A 1M3QA 1O3SA 1G83A 1VQ8Q 2V1UA 3NGYA 5KAFC 2HEOA 2LREA 1ZG5A 1LQ1A 2QSGX 1NGJA 3GX4X 1TV6A 2HF3A 3K9TA 1TXQA 2R7VA 1VQMI 3O6BB 3LMMA 4ID5A 1VQ9Q 1MWMA 2Q31A 4IDHA 3G71Q 1T95A 3FHZA 4YIIA 4PDKA 3H08A 3EFSA 3S3MA 1Q1HA 1VQNN 3EQLF 2P84A 3CMEA 1KU2A 4RTTA 3IUOA 4M9SA 1I0CA 2D5RA 3DLGA 3NTIA 1DTQA 2VG6A 2XAHA 3NAEA 4GY2B 3D1NI 4CYDA 5HLIA 1RRQA 3CCLQ 3DKMA 1TWBA 5M1FA 4C8QG 4OFHA 1X75C 1VUBA 4RTWA 3L4QA 1X2MA 4JI8K 3VS1A 4DSKA 1TTYA 1B8IB 4PJOB 4KH6A 1D0YA 5CLSA 5E17F 3L09A 5J6XA 4LB5A 4HCKA 3EDPA 4ZJZA 5LJ3g 4A4GA 1I94K 3HJFA 2RK2A 2ECBA 2P9KB 3SDGA 1WJSA 2E1OA 3PUBA 3K4CA 2L2OA 3VMFB 2L0KA 2Y48A 3QJ6A 1RABB 4AU7A 3FIWA 4BD3A 1ZGWA 2IA2A 2Z5UA 2JW4A 5GP9A 1MV0B 4O4GA 2KHOA 1E3HA 1OMIA 1I8FA 5CR2A 4ZYAA 1U8BA 2XKPA 5D5XB 4M78G 2KRMA 3FFIA 4CF9A 2WONA 2LQNA 2YHYA 4XONA 4LMYA 1BIAA 2KLAA 4E70A 3I5UA 4NYFA 4K11A 2QASA 1BIBA 3M56A 3NF8A 1R0AA 1U47A 3OH6A 2E4HA 1WQWA 1HDPA 3CCJT 2IS4A 2GOXB 2FMLA 3V4IA 4CEBA 1YJWN 1BIUA 3F8MA 5IXBA 4GVEA 4G9ZA 4UVCA 1H3ZA 4HUGA 5F0CA 1WIEA 4I7FA 4B1ZA 3IH4A 1X1CA 3X20B 1CKAA 1DEJA 1Z6TA 1A5VA 5BRHA 4WX9A 2ECCA 4RGUA 3OYFA 4WYBA 5KAIC 3U21A 5EG0B 2OQRA 3P1GA 3F0CA 4AQYK 1X01A 2JTMA 1G99A 3P8HA 3GP8A 2EIKH 4IO9F 2FRHA 1NLVA 1Y8RB 2ZAEA 3PSFA 4W5RA 4DNCA 2HVIA 2DYIA 4FSVA 1M90O 3IUCA 3PX6A 5CVIA 4YOTA 2LT4A 2PFBA 3HOXJ 4RM3A 2M45A 2E4LA 4PFOA 1WUAA 2MABA 5AQJA 1SKWA 3CCEA 2OAZA 4Z88A 1DT9A 1IXRC 2MH9A 3VTHA 4HEA2 4B9LA 1NKUA 3ZBDA 1WSGA 4XOTA 4XRSA 2DA1A 5JMVA 5FPDA 2DERA 2MW8A 3FKJA 4HRIA 4XQFA 5IT3A 4EHUA 4JI7K 4EVIA 1ZTRA 2BANA 2QTDA 3HRSA 4DV2K 2KISA 5J26A 2ELJA 4BB7A 3FHGA 1OYYA 4C92D 3FK6A 1FC3A 4II2A 3E2UA 1KG6A 4I7HA 1QE1A 3QOEA 3ZT2A 1FXXA 1WBBA 1EH8A 2WA0A 1BDGA 2BV6A 5EX5A 3G4SQ 4ELVA 1YHQI 1SVMA 4FM2A 3CI5A 4RM2A 2EQUA 3AY9A 3TU4K 1IO6A 4OIOF 2A1RA 3R2XC 4XU2A 2X4WA 1Y0UA 2CMPA 2DN0A 2G8VA 2FQ4A 3QINA 1QHTA 2NYXA 1VQNT 3O1WA 4IUUA 2F2WA 4CA0A 1T6DA 3ENHA 1NK4A 2LJ3A 1K73U 3RVCA 3SNNA 4X1VA 2VKHA 2UUAK 5E26A 4BNCA 2QEXI 2VQHA 3AG2H 1D3YA 1TL1A 4FK0A 3CBMA 3CMAQ 1S9GA 3NTHA 1QRYA 3SFMA 1XDUA 3CP8A 5LJWA 1VQNI 2HHQA 4R8HA 4AYBA 3BPVA 5GAN5 4H5WA 1Z9QA 3CCSI 3CPEA 2IVPA 3QYHB 3C95A 3UR3C 1RR8C 3CMMA 1ZQ1A 1X4PA 1WJQA 4MQVA 1GHCA 5CQEA 2VOPA 1MW7A 1VYUA 3W2VA 1SKUB 1QPIA 3EUHA 2VBYA 1B3QA 4B08A 5HLFA 4KGVB 1K9MU 3HTRA 1NBWA 2E36A 2Z1GA 3DTIA 2RGVA 2KJBA 2CSQA 4DOWA 3SQ1A 4XIDA 3BDUA 1G6NA 5KN8A 4HDUA 3RNJA 2M34A 1M1GA 3OR1C 1JO8A 4HLYA 1N3AA 1V54H 4BYYA 4KISA 3HHTB 1WFXA 1UG2A 1MJBA 2O8CB 2GFAA 2BYVE 1EJ9A 2ZGWA 3CFOA 1T03A 4HA8A 2YPRA 2BGCA 2VQFK 2R7XA 4DV0K 3DCFA 4A93J 3Q3SA 1M5Q1 3FF5A 3CC4N 1NK8A 4CJQA 4ICLA 2VXDA 4M74A 5CVVA 2QWOA 2KDSA 2L7FP 1B9MA 1W2BP 3DXKB 2M8EA 1H89C 5FWCA 4OKKA 2PU9B 2D0OA 4C5GA 3DFGA 1MKMA 2LSOA 1ASUA 4JZ4A 1UEBA 1MJ9A 2IPQX 3LM9A 2IVMA 3ZMVA 2OAWA 1SEMA 3LDLA 3K59A 3CM6A 4MFBA 3L00A 1QWFA 3FXJA 1RI7A 1RUOA 2JN0A 4C2UA 3ZQ7A 1MU2A 1YJWI 4GBQA 4B22A 2E1YA 4S05A 3E3VA 3SB2A 2FBKA 2DT5A 3GUDA 2XI9A 3MMVA 4BRMA 3MP8A 2ELKA 1WI3A 1IUFA 2E6NA 4I6ZA 2H3JA 5JLXA 4KJZA 1TP4A 4CFCA 2R7RA 1GT0C 4K43A 5FDLA 2HWVA 1E3MA 5GMKi 2HB5A 5DLOA 1VQ6Q 1RC9A 4BR4A 5KE2A 1B07A 2D8JA 4I76A 3N4MA 2NOFA 1M9SA 2RI3A 5I11A 1WAFA 2QKLB 4EJYA 3CF2A 3WEEA 4M77D 3VQAA 2A6HF 3K4MA 2YLBA 3TR8A 4M3GA 4XLCA 2RJCA 2KZVA 4E7ZA 2BEOA 4BY6C 4I02A 2M4KA 1UECA 2JWLA 3EFOA 4PUOA 3BG3A 3MCAB 3JTHA 4DSIA 1YX5A 5CE3A 4IZZA 4YOWA 3CCMI 2E34A 4I2QA 2IS1A 2R92J 3CF5F 2YUQA 5TKWA 4HNVA 3ZQHA 1EH7A 4L5GA 1MSEC 1FEXA 4C8QE 1VOMA 3THYA 2FXAA 2CH4W 3CCQN 3Q1JA 3FLGA 2KQ2A 3VUZA 3L2WA 2EFOA 4IUTA 1F36A 4G12A 4C8QC 1JLBA 2KBTA 3GTJJ 4NLCA 4OIRF 1UOCA 1OLTA 3T1BA 5HRNA 1RT4A 5SWMA 1RGIA 2QI2A 3BR2A 4U0WA 4WK8F 2NLXA 2JN6A 5I9EB 2JSCA 1S72N 5IY5H 2F5KA 1H92A 3ZMDA 1S7OA 1JBMA 2CGLA 2X74A 4BC5A 4OLBA 1NPPA 3BR3A 3ASKA 1Q18A 3R4KA 3MKWB 4B9WA 1WB9A 4M78E 5DV5A 4OWRB 1FSEA 2Z2SB 2IGKA 2GLOA 4IIMA 1QGPA 2HZTA 4YOVA 2WC2A 2BXYA 4M78C 3DWLE 1WSIA 1VRLA 4AIDA 1OKJA 3QESA 2QQAA 3NWSA 4GYIA 4KYWA 2UXXA 5CCAA 2R7QA 2VGNA 1WHMA 5M3MJ 4EZ9A 3BF1A 2DOAA 4B6MA 3GOIA 2LKSA 4F4KA 2WADA 2XAGA 3FHNA 5CYVA 1XG7A 1GDTA 4DV5K 2DD4A 3RRHA 3I56A 1Y56A 1BW5A 2YUPA 5EC7A 1R58A 5A2QO 4DTRA 5CY4A 1WLPB 2V7ZA 2F8SA 5E8GA 4L0YB 4X65K 2VVKA 1VQLA 1SL1A 3CC4T 3OYLA 1MIJA 4DR2K 1TS9A 5JVGL 4OFAA 2CZ1B 1W2BA 1ZK8A 3ZSVA 3BF3A 2E1MC 2V8KA 2KIUA 3OL4A 1XUPO 3J7ZO 1F1BB 1D1BA 3K2PA 1M3BA 2M3AA 3EH2A 3VQ5A 3EFOB 4IVNA 3VODA 2ID6A 4OGCA 2MLGA 2BE9B 1VK0A 3CUOA 3BJOA 2L54A 4M7AF 2DA7A 1IKYA 2DMQA 4K8XA 2HNYA 2DX1A 4DZPA 2XGCA 4B9VA 1KXPA 3K9JA 5BNGA 1HA8A 2RN7A 1FKPA 1NKCA 4N5SA 3WG7H 4M3FA 1Q86R 4YOXA 1NTCA 1JKPC 4HUEA 1M1KC 4HX4A 2NRHA 3C7NB 2EV6A 3CCRN 4NLBA 4CEEA 4OB1B 4PSWA 4XM3A 3TL4X 4CIFA 2HVRA 2SEMA 2ZCFB 2EA2A 4DSEA 1HBXG 2GF7A 3JTGA 1RI0A 1YOVB 5EEHA 4KDPA 2JZ2A 2D1XA 3MXIA 2D0AA 4KTQA 1WJ5A 1ETQA 4E6KG 3CXCP 2JG6A 1KG7A 3OSSC 1IN6A 1SZ2A 4DSLA 4H4OA 2QQRA 2D0CA 2M16A 4I2OA 2JA7J 1XSVA 2CSOA 3TCJA 3QWXX 2ZMEA 4CHZA 4C92A 4DLGA 5LHHA 4HCBA 1GOBA 4CJFA 4FJXA 4LH5A 1YJNQ 3OVNA 2F9WA 1XTAA 4KHNA 1T56A 1GXPA 3IRRA 3JAMO 3DLLF 1I4K1 4EMHA 1FYLA 1WEFA 1LFBA 2P9NB 3KP2A 3ATUA 3R6SA 3CCEN 5GAN4 2JMAA 4B47A 1VTNC 2OZ6A 2YSRA 1E6HA 2ID3A 3WTWC 1G3TA 2F4IA 1K6OA 3S2HJ 3HPGA 2IVNA 2RV8A 1K4US 5ICFA 1T3SA 1KTQA 3G6EQ 4IRHA 2IPOB 5A2QK 5GANh 4M7YA 2E5KA 2AK5A 3ZMUA 5EDNA 1BHLA 3TAGA 4CC3A 1FOXA 2IIRA 1N9SA 3LGFA 1D9FA 3S14J 2QKKA 3MAJA 3TSUA 3EGDA 3CCQI 3PNTA 1S72T 2OTJN 1M2VA 2CW8A 3O08A 1HD3A 3GDQA 2RAEA 4EFHA 2P6TA 1BI0A 3I9QA 3CJTB 2XK0A 1TYQA 4FO0A 2W6KA 4YDUC 5KGXA 4C30A 3PIPF 2WV0A 1O4XA 3RKQA 4M7DF 1NJIR 3KD1E 2Y75A 2F69A 1B6AA 4KT5C 4QS8A 1D3BA 2BIVA 4HWIA 3VYRB 5GJWB 1D8KA 4AFQC 3VA0A 3RKWA 1OPKA 1ZBHA 2OTLA 1UCRA 1UTIA 1FTTA 3NHGA 2DFIA 5GADP 4KN7X 2VYPA 1PP8F 2VUBA 4XLNF 1ZBIA 1UGQB 4LD0A 3KZIC 4IUPA 4BR0A 3AARA 5I3UA 7AT1B 4U7BA 4CRIA 3FEOA 4ZYEA 3L2RA 2EJFA 3CMEI 3ZEUA 3TAQA 3OSFA 4Y17A 3G2BA 1FT9A 2AP1A 3HUGB 3H45C 2AKLA 4BRKA 3GL1A 1I6HJ 4RW8A 3FZMA 3LYIA 1X69A 4DB3A 2AHJB 3MMYB 1T3VA 2BHZA 4LDWA 3N0UA 5CKTA 4KIFA 3VS4A 3PIOA 1RDUA 1KEAA 4JP0A 4AH9A 1U5TB 3NARA 1H88C 2FBXA 2I7PA 4DV4K 1MNEA 2UV1A 1KJWA 2ZMEB 4C92B 1XNQK 2EYQA 3MXJA 2L8DA 3D5SC 3JAMK 2F7TA 5D5VB 4J2DA 1WYXA 1VRTA 5CKBA 3PO3J 4QTRA 3OSVA 2DT6A 5KN9A 5HK0A 4HLXA 3P8DA 4E1MA 3MEWA 2UUCK 3K4LA 3E9OA 2X4XA 2LK2A 2RHIA 2P8TA 3CCRT 3WQUA 3O1BA 3AAQA 3QIIA 1K4SA 3MKLA 3G25A 5B1AH 4N4HA 3EZ5A 3I5RA 4LDXA 2VONA 3K4JA 3WU2C 1NG9A 4ZDPA 2VV5A 2B5JA 3JRIA 3VFZA 3LQQA 1IV8A 4DU1A 4Z6YA 1T8EA 3CXCA 1M2VB 1G2BA 3EYZA 2DPDA 3J7AY 3LWLA 3H1CA 3LLRA 2E7WA 1M1EB 1TYQB 1UGVA 3QIOA 1X58A 2M8GX 1JLGA 3EN9A 4DQIA 1VQPN 1RNHA 1NOYA 4YOQA 4FYXB 1JGSA 3K5OA 4IG3A 2I5JA 1E3PA 2KXCA 2VQCA 3DRRA 2LKXA 2JM9A 2D1VA 2DL7A 1L3VA 4PJOG 3ABLH 2J6FA 1SQKA 1S1XA 4GYGA 2O8EA 2EFWA 2EKHA 3CC7A 4PL8A 3H8ZA 4Z4FA 3QBXA 4KO0A 5D3GA 4R56A 4IPAA 1OR7C 4AHRA 2M2EA 4BE1A 4I9QA 4B48A 1SFKA 2QVOA 4Y4RA 1SD4A 1LV5A 3SD4A 1SSFA 3M5RA 1XQHA 1G3YA 3CCEI 5B5EC 2R7YA 3IAYA 5AFUH 4F3OA 2YCHA 5LJ5g 3DU5A 4KT0E 1Q9YA 4B24A 5F6FA 5HBMA 2OA4A 2DU9A 1XNRK 2IDOA 3DTKA 2OTJT 4PCQA 3F72A 3TQNA 4X6AJ 1ZREA 3SJHA 1Y71A 1KC8R 1B92A 1RILA 3RMAA 1JJ2P 1RDWX 2HBWA 2HSPA 4XLFA 2K85A 2VKVA 2ASPA 1R22A 1LWEA 2KRFA 1S22A 1QP2A 1N75A 1TNTA 1N8RU 1XCBA 2XIGA 2IS3A 2G7HA 2PEXA 1GOAA 1DPUA 1UMQA 3TTFA 4AIHA 5K5OA 1PRLC 4WQ4A 5LGTA 3SWNA 2UZKA 3LWFA 4AIKA 2FHDA 1MMNA 4AM6A 4LUEA 4FETA 2JGUA 1OH7A 3RQ4A 3P4IA 1VSDA 3TTCA 2OJ2A 3HBLA 4F91B 3VPZA 2RPIA 9ANTA 2DO3A 2DRMA 1XHXA 2NUPA 4HTUA 5KYXA 3LWMA 4AFUC 3BR1A 4MEXF 4F93B 1IBKK 4CFBA 1YI2A 1Z3XA 2H09A 1F9NA 2RQUA 2L0AA 3KWGA 1MZBA 1FKOA 4OMNA 2ABLA 3LAKA 3BLYA 5HRSA 4I99C 2DYBA 1NPRA 2WTUA 4M77B 1XG1A 3UT1A 1ZUYA 2ASOA 2GV9A 1JU5C 3QFUA 1KU3A 1VQKN 2P51A 3BZCA 1FBUA 3UA7A 4PKCC 4JBAA 2CP2A 1BR4A 5HRRA 2QWRA 2V7YA 3H3ZA 3LP1A 4I09A 3IP4B 3S6WA 3LAMA 4M7AD 2L02A 3OHRA 3W2WA 2XB5A 2O8EB 1SFOJ 4XH5A 3TU5A 4KRFA 5I21A 1VQ8N 4ISEA 1WHUA 3RPUD 2B4JA 4CBWA 4JRIA 1OCTC 1WSHA 4L3QA 1BW6A 2CGPA 3T9NA 2X78A 3VQPA 3S93A 3JCMf 5C2FA 3SDBA 5FO5A 3PFSA 4RLFA 3G71N 1YJ9N 3V1OA 3AVGA 5LEKA 4ELUA 2OJED 4DV7K 3CD6N 5ICCA 1NYFA 1R59O 5HODA 5AQUA 1UG1A 2F4OB 3QXEB 2O4IA 3MN9A 4I6MB 4C8MA 5LL6Z 3H3UA 4JX5A 5GAN3 2E2IJ 4A3IJ 5M1KA 4FJ9A 3DPLC 4A57A 4G7ZF 2GWKA 3DKXA 4CGZA 2GGRA 1FP2A 1X6BA 4E7HA 1YNZA 3CCLN 2XRIA 4BJTA 4XICA 3H5RA 3CERA 4UVBA 1XMKA 4ESRA 1JTYA 3SV4A 3R0AA 2PI0A 1VQPT 4JX4A 4J2BA 4ZC3A 2NVUB 1D0XA 1RACB 2RN8A 3GTLJ 3ZT1A 1L3LA 2ED0A 5E1WA 4IHSA 4B09A 3M8RA 3CCVA 1X1PA 2RVCA 5JVTA 4MMKA 1TUYA 4CZCA 1EP4A 1A5XA 2E60A 4ITVA 3CBOA 4BGDA 3CCUA 5JS2A 5F08A 3SWNB 4FE7A 1N5ZA 1M90U 2Q3SA 4UHTA 3E6BA 2P0WA 1IRXA 1J9IA 4ID1A 2YNIA 2NYSA 2RREA 1FYKA 2WC9A 3A0HC 4J8OA 2NZTA 5D4RA 1RAEB 4B1XB 4U0YA 3QJYA 1JL2A 4HQMA 1MGTA 4ILJA 4N4GA 1O57A 2RH2A 4CZJA 3H9JA 3RTRA 1GBQA 1YYVA 3R6OA 1KVAA 2FX0A 4IFVA 5AQHA 1LDDA 1DU0A 2YG8A 1VQMQ 2KMUA 4HF0A 4UXNA 3NPFA 2A5XA 1PUFA 2CUZA 3ZSRA 2KK4A 5AQIA 3F10A 2FBTA 3U6FA 3M5AA 2KVQG 4JDSA 2PMZN 2Z9OA 2QGFB 4KBMB 2NVXJ 3T19A 3SLCA 2DNUA 2HMIA 1TNSA 3Q0WA 2HPMA 2BH1A 3B6PA 2VBXA 3FGUA 3MEDA 3KFWX 1LE8A 4DR4K 2E12A 3A2KA 2BXZA 1H641 2CP6A 3N4QA 3BEXA 4C9YA 3OYDA 3J7AF 2R7DA 4BJ6C 1K73R 4GXOA 4A6EA 2R5ZB 4BDZA 2X35A 1ITGA 4LF5K 3OYCA 1NMNA 1WI7A 3M8QA 4DFPA 2LY1A 4A5MA 3EUKL 5GANg 2COBA 1L3TA 1HJRA 3CWAA 1V4TA 3JR9A 4CZEA 5C0MA 2GELA 3E9FA 3G10A 2ZXJA 3BC8A 3QDKA 3TREA 5KI6A 4CESA 4BY9C 4G6TB 1B34B 2KNBB 5IN1A 3VUBA 2F1LA 1QZ6A 3KNTA 2F6CA 1Z7LA 3UKUA 2MOXA 4FZZA 3NAUA 2EQRA 1K9MR 1F43A 4CC4B 1YXQA 4BI3A 1UGRB 3F22A 1ORNA 1P90A 4HVVA 4ZHRA 3SPZA 1FTZA 5HDGA 1C0TA 1VQKT 4AIJA 5L3GA 3ASOH 4I98B 1UGSB 4RTUA 2LP0A 1XPXA 4W97A 1G5VA 2L7KA 3ASMA 1B9FA 1T2KA 3PX4A 4C0FA 4X1EA 3RZOJ 1RKWA 2ZPGB 3CIPA 1U45A 2VLAA 3BR0A 5IHIA 1VQ8T 5LMNK 3QICA 2W42A 2JT4A 5FKOA 4XEIA 1E4GT 1FIAA 3OS5A 4IUVA 3SHFA 3M4YA 4FU6A 3FZFA 2XVCA 2YDLA 4B1UB 1XC3A 4X9CA 2Q2EB 3G71T 1YJ9T 1OH5A 3S41A 1ZSZC 3CD6T 3I56I 3MP6A 1JKOC 4YIRX 1BJZA 1IO2A 2K5LA 1U49A 5F64A 4PJOE 1HQCA 2DL8A 1MBJA 3VS5A 3TO9A 2EQKA 4IOXA 1IZ6A 1VQLI 2VQLA 3H9GA 4JJBA 2ZGZA 3OWTA 1YJ9I 3GW2A 2P81A 4R0KA 4CEDA 3JSMA 4LFBK 3CMAN 4ESBA 3CCLT 4PJOC 3PL8A 2CV1A 3CJNA 3CD6I 3NFCA 2DT7B 4E47A 1OKRA 4DS5A 2P0PA 5J2MA 2OU2A 3TAPA 4J01A 1WSJA 3GBGA 2XSJC 3PO4A 2YJFA 1RLPC 1NEGA 3RESA 1JLQA 3QOPA 3AFHA 4V19K 1N5YA 5JVGF 1UJ8A 1QVPA 3WU0A 4KA4A 1UHMA 5AQRA 4CHPA 2DVEA 3IWZA 3I58A 3LOCA 3FZKA 3QWLA 4LG3A 1U8RA 4MDBA 4N41A 1ZRDA 2NRWA 3HRTA 1IN4A 1ITYA 1A5WA 1YHQQ 2EJ9A 2FB7A 1MDMA 1YCSB 4K8ZA 3UKUB 4CIGA 3UKRB 1IG7A 5H20A 1BI2A 4PA1A 3L2ZA 3BT9A 3UE5A 1NLOC 3GPLA 5F1RA 3PM1A 4M3DA 3SQ4A 4NQWA 4WQ5A 4M6XA 1Q7YO 2ROLA 1LWCA 4OGEA 2P9UA 4MDXA 2DTIA 4TVRA 1JT0A 3M0UA 2W6LA 5T7BA 4ZDOA 1BGXT 1HLUA 4RW4A 2WV1A 2XB0X 4KH4A 5CAIA 1IXDA 3ZMZA 1XCVA 3F73A 1E3OC 2ZM6K 3IHUA 1X6GA 1N6QA 2R7SA 1PVSA 4R79A 1YFNA 2QEXQ 3HSBA 2HOSA 3CQZJ 5JS1A 4CGHA 1UHSA 1VQNQ 4Y7NJ 2RI2A 3QEWA 3QFPA 2CGJA 3CWUA 3VA3A 4NBQA 4XLEA 3QZ9B 2XDDA 3CCSQ 4M4ZA 1XQOA 1R5GA 2JQ7A 5FLVA 1IF1A 2MGQA 2X9HA 1D0ZA 4DSJA 3GMEA 2RDPA 3CJAA 4O3MA 1PRMC 3AO5A 4DEXA 2QDYB 2VN2A 3WNGA 3K1MA 5AQPA 3WTTC 1VQ7A 1RT2A 2HZDA 3UKGA 3M3YJ 4Z4IA 4CZFA 1PSEA 1JHFA 2P7VB 2L3RA 5KH6A 1I5ZA 1VQOA 1JCEA 1TWGJ 3E5XA 1ZLJA 4CCHA 3QYBA 1WLJA 4BROA 1B9NA 3QODA 1WHJA 3SEMA 1HKSA 2DEQA 2E3IA 2JK3A 1JXEA 2M9UA 2VWFA 4XH4A 1PHTA 2EV5A 3CEYA 2YHWA 2E88A 2DCEA 1P59A 4RMOA 2MFZA 5FU7B 3ITHA 3DLKA 4M7AA 3W6KB 5IYBJ 3SUOA 1TUUA 3OYGA 2F5CA 1Y7XA 2DJQA 1V5GA 2HHSA 4AHSA 3UDCA 3CYMA 1RTDA 2DA9A 2OTLI 3G4ST 4Y15A 4FK4A 1YI2N 2FXUA 4DK9A 1QSLA 2VJIA 2L3SA 2A6AA 5D5WB 4FIBA 2PYJA 3UWNA 3WG9A 3AO4A 4FX0A 5M1QA 4U88A 4G1QA 5J2NA 3HOYJ 1USSA 5DS9A 1HKBA 1TG0A 5ECAA 4O55A 2DLPA 2FO0A 3M57A 3MECA 2G9WA 3A98A 2QXLA 5CKDA 1VQ9A 3OMYA 4GKJK 2XC7A 1YJWQ 4ENNA 4KI4A 4A5NA 2ITGA 3M9AA 4IRIA 4Z4HA 5GJVB 2A3LA 4FJMA 5BPDA 3W3CA 4K25A 1VQ4A 1A6IA 2GWRA 5H1SQ 2GEMA 1WHHA 2Z1HA 3CMAT 1FY7A 4M7XA 1Z91A 3QBWA 4XU3A 4LJZF 3TOBA 5DLQE 3E7LA 3KP7A 3Q9SA 3FWEA 4EA5A 1WGXA 3KP4A 1NYGA 5GAMj 3KCCA 2KZMA 3H35A 1IBMK 3B6CA 4XBFA 2XAFA 2A3ZA 2LD5A 2HMPA 3WTVC 2Y9ZA 2ICWG 1FOKA 2Q0UA 1SFEA 2E41A 3PIOL 1KQJA 4Y28E 5C42A 3DLLA 1R71A 4FOIA 3U9DA 3U1KA 4C8QF 3M1CA 5C12A 1XC9A 5KCOA 1C0UA 2V1XA 4X9DA 1XHZA 5C24A 3M07A 2E5NA 3IHOA 3S3OA 4RTYA 2ZF5O 2DY4A 1POGA 1R49A 1FIPA 1OYIA 2K5CA 1K8AR 4DCHA 3CCMQ 3NMZC 2RI5A 3SZTA 2K2VA 2EILH 3F2KA 3OIOA 2JPSA 3L7WA 3VF4A 3KBGA 4KHSA 3RZDJ 3TWHA 3EAEA 1OOTA 4HV6A 3CCVN 5GMKj 3TW6A 5C4XJ 4O0JA 3T7ZA 3F8FA 3LSHA 3LL3A 5FGMA 2Y0SN 1W4SA 5AQZA 3N4PA 1ZC6A 4BG8A 1S9HA 2NS8A 4NC6A 4M78F 1T7PA 3PIPA 1N8RC 1BL3A 4Y52J 1A35A 2G8KA 4M7DA 4J00A 4AT1B 4C92G 1C0WA 4M7AB 1TKZA 3KTQA 2M0MA 3FM3A 4LLLA 4HXJA 1RRJA 2MD0A 5JLWA 4DYCA 3EKUA 4B9SA 1KCFA 1U0JA 3CC2A 4CF0A 3CC7I 1XTDA 5DYMA 1DIZA 4YOYA 3QPTA 2XHCA 4I0AA 1WDXA 3FDRA 1SRLA 2E5ZA 1M3AA 3QKJA 4E7JA 4WFAL 4PGHA 1XMOK 4DBRA 4MO7A 2YRDA 5FLMJ 5CHZA 3REAB 4CZGA 1D5AA 3EUAA 1ETVA 4M75G 4M72A 4KB0A 1Q81R 5IOYA 1SKRA 4YNQA 1VQ6T 2O31A 2VWBA 3OS2A 1NK0A 2EGEA 4RTVA 2PUOB 1SANA 2D6FA 4J5YA 3H6EA 3CLOA 4XU0A 5HLHA 5KRSA 2QA4A 4PKHA 3JB9G 4DQQA 2VIXA 2W24A 4AHCA 4QLCU 4UNFA 1D5VA 2NS0A 4BVPA 4D7MA 4OMLA 2LG4A 2YX4A 3LFUA 3CMYA 2W82A 2CQXA 3LA3A 1YJNN 1G4DA 1RAGB 3Q5FA 4LD5A 3W0LA 1XB4A 2VL8A 3SQNA 4A3FJ 1QVFP 5LJVA 3OW2S 2H8WA 2NRTA 1MUYA 1IGUA 4D5FA 1RBUA 4FSSA 5D6YA 3ENOA 2LMDA 4RDUA 2LNHB 1HDDC 3HZJA 3ZRGA 4GGGA 2P9PA 3KLGA 2ZSIB 1AWOA 3LCNA 1WJBA 1AHJB 1ZBSA 1LFUP 3BROA 1JCFA 3HL8A 3G6EN 6PAXA 2DVJA 2HDDA 1KQ2A 3NVKA 1YI2I 4CD1A 1QVGP 3SZ2A 2FSNA 3A2FA 1I3QJ 3O4WA 3FDYA 4HYEA 3CWSA 3FZVA 1KA8A 2FJ1A 4P96A 1JXSA 1HKQA 3S6IA 3VF2A 1NK7A 4MGRA 4FCYA 5HS7A 1L0OC 5IYCJ 2PG4A 3O8GA 1Z7UA 4B1VA 1XGOA 2HVSA 3ZSZA 3QDFA 5J4YA 4Y91A 1HKCA 4CJRA 1WI9A 3C7JA 2CZ6B 4DR1K 2K86A 2X4HA 1SVOA 3IKVA 1U4BA 4OB0B 2XKOA 1LPQA 3FSPA 4KFCA 4M3BA 1JRIA 4BRCA 1K76A 2NOBA 1QZZA 3FBIB 5FLXZ 2O5RA 5D8KB 1QTMA 1GOCA 3N05A 2DF6A 1M90C 4BUPA 1LWVA 4JK7A 4L5IA 2STTA 3CESA 4BBSJ 2K6DA 3VU3C 1BCMA 4N0BA 5AZJA 2VJJA 5HDKA 2YUSA 3E66A 5ELZA 4RTFD 5J8FA 3F9MA 3GF5A 3DKWA 1CSKA 5LHIA 3ZETA 2NVYJ 4BHBA 1O3TA 5DDGA 4DGWB 5BS6A 1KQ1A 3VSKA 3CFPA 1S1TA 2FNAA 3T8TA 2XIDA 3LP2A 2DYSH 2OUMA 4IO9L 1ZR4A 1USTA 2LC2A 4O0IA 1Y97A 3QQAA 1KU7A 1QS4A 1Z21A 3SJJA 3ZYYX 3AHUA 1KLNA 4BR5A 2IGOA 3IFRA 3SFIA 2OPRA 2DL4A 1HSJA 4M77G 4KTWA 2X1CA 1JLFA 1JXMA 3QLHA 3MEGA 1KVCA 3KZZA 2XSDC 4PIIA 2CU7A 4ZGJB 2C0TA 4BACA 2XD0A 4PNOA 2FU4A 3CCQQ 4AVPA 3CCVI 1T0FA 1ZR2A 5BPIA 2GUIA 3VEXA 4LFAK 1VIEA 4BQNA 1YF5L 4QVDA 3BTIA 2WY8Q 2E71A 2OF7A 2KROA 4CZZA 3THKA 2E10A 3HC7A 3AG3H 2BY1A 3O5ZA 3QETA 1TKTA 2CYYA 4IURA 5J1YA 1BOAA 1S7EA 3HPHA 3JRDA 4C0DB 4DUZK 1B72B 4HSBA 5KQ8A 2NVTJ 4BRFA 3M4OJ 1QZ5A 1CZAN 2E5QA 1A04A 1LMZA 3THVA 1QHGA 5E41A 3H0IA 3CPWS 4EMKC 2VBZA 4TV7A 5GAOp 1N9RA 2DXCA 4UUTA 2E6MA 4AF1A 4JLGA 1TUGB 3M3ZA 2QXFA 3L2CA 2B6AA 1W7PA 2FBYA 3QEVA 3VEYA 2JRMA 3MWMA 1HRHA 2V1QA 5KVRA 3KXTA 1O3RA 2E65A 1KG5A 2MLKA 5DM7R 4OKEA 1JUPA 3CMEQ 1R23A 2H8RA 5GMKm 1DGRM 4XOPA 2Z0WA 2BTTA 3H1VX 4JYAK 3LSKA 1TGOA 2X3WD 1RDAA 2QM3A 4ESJA 3PMTA 4W5TA 1YJNT 1J0RA 2YXYA 1WKMA 1VQ7N 5E3LA 3V8KA 2DA3A 2HQ5A 3W6JB 2M0YA 3MFKA 1SPKA 5L8RE 5GAOm 3CDHA 1PP7U 1RDBA 4HNUA 1T6CA 5AZJB 1YQKA 4RGSA 5K1YA 5IT9O 2DLLA 4DU4A 3DM2A 5H6QA 2A07F 3LANA 4XKCA 3ZETB 4LDUA 4XTXA 3ISPA 3G6ET 4YTLA 1YN8A 1HNWK 5GANf 4H0EA 2GAUA 4AIAA 4BGBA 3SQ2A 1QVGA 3GFLA 5CO7A 1ZLKA 1DP3A 1D1AA 5AFUA 5M1PA 2LRDA 1S1VA 3WTYC 2RJEA 4ENMA 4Y1DA 1XDSA 4OLAA 5J1UA 3E9GA 5CVJA 3C18A 1J75A 3ZQQA 4EDUA 4BBRJ 2YRVA 4BI8B 2P1JA 5J2QA 1KYWA 5DD4A 2K4BA 4AFZC 4BQOA 5FPMA 3GO5A 1GRIA 4A2BA 2FRYA 2HU9A 1ZXOA 3O4NA 3OBYA 3W6VA 1DGKN 4UB8C 4ZGDB 5LJ3h 1ULYA 5FPNA 2A08A 1RT5A 2VE9A 2XY6A 4M3TA 4NNJA 1J53A 3DBHB 3DKYA 1MWKA 4HVJA 2K9GA 2ZJ2A 1X1AA 2QUFA 2K3BA 5GAEP 2B0LA 4BRGA 2DEUA 4B1RA 3H0DA 4A59A 1WXUA 1BQNA 4LGWA 5BRFA 3L42A 3SPYA 2BHYA 4DFJA 2KRNA 3IRXA 3MN5A 2DXBA 2HI3A 3FXUA 3V8JA 3ZSWA 2O7OA 3O9SA 1HJOA 4E1JA 1K8KA 3WU1B 1YRNB 3FXRA 4C92E 2MCNA 4YRVA 2PBIA 1ETYA 1PNJA 3NH2A 1GLFO 1VSHA 1ZUUA 2J5PA 3ID6A 3MAQA 5D6EA 4GW6A 2Z99A 1S1NA 4IJAA 4BU2A 2PQ8A 5E8IA 4NCAA 2O0YA 3OJSA 3GEZA 2RQVA 2HXOA 2HR3A 4A2AA 1KZHA 1X9JA 5BPMA 5EGOB 5IYDJ 2IG0A 2AQFA 3KLOA 2IAIA 3CCEQ 4M7DC 1IHWA 2GQIA 5FRMA 2XAUA 4E1NA 2IS6A 2K9MA 2NLUA 1FMVA 2HS5A 2FBIA 3BW1A 4IO8A 4DOVA 3SMSA 3CZ6A 2K9NA 2FD5A 1XX5A 1BK2A 2CP3A 3LDPA 3M6GA 4M75C 2OQGA 5IT9K 4LFUA 4CEOA 2JS2A 4HUFA 1MPGA 1WHGA 2GQVA 4KITB 4LY7A 1Y8QB 1UHWA 4BXUA 4CZKA 4U7DA 2JS0A 5HL7L 1KVBA 3HGGA 3QU6A 4FJJA 4RG8A 4Q47A 4CJ5A 1E6GA 5DUKA 1Q86O 2FSWA 5AT1B 4B3TK 4C5HA 2NWMA 4IHVA 3JREA 2EGCA 3H3OB 3ERMA 2Q1ZB 3PFIA 2CS3A 1HX1A 4LXCA 4DBFA 2RJFA 4CJLA 4XLPF 5KYYA 2HHWA 1UB9A 2ME0A 4IWVA 2G8UA 3DLAA 2HVHA 3AKZA 3AVBA 2JA5J 2CYZB 1MSFC 2HBJA 1SD6A 4CHYA 1WPYA 1W36C 3CJRB 1EA3A 2GM4A 3BOQA 3QPHA 1HCRA 1RUWA 4HDVA 2UXDK 2EFPA 2Y1IA 2O03A 3A8HB 4M3RA 3IC7A 3SMPA 3RSEB 1AWJA 5FROA 1J54A 1WSFA 1C1AA 1AKHB 1M2OA 1I07A 4O8KA 1TUDA 3WXKA 1KD1U 2O9SA 4P55A 2IGMA 1ZH5A 1GLEG 4Q5SF 5A2QE 4B9TA 4BJ5C 4XL9A 4WCEL 3O6WA 2W10A 3LSTA 2DMPA 4JRKA 4EA4A 3BE3A 2W48A 1U9NA 4IIOA 3A5MC 2EZLA 1BWFO 1HNZK 2JUFA 2CG4A 3C6UA 4JI0K 1N3CA 4QPQA 2M9HA 2IS2A 2J6OA 1VQ7I 5HP1A 2X1EA 4EGZA 2HW3A 3E6MA 1NKEA 3FC3A 2RQTA 3PO5A 2QA4N 3V4GA 3OYHA 4OVLA 1N34K 4G8XA 1IW7F 1VQOI 1U6ZA 1VRUA 3K1PA 2KT0A 1VQMN 2AJQA 1A31A 4B3OA 2AS5F 3CQ8A 4EVVA 2ESWA 4MHGA 1FMWA 1Y96A 1T0HA 1IJJA 1TAQA 3D7EO 3L4IA 4FWLA 4DV6K 1Z25A 2XKOC 5KYUA 3X24B 1I50J 3F70A 3JRBA 5M3FJ 1ZKGA 1JLCA 1FLIA 4M3XA 3BDDA 1DGWY 2PY5A 1WQ7A 3GWZA 1MNMC 3V9UA 1NJIO 1Q82R 2PTKA 1AEYA 2NUTA 3TOAA 1M30A 2GZWA 1NH3A 1U1SA 4A3LJ 4M77E 1YCYA 4FPAA 3U9ZA 3O4QA 2BOLA 3NH1A 2OZUA 4UV8A 1XQPA 5M5YJ 1OCZH 2K9QA 1KAXA 1A0NB 3HYFA 4FLTA 4EPCA 3SXYA 4M77C 1ZLMA 2XHBA 2L5QA 1APLC 3CQTA 2Y1JA 3GZ6A 4OO1J 4OKJA 2FPEA 5KYYB 1TQPA 4AM3A 5HROA 1VQ4I 1MH4A 4UUSA 2EYZA 4UC4A 2H94A 2QBYA 3JAME 4FSXA 1SV5A 4OAZA 4OPJA 1XSXA 4DIQA 4FZYA 2XDVA 3JCUC 2RE2A 2MC4A 5KYWB 3I55A 4F2SA 4O5VA 4FLUA 4MO4A 4MLOA 4ZYDA 3M55A 1WJCA 1YWPA 2RMOA 2E2OA 1LNWA 5EY4A 3X28B 2HOEA 4G94A 3NGIA 3ECHA 3M54A 3WHCA 3DBLB 3TGNA 3MK6A 1ZQ3P 3NGZA 3WTUC 2O8KA 2K3PA 2EB7A 4BXFA 2LY9A 4G9YA 3JCMJ 3QIPA 2M4GA 1F21A 3KZBA 4LK0F 1IRGA 2WBMA 4OIQF 1BB9A 2AZSA 4ISFA 3KUFA 2D0NA 4W5QA 3V9SA 5KYNA 1YQLA 1ZA1B 2V6CA 4Z94A 3U3YA 3ABTA 4CK3A 2K40A 1HQUA 4KHPK 4E7IA 1VQ5A 1NGDA 3ZSXA 4KUDK 1W4MA 4OMOA 1ACMB 4KRTA 1Y96B 3VW4A 3ZQLA 4JKAA 1V5EA 3DB4A 3TEDA 1QP3A 1DPRA 3OMGA 3U3GA 1OYXA 1RTJA 5KYUB 2UUBK 2XAJA 5AIPA 3OW2M 2EIMH 3G73A 2VKDA 4R1HA 2HXIA 2QZ8A 3H36A 2FG0A 1VSLA 3LP0A 3IMXA 4AHTA 2XGDA 1SL0A 2ZBKA 2L4MA 2MAMA 3IRQA 2EJRA 3CC2I 2HPIA 3VEZA 1RBTA 5H6RA 4ZZLA 1RFQA 2YHAA 3PIPL 1ZBUA 1PD1A 5CYQA 1IUYA 3KK7A 2QDLA 4PQUA 2DAQA 2LNBA 3I9V2 4DJAA 2OZSA 2XGEA 2W04A 2P4TA 3LPUA 3AA3A 2KHMA 4M3EA 2DI3A 4HQEA 8ATCB 3CTAA 4C2TA 4ZDLA 4CYCB 1W7AA 4PJOF 1RIOH 2QA4T 1YHQN 2R7TA 4F7UB 3MP1A 3G7ZA 4C8OA 1JKHA 1HSQA 5GAMd 4J9EA 1NK2P 2QBYB 1RESA 1VQMT 2HVQA 3O9UA 4GO1A 5BR9A 1N77A 1P2FA 4B23A 2G3RA 1BR2A 4I01A 1FK9A 3V6DA 4IEIA 1G15A 3N97A 4EV0A 3VERA 1ZBXA 2QA4I 3I56Q 1RR7A 4ELTA 1R5ID 5EF6A 1E17A 2KR3A 1JKQC 2C0IA 1YW8A 3IKTA 5GAN2 1KC8O 2JSPA 1WWXA 4ABZA 1U2VA 1IDYA 1SSHA 1WOQA 3X25B 1VQLQ 4DFKA 3K4BA 2CP5A 2KL4A 2QEXN 3M9QA 1YJ9Q 5BR8K 5GAEJ 2HHUA 4BQLA 1CZBA 3ZMTA 3HM8A 3CD6Q 2DFHA 2NUBA 4C8QA 1RDCA 1EKEA 5D8LB 2E1HA 2B8AA 4E4HA 3CCSN 3I33A 5KNLA 3L0QA 4BC4A 2H6BA 2PJRA 5FU6C 2RA2A 3LL7A 2IIMA 1RTIA 1TW3A 3P31A 1AOJA 4ZZDA 4KKOA 2IBDA 1OQYA 2LZ6B 4H5RA 1G59A 4IHTA 3O8HA 1ZHFA 4D5CA 3AGKA 4XTYA 4XLHA 4DTUA 3HT3A 4C0GA 2Z1DA 1PWTA 3KWIA 2CT3A 4KUIA 2DDAA 2E2JJ 3WNHA 4EGYA 2VBWA 3VQEA 3G3ZA 4M63C 2O4XA 5C25A 3LSIA 4M78A 1HNIA 4G6QA 3S2DJ 1KIKA 4BRQA 4K42A 2KRCA 2ZNZA 1D8YA 5D7UA 3ECOA 1QQOA 2OI3A 3DWLA 4C8LA 5AZIA 3JRFA 3FK7A 4OPHA 2RK1A 3HM9A 1WPKA 4EJZA 3PQKA 4HZFA 3S1QJ 2CGHA 2Q36A 5AQKA 2K27A 1QQNA 1ZSGA 3GIBA 2M1HA 3PV8A 1SFXA 1KGSA 3TW7A 5GAMg 1FOWA 1ACIA 1MV3A 3CPWM 1OCPA 1YW7A 1LPLA 4P5OA 3FFKB 2WUSA 5JHFA 2HKNA 4H0XB 2R5YA 1IKXA 5HKCA 5GAOq 2EPFA 4DF8A 3S15J 4D6WA 3LA2A 4DTOA 4EP4A 1I3AA 4DZJA 2ZNYA 5J40A 4EATA 2DOEA 4BY6B 3LW5E 3KK1A 3PUFA 1AOYA 2DFFA 3C2HA 2K57A 4F3TA 3EKSA 1G3WA 1ZGAA 3BGRA 2EK5A 1ENHA 2MH2A 1Z6RA 3VB2A 2EYWA 3M0PA 3MZHA 2HMAA 4Z4CA 1WH5A 2NRAC 4E7SA 4RAYA 2CGKA 2FSKA 3VPRA 2GIVA 3HP6A 3EO3A 4DTMA 3GCMA 3AL0C 4M6YA 1TL8A 2XHIA 3P8BB 2LFBA 4QCLA 1YAGA 1OCCH 3ME9A 3KK3A 2NOZA 5AQNA 1U6GA 1HYZA 1LFPA 2P6SA 3ZSQA 4J7FA 8AT1B 1O7LA 2VKEA 4EM0B 4CERA 3A8GB 2OD5A 1U9OA 1YITA 4C8QB 1J9AA 1EV7A 1X2QA 4DTNA 2BY0A 3O9QA 1KQSS 2ZE2A 4JKDA 2ISZA 4CIEA 4L0ZB 2YU3A 4WF9L 5LJ3e 1GFCA 3S9HA 2HQEA 1PM3A 4FT4A 2CW7A 5D6FA 3L1PA 3CCMN 2DJNA 3I0WA 3TARA 4JS5A 2OTLQ 2KQWA 1M27C 3WTZA 1YHQT 2CV0A 3I8DA 4RB1A 5J47A 3DTEA 2XGXA 3J81Z 1NK9A 4JI3K 3NHNA 1ZX6A 3OR2C 3IG1A 2GX9A 4IFEA 1K78A 4MDWA 4E9FA 2KP6A 3TMOA 4MTEA 2EZHA 4JKFA 1F5TA 1ERDA 1OH8A 1ZBFA 1U48A 5LLQA 5F0FA 2XDBA 4OMYA 3EGXA 3DQVC 4N0AC 3OOUA 1H3HA 3LALA 2K2MA 3A5NC 3V7RA 4JKCA 2QEXT 4Y92A 1DLOA 4EW4A 5DUIA 5AZIB 2I5UA 1JLAA 4CH7A 3QHSA 4MO5A 1EX4A 4KN4X 1IN8A 2CREA 2CFXA 2HKXA 4RB2C 4EZ6A 1BA5A 2RKIA 1R36A 1OEBA 2X6WA 4A3JJ 3G0ZA 4J9DA 1U5SA 3CCST 4GFBA 3LH0A 1K73O 1OFCX 2KT8A 3VEWA 2FVUA 5CKEA 4M71A 2R5YB 2L01A 4IOCF 1N6AA 3C6AA 2Y30A 3N5BB 4KBOA 3D2EA 2DZCA 4JAXA 1P9QC 3HHGA 2OYQA 2ZPIB 2X6SA 2W0ZA 1ZRCA 3ZFJA 2E1MB 3KLNA 1RT3A 1Z9ZA 1J59A 4M3ZA 4YDUA 3A03A 3ASNH 3TABA 4UQGA 2IVWA 2LTPA 1JEGA 3UATA 3D7SB 3VQ6A 2YV0X 4M42A 1V55H 2PVOB 3HVRA 2HHXA 3IL2A 2RJDA 1SEUA 1BN5A 1K9MO 3O5BA 3U23A 3VV0A 4E6RA 4B9QA 4JV5K 4II3A 1H9GA 1QPMA 3E5QA 2M7BA 3PO2J 2PNIA 1IDZA 2KFDA 4ZTFA 1X1BA 1EETA 3Q0UA 4FM4B 1TW2A 4BRNA 4DYRA 2P4WA 1TU0B 1N78A 3OJUA 3FBNB 1QWEA 1TWHJ 1YIJN 4GKKK 4WFNL 2YNFA 1TWAJ 4LE9A 5CQGA 3QBYA 5CVRA 2Y31A 2HGCA 3O8VA 2YUOA 1BG3A 1GXQA 4OAYA 4H0TB 1ZBLA 3CC7Q 1Q1VA 3RWUA 3T0YA 2E64A 3V7SA 2Z33A 1YJWT 1AHDP 1KG2A 3CCJA 3O3KA 4P9FA 4MNUA 3SV3A 2CKKA 4E89A 5B1BH 5KCMA 1K78B 3VF6A 2GA1A 2O88A 3OW2A 4Q5VA 3N5NX 1R4MB 4AI5A 3URGA 1NZ9A 2GIZA 1FX7A 3BQZA 2KLOA 1YTUA 3J80Z 5HLTA 2BVLA 4U0VA 2KDOA 1BM9A 2RF2A 4CK1A 2CRGA 4J7IA 3IH2A 3V9XA 2L7ZA 2G7UA 1I1JA 1B59A 1KD1C 4QW2A 4RBOA 3CP2A 3QDRB 3RR6A 3FR0A 2OZMA 1GCQC 2UXCK 2W00A 2RN2A 2ECZA 1HJDA 4JHDA 3ULEA 3ATVA 1YT3A 4JKHA 4CHQA 2HSTA 4JI1K 2F2VA 2O2OA 4Y33A 1R6RA 5HOOA 3H0HA 2XV4S 4CJKA 4Z89A 5HK3A 1NHAA 1N27A 3D2EB 3JCMe 3F8CA 5LJ5h 3HGYA 4PJ0C 1QQJA 3CCMT 3I54A 4M6VA 2R93J 3QAHA 3C0BA 4HT9A 2WB1N 4KHYA 2FRWA 5F0XA 2JM8A 2JWTA 3M59A 1LWFA 5GPCA 4B9MA 2EA4A 5KPRA 1W2BS 3SEZA 5AJ3K 1W5CC 2L89A 4LDVA 1AZGB 4FL6A 3LX7A 2M87A 1NK5A 4DUYK 2UWMA 4BL0B 1YI2Q 1WNLA 1T3LA 1I5OB 3C1DA 4B3SK 5EZGA 1AZEA 1HKGA 3GZ5A 1GUUA 2VCPA 3VQBA 3L2QA 2V1RA 1OR7A 3ZN1A 2VXZA 4JJDA 4G6DA 1DJ7B 5DM6L 2G8FA 3NMUA 3DEEA 5KPZA 2NNWA 2W7NA 3FB9A 4BR7A 1YTYA 2PQWA 4A4HA 4FLYA 1M4ZA 1VQNA 3RMBA 2EGAA 4LNPA 3HKZN 4A5BA 2M7AA 1P4AA 2FEIA 2G0EA 4XN3A 2RHYA 2A5WA 4CZMA 4OINF 3H46O 4CJWA 1J09A 3K4KA 5J3LA 3F21A 4Q0BA 2CFOA 1MUDA 3QYGB 3M8EA 4Z0UA 5IAYA 1UDLA 4GNIA 3CUQC 4CJ3A 3MDQA 1B4AA 3H0FA 4IXAA 2FF3B 3P83D 2EW3A 1IKWA 5FB2A 2MIOA 4FJHA 3U2RA 2HHTA 5KCHA 1KRPA 2QLZA 5BMZA 4S04A 4A3BJ 3CMEN 4CCNA 3TPQA 3ZQGA 2QWMA 4CECA 2D2WA 4ZH4F 2Y69H 1HOMA 4FW2A 1GLAG 4Y13A 3V42A 2F2EA 2L3DA 2QF7A 3S32A 2DXUA 3H41A 1D4XA 1GLNA 4HHTA 1GLDG