3L2UA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and gs9137 (elvitegravir)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
365
structure length
365
Chain Sequence
AELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Retroviral intasome assembly and inhibition of DNA strand transfer
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination/dna
molecule keywords Integrase
total genus 100
structure length 365
sequence length 365
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3l2uA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3l2uA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3l2uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3l2uA03
4CRIA 1RT5A 1ZYQA 3VQDA 1TKDA 2NLUA 1UWBA 3ISNC 1JLCA 2MWOA 4HHTA 4DTUA 3MXMA 1U49A 1UOCA 2RKIA 1HNVA 2HW3A 1RT6A 1NK9A 4O44A 4B9XA 2QKBA 2LCCA 1WN7A 2IGIA 2KFZA 3AO4A 1TK5A 3OY9A 3L42A 4N47A 3RMCA 1TAUA 2QQSA 1RNHA 1RTHA 1IKXA 2RN2A 2YV0X 3LP2A 3L2UA 5KE2A 4Y1DA 3MXJA 3RRHA 1X9SA 2LDMA 4E3SA 2G8FA 2OZMA 4DTRA 4CF9A 3NNQA 4O5BA 1ZBUA 2VWJA 3ASMA 4M45A 3LP0A 4G1QA 3SQ2A 5I3UA 4BDZA 2YNGA 1JXEA 1VK0A 3NF8A 1WSFA 4CFCA 4QOZB 3V1QA 3KLGA 2KTQA 3JYTA 1UAXA 3QEWA 4KPYA 3HP9A 3DRSA 3E01A 4C8MA 4AHVA 4DU3A 1HQUA 1YVUA 2R5MA 4K8ZA 4KB1A 3LYIA 4CJRA 5J1EA 3DI6A 3MEWA 3QIPA 3QIIA 2FBXA 5T7BA 4Z02A 4GY5A 2VG7A 4FVMA 4J2DA 4KHYA 1XHXA 4CGHA 2YKNA 3TAMA 4BACA 2EQKA 3SD4A 1IO2A 2RHXA 4OGCA 3O3HA 4CJWA 1XNIA 4E1MA 1SL1A 2RHIA 3DB4A 2HMIA 3RR8A 4PQUA 3SQ0A 4FJKA 1GOAA 3QO9A 2IOCA 4RW9A 2IS3A 3I0SA 2P1JA 3QINA 1IKYA 1BI4A 3U6FA 4C8KA 1YTAA 2W42A 2IDOA 4FJHA 3Q1JA 3OYFA 1JL2A 1VSEA 3B6PA 3KKSA 2HNYA 3MEEA 3OA6A 1U04A 4KTZA 4CFAA 4E7IA 4RG2A 5J39A 4OKEA 5HRRA 4CEQA 4B9MA 3P8HA 3WNHA 1Q8IA 5IN1A 3HO1A 1C1CA 1F21A 3ZCMA 3KK3A 2RO0A 2ETJA 3ZSZA 3AVNA 3SUPA 2GBZA 2OPPA 2IAJA 3OYLA 1FXXA 3LPTA 4MFBA 3VQAA 4BE0A 1RTJA 4CFBA 2QQRA 4I2QA 3V9SA 1NJYA 2E6LA 1I3AA 4Y1CA 4CF2A 4KTQA 4Z4EA 4NCBA 2DY4A 2B8AA 4IUTA 4LSLA 1S6QA 3VQ9A 3D0PA 4KI4A 2X74A 4CIEA 3QESA 4OGEA 2EQUA 4OJRA 3SV3A 3QEPA 3FEOA 2E6MA 2RHYA 1RCHA 3SV4A 1U4BA 3V9ZA 4DSJA 4KAZA 3PMIA 4CCHA 3AVFA 2RI3A 4W5TA 3MO8A 3SJJA 4E0DA 5E41A 4QQ6A 4KTWA 3OYNA 1JLBA 2GV9A 3KIOA 4DSIA 2JZ2A 2M0OA 1BQNA 2EX3A 1ASWA 3AO5A 4FZZA 1FKOA 3MEGA 1DLOA 2XO7A 3F70A 1NK6A 2ITGA 3DLMA 1NK0A 5KCOA 3MAQA 2RI5A 1REVA 3SUQA 4FJ9A 4ID1A 1BQMA 4OVLA 5D3GA 5M9OA 3HPHA 4AHRA 3L8BA 1NK8A 1JL1A 1YT3A 4DQPA 1QE1A 3LGLA 3IAYA 4C8NA 1NOYA 1QSYA 2LSNA 4HCCA 1NK5A 1A5VA 3C94A 3F9KA 1O1WA 4LD0A 4QVZA 3C6UA 3DRPA 3I8DA 2HB5A 4HTUA 3RMAA 3RRGA 5FRNA 4N4HA 3MEDA 4RW6A 2Y1JA 2KZZA 3L2WA 4E7HA 1DTTA 4FLYA 4EZ9A 3PV8A 1WJSA 4FU6A 3AO2A 4E19A 2F8TA 5KGWA 1JLEA 5J2PA 2HHVA 2M1HA 4FW1A 1J54A 3TAEA 3TAPA 2DIGA 4CF8A 5D6XA 4OKKA 3EZ5A 4FJMA 2P5GA 4FLUA 4QCLA 1CLQA 3AVGA 1RTIA 1SKWA 2PQWA 4KHWA 1FKPA 3ZSVA 2PYLA 1SKRA 2XK0A 4IUPA 4OVAA 4DG1A 2EFIA 1IG9A 1L3SA 3DOLA 3VQBA 1EX4A 4CK1A 4CF1A 1K6YA 5C6SA 1MU2A 4J2AA 1WSHA 4CEZA 5KI6A 1VSKA 4B8CA 4EZ6A 4DLEA 3H6ZA 4F8RA 3KLHA 3D45A 5I42A 2DIQA 3LP1A 4KKOA 1DTQA 2BE2A 1SKSA 4N41A 1LWEA 1KLNA 4DTJA 4FJXA 3RWUA 2EQJA 3AVHA 4JS5A 3NGIA 2A1RA 3L3VA 1TVRA 3ZT4A 3P8DA 5SWMA 5HLFA 4Q0BA 4RW7A 3PNWC 5EU7A 1B9FA 3AV9A 4NYFA 1SSFA 3NBPA 3EYZA 2OPSA 4EP5A 4ELUA 1ZBIA 1NJZA 1UA1A 1X9MA 3V81A 3HL8A 5HP1A 2G8IA 1VSFA 4ZTFA 4FJLA 2OPRA 1TAQA 3RMBA 4CGDA 3WNEA 3K58A 3LGFA 3CFPA 3JSMA 4NZGA 4PLLA 4B8AB 3K2PA 3LWMA 4IURA 1BIUA 2E6NA 4PL6A 1D8YA 3NE6A 3OYMA 3OYAA 1TV6A 2EHGA 2Z1GA 4E7JA 4FJNA 4DSFA 3CEYA 3DB3A 5HRPA 4M41A 4C5HA 3MEVA 3K5NA 1B92A 1QHTA 3HPGA 4ZHRA 1L5UA 1BISA 3VQQA 4R5PA 2Y1IA 1KSPA 4L8RB 2YHBA 4CJ5A 4IBNA 4I9LA 4CJTA 3VQ5A 1WSEA 1S1XA 5DMRA 1FK9A 1WSIA 3THVA 2QKKA 4E89A 3V4IA 4DU4A 1SV5A 3C4SA 2F8SA 2AJQA 2FHDA 3AVBA 4C5EA 4CHQA 3KLEA 3VN5A 1HYVA 3V9XA 3LP3A 4FL6A 2K3YA 4I7FA 5FDLA 4DF4A 2RF2A 3KUFA 1U45A 4LH5A 4Q5VA 3BDLA 1JLQA 4EP4A 4M3XA 2Z1HA 2WOMA 2ZE2A 2RPIA 1U47A 4FK0A 3CFOA 4XIUA 3LX7A 1CXQA 3P83D 2XY5A 5KE3A 1ASVA 3M8PA 3NF9A 3OJUA 1C6VA 1QS4A 4RW8A 2KFNA 3IG1A 4JRPA 3S9HA 1R0AA 4AHCA 1X1PA 4DTMA 1EP4A 3F73A 1LWFA 1WAJA 4E1NA 1JXBA 3RR7A 2P5OA 3LZIA 2GFAA 1BI4B 4CHYA 4HUFA 2RHZA 1RT7A 3MP8A 3FFIA 3HK2A 1BCOA 5C0MA 1OYXA 4FLWA 5CIUA 3QKJA 1JLAA 3NH2A 2X4YA 4I2PA 3V1OA 4IG3A 3VQEA 4PA1A 4Z4FA 2FBYA 2HNZA 3AVJA 3P5JA 2X4XA 4OLBA 2IG0A 3TWHA 1ZBFA 4W5NA 2GF7A 2O4IA 2KZMA 4N5SA 4KHQA 4RW4A 1RBVA 4LH4A 4FM2A 3SNNA 3OYEA 1S1UA 4II1A 1OI1A 2BANA 2YRVA 4QW2A 2E4LA 1C1AA 1T03A 4OLAA 3KK2A 3U3YA 1VSJA 3OMGA 4B9LA 4PY5A 4F3OA 2DFEA 3CYMA 5KTQA 1TK0A 1KFSA 4O55A 2O4XA 4CE9A 5K14A 4Z4CA 3UIQA 2X4WA 2VG5A 4MQ3A 3M9QA 2CKKA 3MEAA 3PX6A 4GW6A 2FBTA 4N76A 4FM0A 4CJFA 3CM5A 1S1WA 4KV8A 5SZTA 4B08A 1LAVA 1S5JA 3L3UA 4ID5A 1L3VA 1RTDA 3CQ8A 3ZT0A 3SPYA 4CJQA 3CFRA 3QETA 3WNFA 1D5AA 3NHGA 3O4QA 2Z1JA 2L89A 2HVHA 5J2NA 4K8XA 2RJDA 3ZSOA 3RTVA 3M8RA 3E9FA 2BDPA 1IKVA 4YNQA 4DWIA 5D6YA 4OPKA 4DFKA 1TKXA 3LALA 2XY8A 5JS1A 1RT1A 4RG8A 5CYQA 3SUOA 1I39A 2RHUA 4C5IA 3G0ZA 4ELTA 2LTOA 4FK2A 3ZSYA 1EXQA 1J9AA 3P1GA 1X9WA 1RT2A 2KW4A 3TR8A 3PX0A 2RJEA 4C8LA 2QXFA 5IAYA 3EAEA 4QQDA 3HPOA 4BE1A 3VQ4A 3SYZA 4O0IA 1TK8A 3VQPA 2HVIA 3KK1A 4E7LA 4CIFA 3K59A 4JLHA 4AHTA 4JRQA 1NKCA 4Q5WA 2HNDA 1CZ9A 2YNFA 4I9QA 3NH0A 4IKFA 2PYJA 2M16A 3E9GA 5C42A 1A5XA 2QK9A 3PX4A 3IS9A 4IUUA 4LSNA 5JS2A 3LLRA 2OZSA 2DTUA 3FC3A 4Z4HA 4FCYA 4DSEA 4KREA 4LY7A 5C25A 1ZBHA 3NF6A 3FDRA 2VG6A 4KRFA 4CHNA 1MHNA 5KH6A 3DMJA 3S3NA 2GUIA 3V9WA 1EKEA 5KGXA 4W5RA 2O4GA 2HHWA 2RI2A 3FLGA 3DRRA 2G8KA 4DQRA 2XHBA 3DYAA 2R5AA 5J2MA 1T05A 2D0AA 2X35A 2YKMA 5DK5A 4DF8A 4CHOA 1JLGA 5CZ1A 3CG7A 1J5OA 4F4KA 2X78A 1JKHA 4A4FA 1Y97A 3VQ7A 1HMVA 4DS5A 3LAKA 4CK2A 1KFDA 4CJLA 1QSLA 4DSLA 3HJFA 4M3RA 2G8UA 1C0MA 3OS0A 2D0BA 4PUOA 3PO5A 3PY8A 1Q9XA 3HVRA 1HYSA 2BGGA 2RJFA 3S3MA 2F5KA 4KHNA 4F2SA 1KTQA 1LWCA 1RDCA 3OS2A 3HT3A 2G8WA 3QLHA 4CESA 5HRSA 3OYHA 4UQGA 1XI1A 3VQ8A 3KLIA 4FZXC 4DTSA 3OYJA 2BIVA 1VSDA 4CIGA 3T1AA 5CYMA 4IUQA 1S6PA 1WSGA 3HYFA 4CERA 2PY5A 3HXMA 3TAFA 4ICLA 4IG0A 3SI6A 1OZ2A 1TKTA 3DM2A 3EY1A 3O8VA 3OVNA 4KO0A 3ZT2A 4X34A 3SQ1A 2RJCA 1WAFA 4FLZA 3PFSA 3I0RA 3OYCA 4H4MA 3ZSQA 4DFJA 1H3ZA 4CJVA 1SL0A 5HROA 2L8DA 1VRUA 4O0JA 2VWKA 3AA3A 3OYBA 2HHUA 4GVMA 4FJ8A 3B6OA 4Z4IA 1ASUA 4N56A 1LAWA 3TAQA 4M3YA 2I5JA 2FC0A 3ZSRA 2XY7A 4Z4GA 4FYDA 4CF0A 3SCXA 3QIOA 3SUNA 2Z1IA 4F2RA 3NFAA 1XWLA 4OKJA 3LPUA 3WNGA 2K3XA 4KFBA 3VQ6A 5CY4A 3ZEHA 5HRNA 3AVKA 3M8SA 4HUEA 1RDAA 1N5YA 1YTUA 2JTFA 3ZT3A 1HRHA 3C95A 3OB9A 3CM6A 1GOBA 1WNSA 1L3UA 4B9UA 3RMDA 1UA0A 1KVCA 1J53A 3NTHA 2IC3A 4H8KA 4DTOA 4CJ4A 3KD5E 4NYNA 1KRPA 4KB0A 1NOZA 2LRQA 2B6AA 4IFVA 2WONA 3HVTA 1JLFA 3QBYA 2NUBA 1C0UA 4M3WA 1WJQA 3ITHA 3QNNA 1A5WA 3L2QA 2X6NA 3OMCA 4B9WA 3K5LA 1WGSA 4HCZA 4F3TA 3S3OA 3VA3A 1Z26A 4FK4A 3H08A 4YFUA 4OPJA 2HHSA 2A1SA 1RBSA 4DTXA 3MEUA 4B9SA 5KCHA 1RI0A 3NTKA 3L2RA 4E7KA 1KHCA 4IFYA 1HJRA 5C24A 4BDYA 3H8ZA 3ZSWA 4CGGA 4DLGA 4HUGA 3LAMA 3T3FA 3U3GA 4CEEA 1G5VA 3TI0A 3TARA 4ELVA 4KHSA 1QQCA 4CK3A 1BIZA 1BHLA 1G15A 1Z25A 4DTNA 1WJRA 2WACA 2HHQA 3QJ6A 4DSKA 1Q9YA 1LW2A 4GMJB 3OYGA 4AHUA 4B9TA 3LANA 3NF7A 3NH1A 3NTIA 3K5MA 1T7PA 4WE1A 2DFFA 1NK4A 4NS5A 4C8OA 5D6WA 2B5JA 1KLMA 2D0CA 1HNIA 4BWMA 1RBTA 1TL1A 1S9EA 5KRSA 2EQMA 2R58A 5CZ2A 3O3GA 3SPZA 4NCGA 3AVCA 1N6QA 2OA8A 3BDPA 4H4OA 4M42A 3DLHA 4FJGA 2DFHA 3SZ2A 4AILC 1W0HA 4PLIA 1TKZA 4A4GA 2Q3SA 3C6TA 3HSTB 2BKDN 1SL2A 4C5GA 4KI6A 4KHUA 3NAEA 3AVLA 1RT4A 1GOCA 4DQSA 3GOXA 3QEIA 1KCFA 4FW2A 4QQGA 3HP6A 3KKRA 4DTPA 2O4XB 3TANA 1VSHA 1S1TA 3OQ5A 3OJSA 2LVMA 3M8QA 4CJUA 1XHZA 2YHAA 3AA5X 1L3TA 2ZQBA 3UWNA 2XDPA 1HYZA 3DLRA 1D9DA 1VSLA 2FBVA 1TL3A 4CHPA 3PO4A 1S9GA 4B3OA 4CGJA 1KVAA 2DAQA 1QSSA 2G8HA 4PWDA 1VSMA 1S1VA 2XRIA 3DLGA 3ZT1A 4M3ZA 4DQQA 1IKWA 1NJWA 4CJ3A 4CFDA 4CHZA 1SUQA 3AVIA 4CJSA 3QEVA 2MWPA 3OYKA 4CGIA 4CEAA 4TSXA 1ITGA 3K5OA 2R7YA 1ZBLA 4J2BA 1RBUA 4DMNA 3KD1E 1VSIA 3OYDA 3A2FA 3ULDA 2OYQA 4M3TA 1RDBA 2BUDA 2GFUA 4ZTJA 3PUFA 4AHSA 3MXIA 1QTMA 5J26A 2P0KA 2OPQA 3DLEA 4CJKA 3SQ4A 1NKBA 1CXUA 4FLTA 3AA2A 4W5QA 4BE2A 1EETA 4CECA 3DLBA 1NK7A 1RT3A 1BCMA 2KQ2A 3ALYA 3VQCA 3TABA 3MP6A 4B9VA 4JS4A 3AO3A 2E5QA 4A4HA 3KTQA 1IH7A 2D5RA 2ATQA 3G10A 3OYIA 1BL3A 4LD6A 1B9DA 2HQXA 1WLJA 1RDDA 3HM9A 2JGUA 3AVAA 4FM1A 3NGZA 3NDKA 1OZ3A 1RBRA 5KRTA 2XY6A 1NKEA 4BD3A 4Z0UA 3OS1A 1KVBA 1C0TA 3IRXA 3ME9A 2PZSA 3AVMA 3QEXA 4FLVA 3KJVA 1D9FA 4HCBA 3LDSA 5J2QA 4IDKA 3MECA 1U48A 3VA0A 4FJ5A 4N4GA 3V1RA 1TGOA 3LZJA 4IUVA 4FJIA 1LV5A 1NJXA 1LW0A 2YNHA 3NGYA 3KLFA 2JLEA 1N27A 3AA4A 4FLXA 3LH0A 4DFMA 1T8EA 4FZYA 1CZBA 4AH9A 4CJPA 4FJJA 3UT1A 4A4EA 2D9TA 4N4IA 3TAGA 4FXDA 3V6DA 3BGRA 2EKOA 4DFPA 3MP1A 1C1BA 2YNIA 2HHTA 3PMTA 1RILA 4O4GA 3V9UA 5FRMA 2L3RA 1W9HA 2F96A 4CGFA 4DU1A 2VYTA 3S6WA 1HQEA 2HQEA 3T19A 1XC9A 4NCAA 2B4JA 3O4NA 3QERA 4BDPA 2R57A 3QNOA 4QAGA 4CEOA 3META 1VRTA 2P51A 1BGXT 1HPZA 1WSJA 2X6SA 3O3FA 5HBMA 2G8VA 4DQIA 2HHXA 4M3UA 4CEFA 4BWJA 4W5OA 3K57A 2G3RA 3AO1A 3LWLA 4UC4A 4CEDA 3L2VA 4L59A 4FJ7A 5FROA 2ZD1A 3DOKA 4CEBA 4J2EA 4EDUA 3ASKA 4DS4A 4B9NA 3DLKA 3ZSXA 4HVJA 3NCIA 4CJEA
chains in the Genus database with same CATH superfamily
5GIOA 1VNDA 1YRNB 4DV4K 1YJNI 5GAEP 2O03A 4WK8F 5BPLA 1JKRC 1LKXA 3RSEB 4E3SA 4C92B 1A31A 1GLBG 3E5QA 4JRIA 2QK0A 1FSEA 4ILJA 4AHVA 5HDKA 1K8AR 3LYIA 3OS5A 2EB7A 4JRKA 3DI6A 2NOHA 2FD5A 5KYYA 3CPWA 2CV1A 2HMIA 3OW2S 5CO7A 1Q81R 4RW9A 1YS7A 2P1JA 5C2FA 2AP1A 2A3LA 5KYWB 1W4MA 4CYCB 5IN1A 5CK9A 1UJ0A 1V5FA 2A41A 2GBZA 3OYLA 1NJYA 4JLGA 2L3QA 2RHYA 3NVKA 3KYDB 3PMIA 2JPBA 4V19S 2WUSA 4FTHA 1F4KA 2ZMEC 3VDXA 2RNGA 1TU0B 1REVA 4FJ9A 1BQMA 2M34A 2L4MA 4ATOA 4QS8A 1TYQA 5F1JA 4DEYA 2ME6A 3I8DA 4HTUA 3TKYA 3EFSA 1WI3A 2MBFA 3TAEA 4PKIA 4QSHA 1CLQA 1HCRA 4KHWA 3PSIA 4VUBA 2WTEA 1DJ7B 1TBXA 3VQBA 4YOVA 4EZ6A 2DKGA 4E6KG 4LG0B 2NOIA 3D45A 3GWZA 5BR9A 1N33K 4HXJA 1TWCJ 1AKHB 3NBPA 3CJRB 2OFKA 3F5TA 2LOOA 1FP2A 3JSMA 3RMCA 3ABTA 2Z1GA 4CYDA 1ETVA 2XAUA 3H6EA 5HRPA 1TUUA 2R5ZB 4D7NA 3CJNA 3OHRA 3W6VA 3AFHA 5K7FA 1YJNQ 2J6FA 5FDLA 1Q86O 1HA8A 5GAMg 2E5LK 1VQ7T 4YRVA 3WQTA 2QASA 1CXQA 1MD0A 2LKPA 1GLEG 1X1PA 4DTMA 5CR4A 2CO5A 3CC2I 4ZGJB 5C0MA 4KYWA 2QSFX 1JLAA 4DUYK 1DIZA 4Z4FA 1XG7A 2X4XA 2LBFB 1ABQA 2KR3A 1BJAA 2ZKZA 3CESA 3OMGA 4JBAA 1TK0A 1KQ1A 2XHKA 1JJ2M 2Q1NA 3UIQA 2HAXA 3C0CA 3ULRB 4EFHA 1QHAA 2RAEA 4C2MJ 2YCHA 3M8RA 1IKVA 4P55A 1AOYA 2XY8A 3SUOA 4IZZA 3G0ZA 4L3QA 3H3ZA 1V3FA 3HPOA 4GY2B 2PQ8A 2GBYA 2JTMA 4DBFA 2JK3A 2GQIA 1KSWA 2LNBA 3KYCB 2ZPHB 3RKXA 2YT6A 2MPXC 5KGXA 2XPUA 3CCUN 4E7SA 2Q0UA 3HFNA 2LTPA 5J2MA 3WU0A 8AT1B 4IOCF 3VERA 1JKHA 4D1QA 3MMYB 3LFUA 3OS0A 3PVQA 4DIQA 3E5XA 1VTNC 3CCEQ 2RN7A 4F2SA 3VQ8A 1T8IA 1HLVA 3JCMc 3O8VA 3HL2A 4KO0A 1R0BG 1S1NA 3OIOA 1WAFA 4DFJA 1OH7A 2F8TA 1BA1A 3OYBA 5HY6A 4IHYA 4N56A 4KBMB 1WDXA 3JCMe 2ELHA 3ZP5A 4C92E 5DCMB 5C3EJ 2BEOA 2J6OA 3K0SA 5DYMA 2NVYJ 3ZQLA 1FC3A 4A0ZA 3HVTA 4CHUA 2HVQA 1WJQA 4DZJA 1J3TA 2MG4A 1R5HA 1VFCA 2KRHA 2UU9K 4DV6K 2D45A 1Y71A 3ZEUA 3WU2C 2HKNA 3C7JA 4EVIA 1M3BA 4DLGA 2M8EA 1JBMA 4JYAK 1O7LA 3CCJI 1BHLA 2CQNA 4QPQA 2FPDA 1HYOA 1E17A 2YX6A 3L1PA 3LANA 3ERMA 1BO5O 2V1NA 4CYCA 1WJAA 1T3LA 2DL3A 1TL1A 3O3GA 5FD6A 3OSFA 4M42A 3QICA 2X3XD 2Y4YA 1A0NB 1RT4A 1T0FA 1KCFA 4NHJA 2VLAA 4DZPA 1YI2T 1RI9A 9ANTA 1XHZA 2DDAA 1W70A 1MBKA 2AHJB 3DLRA 1VSLA 4EATA 4BQLA 2RE2A 4D8DA 1S9GA 3DLLF 4JLIA 1M4ZA 1NYFA 3CCRT 3I55T 2PMZA 2NNYA 2ZB9A 4DMNA 3FXKA 3X2QH 4BRDA 4ZTJA 3QFPA 5J26A 2CQXA 1ZGJA 1VQ6Q 2CJJA 2VQCA 3AKZA 2D0NA 3FIFA 1EH8A 4X64K 2DCEA 4M77G 4A4HA 3PE0A 5FLXO 2HQXA 1W0UA 1RDDA 1FYKA 3OR1C 1OZ3A 3AARA 2NXNB 2K9LA 4FLVA 1WHHA 3GBGA 1T0FC 3VENA 3MECA 4N4GA 3AL0C 3HHHA 2KRMA 5EVZA 1QVPA 3LH0A 2K3BA 4CUGA 1SQKA 1POGA 4DFPA 1X3MA 3S6WA 2VASA 3O4NA 4HX4A 3QNOA 1AA7A 1D1CA 5DUIA 4XRSA 2BBYA 3M5RA 3V7RA 4BI3A 1HQCA 1I1GA 5DDGA 1JRIA 4CEBA 2OC6A 2FYKA 4EDUA 3BE3A 1H3HA 2AS5F 4HHTA 1UOCA 1IV8A 4MLOA 4XOPA 2VUMJ 1WEIA 1NK9A 5LL6Z 1K78B 2DLLA 3RMSA 1RNHA 4LE9A 2M8GX 1QVFP 3ZXSA 5I3UA 5ADXA 1LFPA 3SWNB 1WEGA 4G7OF 5GMKl 3I5UA 4AM3A 2DE0X 5CKBA 3LWIA 4XEIA 4B1UB 4FVMA 4I0AA 5M1QA 1Y0MA 5C0YA 3IRQA 3RR8A 4XRMA 4H03B 4ILHA 4XH1A 2D0PA 4IX7A 3JB9F 3K10A 4E7IA 4B9MA 2CH4W 1FYLA 3ZQFA 2GXAA 3K1PA 1ZRDA 4QLCU 2HBWA 1ETWA 2NRHA 4BE0A 4E9HA 3CMAN 1A5JA 2KIMA 1BG3A 1WHMA 5AQKA 1IG9A 3QYGB 3Q0WA 4B4CA 3UATA 2IBDA 2I2LA 1JCFA 4O8KA 2GV9A 3BF1A 2M0OA 2M5WA 3M53A 3WGHA 1XQPA 4J19A 3MAQA 3T1YK 2RI5A 1OQKA 3IAYA 1QE1A 4PFOA 4C8NA 1NOYA 3DRPA 1PSEA 4RW6A 4A3EJ 1XMQK 4E19A 4LG0A 4K25A 3ZYYX 4OKKA 4O3MA 1N78A 1HSJA 4IUPA 1RRQA 4GVEA 5FFZA 5KI6A 3R6SA 2GTOA 2E6ZA 4B8CA 2O8DA 4HRIA 1OYWA 1VQON 2Y48A 1XMOK 1F36A 5LD2C 5E18F 2PVDB 3VWBA 1BU1A 5HVQC 2HBKA 2ROTA 4NYFA 2O0YA 1YO5C 4B1VA 4ZTFA 3H5RA 2BY3A 3LGFA 1DKGD 4FSXA 2ROLA 1IV0A 2BY0A 2DBBA 3M58A 1GV2A 4R5PA 2NUTB 1XGSA 3WXMB 3THVA 3SZPA 3TTCA 3K4KA 2KE9A 1MJ9A 3K0LA 2E2IJ 3GFJA 5BPDA 1FIPA 3OIPA 3E6BA 4M3XA 2WOMA 2DA9A 4KRTA 3W2VA 2KT1A 2AZVA 2K9QA 2GFAA 1HKGA 4DV1K 2RHZA 1QVFS 2M4GA 1R1TA 2OAUA 4G9ZA 4NL2A 2UUZA 2KAFA 3AVJA 4MZTA 2JS2A 4L6V5 1SS6A 4IO9F 3VEWA 2JPCA 2I10A 1C1AA 2F7TA 3ZQIA 1IHWA 4WYBA 2KIUA 4O55A 1X6GA 4J6YA 1DGRM 2QQBA 2ESHA 4BJ6C 1QNTA 4B08A 4JX6A 3TDUC 4FT2A 1WB9A 2K4JA 2XC7A 2LREA 1Z05A 5L3GA 4O8UA 1JO8A 3IUCA 4A5AA 4YIRX 4IF4A 3EAEA 4BGBA 1IXRC 4XTYA 4Z6YA 3M56A 3K59A 4JLHA 4Q5SF 3EDPA 1TS9A 2HNDA 2M16A 4CCOA 2COZA 3E9GA 1IZ6A 3PL8A 1WZOA 4IUUA 4MO4A 3FC3A 3LQRA 2A3SA 4DCHA 4KRFA 3JV3A 4WX9A 3FK7A 2WAFA 1VQ7Q 4Y91A 1P7JA 2CUBA 1Q7YU 1T05A 2R5AA 3IKTA 1JUMA 1F1ZA 1IRFA 1JLGA 4OU0A 4F4KA 3C2GA 2VUBA 3HTRA 1BBZA 4PUOA 4XTUA 5IXFA 3WTXC 1USTA 1ZSZA 3P38A 3A5ZB 5DV5A 4EVVA 4CESA 2MCNA 3OYJA 2FRHA 4J9BA 5B1BH 1TT5B 3FRNA 2X4JA 4ICLA 4JKFA 4E70A 3OVNA 4FISA 1U8BA 4B21A 3DEEA 2HHUA 2KMUA 4FT4A 3QZ9B 3C1DA 2LR8A 5DCMA 1Q1HA 1WHGA 2Y90A 4F7UF 2EPFA 5KQDA 3CM6A 4Y15A 5GAN7 4H0VB 4RGXA 4AF1A 2DPDA 1TUDA 4RTXA 1YNZA 1SVOA 1TC3C 2HF4A 3CBMA 2JMCA 1RI0A 4IFYA 1Z9CA 2IS2A 4RGSA 4F93B 4HBLA 1YHQQ 2FF3B 3J81E 2CW8A 1T7PA 3IH7A 1HKCA 5B5EC 3I58A 4H4OA 1ZGAA 3O8MA 2OI3A 2BKDN 1T6CA 2L2PA 2HKQB 1GDTA 4HT8A 3ZMVA 3KKRA 1NGBA 4PFPA 2Y31A 5IWAK 4PSXA 1FZPB 1RGIA 1S1VA 4A3JJ 3NGPA 1NG2A 1U5TB 2JUFA 3JCMd 2NS7A 1M1KO 1BC8C 2RQVA 5J4VA 1LJ9A 3JCMP 2R7UA 4OMYA 4CDGA 1YJWI 2P9NA 3OYIA 3HOUJ 2A42A 2EYZA 4FO0A 1E3OC 4M72A 5DLOA 5J8FA 3I56I 1YF5L 4JP0A 3VA0A 4FJ5A 3MWMA 3JREA 1CKAA 3QDRB 4IEEA 4KH1B 1N27A 1AHJB 4OB1B 5AIQA 1J6ZA 3I35A 4RAZA 3J7ZO 4DW6A 3CF5F 2B4JA 7AT1B 3MD2A 4UVAA 1WSJA 3S8PA 4W5OA 2JHJA 1T0JA 3EG3A 4M78D 4FJ7A 5FROA 1ZN2A 4RLQA 3S14J 4HVJA 1VQMN 1UWBA 1B72A 3CJ7A 3JAMZ 1JKQC 1F5TA 3G6EN 2EGEA 2KFZA 2QQSA 2ADUA 4Y1DA 1X9SA 2F2EA 3NWSA 2DXTA 4AC0A 3ASMA 2XU8A 4LF4K 1JXEA 1PU6A 3NF8A 3LCNA 1YVUA 3F0ZA 4DNCA 4BR9A 4LLLA 5JLWA 1KC8R 2O01E 1P2FA 1JTYA 1W2BP 1W7PB 1ZR4A 4RM2A 4HW0A 1N8RU 3U1DA 1YTAA 3PO3J 3CJBA 1JCEA 3HO1A 4RUGA 1GLCG 3FZKA 1M8MA 2DXUA 3NRVA 2IVNA 2KSSA 2IAJA 3FZHA 1R49A 1U1SA 5GMKe 2DY4A 5KCMA 4ZZDA 3QESA 2M7BA 3SV4A 4DSJA 2R7SA 4CCHA 4E0DA 4HNUA 4DYRA 2ENMA 3OYNA 2YUPA 3LDLA 5CVIA 1BQNA 2KHMA 3AO5A 3CXCA 2EQRA 4KIFA 5GANh 2XO7A 3F70A 1NK6A 3TU4K 3VTIA 1AKHA 1S72Q 2UUAK 2JWTA 3RRGA 1Y07A 5FRNA 4BR2A 2KRSA 3VJPA 1JLEA 1J54A 2DIGA 1UFFA 4FJMA 2V8KA 3NEUA 4G9YA 4DGWB 2VONA 3AVGA 1K9MU 5ERIA 1BUPA 4M7XA 4PJOC 5GANg 3EEQA 4EHUA 2VJ4A 2RQRA 2F4OB 1K6YA 4CC2A 4J2AA 1WSHA 1DPUA 3M9AA 5F0FA 1I5LA 5AZJA 4BQZA 2RD1A 1GT0C 3DBHB 2VE9A 3AV9A 2RMOA 5FW9A 1MA9B 2FMLA 3T0YA 3GE1A 5H2FC 1YUWA 3ZN1A 2LQWA 2QWPA 4B23A 2FG0A 3M3ZA 3KLNA 4IZ9A 4C5HA 4XTVA 1PVSA 1NG7A 1E6GA 2IPQX 1AZGB 4CJ5A 1KU3A 2KRFA 2W03A 5E17F 1SV5A 2X51A 5I21A 2F5CA 3OW2P 1DEJA 3CCSQ 1U45A 3I71A 4LFUA 4L5GA 5A2QZ 1QS4A 3GG4A 3HRTA 3BF3A 3MKLA 3PGGA 2Z9OA 1D5YA 4E1JA 4HUFA 3BZ6A 2HQAA 3RZOJ 3FFIA 3EGUA 2CDTA 2X4YA 3Q7BA 2VBWA 1S3JA 3T8TA 2VJJA 2E4LA 4CBXA 2YRVA 2YUSA 1SRMA 4PY5A 3DXJF 1JKOC 1OPKA 5M1FA 1R1VA 3A8YA 3GFLA 2CUEA 2JSCA 2HVHA 1LCUA 1RKWA 1S5LC 1IN5A 3O9UA 1R5ID 4DKWA 2DYRH 4RG8A 2P9LB 4F9OA 4NXNK 2DTRA 3M4OJ 3BR0A 3L09A 4A3KJ 4B3TK 2HQ5A 3C12A 2QWOA 2DILA 3LSJA 1RI7A 2DA2A 2SRCA 1YI2A 4XLFA 5GIPA 4CD3A 3CC7T 2FJ1A 5E3OA 1NJIU 2JUCA 2R7FA 4LMYA 3FDRA 3IWZA 4JZ4A 2GUIA 4YOQA 2O4GA 5LJ5j 1GXQA 4IPAA 1OH8A 4FWPA 5FKMA 3I4PA 2LF8A 2VYPA 5LJ3d 1K4US 4JEPA 3G1OA 4E4HA 2YJFA 3DJCA 3KHYA 2RREA 1YTYA 3HT3A 3QLHA 3ABUA 5HRSA 3OYHA 2VPRA 5EXWA 1S6PA 1YX3A 4DV0K 3ZT2A 4FE7A 2QG9B 1SL0A 1J9IA 1JQQA 4Z4IA 5J1RA 1V55H 3AT1B 3I55Q 4IHVA 3SUNA 2Z1IA 2LKSA 1MPGA 2LBFA 5GAGP 4BRNA 4QTRA 1PD0A 2E2HJ 2N8GA 1N9SA 1W5TA 2AXLA 4KDPA 3U9GA 4OMFB 4J8FA 2YI1A 1Q1VA 5DPKA 5DM7F 3LWFA 2VWBA 3L2QA 2XROA 4HCZA 3S3OA 5DTDA 2NUPA 3OGDA 2ZJPF 2EFWA 1VQ9A 2CH4A 2FE3A 4JJDA 3OH6A 3EUHC 1FNNA 3F6VA 4EJOA 1BIZA 1W6XA 3NHNA 4GFBA 3S9HA 3S93A 1MUNA 3SPZA 4FSSA 3C7NA 5AR0A 1Q82U 2RQWA 4EMSA 1Y39A 1E7OA 4GV3A 3DLLL 2Q3SA 2K5LA 2RN8A 5JLXA 4DQSA 3K4JA 3GOXA 5AT1B 3O80A 2XHIA 2ZSIB 3S1RJ 3OJSA 2VIXA 2YHAA 3EG2A 3BZCA 5IH2A 3PNVA 1VQ5N 3CC4Q 4PSWA 4JPBW 4CHPA 4PWDA 2A68F 3DLGA 3QOPA 3TQNA 4CFDA 2GTJA 3V7SA 5BPMA 1YVNA 3QDFA 3KD1E 3K70C 2YLBA 2LC4A 1X3NA 2A08A 4OMQA 2ZJQF 2X6OA 4C30A 2H27A 2RQPA 3QPLA 3ALYA 3VF4A 1WH7A 4FPBA 3CD6Q 4EHTA 3F21A 3QODA 2WB1A 3WEEA 5K1YA 1VQ9N 5JLFA 1MGTA 3WTTC 2PZSA 3VS7A 3KVGA 3MQ0A 5BN8A 3OL3A 4AQYK 4RCHA 2YRCA 4H5TA 2BTFA 2X3WD 1TWGJ 1YJ9N 2P9KA 3EFOB 3UT1A 3BZKA 3TAGA 2YSQA 3A8MB 4DV7K 4FXDA 1G59A 1YW7A 1QWFA 4EW4A 3L4IA 3EUHA 3LMMA 4IEJA 4MMLA 2FBKA 3K57A 4C2UA 3MK6A 2E1OA 2P5VA 4UC4A 1M5Q1 5EY4A 3CC4T 4M75D 3LDPA 5FPDA 3QPSA 4NUBA 3ASKA 4PJ0C 3ZSXA 2BUPA 5KPTA 1V5GA 2AKLA 3CC2T 1K9MC 2WSEE 1WPKA 4OINF 3OY9A 1TAUA 4C1NK 4HNVA 3ZQQA 5IHKA 2M0CA 3GEZA 3L2UA 1VQOQ 4GV9A 2GEMA 4LDXA 1MUDA 1AU7A 4HX7A 3H0GJ 3P31A 2IT0A 1TNTA 2UXNA 2P84A 1PKTA 4CJRA 2W6KA 3MEWA 3QIPA 5T7BA 2E60A 2NOGA 1YWOA 3TVTA 3VGLA 1XNIA 4ZNXA 4ESBA 2HKXA 4C8KA 2JZYA 3OYFA 5K7HA 3KKSA 4CFAA 4M77D 2E7WA 5K5RA 1VF9A 3WNHA 1Q8IA 5M1PA 3I33A 3KK3A 2PVGB 4DK9A 3LA7A 4U87A 4I2QA 1QKXA 2XGEA 1SANA 4OJRA 1YYVA 3MMVA 1N8RC 2F9TA 5FGMA 4A2UA 1UHWA 2DQLA 5KAIC 4W5TA 3CCQT 1OEBA 3LAPA 3IKMA 4ZC3A 2H3GX 3CC7N 1YFNA 2ITGA 3EZWA 2PUKB 3VS0A 2DU9A 2F5DA 2DAOA 4F7ZA 2QCOA 8ATCB 1MBJA 2YG9A 4RMNA 3F9KA 4HV5A 1V4SA 2KZZA 3RIRA 1O4XA 1D3BB 4JJCA 5KGWA 5CVRA 1R7JA 3CCLQ 4M7AG 5EEAA 2XAHA 3GO5A 2PMZN 4FIBA 4WCEL 2ISYA 3K69A 4EJVA 5CKDA 5ILVA 2DT7B 3I9V2 4I09A 3PJRA 2XDDA 4DQ2A 4N41A 2YU3A 4ME7A 4YTLA 1VQLN 4I0BA 3HRGA 1QZYA 4K0KK 3ZT4A 5AZIB 2EFPA 1YJWN 5BMZA 1ETOA 3A5OC 2OPRA 1ZUUA 2F2WA 4CBWA 4FYYB 5KAFC 4FZXC 1B6AA 3OYMA 3EGXB 2LQNA 3DB3A 2YRDA 2BZXA 1D8KA 2YHBA 4I9LA 2FA5A 1FJLA 3IQLA 3DXKB 2AJQA 3CCYA 1EBMA 3K2AA 1K73O 3ZX2A 2DMQA 1YITI 4HVUA 2H8WA 4G12A 3SLCA 2Z3YA 5AONA 1K8KB 2FLOA 4IO9L 2EFOA 4PL8A 4JRPA 1X2KA 4F7UG 4JI0K 2VN2A 2JWLA 1TW2A 2ID3A 3SHWA 2M7AA 4YFNF 2KZMA 2P5KA 3I9QA 2KIQA 2H6CA 3SNNA 1V4TA 3ZGKA 1OFCX 2WV0A 3OR2C 3RPUA 4QT7A 1NGNA 1IRXA 3CM5A 4PDKA 1L3VA 5CJ9A 3EHQA 2P0PA 3TL4X 3GFIA 4FWOA 3NHGA 4IXAA 3O6WA 1FEXA 3LALA 1XDUA 2JTEA 3BJ6A 2B86A 1TSFA 3KP2A 1X9WA 4M78G 2RJEA 4HYEA 2GWRA 3IV5A 3CCST 3IP4B 3VOEA 1KG1A 2VXEA 3DMJA 4XLNF 3ATVA 1Z3XA 2DO7A 4TV7A 1UG1A 5LJ5e 2JXBA 2EIJH 4FWMA 4XQFA 4U7DA 3CWSA 3IMXA 1G2HA 4DS5A 3LAKA 1RL2A 4CJLA 3P9IA 4PJOG 2G8UA 2VC0A 2JJ7A 4XN3A 2P9LA 4RTFD 5GTHC 4LDUA 5CAIA 1VQMA 3G1MA 4KJZA 4HTLA 3J8AA 2HZDA 4GRIA 2NRZA 3PFSA 2E34A 4BRIA 2XG8D 4FX0A 3H5AA 3ABKH 3BQYA 4WF9L 4BL0B 3I5RA 2XY7A 3M8SA 1TT0A 1NTCA 4YEJA 3NQOA 1IBLK 3RMDA 2QZ8A 1KRPA 4AD9A 3BG6A 5JVGL 5HLHA 1I6XA 1JLFA 2CQKA 2UYTA 3A1YA 1N5ZA 3G1LA 4M7DA 1WGSA 1SVMA 1VQLA 4C0FA 1R23A 4PJMA 3H08A 1YXQA 2WTUA 2M0YA 5I9EB 2LY9A 5CPRB 3HOSA 3CC7I 2EK5A 2AZSA 2E36A 1E0EA 4BDYA 3CC2Q 4HUGA 3G0QA 5JICA 2FBIA 2HHQA 4XKVA 5BPIA 3VS2A 3HFOA 3RMQA 4PZJA 1WX6A 2D0CA 4LB5A 2QEXN 4RKUE 4DQ8A 3VF2A 4DOZA 2JRTA 2Z1DA 2QW9A 3CCSN 1TKZA 3C6TA 1X75C 4J6WA 4C5GA 4Z88A 1SZ2A 2OJ2A 4UVCA 1IN6A 1P7MA 1OCZH 1VHXA 1KGSA 4Y52J 3GIBA 2HYGD 1WQ7A 2DA7A 2CH6A 3C0BA 2FBVA 1RETA 4F17A 3DPUA 4HOBA 2LF7A 2Y0MA 5GAMh 2RQQA 3KZZA 3QEVA 2GUPA 3BJAA 4J2BA 2KP6A 2QYZA 4FASD 2C6YA 2P6SA 1VSIA 2D4WA 2GFUA 1GXPA 1UGRB 2QQ8A 2ESWA 1NKBA 4A6DA 2YHWA 2JMWA 4BXFA 4HKEA 3L6QA 5L8RE 5AQPA 3G73A 4H5VA 2VT3A 5KNLA 2QF7A 3EHRA 3DTIA 5F64A 3SFMA 4XTWA 1CZAN 4AI4A 3ZETB 1T38A 3FHGA 4BQOA 3QPTA 1Z0XA 2VGMA 5LFAA 1ETQA 2JSPA 2L3RA 3T19A 1X58A 1NGJA 4J00A 4YOYA 4J2EA 1JT6A 2H56A 4DS4A 2MC4A 4FE4A 5H20A 1JLCA 2MWOA 1RT6A 4B9XA 5GAN5 3AO4A 2LD5A 3FK6A 4LUDA 3CHWA 1IG8A 2OZMA 2G8FA 1OYIA 4A12A 2VXDA 4G1QA 5KPZA 3CMAI 3ECOA 3RNJA 3ENOA 2P9SB 4OAYA 4Z89A 3BQZA 1N75A 4OMMA 1BIBA 2AIRB 3QHSA 3UDCA 2CP2A 3B73A 5AQSA 2HR3A 4NDLA 2QWRA 4EA5A 1T3VA 2JMAA 4KTQA 1U04A 1ZSZC 1HD3A 3WE3A 2AKKA 3DP7A 1CKBA 4I7HA 5BNGA 1J09A 2OD5A 1BJZA 2OPPA 1W5SA 4CFBA 2HCKA 1RTJA 2E6LA 2EFNA 2EQUA 1ESVA 4KAZA 4KT5C 3LM9A 2HTSA 4UUTA 4GLKA 3K4CA 1JLBA 4G7ZF 3C6HA 3CCRN 4V2FA 4HEA2 3CMEQ 3O8GA 2ME0A 4NBQA 3SUQA 1ZBXA 4XKWA 1BKBA 4GCVA 3LGLA 5AJ3K 2C0OA 3WEEB 1A5VA 5DY9A 1B34B 1YI2N 1DTTA 3CCEA 1WJSA 4YOTA 3C18A 2ZPBB 1MWMA 1EF4A 4C8QG 3GCMA 3LL3A 2O8FB 4ZJZA 1YW8A 4RAGA 1HLUA 1EO1A 4L5EA 2XK0A 1YJNN 2JA6J 3LDOA 2M51A 4CF1A 3MHXA 4ZDLA 5EF6A 4IOAF 2D1XA 1HUXA 2AK5A 2K9MA 5GAMj 4FJXA 3QO3A 4YPRA 4LC9B 1MNMC 5GPAA 1JHFA 2QDYB 1B1BA 2V75A 1NJZA 2PZ1A 3PIOF 4GBQA 3FXQA 5H6QA 4M7DC 3O2PE 4EMKB 1BISA 2VJIA 4DR5K 2XF6A 3HM8A 3CBPA 1VYVA 2CW7A 3DU6A 3V4IA 1AHDP 4D5CA 3KZIC 1A04A 4CHQA 3KLEA 1ZKGA 3G6EA 3OIQA 1LFUP 4MHGA 4RTYA 4AMCA 4C0ZA 5GP9A 1YI2I 2PN6A 1C6VA 1NG9A 5A2QO 4CBUA 1UGPB 3UF4A 3CMAQ 2CUFA 1J59A 5FO5A 5F0CA 3CJCA 3CCRI 4MGRA 3VYUB 2A5WA 2IA2A 2OCEA 1N3CA 4BQQA 1YJNA 5CQYA 3S1MJ 1T03A 4GYGA 1UGVA 4AUXA 3M0RA 2R92J 1SF9A 1H1VA 1VQMI 2CKKA 4ZGEB 3HOXJ 2KVQG 4A2AA 2Z1JA 5FWBA 1KG6A 3FM5A 5L3EA 3T7ZA 3A4CA 5CYQA 3M0SA 4ELTA 2LTOA 4XBFA 1JE8A 3I55A 3P1GA 3FHFA 3ZSYA 1RT2A 4I01A 4QQDA 5ILUA 3VQ4A 1O3SA 2XB0X 3HKZN 1CF7B 1W2BM 3M8FA 2OF7A 2R7QA 2CWEA 1SKUB 3BCBA 4FCYA 3GBQA 2NNWA 2NOEA 4JKDA 4LXCA 2RH2A 1K76A 1RAIB 4NQWA 4ETSA 2JRMA 2PAVA 3DWLA 4M7AC 1PUEE 4UV9A 3R6NA 2HXIA 2JVVA 1R36A 3GW2A 3RUXA 4DSLA 1KD1O 2DDBA 4HSBA 4OMZA 1VQ6T 4EGYA 3PY8A 5EG0A 4ENKA 2MIOA 2NOFA 5KHDA 5CKEA 2G8WA 3I3LA 2BIVA 1RAHB 3KZBA 1NK2P 3PFYA 1T95A 1F43A 1MDMB 2FB7A 4M71A 2LP5A 4CCMA 3BG5A 1CSKA 5DS9A 3CJTB 4LK1F 4M3YA 3CC4A 2FF4A 5LEJA 2ZJPL 3WHBA 3EH2A 1YTUA 2XVCA 3AVKA 1N5YA 2GLOA 1QVTA 3IKVA 3OB9A 5CKTA 1GOBA 1UA0A 4DTOA 3G4SA 3F9MA 4MQVA 3J7AO 3GF5A 4HSRA 4B9WA 1B72B 5GAOl 2A1SA 3C2BA 4J9FA 4DTXA 4M3DA 3S17J 3MEUA 1HDPA 2CP5A 2EJRA 5C24A 3H3VK 1KQSA 1JJ2P 4ELVA 3X26B 4KHSA 1VIFA 5GMKm 5IP7J 1LPLA 2ATCB 3P39A 1RUOA 1MKMA 3NH1A 1ZAOA 4J83A 5KRSA 4G7HF 2MC3A 4BNCA 1KQ8A 4DOVA 1QVGP 2V79A 1PKSA 1M2OA 1SC7A 4BC4A 4XKCA 4B9QA 2CZ7B 3ZRGA 2BYVE 3OQ5A 2A6AA 1WZ2A 3TQ7P 3M0PA 5IPAA 2ECBA 1D0YA 2ED1A 3BEXA 1Y6IA 1UELB 1NJWA 3MWTA 1EV7A 3ASOH 4U0YA 2K6DA 4YG2F 1UMQA 4Q4ZF 4AHSA 2H09A 4N9IA 1TL8A 1EETA 1NK7A 5GMKh 1WYXA 3TABA 4C3IJ 4ISGA 1UCRA 5HS7A 3EE8A 4FWRA 4DR2K 2NVTJ 4RB3C 2HTJA 4BR7A 2YU9J 3AAQA 2YPRA 2EV6A 1M1EB 1KQSP 3RCOA 1V1CA 1BDGA 3O1BA 5D5VB 1D1BA 1WXBA 2KXDA 2V6CA 4ELZC 2BHZA 1NJXA 1XDSA 2JLEA 3TP3A 4FZYA 3SDGA 4FJJA 1M9SA 2D9TA 1VQNT 3KFVA 1JJ2S 3V9UA 2F96A 4NCAA 3H0HA 3DPLC 4XAXB 1NK3P 5IYCJ 4CEDA 2D1HA 3BWGA 5AQTA 2MD5A 1SFOJ 3CMET 4MMKA 3R1XA 3EYYA 4CRIA 1VQNN 3WG9A 2DJQA 2QKBA 3THWB 1TK5A 5KE2A 5TISC 4M45A 1MBEA 2E3IA 2KFDA 4CFCA 2KTQA 3QEWA 3DRSA 3SB2A 4LD9K 3MX5A 3W2AA 2DYSH 3GX4X 2OQGA 3RSEA 4CJWA 2HL3A 2BOLA 5FPMA 4XLAA 3D7EO 1BBYA 2MD0A 2IS3A 2GCXA 1YE9A 2RQUA 3QG1A 3B6PA 4FETA 5AQYA 4OKEA 1NGIA 1C1CA 3CCQA 5LY3A 2ETJA 3MZYA 3ELKA 2X85A 5M1NA 1BI2A 3KBGA 2QM1A 2P9UB 3NFCA 1VQ5I 3J80O 1M3AA 4KT6A 4OGEA 4DBRA 1YIOA 1VQPQ 5IOZA 3RR6A 2ITMA 1IXSB 2P8TA 4A93J 2DXIA 1M3CA 1ASWA 2DMUA 4JN4A 1T6SA 5KCOA 2O8EA 1KG3A 4C92F 3I59A 1V5EA 1YHQA 3IC7A 4XSXF 2Y1JA 3JXUA 4AM7A 2LX9A 2HI3A 1H8KA 3JCMV 1N25A 2FX0A 5IYBJ 1FOKA 4NO7A 1SKWA 3U2RA 1SKRA 4XK4A 3IH3A 4F8RA 3FXMA 3QU3A 3FMSA 5I42A 2DPUA 2YXYA 4M75G 4BROA 3ISPA 3Q9SA 2A05A 1BR4A 5HLFA 2P4RA 3PNWC 2MYSA 1OU9A 3V81A 4BYYA 4BRMA 2RHKA 5BRDA 2UUBK 3EFOA 4AVPA 3G6ET 4AM6A 3FXRA 2CS7A 4FWQA 4L9VA 3DV8A 2VE8A 3VF6A 2PG4A 2NAZA 1C6VX 4KMUX 1MMSA 3FB9A 4DSFA 5AIPA 4CD1A 2Y1IA 4OB3B 5KYNA 1Q82C 3VEVA 5L3CA 1LUJB 2VXFA 3VN5A 3QUIA 5EZGA 2ASPA 4QWQA 2DT5A 3V7CA 1BR1A 1UUEA 3A8OB 3JTGA 2DTOA 3CFOA 4XIUA 4Y4RA 2XY5A 4AHCA 4WXDA 1WAJA 4FL9A 3THYA 4CHYA 2ZGYA 5BRHA 4LJZF 4UOBA 5D6EA 2VVKA 1OYXA 2YX4A 3LWHA 5TGTA 4IIMA 5JHFA 2CH5A 3TWHA 1VQPN 4BKXA 3WTVC 4L9TA 1ZR2A 3KP5A 1XQOA 1QZEA 3LL7A 4B47A 1AVZC 4Y92A 1VSJA 1Q82O 2EKHA 5IHIA 3D5RC 3REBB 1VQ8A 3LSGA 4WXHA 1B3QA 1UHSA 5HL7L 1R8OB 2A5YB 3ZT0A 3LSMA 4ILGB 1LWYA 3JCMX 1SFKA 3VEXA 1O13A 2FEIA 2CFXA 4CVNE 4JV5K 3LNQA 4DFKA 2M87A 1TKXA 2DVJA 1OCPA 2CUZA 2PU9B 5GAGJ 2YHTA 4C8LA 2JS0A 2D6FA 2W41A 2ZPEB 2NZTA 4CIFA 2O7OA 1DGWY 4JRQA 1NKCA 4BI8B 3M1EA 4DSEA 3LDQA 3U21A 4MZPA 4CHNA 2DMPA 3ECHA 2GBQA 3D7SB 1SEUA 1NJIC 3CWAA 4RDUA 1OKRA 2DZCA 3CCMI 2V1RA 1W36C 2IGOA 2NLXA 2K2MA 4HF2A 1NPPA 4KHNA 1RDCA 3H1QA 2W10A 5M1KA 4BJTA 1ARKA 3KLIA 4YIIA 3G3ZA 1BN5A 1WSGA 3D6RA 3HXMA 1BOBA 4LFCK 2X48A 3KEOA 4KBOA 3ZSQA 1H3ZA 2DT6A 5HS9A 1KC8O 3BR5A 1ZLMA 4E9EA 1QVGS 4NL3A 4Z4GA 3SCXA 2ZFUA 2XF7A 2CGHA 1IC8A 5AQNA 3SMSA 4HUEA 5AQRA 1AWWA 1UTIA 3VS5A 1X19A 2HL5C 2AA4A 5L23A 2WONA 4A62A 1IUFA 2Z16A 1R9TJ 2M1BA 5CKFA 5FPEA 4BGAA 2W24A 4BR0A 2L7ZA 1KHCA 1K8KA 5KN8A 3H8ZA 4RAFA 1KEAA 3E9LA 1OULA 3CUQC 5L3FA 1JKPC 1Y1WJ 1NK4A 2FQ4A 3KCCA 4BR4A 4HNTA 3SZ2A 2WADA 1W0HA 1RNLA 4ANJA 1LJOA 4A4GA 4B1ZA 5CCAA 4KI6A 1NJIO 1FW6A 2HNHA 1WNLA 5DM6L 3ER0A 3AA5X 4XONA 1R0CB 2M4KA 3G4SI 3R0AA 4CGJA 1IKWA 2O8EB 5CE3A 4CEAA 3DLAA 3OYDA 2LDUA 1Z9QA 2VGNA 3E9PA 2VB6A 3ZPLA 4RBOA 3CCET 4B9VA 4C92C 2QYOA 4ZYEA 4I2OA 3AO3A 3U4LA 4O5VA 1BL3A 1B9DA 2LYCA 1PRMC 2X1DA 3ID6A 2DZ9A 1QA6A 2ASMA 2NUTA 3KETA 3VS6A 2HYJA 4ENJA 4K11A 4A2BA 2VKHA 5LHGA 2FSKA 1LW0A 5LJ3j 2NNNA 5J47A 3BTLA 2BE7D 1T8EA 4KHPK 4CJPA 2EYQA 3CPWS 1C1BA 4I02A 1XTDA 5KN9A 3QERA 3HOZJ 2CSOA 3INZA 1K73R 4CEFA 1YITA 1EH7A 1OU8A 1GBRA 4QS9A 1IZ1A 1IREB 1KQSS 1O57A 1SG5A 3HM5A 2XASA 3IH4A 1RRSA 4O44A 3L9FA 3VYGA 5BS6A 2HQHA 3DBLB 1K73U 3ULEA 3WU1B 1E3HA 4FYXB 3J7YP 1MBHA 4ASNA 1ZBUA 2Z99A 3SQ2A 3E66A 2LK2A 3CCLT 2E1HA 3I59B 4Z2YA 1UGSB 1DT9A 4C8MA 3CDLA 1IRGA 2XPVA 5J1EA 3G71I 4GY5A 2RV8A 1LDJA 2ABKA 2XAFA 3DB4A 2CUJA 4P96A 1P59A 3H41A 1Y96B 3VSLA 4HSTA 3GTLJ 4B1RA 2HNYA 1RESA 3U9ZA 4H0OA 4RA2A 2Y2ZA 3SEZA 3ZSZA 4A57A 3SUPA 1N39A 3VQAA 1QVFA 3G4ST 4HG2A 4WFAL 1Q7YC 4NCBA 4BU2A 4LSLA 1A35A 1T08B 4NQWB 1VQPA 3CD6T 2IP2A 2R7DA 4X6AJ 4J9EA 1B7TA 4TVRA 4CCJA 3B02A 1P7IA 4KITB 2ZPGB 1JTXA 3LFKA 4B8XA 4OVLA 1NK8A 3HPHA 4DQPA 2LVSA 5LRSA 2KYBA 3TSZA 1M27C 1P9QC 3D1NI 3K4BA 5D3GA 2XHCA 4ZDPA 3DKMA 2CP0A 4E7HA 4J8OA 4EZ9A 3PV8A 3EL2A 5J2PA 1RTIA 1MDMA 4WXCA 1PU7A 2L9SA 2GWKA 4RM3A 3M4GA 3KYLA 3PIOL 3G25A 3H6ZA 4ZYAA 2ZNZA 2W48A 3LP1A 1PYVA 2LJ1A 2KDOA 3R61A 1I5OB 4B3AA 1YCYA 2M9HA 4BHCA 1SSFA 1ZBIA 4Y13A 4EM1A 1SFXA 2MGQA 2L4AA 4FWNA 3K58A 4P1WA 4NLCA 3THWA 1SRLA 2O6GE 1ZG5A 1QLYA 4E7JA 4EIAA 3HPGA 1XTAA 1QVFM 3CMEI 1V76A 3RERA 3H46O 2DXCA 3CCUI 4EM0B 4KH6A 1WJDA 2JWKA 1KZHA 3CLOA 3RPUD 2YR2A 3BR6A 2D5VA 3BDLA 1Y0UA 4J9DA 3HRUA 4JKEA 2XAQA 2OUMA 4OIQF 3GF2A 1XB4A 3CI5A 5AQVA 2DA6A 1T98A 2HYFA 3ZOBA 1EP4A 5HK0A 1FX7A 1NHAA 2MI6A 3QRFF 5CIUA 2XIDA 1ITYA 3CC4I 4PA1A 1WKMA 2BV6A 1XQSC 4BRPA 2R7OA 2XF5A 2DETA 3OYEA 5JMVA 2XV4S 1OI1A 4II1A 2M02A 2BE5F 4F3OA 1VQKI 3WODF 5A0LA 4KV8A 4XU2A 3CCQN 1S29A 2VXZA 4K8XA 3E9FA 4NC6A 1ZG1A 1N77A 4DWIA 4LF9K 5D6YA 4OPKA 1OISA 1KYWA 1NM1A 3VS3A 3FIWA 5IT9O 2QM3A 1Q7YR 5KYUB 2MAMA 2DL4A 1VQKA 2OZSA 4QIWN 3SFZA 3AAFA 2KROA 3SQNA 3GOIA 2Z33A 3V9WA 1YJWQ 2LZ6B 5HS8A 1U84A 3I55I 2KGTA 4DQRA 1WJEA 4IJAA 3PIPF 4KGVB 4DF8A 4BXUA 1XC5A 4XU0A 5GAMe 3VQ7A 1HMVA 4NNJA 1WBBA 2CQ7A 3S2WA 4UUVA 1VRLA 1UDLA 1C0MA 3WTYC 3GZ6A 2RJFA 1RUWA 3S3MA 2QAZA 1UAAA 1VIEA 3M07A 2R93J 2ZJRF 2I7PA 1VQ8Q 2B7EA 3GNGA 1X1AA 4D9JA 1I8FA 3QZ5B 4HT9A 1LEBA 2PY5A 3EUAA 2RA2A 2L2OA 2F9WA 1DDNA 1KU9A 1EJ9A 3SDBA 2P9SA 2MK5A 2W4SA 3PIPA 3A01B 1XWLA 1XJWB 2L9RA 3CUQB 1SD6A 2OA4A 3TGNA 2CREA 2JUGA 4M7DD 1HDDC 2MH2A 2IC3A 1Q81O 3PNYA 4UY8O 3K9TA 4AIAA 2LRQA 2I5WA 1NLOC 2LJ0A 2X6NA 3WGGA 3SEQA 1KC8U 5KCHA 4BGDA 4LK0F 4KGXB 3BFMA 2PMUA 3SDZA 3PTAA 4DTNA 2OTJA 4MEXF 2QTVA 3ZX3A 3ZFJA 4X9DA 2DW4A 3NTIA 3K5MA 3CCMA 1RBTA 1S9EA 1RABB 2P4WA 2JOYA 4DV2K 1B9NA 4CZEA 4ZH4F 4DTPA 2H94A 2BZ8A 4L9JA 2R5YB 3TANA 4A63B 1KQ9A 4OIRF 2MOXA 2ZQBA 3JCMg 4A54A 2LY2A 3CDHA 3K6GA 4HQMA 3I8BA 1WJCA 2XRIA 4CZGA 3LAJA 3AVIA 1IO6A 2KT0A 2VCPA 1ZBLA 1BL0A 3FJPA 2LT4A 1W4SA 5E8IA 2P0KA 3HTVA 4RGUA 1WJBA 1WVRA 2V6EA 3W6KB 3VS4A 3O9RA 1IGUA 1A6IA 2EFQA 4JZ3A 3HM9A 4BD3A 3E1SA 2DEUA 5F27A 5HLIA 3M4YA 3JRDA 4M4ZA 1LNXA 3E1YA 1I5ZA 3LZJA 4IUVA 4XU3A 5GAN6 4B24A 1BWFO 3E5UA 4BR5A 2AQEA 3I54A 2J7IA 3CMMA 2HQEA 5ECAA 1NH3A 3MCPA 3CQYA 2KKOA 3LA3A 2R7ZJ 2K40A 1OCRH 2KRNA 4XRSG 4D7MA 3RZDJ 4A0XA 4A3LJ 2D8HA 4ZGDB 4Y33A 2A0FB 4CJEA 2H3EB 2CP6A 3ISNC 3QYEA 5E79C 3QJYA 2BY1A 1KG2A 1WN7A 3BLYA 1YQRA 4NB4A 4J7IA 2QENA 5IYDJ 2RN2A 1AWXA 1GHCA 3M0TA 2F4MB 3LP0A 4NXMK 4AIDA 4BDZA 1OVYA 5GANf 1VK0A 4QOZB 3LOCA 1TQIA 3JRBA 5D4RA 1BOTO 1MSFC 4C3JJ 3EGDA 4Z02A 3IWFA 3KWIA 4CGHA 4M7AA 1XX5A 4F14A 4V2GA 2IOCA 1MMAA 4PJNA 1SSHA 4C0GA 3RJPA 5E20A 5IT9E 3HDDA 1JL2A 4OF1A 4FOIA 3WVEB 1NYGA 2HDWA 5J39A 1I27A 3AVNA 2R7YA 2B8AA 4MDAA 1S6QA 3QEPA 3CCEI 3ESWB 4XTXA 2GIVA 3MO8A 4M74A 4QQ6A 3KIOA 5AQZA 1VQLQ 2M0MA 5C15A 2EWSA 2PJRB 1UGQB 3CCUA 3HSBA 3OA9A 4HCCA 4LD0A 4XLEA 4N9HA 3C6UA 1VQ6I 2HB5A 5BPNA 3EG9B 1G99A 1QRYA 5JR3A 3TAPA 1KQ2A 3GLLA 4FLUA 1ATNA 5FU7C 3GMEA 2EFIA 1WSUA 4DLEA 4FQGA 2HHHK 3D5LA 3J80K 5AN4A 3A8HB 1LFBA 3AVHA 3NGIA 2D8JA 5SWMA 4IRHA 3S6IA 1JCGA 1B8IA 2FSWA 5LEKA 4F3QA 4CGDA 2OJED 4NZGA 2H6BA 4BRLA 1XSXA 2EHGA 3G71A 4M7AF 5F0XA 2Z5UA 4M41A 1QHTA 2LNHB 3WUHA 4UV8A 2JNGA 2EZIA 2DI3A 3H3UA 2XSJC 3WTUC 3PT9A 3MN7A 3B8AX 4I7FA 2P7VB 3MN6A 2KHOA 5D5XB 1D0ZA 4BEHB 4EJUA 3N5NX 2RPIA 4ON0A 5ADXH 2FSJA 4EEFG 3OJUA 3CBOA 1IXCA 3IG1A 4UHTA 2GOXB 2FNPA 1BI4B 2ZGWA 2KQWA 2KBTA 4M77B 1DU0A 4DR3K 4X65K 2QKMB 2HNZA 2GF7A 5IT9K 4Q48A 5FLXZ 2YS9A 4RW4A 1R1UA 1QGPA 4R8HA 2X4WA 3JCMQ 1DP3A 3CCUT 3E97A 2ZMEA 2CMPA 3OOPA 2NUZA 3JCMW 3M54A 4LD5A 3R60A 3FZFA 3TO7A 1RT1A 1U6GA 5K7ZA 3TR8A 1QQMA 4DUZK 4O0IA 3TP0A 3HKSA 1VQ8I 3O08A 2H1KA 4IKFA 4N4NB 2PJRA 4LSNA 2P5LC 2EJFA 4KREA 1YJNT 2OTLN 1VQ4N 2RQTA 4D5FA 3NMZC 3FLGA 4JKAA 2CFOA 4U0WA 3D2EB 5CZ1A 4CSWA 3HB9A 3GVAA 1X3ZB 4YDUA 2VJ5A 2IJLA 2HBMA 3J80E 2BGGA 4M78F 5BRFA 4F7UB 1XS9A 1R5GA 4OIOF 1BC7C 5CYMA 1RUNA 4IUQA 3BUZB 2EJGA 1LEAA 2F2VA 3F23A 4KULA 1KHIA 4X34A 1M90U 1FJGK 4IL6C 2X9HA 4AIJA 1ZBSA 1UFMA 4O6JA 3RYRA 3PO2J 3TAQA 4F91B 1RIOH 3VEYA 3G2BA 2K4BA 1E2XA 1OJLA 3NAUA 2HBJA 3ZT3A 2QUFA 1S7EA 2DNUA 4H8KA 2E3HA 4IFVA 2DA5A 2ZO4A 2HDCA 3CVSA 4PIIA 2PJPA 2HVSA 3G7ZA 2OTLT 3S1QJ 4ESFA 3I0WA 5JVTA 2JM8A 1GVJA 4PUSA 3QJ6A 1GLAG 2HGCA 5DM6F 4O5FA 5GAMf 3JB9I 1LQ1A 1U5SA 1CGPA 2OA8A 4NCGA 1ZSGA 4K42A 1XSVA 3HTSB 3JSPA 3QWLA 1PDNC 3AVLA 2JM9A 2O8CB 4N4OB 2EV5A 2UZKA 4KN7X 4CZMA 3A01A 1X4PA 1PVEA 4HPQA 3MEXA 1LE8A 1Q86C 2DAQA 1Q86R 2ABLA 1XCBA 1KD1U 2P0QA 2DTZA 2DX1A 2OYQA 1U9OA 1Q7YO 2EWNA 3N4MA 4M75B 1OCOH 1KJWA 4BE2A 4G6DA 1BCMA 1PNJA 3MP6A 4YOUA 2D5RA 3KFWX 3LSPA 4FM1A 4RTZA 3DXKA 1KVBA 3H35A 3QEXA 2F6CA 3ZLJA 3UB5A 5KYXB 4IDKA 1VYTA 4XL9A 4LDWA 2YNHA 4CC3A 2KJBA 2YJEA 1FOXA 1FTZA 1NBWA 1RILA 3VRYA 5E1ZB 2LP0A 5A2QE 1HPZA 4C9YA 2KNBB 1XCVA 3HGYA 1YITN 4L0YB 3NCIA 1ZYQA 3H0DA 1JU5C 5IXBA 1RDUA 4DTUA 2V7YA 1YHQT 1PJRA 2XUBA 1KU2A 1ULYA 5FD5A 1V29B 3LP2A 3RRHA 3MKYB 1G3YA 4A3FJ 4EJYA 3HP9A 1XNRK 1OX9A 4DU3A 2WSCE 1ZA1B 2JTVA 2EQKA 2RHXA 2ZCWA 5F0HA 4FHTA 1SL1A 1IG7A 2QTXA 2EZKA 3QINA 1IKYA 1GV5A 3MEEA 3GP8A 4C8OA 3CETA 5DCFA 5HRRA 5E8GA 3AAPA 3ZX0A 4BRFA 3ML6A 2GZWA 4IWVA 2VQFK 2QQRA 4Z4EA 1GL5A 5EOYA 2BVLA 1W97L 5B3SH 4IQ4A 1U2VA 2E6MA 1WUAA 4M9SA 4ZDOA 3R3LA 5E41A 2CSIA 2EX3A 2XDVA 3I5SA 2P9PA 2CUDA 1ZLJA 2I8DA 1RADB 1VQOI 2E70A 2HDAA 3L8BA 1WJ5A 1JL1A 1K6OA 3CCMT 1EWRA 4LOCA 4DB3A 1ILYA 1BIAA 1PM3A 4B3XA 2D0QB 5AQGA 2EGAA 1U1TA 3AO2A 2Y0SN 3QYBA 5KK1A 5HDGA 2QQ9A 2CZ1B 2JPSA 3J81O 1FPQA 3O5BA 3ZSVA 3KWGA 2X6YA 2DBMA 1EX4A 1G2BA 4OO1J 5C6SA 1MU2A 3R6OA 2NRRA 4GGGA 4OB2B 2ZGZA 3JB9D 2KYMA 3CO7C 2BE2A 3K4MA 1HSTA 1S3XA 1QPMA 1I07A 2VL8A 3CXCS 2KEAA 2OPSA 1HSQA 4M7YA 3WT0A 2VQGA 5CVVA 2QWQA 2ESNA 3PNTA 1MGQA 4MEYF 3R9PA 3QDKA 5D5WB 3CCVI 3K5NA 4C8QF 3DKXA 1OYYA 4N0AC 2K9SA 3FSPA 3CUOA 1C0GA 4DF4A 3X28B 2EA4A 2NVXJ 2ZE2A 2KLOA 3CMYA 1KA8A 1K73C 4E2FB 4V19K 3ZQCA 2GQVA 2UV1A 1AT1B 4C2TA 4KUMA 4ESJA 3F73A 2X0LA 2EAYA 1I1SA 4XIDA 4JUVA 2YUQA 1OR7C 2FOWA 1GXIE 1X3WB 3NH2A 4I2PA 2FBYA 2QGUA 3P5JA 1QP3A 4W5NA 4XR6A 3WTZA 1XN7A 1IBKK 1S1UA 2M30A 2G9WA 4QW2A 1ACMB 2DFEA 3BR1A 1APLC 2FZKB 2D1KA 3TSPA 1BI0A 1T3SA 4FM0A 2GELA 1KONA 4CJQA 1I1JA 5E26A 2OPTA 4H5NA 3KE2A 2L02A 2ZPFB 2QEXT 3SK3A 2PBIA 3RQIA 1I39A 1M1KC 4EQQA 3FF5A 5HLGA 2KW4A 4B3RK 5IAYA 2JT1A 3SYZA 1LMZA 1LNWA 3QSUA 5J6XA 3PIPL 3NH0A 2Z2SB 5AQHA 3GPLA 2PYJA 3QOEA 2PTKA 3DPTA 3CP8A 3TOAA 2VPLA 4F7UE 4J5YA 1EKEA 3AHUA 2XGXA 1GLNA 1ERDA 4AIHA 1G83A 3E19A 1AEYA 3CCRA 3M8EA 1XSDA 2D0AA 2DK5A 2E1CA 4FWLA 4A61A 2VQLA 5AZIA 1KFDA 1QSLA 2VC1A 2D0BA 1FN7A 2DF6A 2P81A 3FZLA 3CCJA 3ULEB 4CIGA 3HYFA 2V9KA 3GTKJ 4IOCL 1H641 4MTEA 2IS4A 2V4JC 4JKBA 5HNFA 4O0JA 3JB9J 4KNYA 4AIKA 2VBXA 3GTJJ 1EWQA 2NVUB 4CZHA 2Q2EB 4MO5A 2CZ0B 1QP2A 3CERA 4WTOB 3LM2A 4EJWA 1I81A 1L3UA 1PD1A 1SMTA 4WQ4A 4LNPA 3QBYA 1E6HA 4X9CA 1UZCA 5KPRA 3FISA 5M5XJ 1JT0A 3BC8A 3TREA 2DL7A 3J7AP 3DKWA 4CGGA 2E41A 1Z7UA 2V1UA 2V52B 3LAMA 2IGMA 4A3BJ 1Z25A 3IAM2 2WC2A 3NF7A 3H9NA 2DFFA 1C0FA 1KLMA 2ZBKA 1QZ6A 3HJFA 2R58A 2L7MP 3CPWM 4IRIA 3BDPA 3NAEA 5GADP 2O9SA 5J1YA 5EGOA 2KI7A 1RDWX 1RACB 2QWMA 4JI7K 2J06A 1L3TA 3UWNA 3J7AF 3SAFA 2EZHA 2XDPA 1D9DA 3PO4A 3S1NJ 4B3OA 4YOXA 1W2BS 2ZPIB 4U67L 2WBNA 1QZZA 3VODA 4M3TA 1ZUKA 3ZQ7A 4DR1K 3DLEA 4MLHA 4CJKA 1Q18A 4BI4A 1YG2A 2YHXA 2EH3A 5JFRA 3KP3A 2E5QA 2ATQA 1ATSA 1MZBA 2K57A 1RBRA 1TYQB 3ME9A 1HOMA 3N4QA 2E2OA 3CCMQ 4X0GA 2YUNA 1BU6O 1TGOA 2VKEA 1ON2A 1BA5A 4FJIA 5TRDA 2I7NA 3K9JA 4N4IA 4M9ZA 3V6DA 1VQ7I 4HVVA 2YNIA 1LPQA 1W9HA 5KYUA 2VYTA 2R57A 4QAGA 1VQ4A 1YI2Q 3DCFA 3I53A 2L9VA 5CYVA 3FHNA 2LMDA 3SJMA 2L5QA 4C8QD 2HW3A 1MBGA 2W84A 1DQUA 2EW3A 1LOTB 1YWPA 1XOVA 3VFZA 4BVPA 2O9LA 2PUOB 2VG7A 1IO2A 2TCTA 4PQUA 1GOAA 1SPKA 2BZTA 5LJ3g 2JVHA 1ZARA 1FTTA 4ABZA 1QQJA 3JB9H 3Q1JA 2L9NA 3F3XA 2BE9B 3FJ5A 2COBA 1FXXA 1I3AA 1P4WA 3P9KA 5CQXA 2EILH 3TCJA 3D0PA 4NOYA 4Y17A 4I6MB 1TTHB 3V9ZA 1WI9A 3G71Q 1IW7F 3ZL7C 4EV0A 2HOAA 4S05A 3MEGA 3TSWA 2W85A 1Y64A 1NK0A 2DN0A 2D1VA 2L3SA 1NGGA 4F3TA 1YT3A 2HBLA 2DFIA 2P9UA 3DEWA 6AT1B 3TO6A 4XRFA 3E9OA 1O1WA 4ELUA 4HX8A 5D8LB 3W0LA 3CJ9A 4EJTA 2IRFG 2CP3A 4FW1A 3K9KA 5AFUH 1EA3A 3F8BA 1IN7A 2JN0A 4QCLA 4A5NA 4I76A 1FKPA 3RI4A 2P9IA 4JHDB 3EG1A 3VYHB 3PSFA 3M55A 2YWWA 3WG7H 5D8KB 2DIQA 3A5NC 1PC0A 1DTQA 1W1FA 2EQJA 1SD4A 2A1RA 3NARA 1TVRA 3SXYA 4CGZA 2DOAA 2L54A 1OPLA 2DXBA 1QO0D 2G8IA 2DTIA 2F5FA 3CVTA 4PLLA 3IHOA 1SHGA 1VQ4I 4PL6A 4QPOA 2P9PB 1YJ9T 2GXBA 1B92A 3GYHX 3L1AA 4UNOA 1XD7A 2ZXIA 3HC7A 9ATCB 4CCLA 1WSEA 5DMRA 1LOJA 1YQKA 1S7AA 4FM4B 2W7NA 3S16J 2FUG2 3KUFA 4ISFA 1NMNA 2MH9A 4BXXJ 2AT1B 2E19A 1S9HA 3LX7A 1K0XA 3NF9A 4JHDA 2KFNA 3VB2A 1NM7A 4E1NA 2P5OA 1Y1VJ 1V4RA 4PJOA 4AI5A 1TUCA 3CQTA 3THKA 1BCOA 5HKCA 1DPRA 3VQEA 3EYIA 2CRGA 3LSHA 3GLXA 2KDZA 1IUYA 1RBVA 4FM2A 2YDLA 4JJBA 4RB0A 3KK2A 2TDXA 2K02A 5K14A 4RTUA 3MEAA 2GNCA 1GBQA 2FBTA 3GTOJ 1S1WA 1OCTC 5DUKA 5I11A 2PLYA 2NOBA 4AFUC 3WNFA 5E1WA 1ZTRA 2DYBA 3O4QA 4CZLA 2DJNA 2JJ9A 1X2QA 1UJ8A 1X6OA 2QWNA 2AQFA 3J7YJ 2MF2A 4AWXB 1X01A 2RHUA 5HLTA 3WTSC 3B6AA 1G4DA 2HQNA 1NG6A 5EYRA 2PFUA 4PCQA 3BG7A 4Q5WA 2SEMA 5M5YJ 2A3ZA 3CJAA 3L4QA 4MDWA 2K79A 2WV1A 5C25A 3QXEB 1UB9A 1NGHA 1T56A 3E0JB 4JOMA 1ATRA 2ICWG 5GANj 5KYXA 2HHWA 2G8KA 4YELA 3DYAA 1X1BA 4MNUA 1T39A 4II3A 2DA3A 2Y9YA 4E6RA 4PL7A 2HSTA 2V8JA 5AQJA 2XMFA 5FLMJ 2R7VA 2FL7A 2ELJA 2LMJA 2VBYA 2W57A 4LITA 3GL1A 5GAN3 3M1FA 2VT2A 1I50J 3QMLA 2P7CB 4WFNL 2QXLA 5H6RA 3B6OA 2KL4A 1B34A 3L7WA 3RKWA 4XK8E 2QSGX 4F2RA 4ZYDA 2EYYA 3Q0VA 3I56N 3UA7A 2K3XA 3SEMA 1RDAA 4ZN3A 2JTFA 1QHGA 3OBYA 4B9UA 1NOZA 1H0MA 1NE8A 2B6AA 4M3WA 3QNNA 1X1DA 4QS7A 3J7ZI 1FYNA 1Z26A 4FK4A 3CCSI 4B48A 4YFUA 4OPJA 2HHSA 1OV3A 4XTZA 1E3MA 3HUGB 4B9LA 1Z3YA 3JTHA 3E6MA 3CCSA 1SHFA 1XMKA 2EZLA 3HZ6A 2DVEA 5IT9Z 4ZN1A 3JAMO 1VQNA 1VQNQ 1MH4A 3BPXA 3JRIA 1STZA 2PNIA 3FKJA 4M75A 3DTEA 1YW9A 3NPFA 2KQRA 3FZMA 2X6XA 3GZNB 2IVWA 1VQLI 3RVCA 2LQ8A 1OLTA 2VQHA 5GPCA 3VMFB 5AQOA 2G8HA 4DYCA 2IS6A 4BB7A 2COWA 3CJQB 2WB1N 4E9FA 2V7FA 1FOWA 5FB2A 1RBUA 3TPQA 2R3SA 2HD0A 1NLPC 2VODA 1PU8A 3E3VA 2HMAA 1YCSB 1GFDA 3OH9A 2W1OA 2E2JJ 4JI3K 2QA4Q 2HS5A 4GYIA 3FE1A 2W00A 1YJ9A 3G10A 2F5VA 2JGUA 2PVOB 3VS1A 1NKEA 3OS1A 1C0TA 3IRXA 4DV3K 3F22A 3AVMA 1KK7A 3FXJA 4HCBA 2OTJN 4BQAA 3F8NA 3O6BB 4ENNA 1Q81U 1VQ7N 1Y8RB 2QBYB 2JG6A 2X1CA 2EKOA 4Y7NJ 3TEDA 3CO6C 2HHTA 5LJ5d 4B3MK 3CXCM 1AWJA 3DKYA 2K5IA 1FT9A 4BY9C 5ICEA 2XRNA 4WCIA 4BWJA 3LWLA 4F52A 3SAGA 3U8XA 3QU6A 2A6EF 1GCPA 5CQGA 2NYSA 2A61A 2K3FA 3CF5L 1YIJA 5HK3A 4X66K 4M78B 4IQJA 5L3DA 2VKDA 1IKXA 1K83J 1JXSA 1ZBJA 4LFAK 2YNGA 3SWNC 5GAN2 1Y0NA 2B0LA 1RAEB 3FR0A 3MZ8A 1NEGA 1UHFA 4OPAA 2RM4A 3BR2A 3DFGA 5GAN8 2XKOC 3O3HA 1H9TA 3SZGA 1HKTA 4P9UA 1IGNA 5EX5A 2P6TA 1BI4A 6PAXA 3LW5E 4KTZA 3OA6A 1ZSZB 1JGGA 2YX7A 4BRQA 3RKYA 4U0VA 2EIMH 3CQXA 1N36K 4CC4B 3ZQHA 2R4GA 3I4MJ 3A2KA 5BOXA 2X74A 4CIEA 2QK9A 2Y30A 4D0PA 1J75A 1RCHA 5TKYA 2K27A 1IDZA 1B9MA 4C3HJ 1Z21A 4KTWA 4B3SK 1ZG3A 1QCFA 2E5NA 1I0CA 1MV0B 1UJYA 2E10A 5EEGA 2E64A 4EMKC 3M1CA 3DLMA 1HBXG 3BT9A 5M1OA 3VU3C 3K7AJ 5KQ8A 2E20A 2X4HA 4GXOA 3C94A 2HZTA 3OTOK 3M0QA 3JCMb 3ERED 4R1HA 2M1HA 4WF2A 4CF8A 5D6XA 2LRDA 1HK9A 3BTJA 4S04A 3U23A 2ED0A 3PQJA 5GAEJ 3MCAB 3HSCA 3CPFA 4PGHA 5FKKA 1M8VA 3EYZA 1QMCA 3JCMh 1XNQK 3O9TA 2UWMA 3WNEA 2E6NA 1K78A 2GM4A 2HEQA 5IP6A 3VOVA 2BY2A 2M3AA 1NEBA 1WSIA 2KPMA 1Z1DA 2CGLA 1LVAA 2IA1A 2BW3B 4ISEA 4Q5VA 1JLQA 3Q0UA 1S72T 1R0AA 2XDBA 3ATUA 2R7RA 2ECZA 1L0OC 4HAMA 3TTFA 2M45A 4WCGA 2WBMA 1YIJI 4RB2C 3CLQA 3MJXA 5IHNA 3U3YA 5C12A 5M5WJ 2OTLI 3PX6A 4X62K 4N76A 4X1EA 5SZTA 4M78E 1TWAJ 4R0KA 2H8RA 1MMDA 2GX9A 3RTVA 4C8QC 2BDPA 2ZFWA 5JVGF 3CD6A 3NWTA 3V8JA 1EXQA 2EV0A 3VQPA 2DPNA 3VYTB 3MKWB 1WJFA 2YNFA 3CCVQ 3ZEUB 2R7XA 4B43A 3IS9A 3ZQGA 1VQKQ 4PHTX 1PG5B 2OTLA 2VG6A 1ZRCA 2IIRA 2AHQA 3JAMK 1A36A 2UXBK 4Q47A 3M57A 2RI2A 5GAMd 3F8MA 2XHBA 1M3QA 1EH6A 2KT8A 1J5OA 3T1BA 3C6AA 2E1YA 3TBIA 5GAN4 2KRCA 4BG9A 2GOMA 2F5KA 4XM3A 3FXOA 2GGRA 2O8DB 3JSOA 2EQIA 4UQGA 4I99C 1AOJA 3T1AA 1XC3A 2HWVA 3CXCP 3BR3A 4YOWA 2E2PA 3CCUQ 4M77C 3F2KA 2RJCA 4FLZA 3I0RA 5JI6A 1FMWA 4FWKA 2L8DA 3QBXA 1ENHA 1WRJA 2M9UA 4GVMA 4FJ8A 1FP1D 1ASUA 1TWHJ 4HDVA 3ZSRA 2XGCA 3MKDA 4BRGA 1HKQA 2DERA 4IHTA 1VQNI 2BXYA 4CI0C 4BY7J 1J53A 4LF6K 2IW5A 1ZQ3P 4HA8A 1YN8A 2CYYA 3S15J 1MJBA 1NU0A 2ZWHA 4B9SA 4OFAA 4QVCA 5AQWA 4DQIA 4D8KA 1G5VA 1QZ5A 1QQCA 3FKIJ 3ZMTA 1G15A 2LCLA 4CZFA 2QGGA 1Q9YA 4B44A 4CW7B 5DM7L 4GMJB 3OYGA 4B9TA 1YIJN 2DD4A 2DODA 3I64A 3OWTA 4RAYA 3AVCA 3ASNH 1K4SA 1DP7P 2Q0RA 2BTTA 3CTAA 4XICA 1R71A 4ZZLA 2ZM6K 1QHHD 1GRIA 1NJIR 1M2VA 1S1TA 1K0SA 4CJUA 3IFRA 3QWYA 3OW2A 2K86A 1ORPA 2HU9A 3A5MC 2EVRA 4CJ3A 4U7BA 1U5TC 1SUQA 2BXZA 2MWPA 2FRWA 4CGIA 3JAME 2E5KA 1N9RA 5F2RA 1VQ5Q 3MXIA 3GNFB 4A6EA 1VA7A 5J8CA 1B4AA 2GXGA 4CECA 5HODA 4AFQC 1PRLC 3VQCA 3CCQQ 1BK2A 2W0ZA 1T33A 1M1KR 1IH7A 3MAJA 5KRTA 2ZSHB 1W1WE 2LH9A 2R5ZA 1D9FA 3M59A 1U3EM 1TUYA 3S2HJ 4XSZF 4OX9K 1MNDA 3CD6N 2GWJA 4DFMA 1VQ9Q 1MDUB 2ID6A 4A4EA 2ZNYA 4G8XA 1NNEA 1V54H 2QSHX 3MP1A 2EBPA 5HCKA 1VQPT 1JGSA 2X6SA 1D0XA 1IXDA 4EW0A 3L2VA 3TTDA 2NS8A 3NVMA 4M7DB 1K9MR 4OFEA 1U78A 2IIMA 4IO8A 4QKUA 3MXMA 1ONVA 1REPC 3OW2M 2JA8J 4KGZB 1RTHA 4FPAA 1OCCH 2FOKA 3BG9A 2F5EA 4W1UA 4O5BA 1YITT 1UAXA 4IOAL 1LCKA 3HBTA 2BH1A 4B6MA 1S8NA 1VAZA 3GTPJ 3L00A 4E1MA 3DXMB 2RHIA 4LF8K 2OTJT 2F5TX 1FMKA 3SQ0A 3A98A 4FJKA 3ZCOA 2B9SA 2WFBA 4DV5K 1JJ6C 1KQJA 3LSIA 3U6FA 4I6MA 1B59A 3SZTA 4FJHA 4IDHA 2YLCA 4DJAA 2HOTA 3VYSB 4LLNA 2O31A 1F21A 3ZCMA 3UA6A 4OMPA 2FSNA 3MPUB 3BY5A 3CMAT 3LPTA 1K8AO 4MFBA 3CCVA 1RFQA 3H0FA 3H0IA 3FMRA 1RAFB 3K70D 3VQ9A 1N8RR 3UKUA 1VOMA 1X69A 4DBHA 3CCLA 4MDBA 3KP4A 2RI3A 4AYBN 1LDDA 4EMKA 4DSIA 1IGQA 1PP7U 4M77F 2XI9A 1X4OA 5KYYB 4BUPA 1R00A 5GAHJ 3KEQA 3RDIA 3VSKA 3BW1A 2RVCA 3RMAA 3V8LA 4R79A 1H8AC 5E3NA 4JK8A 1VQOT 3CCEN 2A40A 2HHVA 2EPDA 3W2WA 3TEEA 4IVNA 5EDNA 1P92A 4K41A 1OQYA 4OVAA 2OTJI 2PI0A 1YQMA 2ASOA 3WQUA 1NGEA 4HZFA 2XKOA 5CVUA 2K7AA 1LWEA 1KLNA 3EUKL 3GBTA 5GANd 3X25B 4JS5A 5FFXA 3UPUA