3L31A

Crystal structure of the cbs and drtgg domains of the regulatory region of clostridium perfringens pyrophosphatase complexed with the inhibitor, amp
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
234
structure length
234
Chain Sequence
VKLKVEDLEMDKIAPLAPEVSLKMAWNIMRDKNLKSIPVADGNNHLLGMLSTSNITATYMDIWDSNILAKSATSLDNILDTLSAEAQNINEERKVFPGKVVVAAMQAESLKEFISEGDIAIAGDRAEIQAELIELKVSLLIVTGGHTPSKEIIELAKKNNITVITTPHDSFTASRLIVQSLPVDYVMTKDNLVAVSTDDLVEDVKVTMSETRYSNYPVIDENNKVVGSIARFHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable manganase-dependent inorganic pyrophosphatase
publication title Crystal Structures of the CBS and DRTGG Domains of the Regulatory Region of Clostridiumperfringens Pyrophosphatase Complexed with the Inhibitor, AMP, and Activator, Diadenosine Tetraphosphate.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 71
structure length 234
sequence length 234
chains with identical sequence B
ec nomenclature ec 3.6.1.1: Inorganic diphosphatase.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
A PF07085 DRTGG DRTGG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 3l31A01
3.40.1390.20 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 HprK N-terminal domain-like 3l31A02
4IY4A 2RIHA 2IOJA 5K22B 5LXQA 4P1GA 5MMZA 2QR1E 2RIFA 3FWSA 4UUUA 1KNXA 3LFZA 2ZY9A 4L0DA 5K25C 3FWRA 3L31A 4L3VA 2O16A 2NYEA 1KO7A 4IY0A 3KPCA 2QRCE 3K2VA 1Y5HA 3OCOA 2UV7A 3LHHA 2YZIA 5IIPA 3GBYA 4FXSA 1PVMA 4FRYA 2RC3A 2NYCA 4IY2A 3I8NA 2YVXA 2UV6A 3FHMA 2YZQA 4PCUA 2EMQA 4P1OA 4GQVA 4GQYA 4NOCA 2OOXE 3OCMA 2D4ZA 3T4NC 2P9MA 5KS7A 4O9KA 4L27A 4IYSA 2YVYA 3K6EA 3KXRA 1O50A 5K24C 2UV5A 4DQWA 1XKFA 2UV4A 3KPDA 3FV6A 3LQNA 4COOA 1YAVA 4IY3A 3PC3A 3ORGA 3SL7A 3TDHC 2PFIA 3L2BA 2EF7A 3HF7A 4L28A 4ESYB 2YVZA 4GQWA 4ESYA 2QREE 2QRDE 4HG0A 3PC4A 3KH5A 5K23C 3FNAA 3KPBA 2QH1A 3DDJA 1PBJA 3OI8A 3PC2A 2QLVC 2OOYE 3TE5C 3LV9A 2OUXA
chains in the Genus database with same CATH superfamily
4IY4A 1NMOA 2IU8A 2RIHA 2IOJA 2JA3A 4E79A 5K22B 5LXQA 4P1GA 5MMZA 2QR1E 2RIFA 3FWSA 4UUUA 1KNXA 3LFZA 2ZY9A 4L0DA 5K25C 3FWRA 4IWMA 3L31A 4L3VA 2AM2A 2O16A 2NYEA 1KO7A 4IY0A 3KPCA 2AM1A 2QRCE 3K2VA 1Y5HA 3OCOA 2UV7A 3WSIA 4QF5A 3LHHA 2YZIA 5IIPA 3GBYA 2YYBA 4FXSA 3EH0A 1PVMA 4FRYA 3WSGA 2RC3A 3WSEA 2NYCA 4IY2A 3I8NA 4C13A 3ZL8A 3WSFA 1E8CA 2YVXA 2UV6A 3EEQA 2XJAA 3FHMA 2YZQA 4PCUA 2IU9A 2EMQA 4BUBA 4P1OA 4GQVA 4GQYA 4NOCA 2OOXE 3OCMA 2D4ZA 3T4NC 2P9MA 5KS7A 4O9KA 4C12A 4L27A 4ZIYA 4IYSA 2YVYA 4IHFA 3K6EA 3KXRA 1O50A 5K24C 4IHHA 2UV5A 3WSDA 4DQWA 1XKFA 2UV4A 3KPDA 3FV6A 3LQNA 4COOA 1YAVA 4IY3A 3PC3A 3ORGA 2IUAA 3SL7A 3TDHC 2J9LA 2PFIA 3L2BA 2EF7A 4CVLA 4QDIA 3HF7A 4L28A 4ESYB 3WSHA 1NMPA 2FYWA 3ZM5A 2YVZA 4E75A 4GQWA 4CVMA 4ESYA 4IHGA 2QREE 2QRDE 2WTZA 4HG0A 3PC4A 3ZM6A 3KH5A 5K23C 3FNAA 3KPBA 2QH1A 4IWGA 3DDJA 1PBJA 3OI8A 3PC2A 1GG4A 2QLVC 3PMOA 2OOYE 3TE5C 4CVKA 3LV9A 2OUXA
chains in the Genus database with same CATH topology
4IY4A 2RIHA 2IOJA 2JA3A 5K22B 5LXQA 4P1GA 5MMZA 2QR1E 2RIFA 3FWSA 4UUUA 1KNXA 3LFZA 2ZY9A 4L0DA 5K25C 3FWRA 3L31A 4L3VA 2O16A 2NYEA 1KO7A 4IY0A 3KPCA 2QRCE 3K2VA 1Y5HA 3OCOA 2UV7A 3LHHA 2YZIA 5IIPA 3GBYA 4FXSA 1PVMA 4FRYA 2RC3A 2NYCA 4IY2A 3I8NA 2YVXA 2UV6A 3FHMA 2YZQA 4PCUA 2EMQA 4P1OA 4GQVA 4GQYA 4NOCA 2OOXE 3OCMA 2D4ZA 3T4NC 2P9MA 5KS7A 4O9KA 4L27A 4IYSA 2YVYA 3K6EA 3KXRA 1O50A 5K24C 2UV5A 4DQWA 1XKFA 2UV4A 3KPDA 3FV6A 3LQNA 4COOA 1YAVA 4IY3A 3PC3A 3ORGA 3SL7A 3TDHC 2J9LA 2PFIA 3L2BA 2EF7A 3HF7A 4L28A 4ESYB 2YVZA 4GQWA 4ESYA 2QREE 2QRDE 4HG0A 3PC4A 3KH5A 5K23C 3FNAA 3KPBA 2QH1A 3DDJA 1PBJA 3OI8A 3PC2A 2QLVC 2OOYE 3TE5C 3LV9A 2OUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IY4 A;  2RIH A;  2IOJ A;  5K22 B;  5LXQ A;  4P1G A;  5MMZ A;  2QR1 E;  2RIF A;  3FWS A;  4UUU A;  1KNX A;  3LFZ A;  2ZY9 A;  4L0D A;  5K25 C;  3FWR A;  3L31 A;  4L3V A;  2O16 A;  2NYE A;  1KO7 A;  4IY0 A;  3KPC A;  2QRC E;  3K2V A;  1Y5H A;  3OCO A;  2UV7 A;  3LHH A;  2YZI A;  5IIP A;  3GBY A;  4FXS A;  1PVM A;  4FRY A;  2RC3 A;  2NYC A;  4IY2 A;  3I8N A;  2YVX A;  2UV6 A;  3FHM A;  2YZQ A;  4PCU A;  2EMQ A;  4P1O A;  4GQV A;  4GQY A;  4NOC A;  2OOX E;  3OCM A;  2D4Z A;  3T4N C;  2P9M A;  5KS7 A;  4O9K A;  4L27 A;  4IYS A;  2YVY A;  3K6E A;  3KXR A;  1O50 A;  5K24 C;  2UV5 A;  4DQW A;  1XKF A;  2UV4 A;  3KPD A;  3FV6 A;  3LQN A;  4COO A;  1YAV A;  4IY3 A;  3PC3 A;  3ORG A;  3SL7 A;  3TDH C;  2PFI A;  3L2B A;  2EF7 A;  3HF7 A;  4L28 A;  4ESY B;  2YVZ A;  4GQW A;  4ESY A;  2QRE E;  2QRD E;  4HG0 A;  3PC4 A;  3KH5 A;  5K23 C;  3FNA A;  3KPB A;  2QH1 A;  3DDJ A;  1PBJ A;  3OI8 A;  3PC2 A;  2QLV C;  2OOY E;  3TE5 C;  3LV9 A;  2OUX A; 
#chains in the Genus database with same CATH topology
 4IY4 A;  1NMO A;  2IU8 A;  2RIH A;  2IOJ A;  2JA3 A;  4E79 A;  5K22 B;  5LXQ A;  4P1G A;  5MMZ A;  2QR1 E;  2RIF A;  3FWS A;  4UUU A;  1KNX A;  3LFZ A;  2ZY9 A;  4L0D A;  5K25 C;  3FWR A;  4IWM A;  3L31 A;  4L3V A;  2AM2 A;  2O16 A;  2NYE A;  1KO7 A;  4IY0 A;  3KPC A;  2AM1 A;  2QRC E;  3K2V A;  1Y5H A;  3OCO A;  2UV7 A;  3WSI A;  4QF5 A;  3LHH A;  2YZI A;  5IIP A;  3GBY A;  2YYB A;  4FXS A;  3EH0 A;  1PVM A;  4FRY A;  3WSG A;  2RC3 A;  3WSE A;  2NYC A;  4IY2 A;  3I8N A;  4C13 A;  3ZL8 A;  3WSF A;  1E8C A;  2YVX A;  2UV6 A;  3EEQ A;  2XJA A;  3FHM A;  2YZQ A;  4PCU A;  2IU9 A;  2EMQ A;  4BUB A;  4P1O A;  4GQV A;  4GQY A;  4NOC A;  2OOX E;  3OCM A;  2D4Z A;  3T4N C;  2P9M A;  5KS7 A;  4O9K A;  4C12 A;  4L27 A;  4ZIY A;  4IYS A;  2YVY A;  4IHF A;  3K6E A;  3KXR A;  1O50 A;  5K24 C;  4IHH A;  2UV5 A;  3WSD A;  4DQW A;  1XKF A;  2UV4 A;  3KPD A;  3FV6 A;  3LQN A;  4COO A;  1YAV A;  4IY3 A;  3PC3 A;  3ORG A;  2IUA A;  3SL7 A;  3TDH C;  2J9L A;  2PFI A;  3L2B A;  2EF7 A;  4CVL A;  4QDI A;  3HF7 A;  4L28 A;  4ESY B;  3WSH A;  1NMP A;  2FYW A;  3ZM5 A;  2YVZ A;  4E75 A;  4GQW A;  4CVM A;  4ESY A;  4IHG A;  2QRE E;  2QRD E;  2WTZ A;  4HG0 A;  3PC4 A;  3ZM6 A;  3KH5 A;  5K23 C;  3FNA A;  3KPB A;  2QH1 A;  4IWG A;  3DDJ A;  1PBJ A;  3OI8 A;  3PC2 A;  1GG4 A;  2QLV C;  3PMO A;  2OOY E;  3TE5 C;  4CVK A;  3LV9 A;  2OUX A; 
#chains in the Genus database with same CATH homology
 4IY4 A;  2RIH A;  2IOJ A;  2JA3 A;  5K22 B;  5LXQ A;  4P1G A;  5MMZ A;  2QR1 E;  2RIF A;  3FWS A;  4UUU A;  1KNX A;  3LFZ A;  2ZY9 A;  4L0D A;  5K25 C;  3FWR A;  3L31 A;  4L3V A;  2O16 A;  2NYE A;  1KO7 A;  4IY0 A;  3KPC A;  2QRC E;  3K2V A;  1Y5H A;  3OCO A;  2UV7 A;  3LHH A;  2YZI A;  5IIP A;  3GBY A;  4FXS A;  1PVM A;  4FRY A;  2RC3 A;  2NYC A;  4IY2 A;  3I8N A;  2YVX A;  2UV6 A;  3FHM A;  2YZQ A;  4PCU A;  2EMQ A;  4P1O A;  4GQV A;  4GQY A;  4NOC A;  2OOX E;  3OCM A;  2D4Z A;  3T4N C;  2P9M A;  5KS7 A;  4O9K A;  4L27 A;  4IYS A;  2YVY A;  3K6E A;  3KXR A;  1O50 A;  5K24 C;  2UV5 A;  4DQW A;  1XKF A;  2UV4 A;  3KPD A;  3FV6 A;  3LQN A;  4COO A;  1YAV A;  4IY3 A;  3PC3 A;  3ORG A;  3SL7 A;  3TDH C;  2J9L A;  2PFI A;  3L2B A;  2EF7 A;  3HF7 A;  4L28 A;  4ESY B;  2YVZ A;  4GQW A;  4ESY A;  2QRE E;  2QRD E;  4HG0 A;  3PC4 A;  3KH5 A;  5K23 C;  3FNA A;  3KPB A;  2QH1 A;  3DDJ A;  1PBJ A;  3OI8 A;  3PC2 A;  2QLV C;  2OOY E;  3TE5 C;  3LV9 A;  2OUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...