3L33A

Human mesotrypsin complexed with amyloid precursor protein inhibitor(appi)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin-3
publication title Determinants of affinity and proteolytic stability in interactions of Kunitz family protease inhibitors with mesotrypsin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/cell adhesion
total genus 52
structure length 224
sequence length 224
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l33A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3l33A02
1P2QA 3D62A 2QY0B 1QRXA 4D9QA 1MU6B 5LPEA 1F2SE 1BBRH 3VB4A 1SOTA 1GJ7B 1YM0A 2FOAA 1QIXB 2CN0H 1BTHH 1W7GH 2UUFB 2QYIA 2UWLA 2ZGBH 4M7GA 3TGKE 2B8OH 4HI3A 4I33A 2FWWA 4H6SB 1GI8B 1UVPA 1SGQE 3GY8A 4O03A 2Y5FA 1VJ9U 5F03A 4J2YB 1GDQA 3ATWA 1Y3XA 1DPOA 1Z8JB 2F9BH 1C4V2 1Z6EA 3EE0B 1YP9A 3GISB 3UOPA 4Y6DA 1VITG 2SNVA 2P59A 2BD4A 2GX4A 2ODPA 3F9GA 5DO4H 4Y76A 1BOQA 1TRMA 2WPKS 1MTWA 3VPKA 2Y82A 6CHAC 2ZDKA 1YF4A 1EAUA 1IQLA 1QCPA 1E34B 3TPIZ 4B2AA 4ISOA 3A7WA 2FOFA 3SNAA 1FMGA 4UDWH 3KGPA 1A61H 1TFXA 1KTSB 3PLPA 2P95A 1EX3A 2FLRH 1BTYA 1P01A 1FJSA 2R0LA 2OINA 2PUXB 2ZQ2A 1O2HA 3URCA 4AOQA 2Y7XA 4ZH8A 1HFDA 1D6WA 4CBNA 3LGTA 1N8OC 2P16A 2ASUB 1A0JA 1KLIH 4R0IA 3SHAH 3MU1A 2XYAA 4U30A 3NPSA 1IAUA 2GT7A 1D4PB 1NRRH 1Z8IB 2J9NA 1NRQH 2QF0A 3CENA 3P8OA 3SU0A 1H4WA 1DY8A 4K5ZA 1WOFA 1GCTB 3BF6H 1AE5A 3S7HB 2XNIA 4IC5A 3VEQB 1GJ8B 1PQAA 1S0QA 5C5OA 2ULLA 3FP8E 1SGFG 2CJIA 5C67A 1BRCE 5FBIA 7ESTE 1OXGA 1HLTH 5EW1H 5H4IB 3MTYA 4AFQA 1C1NA 1GI5A 5EQQA 2BQ6B 4WH8A 3RXHA 1AE8H 3UNSA 4NIVA 5E0GA 2VIOA 2PGBB 1B5GH 5DP5A 2QXHA 4AB8A 1H8IH 4GCHG 1YCPK 1F7ZA 3I29A 5HGGA 1SPJA 1BTWA 2A31A 1SGEE 1G37A 3LC5A 2BY9X 1LQEA 1DE7H 3SORA 1O5BB 4Q7XA 3BG4B 3RC6A 1FPCH 2YNAA 1YPHC 4AORA 1EXFA 3BTKE 2ODYB 1ETTH 1MKWK 1EZQA 2STAE 4OS2A 2WUCA 4NWLA 2AS9A 3IITA 2H1UA 1HBTH 2FS9A 2H9TH 3ATIA 3T2NA 1L1NA 1TPSA 1TX6A 2OBQA 3DFLA 5IDKA 3CP7A 4ZKNU 1KDQB 2ZI2H 4CRDA 4GLYA 4K2YA 4TWYA 2OC8A 2NWNA 1NRPH 5E2OA 3SU3A 2TIOA 2ZHQH 2C8ZB 3RC4A 3ENSB 3T62A 2UUKB 1PQ7A 1NRNH 2A7HA 4X2WA 3DA9B 3MU0A 4KGAA 1TX7A 1CA0B 3DFJA 1G2LA 5L2ZH 1OP8A 1Z6JH 3A8CA 3M7UA 1GI2A 2IPHA 1O31A 2WV4A 5FBEA 3RC5A 1QL8A 3VB7A 1SQAA 2QN5T 3FANA 1HIAB 2OBOA 5C2ZA 3A89A 3W94A 5LPRA 3S9BA 3BIUH 2VIPA 2BXUH 4FUHA 2H6MA 4YOGA 3MMGA 4Q7YA 4DY7B 1MAYA 2A4QA 2GZ7A 4OS6A 3RM0H 2GZ8A 4IC6A 3PLBA 1E36B 4BOHA 1GBIA 1WCZA 3LGVA 5DPAA 2R3YA 3ZZ7A 4CRBA 2FOEA 1XMNB 3TVJB 1ZR0A 1Y59T 1ZZZA 1A1RA 1SMFE 3JZ2B 1G3DA 3NZIA 4LK4A 1MTUA 4ABEA 3KF2A 1Q31A 2B9LA 2FOGA 2VIDA 1O2SA 1HAHH 2CHAC 1AVGH 4DIIH 5DP8A 5K7RA 4KTSA 1YBWA 1GI4A 2JH6D 1DWEH 1TNIA 1FIWA 5CE1A 5B6OA 3P70B 3KQBA 4U32A 1BJVA 1JIRA 2VVCA 3Q00A 1ZPCA 1YGCH 1UCYH 3P95A 4AFSA 5ESBA 4ZKSU 1O2YA 3ZZBA 3RXQA 3TNSA 1IQFA 3RU4T 4WXIA 1GJ5H 2O8MA 5AVDA 4ABBA 3MU4A 3M7QA 1W0YH 4A92A 1DWDH 1SQTA 4JCNA 1WU1A 1TNJA 1PYTC 2NU2E 3TIUA 3ZV9A 3AASA 1KXCA 1O35A 3LGWA 1QQ4A 2VVUA 4ZUHA 2G5NA 5DG6A 1NY22 1GBCA 3QZRA 4R8TB 5C1XA 4LZ1H 4KELA 3TH4H 3M61U 3TK6A 2Z94A 5A0AE 3KN2A 4MNVA 1QHRB 2SGQE 1YLDA 5GPIB 1GBFA 3L3TA 2JKHA 1UK3A 2QXGA 2W7SA 1Z8GA 4CH8B 4BAKB 1W8BH 1QRWA 3A8AA 3QLPH 2A32A 2WUBA 1TGCA 3Q3KA 2A5AA 3M5LA 3S9AA 5ABWA 1NU7B 1RTKA 3HK3B 1H9IE 1UVUH 1CHOF 3PLKA 3UUZA 2ZU1A 4A7IB 4X1PU 1F5LA 3KL6A 2JETB 1G2MA 3M3SA 4B76A 3GY2A 1FDPA 5AFYH 2EEKA 1P2MA 5EG4A 3M7TA 1FV9A 2UUYA 4IGDA 2BOHB 1ZTJA 3UFAA 3RXEA 3MNSA 1LCYA 2CXVA 2ANKH 1G3BA 2PKAA 1O3IA 2AFQB 4OS7A 1L4ZA 5HXFA 1KSNA 2FOBA 3MI4A 5FHTA 1Y3UA 2OC0A 4RKJB 1MCVA 1CGJE 2H5DA 4K1SA 3F6UH 1TYNA 3DUXH 1IQHA 5T3HA 4OS5A 4B2CA 1WAYB 1CVWH 4NGAH 3N7OA 2QXJA 1O2VA 1SLUB 1IHTH 3RMNH 3TK9A 1QTFA 1QB1A 3L6PA 1CSOE 1PJPA 2ZHWH 3RU4D 4MPWA 1XXFA 2RA3A 3MFJA 1O5FH 1KLTA 1D3DB 4MNWA 2WYGA 5A09A 2I6SA 2VIVA 1AFQC 1AVWA 1Q2WA 1LKBA 1W3CA 1BMAA 3M5MA 4UFDH 3V13A 1EB1H 3KCGH 3QK1A 4KP0A 5DK1A 1C1QA 4B74A 4K3JA 4WF8A 1N1LA 1O2QA 1ARCA 1C9PA 1GI6A 3RMMH 1YPEH 3RLWH 4I7YH 3U9AH 1O3FA 1TQ7B 1EAXA 2FLBH 3RXTA 1OWIA 2V35A 1LPGB 1V2JT 3MNXA 3U1IB 1PPFE 4AX9H 1GWAA 1S81A 2K1QA 2QC2A 4X8VH 3RXGA 2Q6GA 3QTOH 2RG3A 1O2JA 3FP7E 2A7JA 3M36A 1H9LB 1ZJDA 4Z6AH 1HNEE 3GCNA 2XBXA 1GHBF 2PHBA 1BCUH 3ZYEA 3BTFE 2XC4A 1RD3B 2A1DB 1HRTH 1GDUA 1ESTA 2ZNKH 1UK2A 3RXIA 3MH6A 1QB6A 5HM9A 1MUEB 1HXEH 5I25A 1AMHA 2OLGA 1P2JA 1C4Y2 1VGCB 2C93B 3SI3H 2P94A 3BSQA 4E7NA 4LXBH 1YPHE 1ZRKA 2ZC9H 1ORFA 2ZU4A 3LC3A 1FQ3A 1SHYA 1Y5AT 1VCPA 4X8SH 1SI5H 4ABFA 1DUEA 4MLFB 3P8NA 1F5KU 2Z3EA 3SJKA 3IWMA 5L6NH 1HIAA 1O3BA 2TBSA 2B0FA 1ELAA 4ZHLU 1P2NA 2ZO3H 3TGIE 2Q1JA 1DM4B 4BTTB 1TBQH 2VB0A 2ZGXH 1Q3XA 1XUHA 1QBNA 4NFFA 4YLQH 1IHSH 1NT1A 3BTEE 1V2VT 2VIWA 1GJAB 1EZXC 1O3EA 1P03A 1DS2E 1W14U 3Q3YA 3AW0A 2ZPSA 5E0HA 1KYNA 2BM2A 1TGNA 1ABIH 2CGAA 1O2GH 3RU4E 2ILNA 1FN8A 2BZAA 1TNLA 3NK8A 1GHXH 2Z7FE 3SU1A 3QX5H 4E06H 2BTCE 1GGDB 3PYHA 1O2KA 2OP9A 5EXNA 5FX5A 4MQAA 2ZCKP 1SLVB 5CHAB 3D49H 4FU8A 2FDAA 4JK6A 4IN2A 1PPBH 1EAIA 1C5UA 1QB9A 2HNTC 4GSOA 2FI5E 1KY9A 1MD7A 1T8LA 4GVUA 2BD8A 3MNCA 3U8RH 1MBMA 1S85A 2A2QH 2GDDA 3RXKA 2ALPA 1WTGH 4JK5A 4H4FA 2AIPA 1TNHA 5JDUB 1AY6H 5JBTA 2VVVA 3I77A 1IQNA 1SGYE 4FUDA 1SFIA 1BHXB 2GP9B 3SV7A 1HPGA 4CHAC 4GCHF 1DT2A 2ZWLH 1AKSB 2AERH 1IQMA 1HXFH 1O3KA 3UTUH 1HUTH 1T31A 2QAAA 3V0XA 2XRCA 2HOBA 2IOTA 2Y5HA 3FZDA 3A7VA 2G55A 2FOMB 1G9IE 4A1XA 3ATLA 1TWXB 3E16B 4WMEA 1BBRE 2BDGA 3U98H 1LHCH 2GVFA 1D6RA 4AG2A 4BXWA 3E0PB 1O2PA 3EA7A 3QWCH 2C3SA 1P05A 1GMHG 3UR6A 2F9NA 2GD4B 2ZFPH 2GV6A 3LOXA 1FY8E 5JB8S 4UD9H 2ZECA 4JYVH 3QGJA 2FMJA 4AGJA 3TJNA 2VNTA 4YO9A 2SGFE 2XCNA 4AYVB 3QN7A 5FCKA 3PMHB 2NU4E 2ZFRH 2PFEA 3Q76A 2FPZA 1SG8B 1O3GA 1Y5UT 1QA0A 1XUIA 1V2KT 1S5SA 4AGKA 1A5GH 4CRFA 6CHAB 4X6OA 4Y71A 1P04A 1W11U 1ZYOA 1MKXH 3L33A 4FUGA 1SGDE 3ZZ8A 2W5EA 4INHA 1J8AA 2CF9H 1QFKH 3UWJH 1TOMH 3M5OA 1C1MA 1AU8A 1FY3A 1WTHD 1GMDG 3ZZ9A 1ZSKA 1AWHB 1GHBG 2BY5X 1ELEE 1NO9H 1XUGA 3A85A 3S0NA 1TONA 3KIDU 3QTVH 4CRCA 4NZQA 1IQEA 4AYYB 1WUNH 3E1XB 1P12E 1EOLA 2ZHEH 5C20A 1N8OB 4X6MA 2FM2A 3JZ1B 1TE0A 5EOKA 4NIYA 1GJ9B 1SLWB 4X6NA 1C1UH 4ZMAH 8LPRA 1EP6A 1T8MA 2AYWA 1ZPBA 3K65B 3ZVBA 3U69H 1A0LA 2AIQA 1C9TA 5G4BA 4B73A 1BIOA 1YLCA 3PO1C 1HAIH 1FAKH 3HGNA 1ZTLA 1AZZA 3BTDE 3DHKH 4CREA 4FVBA 1ZJKA 1CT4E 2QXIA 3SI4H 1JOUB 2O8TA 3GCOA 5A0BA 4O97A 1L2EA 4Y8XA 4A1TA 1A4WH 4D7GA 2PR3A 1MZDA 3F68H 1N6XA 2F9PA 3A7YA 1JIMA 1DITH 1NC6A 1S6HA 3HKJB 4HGCA 1ELGA 3PV4A 1XUFA 1W10U 1HYLA 3M37A 4IW4E 2TGTA 5TCAA 4A6LA 2VJ1A 3RXVA 2J92A 2Q6FA 5F8ZA 4FUFA 4I8GA 1TMBH 2ZU3A 1GI7B 1GPZA 3STIA 1PQ8A 3BTWE 3STJA 5C5NA 3E8LA 3DD2H 1SGFA 1GL0E 1O3HA 1Z71A 5PTPA 1WQVH 2ZFQH 4K60A 1BRBE 1GBHA 5EPYA 2ANYA 4BAQB 1EAWA 1TRNA 1XM1A 1QNJA 5C3NA 4ZXXH 2OC1A 3FAOA 1EOJA 4I31A 4Y7AA 3F1SB 1OWJA 3ZVGA 1FZZA 3SNBA 5IYTA 2HGTH 7GCHF 1LHDH 5BPEA 4FUCA 2JH0D 3KHVA 2HLCA 1C5TA 2ZEBA 4NWKA 3GCHB 2OUAA 5F8XA 1K1MA 2VWOA 2O8LA 2V6NA 2SGPE 3BEUA 1GBEA 4X1RU 5T6DA 2RDLA 3C27B 1O3PB 1W13U 3I78A 2W3IA 1C5YB 1LHGH 1GBAA 3RXRA 4YTAA 1GBMA 2JH5D 2ANWA 1V2MT 1Z1IA 4FU7A 1EKBB 1AZ8A 1F0TA 3SU5A 4CRAA 4FVDA 1AD8H 1H9HE 1THSH 1O2NA 1NFUA 2C90B 1NROH 2PKSB 3SU4A 1HJ9A 3GCHC 1QURH 2Z9GA 1G36A 1VCWA 3A83A 3LPRA 3E0NB 2FS8A 4WJG2 1GVLA 1TPAE 4IBLH 1QA7A 4ISNA 4BTIB 2BHGA 4CRGA 2KAIB 1QBVH 1ZMNA 1HDTH 2BDHA 3ZZ4A 4CR9A 2A5IA 4YM9A 2ZCHP 4D76A 1QJ7B 2QF3A 2PKSC 2XTTB 1K1LA 3ODFA 3SV2H 1W12U 5SGAE 3SQHE 1AO5A 1CHGA 2C8WB 4X1SU 2Q6DA 1GBJA 4JZDH 1TMUH 5GJ4B 4K69A 1ANBA 4DVAU 3MH5A 1DWCH 2CHAB 4ZROA 3VB5A 1UHBB 7KMEH 3T28A 1TALA 4TPIZ 4O9VA 2IN2A 1AKSA 4IMQA 4GHQA 1W0ZU 2BDYA 3A88A 4NIWA 1EZUC 2G8TA 5I46H 1A5HA 1C5OH 5A8XA 2IJOB 3TITA 1UCYE 3ZZ5A 4BXSA 2FTMA 2V0BA 3URDA 1BTXA 1P57B 1O5EH 1LVYA 1GJCB 3S7KB 1HAVA 2VIQA 1SGTA 1LVOA 1K21H 2PV9B 2AEIH 4YLUA 9ESTA 5ETXA 3TJOA 2FXRA 1KTTB 4XE4A 3T29A 2BLQA 3MU8A 2FEQH 1JBUH 5E0JA 2ZA5A 1UTPA 1P3CA 1CGHA 4ZHAA 1TGBA 3BTGE 1LKAA 2FI4E 3M3TA 4RN6A 1A0HB 3PM3A 1C1WH 1INCA 2ZU5A 1UVSH 1QR3E 3GY7A 1CT0E 1BRUP 1BTZA 3TH2H 1DXPA 3ZZ3A 3MU5A 1K1OA 3RP2A 1TNKA 1V2RT 1T7CA 3P6ZB 5HYOA 2J38A 3P8GA 3Q77A 1SFQB 1ARBA 4FU9A 2ZDLA 1C5NH 2O8UA 4UEHH 4X2XA 2BDIA 4ZAEA 3VXFH 5EQSA 2THFB 2J95A 1V2NT 1ESBA 1C5QA 5AF9H 4UFEH 4IS5A 1BZXE 2ZDNA 3HPTB 1SOZA 3VB6A 1V2UT 1SB1H 2TGAA 1ZGIA 4SGBE 1SGNE 1XUJA 4X6PA 3KEEA 1UTQA 1AB9C 2AMDA 1ELDE 1OWKA 1YCPH 7GCHG 2FI3E 3LT3A 2FYRA 2Z6BD 1QRZA 4JYUH 1BTUA 1P11E 1AUJA 4UONA 4ISHH 4RSPA 4GPGA 1NFXA 1J16A 1F0UA 1MBQA 2P8OC 4WMFA 1OYTH 2D26C 1ZHRA 2FIRH 1LHEH 1P9UA 1BMLA 1K1PA 3ESTA 2GDEH 2ZGCA 5EPNA 4B75A 1MKWH 1EJAA 2GMTC 4NSYA 1C2LA 1EPTC 2WINI 3RMOH 3RUOA 4ABJA 2ZFFH 1FY1A 5CMXH 1RJXB 1J15A 3MO3A 4VGCC 3UREA 8ESTE 1S82A 2BOKA 3PMBB 2F83A 3ZVFA 1J14A 1DOJA 2GKVE 4Y7BA 4ABAA 1C5ZB 2UWOA 2R3UA 4JYTA 3TGJE 3A80A 1OPHB 1E35B 3U8OH 1UTJA 2GGVB 3M35A 3NKKA 1SGCA 3PWCA 1AQ7A 1CT2E 4FUJA 2FESH 1ZSJA 1OSSA 4D7FA 1Z7KA 2RCEA 2BYAX 3U1JB 3LJJA 1OOKB 1O3LA 1O5AB 2ZPQA 1AFQB 4HTCH 1ETSH 4DIHH 4BTUB 2PTNA 1C2HA 4B1TA 1GBDA 1D3TB 1ABJH 2XC0A 4DURA 1C5PA 1BB0B 1RS0A 2FX6A 3GICB 2LNCA 3RXSA 1GJBB 2XW9A 4JZFH 4X1QU 2D8WA 4CH2B 3A7XA 2A0QB 1GMHF 1RRKA 4IN1A 2H2ZA 5L2YH 1A3BH 3ZZAA 3QDZB 2XBYA 2F3CE 1EJMA 5JBBS 2BX4A 3UOUA 3TNTA 2I6QA 3VGCC 1F5RA 4X2YA 2BLWA 5EW2H 2DUCA 2D1JA 2ZHDA 1C5WB 1GI3A 4ABIA 4OGXA 1O3AA 4WXVA 1W2KH 1JWTA 1P10A 3E3TA 1O33A 1IQJA 1CU1A 4XBBA 1ANCA 1V6DA 3FVFB 3MOCA 3F9EA 4GAWA 4U01A 1WBGB 2FO9A 3RXOA 1BQYA 2EC9H 4ASHA 1HJAB 1EQ9A 1BBRK 1V2QT 2VWMA 1O2MA 1UTKA 1KDQA 4XFQA 4INLA 1XVOA 1AFEH 2DE9A 1RTLA 2O8WA 1GMDF 4NZLA 1ZRBA 1SL3A 4ESTE 1M9UA 3K6YA 2G4UA 2ZGJA 3OY5U 3OTJE 3UPEA 1CGIE 2KAIA 4QT8C 2PGQB 3UR9A 1ZLRA 1E0FD 1HJAC 1ZHMA 3O8RA 2SGDE 1CQQA 1QL9A 2BQ7B 3SZNA 4B71A 1H1BA 6ESTA 1E38B 1HAGE 1KXDA 3T27A 4SGAE 2R2WU 3A87A 4X2VA 1OP2A 4TWWA 4ABGA 1A5IA 1DDJA 1PQ5A 3LGUA 2A7CA 1DSTA 1D3QB 2XWAA 1PYTD 3MO9A 2LPRA 1MMJN 1C5XB 1OP0A 2NU0E 3V3MA 4BANB 5JBAS 2FOHA 1V2OT 2FZZA 1FY5A 1ELVA 3MO6A 1TIOA 1YCPM 3GY4A 1KIGH 2R0KA 3A7TA 3O8BA 1C1PA 4XSKU 5EXLA 1YPKH 2ZTYA 3SUFA 3RM2H 2VU8E 1HAXB 1L0ZA 1L4DA 1P06A 1NFYA 2P3TB 3NCLA 1QL7A 3BTME 3ODDA 5EXMA 1NTPA 2CMYA 1PFXC 3RDZA 4BAMB 1DWBH 4PROA 4CHAB 2GV7A 3P8FA 3SNDA 5EU8A 1UVOA 5A8ZA 1K2I1 4AN7A 2ZHFH 1P2KA 1BTPA 1V2LT 3ATKA 1O2WA 1ELBA 2OTVA 1EUFA 2HALA 2Z3DA 5JPMH 2R9PA 1LQDB 1K1JA 1AI8H 1GHVH 2XBWA 3ZVEA 4UE7H 3RXCA 2ZTZA 2BD5A 1GG6B 3AAVA 1NRSH 1V2ST 3SU2A 1ZHPA 2G5VA 3GDSA 2ZP0H 2SNWA 3A8BA 5LH8A 1GBKA 2W3KA 3LGYA 4UFFH 2ZCLP 1LPKB 1O2RA 2ZDVH 9LPRA 2GCHG 3HGPA 1Y3YA 3SGBE 1O39A 3AW1A 4YT6H 1MAXA 1O3MA 1SBWA 1U6QA 1O2UA 1MCTA 3AAUA 4F49A 3TJUA 1KXBA 1GJ6A 2NU3E 1GG6C 2WV5A 2FOCA 5JYIA 2FODA 3R3GB 1SSXA 3EYDA 3EDXB 4YOIA 3UIRA 2PSYA 5GDSH 2J4IA 1YC0A 2ZFSA 2STBE 1B0FA 4ZXYH 1O3JA 1MQ5A 6GCHG 1SC8U 1Z1JA 2Z3CA 5FPTA 1ETRH 1DLKB 1MQ6A 1O3CA 1FY4A 2XCFA 3GOVB 3HK6B 4OGYA 2EI7A 1V2PT 2SGEE 1JRSA 5DGJA 1B0EA 1HAZB 1HCGA 2XBVA 1PPGE 2AGGX 2P3UB 3UQOA 3SUGA 1O30A 1IQKA 3E91A 1LHFH 1LO6A 1THRH 4NA7A 1YPMH 1EASA 5DJ7A 3RXAA 1BHXF 3HKIB 2TRMA 3SUEA 2QGRA 4I8LA 1XVMA 3GDVA 3MH4A 1O32A 2P3FH 1T8OA 1VR1H 4KTCA 2QV1A 2ZTXA 1J9CH 1D3PB 4OS4A 1FXYA 3S9CA 2EI6A 4FUIA 1C2IA 1C5LH 1L1GA 3PO1B 1LPZB 1WSSH 1YKTA 1IQIA 3SHCH 4YZUA 1SVPA 2C4FH 3UY9A 5FCRA 1SGRE 2BY8X 2PWXA 4K8YA 1EZSC 2C8XB 1QJ1B 5GIBA 1AUTC 1LMWB 8GCHF 3LKWA 3PWBA 1VCQA 1WQSA 1T4VH 3M3VA 2W26A 1P2OA 2ZDMA 1GVZA 1YPJH 3ZV8A 1GHWH 1FONA 1DANH 3ELAH 2GZ9A 1BDAA 1P0SH 1XXDA 2BB4A 3EA9A 3UWIA 4DGJA 2ALVA 1X7AC 2BQWB 1MD8A 4NA8A 4LOYH 4K8BA 3PMJA 2ZF0H 3A8DA 3ZYDA 1OWHA 2W7UA 1BITA 5HM2A 1VZQH 2PTCE 3KQCA 1T4UH 2ZG0H 1AGJA 2BXTH 3QO6A 4HFPB 3W95A 4BAOB 2B5TB 1MU8B 3EA8A 3T26A 3SV8A 3SOSA 1D9IA 2DE8A 3SU6A 1UVTH 3H7OA 1T32A 1RGQA 2R2MB 1Y8TA 3GCTG 2BD3A 1DLEA 1UCYK 5BRRE 2HVXA 1XX9A 1SLXB 2ZFTA 1RIWB 2PKAB 1K22H 1O38A 1GHAG 1TMTH 3GYLB 1FUJA 2ZGHA 5FPSA 3RXLA 3V12A 2NU1E 1B7XB 3P17H 4K1EA 1GMCF 1TQ0B 1NS3A 5LGOA 5ESTE 2AGEX 5HMAA 3H7TA 2YOLA 3D23A 4I8KA 1ZTKA 3A7ZA 2ANMH 1A3EH 3QGNB 3ZZ6A 2D2DA 5J4QA 1RIWC 1TRYA 3RXUA 2ZDAH 4CR5A 1T8NA 2CV3A 4DOQA 1GCTC 5GXPA 4HZHA 1FNIA 2Z9JA 1IOEA 1K28D 1O0DH 1L1JA 1QBOA 2EI8A 3LU9B 1JRTA 4E7RG 5E2PA 3A84A 1TBZH 4ABHA 2H9HA 3IG6B 2Z9IA 3OSYA 1LVMA 1QGFA 1O5CB 3H5CB 4ZHMU 3AVZA 1FI8A 2BY6X 3TH3H 1G30B 1TLDA 1O2LA 4XOJA 1VITH 2A4GA 2UUJB 2BY7X 1A2CH 3OX7U 2O9QA 1ACBE 4XBCA 2OXSA 1V3XA 4JZEH 2VINA 4J1YA 2HRVA 1O36A 5T6GA 3F9FA 4AFZA 3T25A 3TJVA 1OS8A 5DP6A 2VGCB 2GTBA 3R0FA 4WWYA 4F4OC 2G4TA 3SQEE 1MH0A 3BG4C 1FAXA 2ODQA 1DFPA 2AMQA 1JMOH 4BAHB 5F8TA 1NZQH 2J94A 1C2GA 6LPRA 3B23B 3LJOA 3GYMA 2AGIX 1HAPH 2A4RA 2OD3B 3RMLH 4E05H 2TPIZ 3EAJA 5K0HA 4MG3A 1O2ZA 2A2XH 5DP7A 1FLEE 1KXEA 2G81E 1S83A 1V2TT 3ZZDA 5A0CA 1UK4A 3NXPA 1P02A 5LPFA 2VGCC 3RLYH 3RXMA 1ESAA 2Y6TA 1AN1E 1NPMA 1ELFA 1RXPA 8GCHG 2F9UA 1O2XA 1C1OA 2G51A 3WY8A 4JMYA 3SUDA 5FXLA 4RKOB 7LPRA 3PTNA 2BZ6H 3RXFA 3RXPA 1GCDA 4AB9A 1GBBA 3KQEA 3ITIA 3PB1E 1LVBA 1TNGA 1FIZA 1F92A 1C2DA 2ZQ1A 2FX4A 1K1IA 3SNCA 1EATA 2HNTE 1CA0C 1ZPZA 2C8YB 4NCYA 4Y8YA 2BD7A 1C2JA 1GI1A 2F9VA 2XC5A 1HV7A 3U8TH 3OYPA 4GUXA 3PROA 2XXLA 4Y10E 5F6MA 3FZZA 4INKA 5A2MH 5JB9S 1RFNA 4Q2KA 1P9SA 1O5GH 1SQOA 5FAHA 2HPPH 1P09A 3BTHE 2G00A 3ZZCA 1YPLH 1S84A 3LGIA 1O3OA 3B8JA 4K1TA 2VWLA 5T6FA 4LZ4B 1ELCA 3TK5A 3O8CA 4X1NU 4MNYA 1E37B 1NN6A 1CA8B 3GY5A 2B7DH 3E90B 3P92A 1AB9B 1P8VC 1TA2A 1AHTH 2WPMS 1TGSZ 1A7SA 5AHGH 4NFEA 1MTSA 2ESTE 1AWFH 3BTTE 1LTOA 1QJ6B 2ZPRA 2CF8H 4Y0YE 4TYDA 4ZKRU 2P8OB 1S6FA 4O3TA 3C1KA 1RTFB 1O2TA 1UTNA 1GMCG 1ZGVA 4Y8ZA 2GMTB 1GBLA 3D65E 3BG8A 1EPTB 1YYY1 5JBCS 2YNBA 3FFGA 1C1SA 4VGCB 2WPIS 5EODA 1AVXA 3VFEA 8KME2 5GWZA 1G32B 3SN8A 4AFUA 4KTUA 4NA9H 1AIXH 1DVAH 4THNH 2WPLS 1ZMJA 4H42U 5TCCA 3BEIB 2Y5GA 1IQGA 1MZAA 1GJ4H 4I32A 1C2EA 4DW2U 3ZVCA 1C2MA 3MHWU 3A86A 4GHTA 1THPB 1C1RA 4NG9H 1TX8A 3E6PH 1QQUA 1DX5M 1GBTA 3O8DA 4X8UH 1GDNA 2Y81A 4DJZB 1DXWA 4TY7A 2PLXA 1HAYB 1GHZA 1P2IA 2BDCA 4DT7B 2XWBI 1F0SA 3ZVDA 1KXAA 3OY6U 4JZIA 1WYKA 1QY6A 4WVPE 3LDXH 1EB2A 4Q7ZA 2BVSH 3BV9B 3MWIU 1ANEA 1OWEA 1VJAU 4YOJA 1ID5H 3Q3XA 1F0RA 1Y5BT 2BDBA 2GCHF 4MPXA 1O5DH 1GHYH 1NESE 4MVNA 3VGCB 2SGAA 2TGPZ 1O3NA 1UO6A 1XKBC 4Z0KA 3SJ9A 4MNXA 1FN6A 1ANDA 2PSXA 4WH6A 4UFGH 2JETC 2BVRH 4ISLA 2H9EH 1V2WT 1SGIB 4FXGH 1TABE 1W7XH 1FPHH 1C5SA 1ELTA 3BEFB 1BRAA 1TAWA 6GCHF 4YT7H 3K6ZA 1TA6A 5GCHF 4DG4A 1DICA 1SHHB 4WY3A 4MTBA 1CO7E 1XKAC 2A45B 4ABDA 1PPHE 4ISIH 3FP6E 2QIQA 4TPYA 3RXBA 2FYQA 3QZQA 1A46H 1BJUA 2OC7A 3BTQE 2AMPA 3GDUA 2M5TA 3M5NA 1K1NA 3SBKA 5A8YA 3MH7A 3T5FH 3B9FH 3NWUA 2BDAA 5EQRA 4D8NA 2J2UA 3G01A 4X0WU 2OQUA 1BUIA 1DSUA 1JXPA 3HATH 3PMAB 4Y11E 4MPVA 2UWPA 3LIWA 1ZMLA 4FUEA 1C1VH 1MKXK 3S69A 4TY6A 3SJ8A 1TPOA 2FTLE 2BVXH 3RXDA 2TGDA 3CS7A 1OKXA 1C2FA 5C1YA 3SJIA 1UJ1A 3PTBA 1C5RA 2ZKSA 3DT0H 2A5KA 1P3EA 4JZ1A 2Z9KA 3SGAE 1KXFA 2HPQH 3SV9A 1VITF 1PPCE 2ZZUH 1CE5A 3KQDA 2GCTB 2V3HH 1J17T 3EGKH 1UTMA 1HB0B 1OYQA 4AZ2B 1SGPE 1DY9A 2J34A 4MPUA 3UQVA 1C1TA 2WPJS 1KLJH 2H5CA 2SFAA 4IMZA 1TGTA 4O3UA 1O37A 3TLOA 1UHBA 2BD2A 2VH6A 3V7TA 2RA0A 2OQ5A 1MTNB 1UTOA 4OS1A 1O2OA 3ZVAA 2GCTC 1OWDA 2V3OH 1NFWA 1TPPA 1ZSLA 3SGQE 1C4U2 2BLVA 1C2KA 1BA8B 2ZIQH 2BD9A 1S0RA 1VGCC 1GJDB 3VB3A 1NM6A 1N6YA 4YESB 4Y79A 3VXEH 2VWNA 1PPZA 3CS0A 1SR5C 1G3EA 3GCTF 5FPYA 3RXJA 3SV6A 5TJXA 1YPGH 1MTNC 3NUMA 1HJ8A 2QCYA 3A82A 4FUBA 5FX6A 2GT8A 2WYJA 5E8EH 3MYWA 1BMNH 3ATMA 5J4SA 1CHOG 3EQ0H 3GY6A 1GHAF 3TU7H 3BN9A 2BMGB 1GL1A 1OX1A 4B2BA 2BX3A 1K9OE 1TBRH 2G52A 4A5TS 2AH4X 1LDTT 4AG1A 4DCDA 1TB6H 1BT7A 4BNRA 4NIXA 4A1VA 4WMDA 5DKMA 5C1UA 3BIVH 3SO3A 5L30H 4I8HA 1DUAA 1WV7H 2EA3A 5DP9A 1CBWB 3LONA 4MDSA 1UTLM 3A81A 1HGTH 3OU0A 2Z9LA 4Q80A 2BLOA 2HNTF 1XUKA 1TOCB 3K9XB 1GGDC 1G3CA 1H8DH 3LH3A 5CHAC 1PPEE 2OCVB 1UMAH 2ZU2A 4H6TA 1EPTA 1C5MD 5DP3A 2Y80A 4NSVA 5AFZH 1O34A 2Y7ZA 5GCHG 3SNEA 1C5VA 1O3DA 3LH1A 1Y3VA 5EGMA 2PUQH 2F9OA 1O2IA 2HWLB 3GY3A 4KKDA 1CBWC 1EJNA 4I8JA 3QUMP 1BMMH 4XDEA 1HAVB 2QA9E 2P93A 4Y0ZE 2WPHS 1EP5A 2F91A 5DP4A 2PW8H 4XBDA 1MTVA 4U2WA 4ZKOU 1Y3WA 4CBOA 3UNRA 3SJOA 1GI9B 2A4OA 2VH0A 3MNBA 4X8TH 2FP7B 3F9HA 1GI0A 1GVKB 3SW2B 3UNQA 1HAOH 3KNXA 1NU9A 1Z8RA 4D9RA 1ZOMA 3K2UA
chains in the Genus database with same CATH superfamily
1P2QA 3D62A 2QY0B 1QRXA 4D9QA 1MU6B 5LPEA 1F2SE 1BBRH 3VB4A 1SOTA 1GJ7B 1YM0A 2FOAA 1QIXB 2CN0H 1BTHH 1W7GH 2UUFB 2QYIA 2UWLA 2ZGBH 4M7GA 5CHBA 3TGKE 2B8OH 4HI3A 4I33A 2FWWA 4H6SB 1GI8B 1UVPA 1SGQE 3GY8A 4O03A 2Y5FA 1VJ9U 2HLDD 2KCPA 4J2YB 5F03A 1GDQA 3ATWA 1Y3XA 1DPOA 1Z8JB 2F9BH 1C4V2 1Z6EA 3EE0B 1YP9A 3GISB 3UOPA 4Y6DA 1VITG 2SNVA 2P59A 2BD4A 2GX4A 2XOKD 2ODPA 3PV2A 3F9GA 5DO4H 4Y76A 1BOQA 1TRMA 2WPKS 1MTWA 3VPKA 2Y82A 6CHAC 2ZDKA 1YF4A 1EAUA 1IQLA 1QCPA 1E34B 3TPIZ 4B2AA 3CNRA 4ISOA 3A7WA 2FOFA 3SNAA 1FMGA 4UDWH 3KGPA 1A61H 1YWUA 1TFXA 2F43B 1KTSB 3PLPA 2P95A 1EX3A 2FLRH 1BTYA 1P01A 1FJSA 2R0LA 2OINA 2PUXB 2ZQ2A 1O2HA 3URCA 4AOQA 2Y7XA 4ZH8A 1HFDA 1D6WA 4CBNA 3LGTA 1N8OC 2P16A 2ASUB 1A0JA 1KLIH 4R0IA 3SHAH 3MU1A 2XYAA 4U30A 3NPSA 1IAUA 2GT7A 1D4PB 1NRRH 1Z8IB 2J9NA 1NRQH 2QF0A 3CENA 3P8OA 3SU0A 1H4WA 1DY8A 4K5ZA 1WOFA 1GCTB 3BF6H 1AE5A 3S7HB 2XNIA 4IC5A 3VEQB 1GJ8B 1PQAA 1S0QA 5C5OA 2ULLA 3FP8E 1SGFG 2CJIA 5C67A 1BRCE 5FBIA 7ESTE 1OXGA 1HLTH 5EW1H 5H4IB 3MTYA 4AFQA 1C1NA 1GI5A 5EQQA 2BQ6B 4WH8A 3RXHA 1AE8H 3UNSA 4NIVA 5E0GA 2VIOA 2PGBB 5KECA 1B5GH 5DP5A 2QXHA 4AB8A 1H8IH 1YLNA 1YCPK 4GCHG 1F7ZA 3I29A 5IK2D 5HGGA 1SPJA 1BTWA 2A31A 1SGEE 1G37A 3LC5A 2BY9X 1LQEA 1DE7H 3SORA 1O5BB 4Q7XA 3BG4B 3RC6A 1FPCH 2YNAA 1YPHC 4AORA 1EXFA 3BTKE 2ODYB 1ETTH 1MKWK 1EZQA 2STAE 4OS2A 2WUCA 4NWLA 2AS9A 3IITA 2H1UA 1HBTH 2FS9A 2H9TH 3ATIA 3T2NA 1L1NA 1TPSA 1TX6A 2OBQA 3AK5A 4B6FA 3DFLA 5IDKA 3CP7A 2KR7A 4ZKNU 4AC9A 1KDQB 2ZI2H 4CRDA 4GLYA 4K2YA 4TWYA 2OC8A 2L74A 2NWNA 1NRPH 5E2OA 3SU3A 2TIOA 2ZHQH 2C8ZB 3RC4A 3ENSB 3F2HA 3T62A 3FOAA 2UUKB 1PQ7A 1NRNH 2A7HA 4X2WA 3DA9B 3MU0A 4KGAA 1TX7A 1CA0B 3DFJA 1G2LA 1QZ8A 5L2ZH 1OP8A 1Z6JH 3A8CA 3M7UA 1GI2A 2IPHA 1O31A 2WV4A 5FBEA 3RC5A 1QL8A 3VB7A 1SQAA 2QN5T 3FANA 1YY3A 1HIAB 2OBOA 5C2ZA 3A89A 3W94A 5LPRA 3S9BA 3BIUH 3OE7D 2VIPA 2BXUH 4FUHA 2H6MA 4YOGA 3MMGA 4Q7YA 4DY7B 1MAYA 2A4QA 2GZ7A 4OS6A 3RM0H 2GZ8A 2IJD1 4IC6A 3PLBA 1E36B 4BOHA 2K8IA 1GBIA 1WCZA 3LGVA 5DPAA 2R3YA 3ZZ7A 4CRBA 2FOEA 1XMNB 3TVJB 1ZR0A 1Y59T 3PRBA 1ZZZA 4ACBA 1A1RA 1SMFE 3JZ2B 1G3DA 3NZIA 4LK4A 1MTUA 4ABEA 3KF2A 1Q31A 2B9LA 2FOGA 2VIDA 1O2SA 1HAHH 2CHAC 1AVGH 2WZQA 4DIIH 5DP8A 5K7RA 4KTSA 1YBWA 1GI4A 2JH6D 1DWEH 1TNIA 3NRLA 1FIWA 5CE1A 5B6OA 3P70B 3KQBA 3OEED 4Z1MD 4U32A 1BJVA 1JIRA 2VVCA 3Q00A 1ZPCA 1YGCH 1UCYH 3P95A 4AFSA 5ESBA 3UAIC 4ZKSU 1O2YA 3ZZBA 3RXQA 3TNSA 1IQFA 3RU4T 4WXIA 1GJ5H 2O8MA 5AVDA 4ABBA 3MU4A 3M7QA 1W0YH 4A92A 1DWDH 1SQTA 4JCNA 1WU1A 1TNJA 1PYTC 2NU2E 3TIUA 3ZV9A 5EJZA 1EFRD 3AASA 1KXCA 1O35A 3LGWA 1QQ4A 2VVUA 4ZUHA 2G5NA 5DG6A 1NY22 1GBCA 3QZRA 4R8TB 5C1XA 4LZ1H 4KELA 3TH4H 3M61U 3TK6A 2Z94A 5A0AE 3KN2A 2KCAA 4MNVA 1QHRB 2SGQE 1YLDA 5GPIB 1GBFA 3L3TA 2JKHA 1UK3A 2QXGA 2W7SA 1Z8GA 4CH8B 4BAKB 1W8BH 1QRWA 3A8AA 3QLPH 2A32A 2WUBA 1TGCA 3Q3KA 2A5AA 3F0OA 3M5LA 3S9AA 5ABWA 2LELA 1NU7B 1RTKA 3HK3B 1H9IE 1UVUH 1CHOF 3PLKA 3UUZA 2ZU1A 4A7IB 4X1PU 1F5LA 3KL6A 2JETB 1G2MA 3M3SA 4B76A 3GY2A 2PP6A 1FDPA 5AFYH 2EEKA 1P2MA 2QF4A 5EG4A 3M7TA 1FV9A 3F3BA 2UUYA 4IGDA 2BOHB 1ZTJA 3UFAA 3RXEA 3MNSA 1LCYA 4RI0A 3UB0A 2CXVA 2ANKH 1G3BA 2PKAA 1O3IA 2AFQB 4OS7A 1L4ZA 5HXFA 1KSNA 2FOBA 3MI4A 5FHTA 1Y3UA 2OC0A 4RKJB 1MCVA 1VKYA 5T1VA 1CGJE 2H5DA 4K1SA 2EY4C 1TYNA 3DUXH 2JIZD 3F6UH 1IQHA 5T3HA 4OS5A 4B2CA 1WAYB 1CVWH 4NGAH 3N7OA 2QXJA 1O2VA 1SLUB 1IHTH 3RMNH 3TK9A 2YMSB 1QTFA 3WWBA 1QB1A 3L6PA 1CSOE 1PJPA 2ZHWH 3RU4D 4MPWA 1NBMD 1XXFA 2RA3A 3MFJA 1O5FH 1KLTA 1D3DB 4MNWA 2WYGA 5A09A 2I6SA 2VIVA 1AFQC 1AVWA 1Q2WA 1LKBA 1W3CA 1BMAA 3M5MA 4UFDH 3V13A 1EB1H 3KCGH 3QK1A 4KP0A 5DK1A 1C1QA 4B74A 4K3JA 4WF8A 1N1LA 1O2QA 1ARCA 1C9PA 1GI6A 3RMMH 1YPEH 3RLWH 3W1EA 5CDFE 4I7YH 3U9AH 1O3FA 1TQ7B 1EAXA 2FLBH 3MQKC 3RXTA 2J5UA 1OWIA 2V35A 1LPGB 1V2JT 3MNXA 3U1IB 1PPFE 4AX9H 1GWAA 1S81A 2K1QA 2QC2A 4X8VH 3RXGA 2Q6GA 3QTOH 2RG3A 1O2JA 3FP7E 2A7JA 3M36A 1H9LB 1ZJDA 4Z6AH 1HNEE 3GCNA 2XBXA 1GHBF 2PHBA 1BCUH 3ZYEA 3BTFE 2XC4A 1RD3B 2A1DB 1HRTH 1GDUA 1ESTA 2ZNKH 1UK2A 3RXIA 3MH6A 1QB6A 5HM9A 1MUEB 1HXEH 5I25A 1AMHA 2OLGA 1P2JA 1C4Y2 1VGCB 2C93B 3SI3H 2P94A 3BSQA 4E7NA 4LXBH 1YPHE 1ZRKA 2ZC9H 1ORFA 2ZU4A 3DSPA 3LC3A 1FQ3A 1SHYA 1Y5AT 1E1QD 1VCPA 1SI5H 4X8SH 4ABFA 1DUEA 4MLFB 3P8NA 1F5KU 2Z3EA 3SJKA 3IWMA 5L6NH 1HIAA 1O3BA 2TBSA 2B0FA 1ELAA 4ZHLU 1P2NA 2ZO3H 3TGIE 2Q1JA 1DM4B 4BTTB 1TBQH 2VB0A 2ZGXH 1Q3XA 1XUHA 1QBNA 4NFFA 4YLQH 1IHSH 1NT1A 3BTEE 1V2VT 2VIWA 2J98A 1GJAB 1EZXC 1O3EA 1P03A 1DS2E 1W14U 3Q3YA 3AW0A 2ZPSA 5E0HA 5C94A 1KYNA 3U28C 2BM2A 1TGNA 1ABIH 4P02A 2CGAA 1O2GH 3RU4E 2ILNA 1NBME 1FN8A 2BZAA 1TNLA 5HIYA 3NK8A 1GHXH 2Z7FE 3SU1A 3QX5H 4E06H 2BTCE 1GGDB 3PYHA 1O2KA 2OP9A 5EXNA 5FX5A 4MQAA 2ZCKP 1SLVB 5CHAB 3D49H 4FU8A 2FDAA 4JK6A 4IN2A 1PPBH 1EAIA 1C5UA 1QB9A 2HNTC 4GSOA 2FI5E 1KY9A 1MD7A 1T8LA 4GVUA 2BD8A 3MNCA 3U8RH 1MBMA 1S85A 2A2QH 2GDDA 3RXKA 2ALPA 1WTGH 4JK5A 2RFKC 4H4FA 2AIPA 1TNHA 5JDUB 1AY6H 5JBTA 2VVVA 3I77A 1IQNA 1SGYE 4FUDA 1SFIA 1BHXB 1E1RD 2GP9B 3SV7A 1HPGA 4CHAC 4GCHF 1DT2A 3KYGA 2ZWLH 1AKSB 2AERH 1IQMA 1HXFH 1O3KA 3UTUH 1HUTH 1T31A 2QAAA 3V0XA 2XRCA 2HOBA 2IOTA 2Y5HA 3FZDA 3A7VA 2G55A 2FOMB 1G9IE 4A1XA 3ATLA 1TWXB 3E16B 4WMEA 1BBRE 2BDGA 3U98H 3VG8A 1LHCH 2GVFA 4I86A 1D6RA 4AG2A 4BXWA 3E0PB 1O2PA 3EA7A 3QWCH 2C3SA 1P05A 1GMHG 3UR6A 2F9NA 2GD4B 2ZFPH 2GV6A 3LOXA 1FY8E 5JB8S 4UD9H 2ZECA 4JYVH 3QGJA 4YXWD 2FMJA 4AGJA 3TJNA 2VNTA 4YO9A 2SGFE 2XCNA 4AYVB 3QN7A 5FCKA 4F48B 3PMHB 2NU4E 2ZFRH 2PFEA 3Q76A 2FPZA 1SG8B 1O3GA 1Y5UT 1QA0A 1XUIA 1V2KT 1S5SA 4AGKA 1A5GH 4CRFA 6CHAB 4X6OA 4Y71A 1P04A 1W11U 1ZYOA 1MKXH 3L33A 4FUGA 1SGDE 3ZZ8A 4B6EA 2W5EA 4INHA 1J8AA 2CF9H 1QFKH 3UWJH 1TOMH 3M5OA 1C1MA 1AU8A 1FY3A 1WTHD 1GMDG 3ZZ9A 1ZSKA 1AWHB 1GHBG 2BY5X 3DSOA 1ELEE 1NO9H 1XUGA 3A85A 3S0NA 1TONA 3KIDU 3QTVH 4CRCA 4NZQA 1IQEA 4AYYB 1WUNH 3E1XB 1P12E 1EOLA 2ZHEH 5C20A 1N8OB 4X6MA 2FM2A 3JZ1B 1TE0A 5EOKA 4NIYA 1GJ9B 2V3MA 1SLWB 4X6NA 1C1UH 4ZMAH 8LPRA 1EP6A 1T8MA 2AYWA 1ZPBA 3K65B 3ZVBA 3U69H 1A0LA 2AIQA 1C9TA 5G4BA 4B73A 1BIOA 1YLCA 3PO1C 1HAIH 1FAKH 3HGNA 1ZTLA 1AZZA 3BTDE 3DHKH 3OAAD 4CREA 5DSFA 3N7EA 4FVBA 1ZJKA 1CT4E 2QXIA 3SI4H 1JOUB 2O8TA 3GCOA 5A0BA 4O97A 1L2EA 4Y8XA 2WHXA 4FOUC 4A1TA 1A4WH 4D7GA 2PR3A 1MZDA 3F68H 1N6XA 2F9PA 3A7YA 1JIMA 1DITH 1NC6A 1S6HA 3HKJB 4HGCA 1ELGA 3PV4A 1XUFA 1W10U 1SQRA 1HYLA 3M37A 4IW4E 2TGTA 5TCAA 4A6LA 2VJ1A 3RXVA 2J92A 2Q6FA 5F8ZA 4FUFA 4I8GA 1TMBH 2ZU3A 1GI7B 1GPZA 3STIA 1PQ8A 3BTWE 3STJA 5C5NA 3E8LA 3GS9A 3DD2H 1SGFA 1GL0E 1O3HA 1Z71A 5PTPA 1WQVH 2ZFQH 4K60A 1K0HA 1BRBE 1GBHA 5EPYA 2ANYA 4BAQB 1EAWA 1TRNA 1XM1A 1QNJA 5C3NA 4ZXXH 2OC1A 3FAOA 1EOJA 4I31A 4Y7AA 3F1SB 1OWJA 3ZVGA 1FZZA 3SNBA 5IYTA 2HGTH 7GCHF 1LHDH 5BPEA 4FUCA 4TT3D 2JH0D 3KHVA 2HLCA 1C5TA 2ZEBA 4NWKA 3GCHB 2OUAA 5F8XA 1K1MA 2VWOA 2O8LA 2V6NA 2SGPE 3BEUA 1GBEA 4X1RU 5F53A 5T6DA 2RDLA 3C27B 1O3PB 1W13U 3I78A 2W3IA 1C5YB 1LHGH 4XD7D 1GBAA 3RXRA 4YTAA 1GBMA 4DT4A 2JH5D 2ANWA 1V2MT 1Z1IA 4FU7A 1EKBB 1AZ8A 1F0TA 3SU5A 4CRAA 4FVDA 5GNDA 1AD8H 1H9HE 1THSH 1O2NA 1NFUA 2C90B 1NROH 2PKSB 2KZ4A 3SU4A 1HJ9A 3GCHC 1COWD 2KCYA 1QURH 2Z9GA 1G36A 1VCWA 3A83A 3LPRA 3E0NB 2FS8A 4WJG2 1GVLA 1TPAE 4IBLH 1QA7A 4ISNA 2WV9A 4BTIB 2BHGA 4CRGA 4F55A 2KAIB 1QBVH 1ZMNA 1HDTH 2BDHA 3ZZ4A 4CR9A 2A5IA 4YM9A 2ZCHP 4D76A 1QJ7B 2QF3A 2PKSC 2XTTB 1K1LA 3ODFA 3SV2H 1W12U 5SGAE 3SQHE 1AO5A 1CHGA 2C8WB 4X1SU 2Q6DA 1GBJA 4JZDH 1TMUH 5GJ4B 4K69A 1ANBA 4DVAU 3MH5A 1DWCH 1H8ED 2CHAB 4ZROA 5EJLA 3VB5A 1UHBB 7KMEH 3T28A 1TALA 4TPIZ 4O9VA 2IN2A 5C0UA 1AKSA 4IMQA 4GHQA 1W0ZU 2BDYA 3A88A 4NIWA 1EZUC 2G8TA 5I46H 1A5HA 1C5OH 5A8XA 2IJOB 3TITA 1UCYE 3ZZ5A 4BXSA 2FTMA 2V0BA 3URDA 1BTXA 1P57B 3WW7A 1O5EH 1LVYA 1GJCB 3S7KB 1HAVA 2VIQA 3KYFA 1SGTA 1LVOA 1K21H 2PV9B 2AEIH 4YLUA 9ESTA 5ETXA 3TJOA 2FXRA 1KTTB 4XE4A 3T29A 2BLQA 3MU8A 2FEQH 1JBUH 5E0JA 2ZA5A 1UTPA 1P3CA 1CGHA 4ZHAA 1TGBA 3BTGE 1LKAA 2FI4E 3M3TA 4RN6A 1A0HB 3PM3A 1C1WH 1INCA 2ZU5A 1UVSH 1QR3E 3GY7A 1CT0E 1BRUP 1BTZA 3TH2H 1DXPA 3ZZ3A 3MU5A 1K1OA 3RP2A 1TNKA 1W0JD 1V2RT 1T7CA 3P6ZB 5HYOA 2J38A 3P8GA 3Q77A 1SFQB 1ARBA 4FU9A 4TSFD 2ZDLA 1C5NH 2O8UA 4UEHH 4X2XA 2BDIA 4ZAEA 3VXFH 5EQSA 2THFB 2J95A 1V2NT 1ESBA 1C5QA 5AF9H 4UFEH 4IS5A 1BZXE 2ZDNA 3HPTB 1SOZA 3VB6A 1V2UT 1SB1H 2TGAA 1ZGIA 4SGBE 1SGNE 1XUJA 2XNDD 1BMFD 3KEEA 4X6PA 1UTQA 1AB9C 2AMDA 1ELDE 1OWKA 1YCPH 7GCHG 2FI3E 3LT3A 2FYRA 2K0QA 2Z6BD 1QRZA 4JYUH 1BTUA 1P11E 1AUJA 4UONA 4ISHH 4RSPA 4GPGA 1NFXA 1J16A 1F0UA 1MBQA 2P8OC 4WMFA 1OYTH 2D26C 1ZHRA 2FIRH 1LHEH 1P9UA 1BMLA 1K1PA 3ESTA 2GDEH 2ZGCA 5EPNA 4B75A 1MKWH 1EJAA 2GMTC 4NSYA 1C2LA 1EPTC 2WINI 3RMOH 3WWFA 3RUOA 4ABJA 2ZFFH 1FY1A 5CMXH 1RJXB 1J15A 3MO3A 4VGCC 3UREA 8ESTE 1S82A 2BOKA 3PMBB 2F83A 3ZVFA 1J14A 1DOJA 2GKVE 4Y7BA 4ABAA 1C5ZB 2UWOA 2KFWA 2R3UA 4JYTA 3TGJE 3A80A 1OPHB 1E35B 3U8OH 1UTJA 2GGVB 3M35A 3NKKA 1SGCA 3PWCA 1AQ7A 1CT2E 4FUJA 2FESH 1ZSJA 1OSSA 4D7FA 1Z7KA 2RCEA 2BYAX 3U1JB 3LJJA 1OOKB 1O3LA 1O5AB 2ZPQA 1AFQB 2QE7D 1ETSH 4HTCH 4BTUB 4DIHH 2PTNA 1C2HA 4B1TA 1GBDA 1D3TB 1ABJH 2XC0A 3PV5A 2M2AA 4DURA 1C5PA 1BB0B 1RS0A 2FX6A 3GICB 2LNCA 3RXSA 1GJBB 2XW9A 4JZFH 4X1QU 2CK3D 2D8WA 4CH2B 3A7XA 2A0QB 1GMHF 4M9FA 1RRKA 4IN1A 2H2ZA 5L2YH 1A3BH 3ZZAA 3QDZB 2XBYA 2F3CE 1EJMA 5JBBS 2BX4A 3UOUA 3TNTA 2I6QA 3VGCC 1F5RA 4X2YA 2BLWA 5EW2H 2DUCA 2D1JA 2ZHDA 1C5WB 1GI3A 4ABIA 4OGXA 1O3AA 4WXVA 1W2KH 1JWTA 2KM0A 1P10A 3E3TA 1O33A 1IQJA 1CU1A 4XBBA 1ANCA 1V6DA 3FVFB 3MOCA 3F9EA 4GAWA 4U01A 1WBGB 2FO9A 3RXOA 3EE7A 1BQYA 2EC9H 4ASHA 1HJAB 1EQ9A 1BBRK 1V2QT 2VWMA 1O2MA 1UTKA 1KDQA 5EIYA 4XFQA 4INLA 1XVOA 1AFEH 2DE9A 1RTLA 2O8WA 1GMDF 4NZLA 1ZRBA 1SL3A 4ESTE 1M9UA 3K6YA 2G4UA 2HVYB 2ZGJA 3OY5U 3OTJE 3UPEA 1CGIE 2KAIA 4QT8C 2PGQB 3UR9A 1ZLRA 1E0FD 1HJAC 1ZHMA 3O8RA 2SGDE 1CQQA 1QL9A 2BQ7B 3SZNA 4B71A 1H1BA 6ESTA 1E38B 1HAGE 1KXDA 3T27A 4SGAE 2R2WU 3A87A 4X2VA 1OP2A 4TWWA 4ABGA 1A5IA 1DDJA 1PQ5A 3LGUA 2A7CA 1DSTA 1D3QB 2XWAA 1PYTD 3MO9A 2LPRA 5C0TA 1MMJN 1C5XB 1OP0A 2NU0E 3V3MA 4BANB 5JBAS 2FOHA 1V2OT 2FZZA 1FY5A 1ELVA 3MO6A 1TIOA 1YCPM 3GY4A 1KIGH 2R0KA 3A7TA 3O8BA 1C1PA 4XSKU 5EXLA 1YPKH 2ZTYA 3SUFA 3RM2H 2VU8E 1HAXB 1L0ZA 1L4DA 1P06A 1NFYA 2P3TB 3NCLA 1QL7A 3BTME 3ODDA 5EXMA 1NTPA 2CMYA 1PFXC 3RDZA 4BAMB 1DWBH 4PROA 3F2GA 4CHAB 2GV7A 3P8FA 3SNDA 5EU8A 1UVOA 5A8ZA 1K2I1 4AN7A 2ZHFH 1P2KA 1BTPA 1V2LT 3ATKA 1O2WA 1ELBA 2OTVA 1EUFA 2HALA 2Z3DA 5JPMH 2R9PA 1LQDB 1K1JA 1AI8H 1GHVH 2XBWA 3F2FA 3ZVEA 2W6JD 4UE7H 3RXCA 2ZTZA 2BD5A 1GG6B 3AAVA 3SYJA 1NRSH 1V2ST 3SU2A 2AHME 1ZHPA 2G5VA 3GDSA 5B6LA 2ZP0H 2SNWA 3A8BA 5LH8A 1GBKA 2W3KA 3LGYA 4UFFH 2ZCLP 1LPKB 1O2RA 2ZDVH 3F0PA 9LPRA 2GCHG 3HGPA 1Y3YA 3SGBE 1O39A 3AW1A 4YT6H 1MAXA 1O3MA 1SBWA 1U6QA 1O2UA 1MCTA 3OTPA 3AAUA 4F49A 3TJUA 1KXBA 1GJ6A 2NU3E 1GG6C 1KMHB 2WV5A 2FOCA 5JYIA 2FODA 3R3GB 1SSXA 3EYDA 2LP6A 3EDXB 4YOIA 3UIRA 2PSYA 5GDSH 2J4IA 1YC0A 2ZFSA 2STBE 1B0FA 4ZXYH 1O3JA 1MQ5A 6GCHG 1SC8U 1Z1JA 2Z3CA 5FPTA 1ETRH 1DLKB 1MQ6A 1O3CA 1FY4A 2XCFA 3GOVB 3HK6B 4OGYA 2EI7A 1V2PT 2SGEE 1JRSA 1WDIA 5DGJA 1B0EA 1HAZB 1HCGA 2XBVA 1PPGE 2AGGX 2P3UB 3UQOA 3SUGA 1O30A 1IQKA 3E91A 1LHFH 2KCOA 1LO6A 1THRH 4NA7A 1YPMH 1EASA 5DJ7A 3RXAA 1BHXF 3HKIB 2TRMA 3SUEA 2F4LA 2YMSD 2QGRA 2KX4A 4I8LA 1XVMA 3GDVA 3MH4A 1O32A 1T8OA 1VR1H 2P3FH 4KTCA 2QV1A 2ZTXA 1J9CH 1D3PB 4OS4A 1FXYA 3S9CA 2EI6A 4FUIA 1C2IA 1C5LH 1L1GA 3PO1B 1LPZB 1WSSH 1YKTA 1IQIA 3SHCH 4YZUA 1SVPA 2C4FH 3UY9A 3FKSD 5FCRA 1SGRE 2BY8X 2PWXA 4K8YA 1EZSC 2C8XB 1QJ1B 5GIBA 1AUTC 1LMWB 8GCHF 3LKWA 3DSGA 3PWBA 4ZCNA 1VCQA 1WQSA 1T4VH 3M3VA 2W26A 3FO8D 1P2OA 2ZDMA 1MABB 1GVZA 1YPJH 3ZV8A 1GHWH 1FONA 1DANH 3ELAH 2GZ9A 1BDAA 1P0SH 3SZEA 1XXDA 2BB4A 3EA9A 3UWIA 4DGJA 2ALVA 1X7AC 2BQWB 1MD8A 4NA8A 4LOYH 4K8BA 3PMJA 2ZF0H 3A8DA 3ZYDA 1OWHA 2W7UA 1BITA 5HM2A 1VZQH 2PTCE 3KQCA 1T4UH 2ZG0H 1AGJA 2BXTH 3QO6A 4HFPB 3W95A 4BAOB 2B5TB 1MU8B 3EA8A 3T26A 2EQNA 3SV8A 3SOSA 1D9IA 2DE8A 3SU6A 1UVTH 3H7OA 1T32A 1RGQA 2R2MB 1Y8TA 3GCTG 2BD3A 1DLEA 1UCYK 5BRRE 2HVXA 1XX9A 1SLXB 2ZFTA 1RIWB 2PKAB 1WXRA 1K22H 1O38A 1GHAG 1TMTH 4ASUD 3GYLB 1FUJA 2ZGHA 5FPSA 3RXLA 3V12A 2NU1E 1B7XB 3P17H 4K1EA 1GMCF 1TQ0B 1NS3A 5LGOA 5ESTE 2AGEX 5HMAA 3H7TA 2YOLA 3D23A 4I8KA 1ZTKA 3A7ZA 2ANMH 1A3EH 3QGNB 2W6ID 3ZZ6A 2D2DA 5J4QA 1RIWC 1TRYA 3RXUA 2ZDAH 4CR5A 1T8NA 2CV3A 4DOQA 1GCTC 5GXPA 4HZHA 1FNIA 2Z9JA 1IOEA 1K28D 1O0DH 1L1JA 1QBOA 2EI8A 3LU9B 1JRTA 4E7RG 5E2PA 3A84A 1TBZH 4ABHA 2H9HA 3IG6B 2Z9IA 3OSYA 1LVMA 1QGFA 2RDEA 5FL7D 1O5CB 3H5CB 4ZHMU 3AVZA 1FI8A 2BY6X 3TH3H 1G30B 1OHHD 1TLDA 1O2LA 4XOJA 1VITH 2A4GA 2UUJB 2BY7X 1A2CH 3OX7U 2O9QA 1ACBE 4XBCA 2OXSA 4OM9A 1V3XA 4JZEH 2VINA 4J1YA 2HRVA 1O36A 5T6GA 3F9FA 4AFZA 3T25A 3TJVA 1OS8A 5DP6A 2VGCB 2GTBA 3R0FA 4WWYA 4F4OC 2G4TA 3SQEE 1MH0A 3BG4C 1FAXA 2ODQA 1DFPA 2AMQA 1JMOH 1H8HD 4BAHB 5F8TA 1NZQH 2J94A 1C2GA 6LPRA 3B23B 3LJOA 3GYMA 2AGIX 4RT0A 5HIZA 2A4RA 1HAPH 2OD3B 3RMLH 4E05H 2TPIZ 3EAJA 5K0HA 4MG3A 1O2ZA 2A2XH 5DP7A 1FLEE 1KXEA 2G81E 1S83A 1V2TT 3DCLA 3ZZDA 5A0CA 1UK4A 3NXPA 1P02A 5LPFA 2VGCC 3RLYH 3RXMA 1ESAA 2Y6TA 1AN1E 1NPMA 5EJ1A 1ELFA 1RXPA 8GCHG 2F9UA 1O2XA 1C1OA 2G51A 3WY8A 4JMYA 3SUDA 5FXLA 4RKOB 7LPRA 3PTNA 2BZ6H 3RXFA 3RXPA 1GCDA 4AB9A 1GBBA 3KQEA 3ITIA 3PB1E 1LVBA 1TNGA 1FIZA 1F92A 1C2DA 2ZQ1A 2FX4A 1K1IA 3SNCA 1EATA 2HNTE 1CA0C 1ZPZA 1W0KD 2J98B 2C8YB 4NCYA 4Y8YA 2BD7A 4HG6A 1C2JA 1GI1A 2F9VA 2XC5A 1HV7A 3U8TH 3OYPA 4GUXA 3PROA 2XXLA 4Y10E 5F6MA 3FZZA 4INKA 5A2MH 5JB9S 1RFNA 4Q2KA 1P9SA 1O5GH 1SQOA 5FAHA 2HPPH 1P09A 3BTHE 2G00A 3ZZCA 1YPLH 1S84A 3LGIA 1O3OA 3B8JA 4K1TA 2VWLA 5T6FA 4LZ4B 1ELCA 3TK5A 3O8CA 4X1NU 4MNYA 1E37B 1NN6A 1CA8B 3GY5A 2B7DH 3E90B 3P92A 1AB9B 1P8VC 1TA2A 1AHTH 2WPMS 1TGSZ 1A7SA 5AHGH 4NFEA 1MTSA 2ESTE 1AWFH 3BTTE 1LTOA 1QJ6B 2ZPRA 2CF8H 4Y0YE 4TYDA 4ZKRU 2P8OB 1S6FA 4O3TA 3C1KA 1RTFB 1O2TA 1UTNA 1GMCG 1ZGVA 4Y8ZA 2GMTB 1GBLA 3D65E 3BG8A 1EPTB 1YYY1 5JBCS 2YNBA 3FFGA 1C1SA 4VGCB 2WPIS 5EODA 1AVXA 2GJGA 3VFEA 8KME2 5GWZA 1G32B 3SN8A 4AFUA 4KTUA 4NA9H 1AIXH 1DVAH 4THNH 2WPLS 1ZMJA 4H42U 5TCCA 3BEIB 2Y5GA 4P00A 1IQGA 1MZAA 1GJ4H 4I32A 1C2EA 4DW2U 3ZVCA 1C2MA 3MHWU 3A86A 4GHTA 1THPB 1C1RA 4NG9H 1TX8A 3E6PH 5HKKD 1QQUA 1DX5M 1GBTA 4Q63A 3O8DA 4X8UH 1GDNA 2Y81A 4DJZB 1DXWA 4TY7A 2PLXA 1HAYB 5C17A 1GHZA 1P2IA 2BDCA 4DT7B 2XWBI 1F0SA 3ZVDA 1KXAA 3OY6U 4JZIA 1WYKA 1QY6A 4WVPE 1UW7A 3LDXH 1EB2A 4Q7ZA 2BVSH 3BV9B 3MWIU 1ANEA 1OWEA 1VJAU 4YOJA 5DN6D 1ID5H 3OFND 3Q3XA 1F0RA 1Y5BT 2BDBA 2GCHF 4MPXA 1O5DH 1GHYH 1NESE 4MVNA 3VGCB 2SGAA 2TGPZ 1O3NA 1UO6A 1XKBC 4Z0KA 3SJ9A 4MNXA 5KEDA 1FN6A 1ANDA 2PSXA 4WH6A 4UFGH 2JETC 2BVRH 4ISLA 2H9EH 1V2WT 1SGIB 4FXGH 1TABE 1W7XH 2VBCA 1FPHH 1C5SA 1ELTA 3N7DA 3BEFB 1BRAA 1TAWA 6GCHF 4YT7H 3K6ZA 1TA6A 5GCHF 4DG4A 1E79D 1DICA 1SHHB 4WY3A 4MTBA 1SKYE 1CO7E 1XKAC 2A45B 4ABDA 1PPHE 4ISIH 3FP6E 2QIQA 4TPYA 3RXBA 2FYQA 2J97A 3QZQA 2JDID 1A46H 1BJUA 2OC7A 3BTQE 2AMPA 4FETA 3GDUA 2M5TA 2JJ2D 3M5NA 1K1NA 1FX0B 3SBKA 5A8YA 3MH7A 3T5FH 3B9FH 3NWUA 2BDAA 5EQRA 4D8NA 2J2UA 3G01A 3H09A 4X0WU 2OQUA 1BUIA 1DSUA 1JXPA 3HATH 3PMAB 4Y11E 4MPVA 2UWPA 3LIWA 2YMSC 1ZMLA 4FUEA 1C1VH 1MKXK 3S69A 4TY6A 3SJ8A 1TPOA 2FTLE 2BVXH 3RXDA 2TGDA 3CS7A 1OKXA 4RT1A 1C2FA 5C1YA 3SJIA 2JJ1D 1UJ1A 3PTBA 1C5RA 2ZKSA 3DT0H 3PRDA 2A5KA 1P3EA 4JZ1A 2Z9KA 3SGAE 1KXFA 2HPQH 3SV9A 1VITF 1PPCE 2ZZUH 1CE5A 3KQDA 2GCTB 4ACAA 2V3HH 1J17T 3EGKH 1UTMA 1HB0B 1OYQA 4AZ2B 1SGPE 1DY9A 2J34A 4MPUA 3UQVA 1C1TA 2WPJS 1KLJH 2H5CA 3OEHD 2SFAA 4IMZA 1TGTA 4O3UA 1O37A 3TLOA 1UHBA 2BD2A 2VH6A 3V7TA 2RA0A 2OQ5A 1MTNB 1UTOA 5KGOA 4OS1A 1O2OA 3ZVAA 2GCTC 1OWDA 4Q4LA 2V3OH 1NFWA 1TPPA 1ZSLA 3SGQE 1C4U2 2BLVA 1C2KA 1BA8B 2ZIQH 2OK5A 2BD9A 1S0RA 1VGCC 1GJDB 3VB3A 1NM6A 1N6YA 4YESB 4Y79A 3VXEH 2VWNA 1PPZA 3CS0A 1SR5C 1G3EA 3GCTF 5FPYA 3RXJA 3SV6A 5TJXA 1YPGH 1MTNC 2IPQX 3NUMA 1HJ8A 2QCYA 3A82A 4FUBA 5FX6A 2GT8A 2WYJA 2V7QD 5E8EH 3MYWA 1BMNH 3ATMA 5J4SA 1CHOG 3EQ0H 3GY6A 1GHAF 3TU7H 3BN9A 3KQ5A 2BMGB 1GL1A 1OX1A 4B2BA 2BX3A 1K9OE 1TBRH 2G52A 4A5TS 2AH4X 1LDTT 4AG1A 4DCDA 1TB6H 1BT7A 4BNRA 4NIXA 4A1VA 4WMDA 2QF5A 5DKMA 2L6OA 5C1UA 3BIVH 3SO3A 5L30H 4I8HA 1DUAA 1WV7H 2EA3A 3N99A 5DP9A 1CBWB 3LONA 4MDSA 1UTLM 3A81A 1HGTH 3OU0A 2Z9LA 4Q80A 2BLOA 2HNTF 1XUKA 1TOCB 3K9XB 1GGDC 1G3CA 1H8DH 3LH3A 5CHAC 1PPEE 3ZIAD 2OCVB 1UMAH 2ZU2A 4H6TA 1EPTA 1C5MD 5DP3A 2Y80A 4NSVA 5AFZH 1O34A 2Y7ZA 5GCHG 3SNEA 4XRNA 1C5VA 1O3DA 3LH1A 1Y3VA 5EGMA 2PUQH 2F9OA 1O2IA 2HWLB 2WPDD 3GY3A 1CBWC 1EJNA 4KKDA 4I8JA 3QUMP 1BMMH 4XDEA 1HAVB 2QA9E 2P93A 4Y0ZE 2WPHS 1EP5A 2F91A 5DP4A 2PW8H 4XBDA 1MTVA 4U2WA 4ZKOU 1Y3WA 4CBOA 3UNRA 1S6LA 3SJOA 1GI9B 2A4OA 2VH0A 3MNBA 2WSSD 4X8TH 2FP7B 3F9HA 1GI0A 1GVKB 3SW2B 3UNQA 1HAOH 3KNXA 1NU9A 1Z8RA 4D9RA 3FN8A 1ZOMA 3K2UA
chains in the Genus database with same CATH topology
1P2QA 3D62A 2QY0B 1QRXA 4D9QA 1MU6B 5LPEA 1F2SE 1BBRH 3VB4A 1SOTA 1GJ7B 1YM0A 2FOAA 1QIXB 2CN0H 1BTHH 1W7GH 2UUFB 2QYIA 2UWLA 2ZGBH 4M7GA 3TGKE 2B8OH 4HI3A 4I33A 2FWWA 4H6SB 1GI8B 1UVPA 1SGQE 3GY8A 4O03A 2Y5FA 1VJ9U 5F03A 4J2YB 1GDQA 3ATWA 1Y3XA 1DPOA 1Z8JB 2F9BH 1C4V2 1Z6EA 3EE0B 1YP9A 3GISB 3UOPA 4Y6DA 1VITG 2SNVA 2P59A 2BD4A 2GX4A 2ODPA 3F9GA 5DO4H 4Y76A 1BOQA 1TRMA 2WPKS 1MTWA 3VPKA 2Y82A 6CHAC 2ZDKA 1YF4A 1EAUA 1IQLA 1QCPA 1E34B 3TPIZ 4B2AA 4ISOA 3A7WA 2FOFA 3SNAA 1FMGA 4UDWH 3KGPA 1A61H 1TFXA 1KTSB 3PLPA 2P95A 1EX3A 2FLRH 1BTYA 1P01A 1FJSA 2R0LA 2OINA 2PUXB 2ZQ2A 1O2HA 3URCA 4AOQA 2Y7XA 4ZH8A 1HFDA 1D6WA 4CBNA 3LGTA 1N8OC 2P16A 2ASUB 1A0JA 1KLIH 4R0IA 3SHAH 3MU1A 2XYAA 4U30A 3NPSA 1IAUA 2GT7A 1D4PB 1NRRH 1Z8IB 2J9NA 1NRQH 2QF0A 3CENA 3P8OA 3SU0A 1H4WA 1DY8A 4K5ZA 1WOFA 1GCTB 3BF6H 1AE5A 3S7HB 2XNIA 4IC5A 3VEQB 1GJ8B 1PQAA 1S0QA 5C5OA 2ULLA 3FP8E 1SGFG 2CJIA 5C67A 1BRCE 5FBIA 7ESTE 1OXGA 1HLTH 5EW1H 5H4IB 3MTYA 4AFQA 1C1NA 1GI5A 5EQQA 2BQ6B 4WH8A 3RXHA 1AE8H 3UNSA 4NIVA 5E0GA 2VIOA 2PGBB 1B5GH 5DP5A 2QXHA 4AB8A 1H8IH 4GCHG 1YCPK 1F7ZA 3I29A 5HGGA 1SPJA 1BTWA 2A31A 1SGEE 1G37A 3LC5A 2BY9X 1LQEA 1DE7H 3SORA 1O5BB 4Q7XA 3BG4B 3RC6A 1FPCH 2YNAA 1YPHC 4AORA 1EXFA 3BTKE 2ODYB 1ETTH 1MKWK 1EZQA 2STAE 4OS2A 2WUCA 4NWLA 2AS9A 3IITA 2H1UA 1HBTH 2FS9A 2H9TH 3ATIA 3T2NA 1L1NA 1TPSA 1TX6A 2OBQA 3DFLA 5IDKA 3CP7A 4ZKNU 1KDQB 2ZI2H 4CRDA 4GLYA 4K2YA 4TWYA 2OC8A 2NWNA 1NRPH 5E2OA 3SU3A 2TIOA 2ZHQH 2C8ZB 3RC4A 3ENSB 3T62A 2UUKB 1PQ7A 1NRNH 2A7HA 4X2WA 3DA9B 3MU0A 4KGAA 1TX7A 1CA0B 3DFJA 1G2LA 5L2ZH 1OP8A 1Z6JH 3A8CA 3M7UA 1GI2A 2IPHA 1O31A 2WV4A 5FBEA 3RC5A 1QL8A 3VB7A 1SQAA 2QN5T 3FANA 1HIAB 2OBOA 5C2ZA 3A89A 3W94A 5LPRA 3S9BA 3BIUH 2VIPA 2BXUH 4FUHA 2H6MA 4YOGA 3MMGA 4Q7YA 4DY7B 1MAYA 2A4QA 2GZ7A 4OS6A 3RM0H 2GZ8A 4IC6A 3PLBA 1E36B 4BOHA 1GBIA 1WCZA 3LGVA 5DPAA 2R3YA 3ZZ7A 4CRBA 2FOEA 1XMNB 3TVJB 1ZR0A 1Y59T 1ZZZA 1A1RA 1SMFE 3JZ2B 1G3DA 3NZIA 4LK4A 1MTUA 4ABEA 3KF2A 1Q31A 2B9LA 2FOGA 2VIDA 1O2SA 1HAHH 2CHAC 1AVGH 4DIIH 5DP8A 5K7RA 4KTSA 1YBWA 1GI4A 2JH6D 1DWEH 1TNIA 1FIWA 5CE1A 5B6OA 3P70B 3KQBA 4U32A 1BJVA 1JIRA 2VVCA 3Q00A 1ZPCA 1YGCH 1UCYH 3P95A 4AFSA 5ESBA 4ZKSU 1O2YA 3ZZBA 3RXQA 3TNSA 1IQFA 3RU4T 4WXIA 1GJ5H 2O8MA 5AVDA 4ABBA 3MU4A 3M7QA 1W0YH 4A92A 1DWDH 1SQTA 4JCNA 1WU1A 1TNJA 1PYTC 2NU2E 3TIUA 3ZV9A 3AASA 1KXCA 1O35A 3LGWA 1QQ4A 2VVUA 4ZUHA 2G5NA 5DG6A 1NY22 1GBCA 3QZRA 4R8TB 5C1XA 4LZ1H 4KELA 3TH4H 3M61U 3TK6A 2Z94A 5A0AE 3KN2A 4MNVA 1QHRB 2SGQE 1YLDA 5GPIB 1GBFA 3L3TA 2JKHA 1UK3A 2QXGA 2W7SA 1Z8GA 4CH8B 4BAKB 1W8BH 1QRWA 3A8AA 3QLPH 2A32A 2WUBA 1TGCA 3Q3KA 2A5AA 3M5LA 3S9AA 5ABWA 1NU7B 1RTKA 3HK3B 1H9IE 1UVUH 1CHOF 3PLKA 3UUZA 2ZU1A 4A7IB 4X1PU 1F5LA 3KL6A 2JETB 1G2MA 3M3SA 4B76A 3GY2A 1FDPA 5AFYH 2EEKA 1P2MA 5EG4A 3M7TA 1FV9A 2UUYA 4IGDA 2BOHB 1ZTJA 3UFAA 3RXEA 3MNSA 1LCYA 2CXVA 2ANKH 1G3BA 2PKAA 1O3IA 2AFQB 4OS7A 1L4ZA 5HXFA 1KSNA 2FOBA 3MI4A 5FHTA 1Y3UA 2OC0A 4RKJB 1MCVA 1CGJE 2H5DA 4K1SA 3F6UH 1TYNA 3DUXH 1IQHA 5T3HA 4OS5A 4B2CA 1WAYB 1CVWH 4NGAH 3N7OA 2QXJA 1O2VA 1SLUB 1IHTH 3RMNH 3TK9A 1QTFA 1QB1A 3L6PA 1CSOE 1PJPA 2ZHWH 3RU4D 4MPWA 1XXFA 2RA3A 3MFJA 1O5FH 1KLTA 1D3DB 4MNWA 2WYGA 5A09A 2I6SA 2VIVA 1AFQC 1AVWA 1Q2WA 1LKBA 1W3CA 1BMAA 3M5MA 4UFDH 3V13A 1EB1H 3KCGH 3QK1A 4KP0A 5DK1A 1C1QA 4B74A 4K3JA 4WF8A 1N1LA 1O2QA 1ARCA 1C9PA 1GI6A 3RMMH 1YPEH 3RLWH 4I7YH 3U9AH 1O3FA 1TQ7B 1EAXA 2FLBH 3RXTA 1OWIA 2V35A 1LPGB 1V2JT 3MNXA 3U1IB 1PPFE 4AX9H 1GWAA 1S81A 2K1QA 2QC2A 4X8VH 3RXGA 2Q6GA 3QTOH 2RG3A 1O2JA 3FP7E 2A7JA 3M36A 1H9LB 1ZJDA 4Z6AH 1HNEE 3GCNA 2XBXA 1GHBF 2PHBA 1BCUH 3ZYEA 3BTFE 2XC4A 1RD3B 2A1DB 1HRTH 1GDUA 1ESTA 2ZNKH 1UK2A 3RXIA 3MH6A 1QB6A 5HM9A 1MUEB 1HXEH 5I25A 1AMHA 2OLGA 1P2JA 1C4Y2 1VGCB 2C93B 3SI3H 2P94A 3BSQA 4E7NA 4LXBH 1YPHE 1ZRKA 2ZC9H 1ORFA 2ZU4A 3LC3A 1FQ3A 1SHYA 1Y5AT 1VCPA 4X8SH 1SI5H 4ABFA 1DUEA 4MLFB 3P8NA 1F5KU 2Z3EA 3SJKA 3IWMA 5L6NH 1HIAA 1O3BA 2TBSA 2B0FA 1ELAA 4ZHLU 1P2NA 2ZO3H 3TGIE 2Q1JA 1DM4B 4BTTB 1TBQH 2VB0A 2ZGXH 1Q3XA 1XUHA 1QBNA 4NFFA 4YLQH 1IHSH 1NT1A 3BTEE 1V2VT 2VIWA 1GJAB 1EZXC 1O3EA 1P03A 1DS2E 1W14U 3Q3YA 3AW0A 2ZPSA 5E0HA 1KYNA 2BM2A 1TGNA 1ABIH 2CGAA 1O2GH 3RU4E 2ILNA 1FN8A 2BZAA 1TNLA 3NK8A 1GHXH 2Z7FE 3SU1A 3QX5H 4E06H 2BTCE 1GGDB 3PYHA 1O2KA 2OP9A 5EXNA 5FX5A 4MQAA 2ZCKP 1SLVB 5CHAB 3D49H 4FU8A 2FDAA 4JK6A 4IN2A 1PPBH 1EAIA 1C5UA 1QB9A 2HNTC 4GSOA 2FI5E 1KY9A 1MD7A 1T8LA 4GVUA 2BD8A 3MNCA 3U8RH 1MBMA 1S85A 2A2QH 2GDDA 3RXKA 2ALPA 1WTGH 4JK5A 4H4FA 2AIPA 1TNHA 5JDUB 1AY6H 5JBTA 2VVVA 3I77A 1IQNA 1SGYE 4FUDA 1SFIA 1BHXB 2GP9B 3SV7A 1HPGA 4CHAC 4GCHF 1DT2A 2ZWLH 1AKSB 2AERH 1IQMA 1HXFH 1O3KA 3UTUH 1HUTH 1T31A 2QAAA 3V0XA 2XRCA 2HOBA 2IOTA 2Y5HA 3FZDA 3A7VA 2G55A 2FOMB 1G9IE 4A1XA 3ATLA 1TWXB 3E16B 4WMEA 1BBRE 2BDGA 3U98H 1LHCH 2GVFA 1D6RA 4AG2A 4BXWA 3E0PB 1O2PA 3EA7A 3QWCH 2C3SA 1P05A 1GMHG 3UR6A 2F9NA 2GD4B 2ZFPH 2GV6A 3LOXA 1FY8E 5JB8S 4UD9H 2ZECA 4JYVH 3QGJA 2FMJA 4AGJA 3TJNA 2VNTA 4YO9A 2SGFE 2XCNA 4AYVB 3QN7A 5FCKA 3PMHB 2NU4E 2ZFRH 2PFEA 3Q76A 2FPZA 1SG8B 1O3GA 1Y5UT 1QA0A 1XUIA 1V2KT 1S5SA 4AGKA 1A5GH 4CRFA 6CHAB 4X6OA 4Y71A 1P04A 1W11U 1ZYOA 1MKXH 3L33A 4FUGA 1SGDE 3ZZ8A 2W5EA 4INHA 1J8AA 2CF9H 1QFKH 3UWJH 1TOMH 3M5OA 1C1MA 1AU8A 1FY3A 1WTHD 1GMDG 3ZZ9A 1ZSKA 1AWHB 1GHBG 2BY5X 1ELEE 1NO9H 1XUGA 3A85A 3S0NA 1TONA 3KIDU 3QTVH 4CRCA 4NZQA 1IQEA 4AYYB 1WUNH 3E1XB 1P12E 1EOLA 2ZHEH 5C20A 1N8OB 4X6MA 2FM2A 3JZ1B 1TE0A 5EOKA 4NIYA 1GJ9B 1SLWB 4X6NA 1C1UH 4ZMAH 8LPRA 1EP6A 1T8MA 2AYWA 1ZPBA 3K65B 3ZVBA 3U69H 1A0LA 2AIQA 1C9TA 5G4BA 4B73A 1BIOA 1YLCA 3PO1C 1HAIH 1FAKH 3HGNA 1ZTLA 1AZZA 3BTDE 3DHKH 4CREA 4FVBA 1ZJKA 1CT4E 2QXIA 3SI4H 1JOUB 2O8TA 3GCOA 5A0BA 4O97A 1L2EA 4Y8XA 4A1TA 1A4WH 4D7GA 2PR3A 1MZDA 3F68H 1N6XA 2F9PA 3A7YA 1JIMA 1DITH 1NC6A 1S6HA 3HKJB 4HGCA 1ELGA 3PV4A 1XUFA 1W10U 1HYLA 3M37A 4IW4E 2TGTA 5TCAA 4A6LA 2VJ1A 3RXVA 2J92A 2Q6FA 5F8ZA 4FUFA 4I8GA 1TMBH 2ZU3A 1GI7B 1GPZA 3STIA 1PQ8A 3BTWE 3STJA 5C5NA 3E8LA 3DD2H 1SGFA 1GL0E 1O3HA 1Z71A 5PTPA 1WQVH 2ZFQH 4K60A 1BRBE 1GBHA 5EPYA 2ANYA 4BAQB 1EAWA 1TRNA 1XM1A 1QNJA 5C3NA 4ZXXH 2OC1A 3FAOA 1EOJA 4I31A 4Y7AA 3F1SB 1OWJA 3ZVGA 1FZZA 3SNBA 5IYTA 2HGTH 7GCHF 1LHDH 5BPEA 4FUCA 2JH0D 3KHVA 2HLCA 1C5TA 2ZEBA 4NWKA 3GCHB 2OUAA 5F8XA 1K1MA 2VWOA 2O8LA 2V6NA 2SGPE 3BEUA 1GBEA 4X1RU 5T6DA 2RDLA 3C27B 1O3PB 1W13U 3I78A 2W3IA 1C5YB 1LHGH 1GBAA 3RXRA 4YTAA 1GBMA 2JH5D 2ANWA 1V2MT 1Z1IA 4FU7A 1EKBB 1AZ8A 1F0TA 3SU5A 4CRAA 4FVDA 1AD8H 1H9HE 1THSH 1O2NA 1NFUA 2C90B 1NROH 2PKSB 3SU4A 1HJ9A 3GCHC 1QURH 2Z9GA 1G36A 1VCWA 3A83A 3LPRA 3E0NB 2FS8A 4WJG2 1GVLA 1TPAE 4IBLH 1QA7A 4ISNA 4BTIB 2BHGA 4CRGA 2KAIB 1QBVH 1ZMNA 1HDTH 2BDHA 3ZZ4A 4CR9A 2A5IA 4YM9A 2ZCHP 4D76A 1QJ7B 2QF3A 2PKSC 2XTTB 1K1LA 3ODFA 3SV2H 1W12U 5SGAE 3SQHE 1AO5A 1CHGA 2C8WB 4X1SU 2Q6DA 1GBJA 4JZDH 1TMUH 5GJ4B 4K69A 1ANBA 4DVAU 3MH5A 1DWCH 2CHAB 4ZROA 3VB5A 1UHBB 7KMEH 3T28A 1TALA 4TPIZ 4O9VA 2IN2A 1AKSA 4IMQA 4GHQA 1W0ZU 2BDYA 3A88A 4NIWA 1EZUC 2G8TA 5I46H 1A5HA 1C5OH 5A8XA 2IJOB 3TITA 1UCYE 3ZZ5A 4BXSA 2FTMA 2V0BA 3URDA 1BTXA 1P57B 1O5EH 1LVYA 1GJCB 3S7KB 1HAVA 2VIQA 1SGTA 1LVOA 1K21H 2PV9B 2AEIH 4YLUA 9ESTA 5ETXA 3TJOA 2FXRA 1KTTB 4XE4A 3T29A 2BLQA 3MU8A 2FEQH 1JBUH 5E0JA 2ZA5A 1UTPA 1P3CA 1CGHA 4ZHAA 1TGBA 3BTGE 1LKAA 2FI4E 3M3TA 4RN6A 1A0HB 3PM3A 1C1WH 1INCA 2ZU5A 1UVSH 1QR3E 3GY7A 1CT0E 1BRUP 1BTZA 3TH2H 1DXPA 3ZZ3A 3MU5A 1K1OA 3RP2A 1TNKA 1V2RT 1T7CA 3P6ZB 5HYOA 2J38A 3P8GA 3Q77A 1SFQB 1ARBA 4FU9A 2ZDLA 1C5NH 2O8UA 4UEHH 4X2XA 2BDIA 4ZAEA 3VXFH 5EQSA 2THFB 2J95A 1V2NT 1ESBA 1C5QA 5AF9H 4UFEH 4IS5A 1BZXE 2ZDNA 3HPTB 1SOZA 3VB6A 1V2UT 1SB1H 2TGAA 1ZGIA 4SGBE 1SGNE 1XUJA 4X6PA 3KEEA 1UTQA 1AB9C 2AMDA 1ELDE 1OWKA 1YCPH 7GCHG 2FI3E 3LT3A 2FYRA 2Z6BD 1QRZA 4JYUH 1BTUA 1P11E 1AUJA 4UONA 4ISHH 4RSPA 4GPGA 1NFXA 1J16A 1F0UA 1MBQA 2P8OC 4WMFA 1OYTH 2D26C 1ZHRA 2FIRH 1LHEH 1P9UA