3L35A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords GP41 N-PEPTIDE
total genus 21
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l35A00
2Q3IA 3UIAA 1JNMA 3B8EB 2WPQA 4C7NA 4B86A 1CI6A 1MV8A 5APTA 3A7OA 1T2KC 1CZQA 2Z5HA 5AVRB 1IO4A 1NAFA 3A5TA 1FOSF 2H7HA 5AVVB 4GKGA 3M0AA 3P32A 3LIEA 4I6MC 1GU5A 1FOSE 1YYCA 5AW7B 1CI6B 3NMDA 2XZRA 1GTWA 1GZLA 1MFZA 1GK4A 1SP4A 5AW1B 1JUNA 2XV5A 2WWWA 3HE4B 3A2AA 3L36A 5APUA 1H8AA 1SLQA 3M9HA 5APSA 3P8MC 5CMZA 3KQGA 2E43A 2WPSA 4LC1A 5AVTB 2BASA 2KP8A 3VYIA 1FAVA 1HUCA 2W27A 3MGNA 2R32A 3A3YB 5AW2B 2C9NY 2E42A 1OXZA 3M9BA 3TYYA 5APXA 3V4QA 1KQLA 1S9KE 1J2JB 4AYCA 2QM7A 5AW6B 3VMYA 2YO3A 5APVA 5AW0B 3T97A 4I2LC 1H89A 3M06A 1HBWA 4KHXA 5AVYB 5AW3B 1CSBA 4JYCA 1GD2E 3O8ZA 2QM8A 3VN0A 2W6AA 3V5BA 2VRSA 2WTYA 3MD0A 1H88A 2P7JA 3I5CA 2R5BA 3TK1A 5AW9B 1X8YA 4DZOA 3L35A 3V4WA 2XU6A 3M91A 1DH3A 2WPRA 5AVWB 5AW5B 1HJBA 5AW4B 2N9BA 2ZXEB 4JYBA 3TNUB 3VMXA 4AQRD 3HE4A 1A02F 2IPPA 1NWQA 2WT7A 2R3CA 3L37A 1OWAA 2ZFCA 2P2UA 5APWA 2P67A 5AVXB 4C7NB 4XE5B 4M3LA 3VMZA 3NTNA 3HE5A 3NFQA 2Q5UA 1MUUA 3TNUA 3M0DA 3KDPB 1T2KD 3P7KA 5AVSB 4HYTB 3SWFA 5APYA 2Z5IA 1S9KD 3OAKA 3IR9A 3HTKA 2YO2A 1A02J 5AVUB 3HE5B 5AW8B 2Q7CA 1HWTC 1GU4A 1GK6A 2C9LY 1G2CB 5AVQB 4C46A 5APQA 2JJLA 4AUWA 4GT1A 2YNYA 5AVZB 3NXSA 2R5DA 4RESB 2WT7B 4EOTA 3VTPC 3LIDA
chains in the Genus database with same CATH superfamily
2QIWA 4H13D 1L0LD 3AE3C 1VQOP 5E79E 3D6ZA 1KTMA 4U7JA 5BVZA 3AE5C 3RK3D 2CPBA 2O1JA 1JM0A 1CI6A 2QJPB 1M1JC 2IFMA 3PLNA 4MN4C 3OA7A 1CZQA 5KLVD 1M1KQ 1PIXA 2Z5HA 2P1JA 1SQPE 5CCHC 2H7HA 3AE7C 2O3JA 5AVVB 4GKGA 2OYHC 1NTZG 3LIEA 1KFMA 1PGJA 1SQQJ 1Y47A 2MJZA 1EXIA 3AEDC 2Y0CA 1QLED 1JEKA 2IZ1A 2RKLA 1YITP 1CI6B 3NMDA 3RL0g 1MKMA 1BSHA 1GTWA 3WMM0 1SQPD 3QH9A 2IBZG 2O1KA 1NOHA 2HFED 1U7JA 1GK4A 4XA4A 4XFJA 5GTIH 1QL1A 1VDFA 1K8AQ 1KILB 1M1JA 3A0BH 3JSVC 3L36A 5APSA 4OVNF 2KOGA 5KKZB 3KQGA 1M57D 1H0TA 2E5YA 2WPSA 1LTBC 2XNXA 2BASA 4LC1A 4NPEA 1W2BO 1FAVA 3R4YA 1BGYJ 2WQYC 2QJPC 5TJHA 2QJYC 1SFCA 3AE9C 3B5NC 2W90A 3MUDA 4O9BA 3Q1MA 1YIJP 1WT6A 3A0BE 1K05A 1KB9I 1T3JA 2H8PD 3CCEP 2M8RA 2A45G 1SS1A 2WVRA 4TT3H 3T97B 2IBZE 2N1TB 4OGQC 3V2QA 2KXPB 4DT0A 4GOEA 3CCQP 3W67A 3D6YA 1Q2NA 1FZCC 2GUVA 1KYOI 4JF7A 1BGYE 1LT9A 3PHLA 3FWLA 4JBZA 5APVA 1FJPA 3KZIH 4U3FG 1L0ND 4UB8H 3EFFK 2IBZD 5AW0B 4ASVA 1SQPG 3Q5RA 3VMAA 1OZHA 1HBWA 3A0HE 3FXDA 1X22A 4ZKUA 1HTLC 2FFDB 1FDIA 2WITA 3AE6C 2NPSA 1IC2A 4JYCA 1GD2E 1KMIZ 2D2CB 3L72D 2W6AA 3CWBD 3V5BA 3IF4A 2IYPA 1BCCD 1HH0A 3ITKA 4HB1A 5GTHE 3I5CA 1RE4C 2P58A 2R5BA 2POHA 1AVOA 3H1KE 3PTZA 4N78E 4EI2A 3RBZA 5AW9B 2KLUA 4OWFA 1NTKJ 1X8YA 1YI2P 3AEAC 3L73G 1FOSF 3L35A 2Q1KA 3CCLP 1URQC 4PV1B 1NO4A 2ZYGA 1P84E 3TGUE 4GODA 1BE3J 2BCCJ 4YXDC 5AVWB 4WBAA 1HVVA 1U7MA 1FS0E 1ZRTD 2LXBA 3CCJP 1HJBA 5AW4B 1CW5A 1KB9H 1L4AC 2N9BA 2ZXEB 2ZYAA 3B5ND 4JYBA 3SFDC 3TNUB 3H1HJ 3K5BA 3L70E 5C39A 2YKQA 2FYNC 1KQFB 3AE8C 1SQBG 1ZW0A 4PD4D 1Q90D 4BWNA 2FFDA 1JY2O 1Q82Q 3BCCD 4L76A 2FYUG 3FXEA 3HD7B 3USSA 2RH0A 4C7NB 3L71E 1FZGA 3HE5A 4Y99C 3TGUG 1KQGB 2H89C 2O01N 2QVAA 1HJ0A 3B5NB 3G9RA 2I8DA 3LW5J 3NFQA 1JY3N 2OTJP 3H32A 1X79B 2UWJE 1T2KD 1URQB 4IFFA 4KT0J 4PV1C 1EDLA 5APYA 3BRVB 2Z5IA 2ZT9D 3H1HE 1LWUB 3GHGA 1H8AA 2GM4A 1RF0A 3H1LG 4GIFA 3L71D 2LR2A 3IR9A 4NPDA 5B66E 1AJYA 1SQBJ 2WPVB 3C8VA 1A02J 1ZMEC 1DEBA 2IZ0A 1IFPA 2JWAA 4PD4H 4W7YA 2Q7CA 3VP9A 4RJTA 5KLVE 1AQ5A 1FJKA 1L0NG 4W7ZA 5GTHH 1PFIA 1AQTA 1X0TA 2FXOA 4HJGH 1Q81Q 1SQPK 1SQQG 4GT1A 2SPZA 2YNYA 1FZCA 4RESB 1E5WA 1PP9J 2KZJA 3LIDA 3H25A 2ZXXA 3OW2O 2HPCA 2Q3IA 1LP1A 1LWUC 1KFNA 2N9YB 3CXHD 3N4XA 4U3FE 4WY4D 3V2NA 5KTBA 2WPQA 4A7PA 4C7NA 2KYVA 2WSSH 4KJMA 1H0TB 2OYOA 3A7OA 2YMKA 2WSEH 1T2KC 1W2EA 5H2FE 3ZDMA 2E43A 3EWKA 2FFDC 1LT1A 1NHLA 1IFMA 3AEEC 2QE7H 1BGYD 1DD3A 2AXTE 1KYOE 4H44D 1YHQP 1VQ7P 1VQKP 4I6MC 5BU8B 4WY4B 3H1KG 4WWIA 2FYZA 1SQVK 2ZYDA 3D70A 1X9VA 2YKOA 2FYUK 3L75J 4D6TG 2Q9IA 1Y8AA 3RGUA 1D7MA 1GZLA 2KI7B 1NTMK 5AW1B 1JUNA 2XV5A 2WWWA 2Y0EA 1L4AD 1OMIA 4RO0A 3BVHA 2N1TD 1RHZB 1SLQA 2YMYA 2A06G 3P8MC 1EDKA 1JY2N 5KLVJ 3L4FA 2L91A 3H1JE 1JB0J 3H1KD 1ZLLA 3A3YB 5AW2B 1VL2A 1USDA 2BEZF 2FKWB 1QVFO 5KLVK 4IFDK 1NTZE 2ITAA 2KZIA 1OFCX 1LTJC 2WZ7A 1VQ9P 1BSNA 1QGKB 2JP3A 4OH8B 1P84I 1JY2P 2C0XA 2B87A 4AYCA 1E79H 1L0LJ 2E76C 2KUBA 5KLIB 1KC8Q 2M5AB 3MHVA 4UB8E 3G4SP 1SQVJ 3CL3D 4N78D 4NPFX 2AEFA 4I1LA 4ZMDA 5CCGD 1BE3D 2BCCD 4H0LB 1N8RQ 2OYHB 3M06A 1NTZJ 2JWDA 4Y28J 1GMJA 1SVFA 3AEBC 3G71P 3TF5A 3PP5A 1S2EA 1K9MQ 1HGZA 2QJYB 2QM8A 1ZRTE 3O8ZA 5CBOA 1RQUA 1NGMB 1KYOH 1LT9B 2E76B 1L0LG 2W6JH 3BCCG 3IFMA 2HPCB 1HGVA 2WSEJ 2Z4EA 3PJSK 5CJ4A 1UIXA 1JTHB 3CX5D 3SWYA 4IOIH 1FZCB 1SQVG 1QL2A 2G3AA 2P7JA 1JCDA 2FYUE 5EFWB 1J1DB 1NAYA 2NPSC 3L74G 5M1BA 2QSIA 1G1JA 2FXPA 1M8OB 1NTMJ 3CCRP 2YKPA 3V4WA 2FYUJ 4WB4A 2XU6A 3L70G 2G8YA 1DH3A 2KLVA 2WPRA 1AVYA 5AW5B 2PRRA 1NTKE 1SFCC 2KS1B 3PH0A 1Q86Q 3MTUE 4PJ0E 1N86A 1R5LA 3ABVC 1URQA 4CPGA 3IN6A 5CCHA 3H1JG 5B66H 1OWAA 1QX8A 2ZT9B 3CC4P 5TISE 1GL2B 1NTKD 5APWA 1JY3P 2P67A 1K04A 3E1RA 1ZV8A 2OQQA 3F89A 3OJAB 1PGOA 3H1IG 5KJ7A 3L75D 1NU1G 3CI9A 3TNUA 3M0DA 2YIUB 2J59M 1LTGC 1PP9G 2V7QJ 5AVSB 3U1CA 3SWFA 3RK2C 3RK3C 2HYNA 2NPSD 1S9KD 1GL2D 1LTTC 2QJKB 3HD7A 3H1JJ 3L75E 4H13C 2JO1A 5B5EH 1DIPA 2HG5D 1GU4A 2HLOA 2CK3H 3AE2C 2C9LY 1PZQA 1G2CB 1KN7A 4WVZA 1IK7A 2K9YA 2KS1A 1KILA 1M1JB 1L0NK 2Q3EA 3HRNA 1M90Q 2OYHA 2IYOA 4AUWA 1NU1J 2FY8A 4N6JA 3P8CD 1PP9D 3B4SA 3NXSA 2V7QH 4H44B 1LJ2A 5AVTB 3V2PA 1LGHB 1G1IA 2QEXP 4EOTA 1XTCC 2O01J 3UIAA 1TU3F 2QA4P 1KORA 1N7SD 3B8EB 3CLQA 1KB9E 1LT9C 3G6EP 1LTAC 4N3YB 5APTA 2IDBA 4Y99B 1IZNB 1N2DC 5KLVG 1NU1E 3F5HA 3A5TA 1OX3A 1SQQD 3AEFC 4R4MA 3II6A 3PRJA 4IL6H 1M56D 2LKMA 2P10A 3P32A 3Q3DA 1Q7YQ 1KB9D 1PPJD 4RKUJ 1BE3E 2BCCE 2B9BA 1FOSE 1YYCA 1PV3A 2R3SA 2ZVOB 3M0DC 1IFNA 3R2PA 4IL6X 2XZRA 1YJ9P 1JOCA 1JY3O 2XKMA 1FE6A 1YQ4C 1S4XA 1NTKK 3CD6P 1MFZA 1KV4A 3KZIE 1EZVD 3HE4B 2W8ZA 1PPJE 3A2AA 5APUA 1FBMA 2N1TA 3U1AA 1BDCA 1L2PA 2M5AA 3L73J 2KP8A 3VYIA 1PGQA 1SQBE 2E74C 3BRTB 1ZP0C 1DEEG 1SQXK 2RN0A 3AE4C 1FC2C 2W27A 3MGNA 2KNCB 2E42A 4YTPC 3I55P 3H1HD 1R5SA 1FZBA 3QWOC 1VQ6P 1N7SC 1PGPA 2Q6QA 3TYYA 4H0LD 4H44C 1KQLA 5CJ0A 5DJTB 5CBNA 4TLFA 2WSFH 2GUSA 2J5UA 3BCCJ 1IFIA 3GW6A 3CMEP 1NKNA 1NYHA 1RF1A 3RK2B 3FX0A 2QM7A 1NTMD 2D2CD 1W5CE 5AW6B 1DD4A 3L73E 4ZKPA 2FYUD 1SQVD 1RE4A 3MP7B 2I1JA 4WY4C 3WUTA 1S5LE 4LLHA 3MUDC 3T97A 1H89A 3L70J 1OVVA 1Y9BA 4KHXA 1VF5D 4K35A 4K3AA 2E75B 3RK2D 2PFXA 1ZXGA 1SQXJ 3CWBJ 1GW4A 1LP1B 3GHGC 3D71A 1YTZI 1RF1C 1VF5C 2AXCA 2OTKE 3JCUE 4GDOA 2CPSA 1VQPP 1FZFA 1LTSC 3MD0A 4GOFA 2NPSB 1KILC 2FBWC 1KYOD 2KNCA 3AECC 1BCCJ 2M0BA 4YPCA 2IFNA 1N7LA 2ZT9C 3C1LA 2PAJA 1LWUA 3GHGB 3MIWA 2D2CC 3WU2E 4DZOA 4EIJA 4YXWH 3CCVP 1BGYG 5E79H 3SWKA 3M91A 3V2RA 4BRYB 3CCUP 2OYIC 2NZ2A 4BXLA 2E5TA 2XDJA 5KKZC 2ZJSE 4D6TD 3CWBG 1J1EB 3HUSB 2K1AA 1SQBK 1JTHA 3L72G 1SFCD 4H0LC 1OVUA 3JC22 3W68A 1PP9E 1RE3A 2H88C 4IL6E 2KIKA 1EQ7A 3B5NA 3VMXA 1NWQA 2W6BA 3H1JD 5GTIE 2E74D 2WT7A 3S9OA 1LNQA 1WRGA 3L37A 4D6TE 2JKVA 2ZFCA 4HKZH 4U3FJ 2P2UA 3C9IA 3HTKB 5AVXB 3RL0C 3TDKA 3H6PA 1AV1A 4QMAA 4M3LA 3VMZA 5TISH 3NTNA 5KAIH 3CPWO 1NU1D 1N73B 2AEMA 1KQSO 1J1EC 3HUSC 3KHUA 1JMMA 2Q5UA 3P8CE 4I7ZB 4PJ0H 3KDPB 3CXHI 3LW5H 4HYTB 5KAFE 2OGUA 1VQ5P 2KK7A 2K88A 1VQNP 2K9JB 3OAKA 1EDIA 2WSCJ 1YBKA 3BATA 1K73Q 3M9QA 2AEJA 2MKVA 4L75A 5CCGC 5KAIE 3H1ID 2BEQD 1SQQE 5AVQB 4C46A 3KPEA 4R4LA 1NVOA 1QVGO 2KSEA 1L0NE 3AE1C 3B71A 5AVZB 2Y9ZA 2R5DA 3FWNA 2WT7B 4OGQB 3VTPC 1P84H 3CX5E 1USEA 1IFJA 2DW3A 2YXQB 3CCSP 2XNDH 1RF0C 3H1IE 3TSIA 1JNMA 4WY4A 2WSCH 1T6AA 1T8ZA 4JPZB 4B86A 1EZVE 3H1HG 1MV8A 3O6QA 1EXJA 1T3UA 3L72E 3A0HH 2W83C 3BASA 2I1KA 1WMKA 5AVRB 1IO4A 3FGAD 1BCCE 1NTME 1FZEA 1NAFA 1NTZK 3IAOA 1S1CX 4OGQD 5KLIC 3CMAP 2V4HA 3M0AA 1GL2C 4H13B 2OTLP 3RL0D 2N1TC 1ZR4A 1U57A 1AA0A 2A45H 3GLMA 3H1IJ 2K9JA 3TGUJ 3RK3B 1GU5A 5AW7B 4Z1MH 3GF3A 3I56P 3HUSA 4PD4I 1P84D 3TGUD 3Q5PA 2YIUC 4L73A 3E7KA 1S72P 1L0LK 5K5GB 1IFDA 1SP4A 4W80A 3WU2H 2H43A 1EDJA 1OW8A 2NRGA 2PP6A 2QJKC 1LTJB 3M9HA 2ZAEB 4EDFA 3RL0B 1OW6A 1Z56A 2OARA 1KILE 1NTMG 5CMZA 1IK9A 1OVRA 2HODA 3SFEC 1GL2A 1FDOA 1SQVE 3GMAA 3L70D 3AEGC 3JCUH 1NKZB 1HUCA 4HH2A 4I7ZC 1S5LH 1VQ4P 1BE3G 2BCCG 2R32A 1L0LE 2C9NY 1RE3C 1OXZA 3M9BA 1N73C 4UB6H 5L8RJ 2Y9YA 1YJNP 1L4AB 1RH5B 3H32B 1KILD 5APXA 3V4QA 1S9KE 1J2JB 1NH4A 5CCHD 1VF5B 2O01H 2LXCB 1AFOA 1FDMA 2FYNB 3GG2A 4DJGA 2RMZA 4DOJA 3VMYA 1KZUB 1XTGB 2YO3A 2A45I 4UB6E 1N7SA 1YJWP 2YXRB 4C7RA 2HR3A 2GA1A 4I2LC 4LGDE 1JCCA 3G3ZA 2B89A 2OYIB 1JMBA 5AVYB 5AW3B 3CCMP 5BU5A 2A06D 3H1KJ 1RF1B 1LTJA 1BDDA 1PPJG 2ZVNB 2B88A 3L72J 1PL5A 4PV1D 3VN0A 4BRYA 1VQ8P 2HODB 2K37A 1KD1Q 3H1LJ 3VOPA 2VRSA 2J58A 2WTYA 1VQLP 1EC5A 1H88A 1DX7A 1RQVA 1RY3A 3KYQA 3HD7C 3O6QB 2Y0DA 3CXHE 4U3FD 2WMMA 1ZN5A 5DJUB 2QRXA 1IJDB 1MFTA 1NU1K 2A06E 3E1IA 1SQPJ 4L74A 3TK1A 1L0NJ 1L4AA 4ASWA 2E75D 2IBZI 2E74B 5CHXA 4EYYQ 1OIPA 2E76D 4IFMA 5KJ7C 2M3EA 2M3BA 4DCKA 1M7LA 3Q5SA 2L5GB 2K3RA 3H1LE 1SQQK 3VP8A 1R8EA 1N73A 2FXMA 3CWBE 2R44A 2JEEA 2WSFJ 4ZNCA 2AXTH 3HE4A 3S4RA 4AQRD 2IPPA 2PGDA 1SQBD 3CX5H 3CX5I 3RBXA 2KSJA 1URQD 3CC7P 3L71G 2R3CA 5H2FH 3EQ2A 2JR8A 3H1LD 2OYIA 1JO5A 1NTKG 1GW3A 1SQXE 1EZVI 3V6IA 1SFCB 3EFGA 4XE5B 1ZR2A 1HF9A 1UIIA 1LTIC 1A02F 5B5EE 1S3JA 1OW7A 5KJ7D 5CCGA 1QEXA 1MUUA 3L75G 4D6TJ 2KB7P 1G2CA 2E75C 3P7KA 1VQMP 1SQXG 3L74E 3WUUA 3L73D 1NTZD 1MZ9A 1SQXD 1YQ3C 2B87B 3N7NA 4JQ0D 5KAFH 1NJIQ 1GDTA 2JDIH 3HD7D 3Q2YA 3WUVA 3HTKA 3L71J 2YO2A 1FU1A 4PD4E 1VPCA 5AVUB 1N7SB 1BCCG 2C0WA 3BCCE 1ZOYC 3HE5B 2IX7C 3KXDA 1GK6A 3L74J 5AW8B 2QG4A 3U59A 1HWTC 3RK3E 3L74D 3S1KA 1EZVG 5APQA 3SSUA 2JJLA 3CXHH 1S5LX 3GF7A 3MZWB 1J1DC 1YTZT 1FZAA 3CC2P 1CSBA
chains in the Genus database with same CATH topology
5BVZA 3RK3D 2CPBA 2O1JA 1CI6A 1M1JC 2IFMA 3OA7A 1CZQA 2Z5HA 2P1JA 5CCHC 2H7HA 5AVVB 2OYHC 4GKGA 3LIEA 1KFMA 2MJZA 1CI6B 3NMDA 1GTWA 3WMM0 2O1KA 1NOHA 2HFED 1GK4A 4XA4A 1QL1A 1VDFA 1KILB 1M1JA 3L36A 5APSA 2KOGA 3KQGA 2WPSA 2XNXA 1LTBC 4LC1A 2BASA 1FAVA 1SFCA 3B5NC 4O9BA 3MUDA 1WT6A 2H8PD 1T3JA 2M8RA 2A45G 3V2QA 2N1TB 1FZCC 2GUVA 4JF7A 1LT9A 1FJPA 5APVA 5AW0B 1HBWA 4ZKUA 1HTLC 2FFDB 2WITA 2NPSA 1IC2A 4JYCA 1GD2E 2W6AA 3V5BA 1HH0A 3I5CA 1RE4C 2R5BA 2POHA 4N78E 5AW9B 1X8YA 3L35A 1URQC 1NO4A 5AVWB 4WBAA 1HVVA 1HJBA 1CW5A 5AW4B 1L4AC 2N9BA 2ZXEB 4JYBA 3B5ND 3TNUB 2YKQA 2FFDA 1JY2O 3HD7B 4C7NB 1FZGA 3HE5A 4Y99C 3NFQA 3B5NB 1JY3N 3H32A 1X79B 1T2KD 1URQB 4IFFA 5APYA 3BRVB 2Z5IA 1LWUB 3GHGA 2GM4A 1RF0A 4GIFA 3IR9A 1A02J 1DEBA 2Q7CA 4W7YA 3VP9A 1AQ5A 1FJKA 4W7ZA 1PFIA 1SQPK 4GT1A 2YNYA 1FZCA 4RESB 1E5WA 3LIDA 2HPCA 2Q3IA 1LWUC 5KTBA 1KFNA 3N4XA 4WY4D 3V2NA 2WPQA 4C7NA 2KYVA 3A7OA 2WSEH 1T2KC 1W2EA 2FFDC 1NHLA 1IFMA 4I6MC 5BU8B 4WY4B 2FYZA 1SQVK 1X9VA 2YKOA 2FYUK 2Q9IA 1GZLA 1NTMK 5AW1B 1JUNA 2XV5A 2WWWA 3BVHA 1L4AD 2N1TD 2YMYA 1SLQA 3P8MC 1JY2N 3L4FA 1ZLLA 3A3YB 5AW2B 2FKWB 5KLVK 4IFDK 1LTJC 2WZ7A 4OH8B 2C0XA 1JY2P 4AYCA 3CL3D 4N78D 5CCGD 2OYHB 3M06A 1SVFA 3PP5A 1HGZA 3O8ZA 2QM8A 2HPCB 1LT9B 3IFMA 1HGVA 2Z4EA 5CJ4A 1JTHB 3SWYA 1QL2A 2P7JA 1JCDA 1J1DB 2NPSC 1G1JA 2YKPA 3V4WA 4WB4A 2XU6A 1DH3A 2KLVA 2WPRA 5AW5B 1SFCC 3MTUE 1N86A 1URQA 5CCHA 1OWAA 1GL2B 5APWA 1JY3P 2P67A 1ZV8A 3OJAB 5KJ7A 3CI9A 3TNUA 3M0DA 2J59M 1LTGC 3U1CA 5AVSB 3SWFA 3RK2C 3RK3C 2HYNA 2NPSD 1S9KD 1GL2D 1LTTC 3HD7A 2HG5D 1GU4A 2HLOA 2C9LY 1G2CB 1KILA 1M1JB 1L0NK 3HRNA 2OYHA 4AUWA 4N6JA 3P8CD 3V2PA 3NXSA 5AVTB 4EOTA 1LGHB 1G1IA 1XTCC 3UIAA 3B8EB 1N7SD 3CLQA 1LT9C 1LTAC 4N3YB 5APTA 4Y99B 1N2DC 3A5TA 3II6A 2LKMA 3P32A 1FOSE 1YYCA 3M0DC 1IFNA 3R2PA 2XZRA 1JOCA 1JY3O 2XKMA 1NTKK 1MFZA 3HE4B 3A2AA 5APUA 3U1AA 1FBMA 2N1TA 2KP8A 3VYIA 3BRTB 1SQXK 2W27A 3MGNA 2E42A 1FZBA 1N7SC 3TYYA 1KQLA 5CJ0A 2WSFH 2GUSA 1IFIA 1NKNA 1RF1A 3RK2B 2QM7A 5AW6B 4ZKPA 1RE4A 4WY4C 2I1JA 4LLHA 3T97A 1H89A 4KHXA 3RK2D 1GW4A 3GHGC 1YTZI 1RF1C 1FZFA 2CPSA 1LTSC 3MD0A 1KILC 2IFNA 1N7LA 2PAJA 1LWUA 3GHGB 3MIWA 4DZOA 4EIJA 3V2RA 3M91A 2OYIC 2XDJA 1J1EB 3HUSB 1SQBK 1JTHA 1SFCD 1J1DC 1RE3A 1EQ7A 3B5NA 3VMXA 1NWQA 2W6BA 2WT7A 1WRGA 3L37A 2ZFCA 2P2UA 3C9IA 3HTKB 5AVXB 3RL0C 3H6PA 4M3LA 3VMZA 1N73B 3NTNA 1J1EC 3HUSC 1JMMA 2Q5UA 3P8CE 3KDPB 3LW5H 4HYTB 3OAKA 3BATA 3M9QA 5CCGC 5AVQB 4C46A 3KPEA 5AVZB 2R5DA 2WT7B 3VTPC 1IFJA 1JNMA 1RF0C 3TSIA 4WY4A 2WSCH 1T8ZA 4B86A 1MV8A 1T3UA 3BASA 2I1KA 5AVRB 1IO4A 1FZCB 1FZEA 1NAFA 1NTZK 1FOSF 3M0AA 1GL2C 3RL0D 2N1TC 1ZR4A 2A45H 1GU5A 3RK3B 5AW7B 3HUSA 1L0LK 1IFDA 1SP4A 4W80A 2H43A 2PP6A 1H8AA 1LTJB 3M9HA 3RL0B 5CMZA 1Z56A 2OARA 2E43A 1DX7A 1IK9A 2HODA 1GL2A 4HH2A 1NKZB 1HUCA 2C9NY 2R32A 1RE3C 1OXZA 3M9BA 1N73C 1L4AB 5APXA 3H32B 1KILD 3V4QA 1S9KE 1J2JB 1NH4A 5CCHD 2O01H 1AFOA 1FDMA 4DOJA 3VMYA 1KZUB 1XTGB 2YO3A 2A45I 1N7SA 4C7RA 4LGDE 4I2LC 1JCCA 3G3ZA 2OYIB 5AVYB 5AW3B 5BU5A 1RF1B 1LTJA 3VN0A 2HODB 3VOPA 2VRSA 2J58A 2WTYA 1H88A 1RY3A 3KYQA 3HD7C 1ZN5A 1IJDB 1NU1K 3E1IA 3TK1A 1L4AA 5CHXA 4IFMA 5KJ7C 2M3BA 1M7LA 2L5GB 1SQQK 3VP8A 1N73A 2FXMA 2JEEA 4AQRD 3HE4A 1A02F 2IPPA 2KSJA 1URQD 2R3CA 2OYIA 3EQ2A 1JO5A 1GW3A 1SFCB 3EFGA 4XE5B 1ZR2A 1LTIC 5KJ7D 5CCGA 1MUUA 2KB7P 1G2CA 3P7KA 3N7NA 1MZ9A 1GDTA 3HD7D 3HTKA 2YO2A 1FU1A 1VPCA 5AVUB 1N7SB 2C0WA 3HE5B 5AW8B 3U59A 1HWTC 2IX7C 1GK6A 5APQA 2JJLA 4I1LA 2NPSB 1YTZT 1FZAA 1CSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3I A;  3UIA A;  1JNM A;  3B8E B;  2WPQ A;  4C7N A;  4B86 A;  1CI6 A;  1MV8 A;  5APT A;  3A7O A;  1T2K C;  1CZQ A;  2Z5H A;  5AVR B;  1IO4 A;  1NAF A;  3A5T A;  1FOS F;  2H7H A;  5AVV B;  4GKG A;  3M0A A;  3P32 A;  3LIE A;  4I6M C;  1GU5 A;  1FOS E;  1YYC A;  5AW7 B;  1CI6 B;  3NMD A;  2XZR A;  1GTW A;  1GZL A;  1MFZ A;  1GK4 A;  1SP4 A;  5AW1 B;  1JUN A;  2XV5 A;  2WWW A;  3HE4 B;  3A2A A;  3L36 A;  5APU A;  1H8A A;  1SLQ A;  3M9H A;  5APS A;  3P8M C;  5CMZ A;  3KQG A;  2E43 A;  2WPS A;  4LC1 A;  5AVT B;  2BAS A;  2KP8 A;  3VYI A;  1FAV A;  1HUC A;  2W27 A;  3MGN A;  2R32 A;  3A3Y B;  5AW2 B;  2C9N Y;  2E42 A;  1OXZ A;  3M9B A;  3TYY A;  5APX A;  3V4Q A;  1KQL A;  1S9K E;  1J2J B;  4AYC A;  2QM7 A;  5AW6 B;  3VMY A;  2YO3 A;  5APV A;  5AW0 B;  3T97 A;  4I2L C;  1H89 A;  3M06 A;  1HBW A;  4KHX A;  5AVY B;  5AW3 B;  1CSB A;  4JYC A;  1GD2 E;  3O8Z A;  2QM8 A;  3VN0 A;  2W6A A;  3V5B A;  2VRS A;  2WTY A;  3MD0 A;  1H88 A;  2P7J A;  3I5C A;  2R5B A;  3TK1 A;  5AW9 B;  1X8Y A;  4DZO A;  3L35 A;  3V4W A;  2XU6 A;  3M91 A;  1DH3 A;  2WPR A;  5AVW B;  5AW5 B;  1HJB A;  5AW4 B;  2N9B A;  2ZXE B;  4JYB A;  3TNU B;  3VMX A;  4AQR D;  3HE4 A;  1A02 F;  2IPP A;  1NWQ A;  2WT7 A;  2R3C A;  3L37 A;  1OWA A;  2ZFC A;  2P2U A;  5APW A;  2P67 A;  5AVX B;  4C7N B;  4XE5 B;  4M3L A;  3VMZ A;  3NTN A;  3HE5 A;  3NFQ A;  2Q5U A;  1MUU A;  3TNU A;  3M0D A;  3KDP B;  1T2K D;  3P7K A;  5AVS B;  4HYT B;  3SWF A;  5APY A;  2Z5I A;  1S9K D;  3OAK A;  3IR9 A;  3HTK A;  2YO2 A;  1A02 J;  5AVU B;  3HE5 B;  5AW8 B;  2Q7C A;  1HWT C;  1GU4 A;  1GK6 A;  2C9L Y;  1G2C B;  5AVQ B;  4C46 A;  5APQ A;  2JJL A;  4AUW A;  4GT1 A;  2YNY A;  5AVZ B;  3NXS A;  2R5D A;  4RES B;  2WT7 B;  4EOT A;  3VTP C;  3LID A; 
#chains in the Genus database with same CATH topology
 2QIW A;  4H13 D;  1L0L D;  3AE3 C;  1VQO P;  5E79 E;  3D6Z A;  1KTM A;  4U7J A;  5BVZ A;  3AE5 C;  3RK3 D;  2CPB A;  2O1J A;  1JM0 A;  1CI6 A;  2QJP B;  1M1J C;  2IFM A;  3PLN A;  4MN4 C;  3OA7 A;  1CZQ A;  5KLV D;  1M1K Q;  1PIX A;  2Z5H A;  2P1J A;  1SQP E;  5CCH C;  2H7H A;  3AE7 C;  2O3J A;  5AVV B;  4GKG A;  2OYH C;  1NTZ G;  3LIE A;  1KFM A;  1PGJ A;  1SQQ J;  1Y47 A;  2MJZ A;  1EXI A;  3AED C;  2Y0C A;  1QLE D;  1JEK A;  2IZ1 A;  2RKL A;  1YIT P;  1CI6 B;  3NMD A;  3RL0 g;  1MKM A;  1BSH A;  1GTW A;  3WMM 0;  1SQP D;  3QH9 A;  2IBZ G;  2O1K A;  1NOH A;  2HFE D;  1U7J A;  1GK4 A;  4XA4 A;  4XFJ A;  5GTI H;  1QL1 A;  1VDF A;  1K8A Q;  1KIL B;  1M1J A;  3A0B H;  3JSV C;  3L36 A;  5APS A;  4OVN F;  2KOG A;  5KKZ B;  3KQG A;  1M57 D;  1H0T A;  2E5Y A;  2WPS A;  1LTB C;  2XNX A;  2BAS A;  4LC1 A;  4NPE A;  1W2B O;  1FAV A;  3R4Y A;  1BGY J;  2WQY C;  2QJP C;  5TJH A;  2QJY C;  1SFC A;  3AE9 C;  3B5N C;  2W90 A;  3MUD A;  4O9B A;  3Q1M A;  1YIJ P;  1WT6 A;  3A0B E;  1K05 A;  1KB9 I;  1T3J A;  2H8P D;  3CCE P;  2M8R A;  2A45 G;  1SS1 A;  2WVR A;  4TT3 H;  3T97 B;  2IBZ E;  2N1T B;  4OGQ C;  3V2Q A;  2KXP B;  4DT0 A;  4GOE A;  3CCQ P;  3W67 A;  3D6Y A;  1Q2N A;  1FZC C;  2GUV A;  1KYO I;  4JF7 A;  1BGY E;  1LT9 A;  3PHL A;  3FWL A;  4JBZ A;  5APV A;  1FJP A;  3KZI H;  4U3F G;  1L0N D;  4UB8 H;  3EFF K;  2IBZ D;  5AW0 B;  4ASV A;  1SQP G;  3Q5R A;  3VMA A;  1OZH A;  1HBW A;  3A0H E;  3FXD A;  1X22 A;  4ZKU A;  1HTL C;  2FFD B;  1FDI A;  2WIT A;  3AE6 C;  2NPS A;  1IC2 A;  4JYC A;  1GD2 E;  1KMI Z;  2D2C B;  3L72 D;  2W6A A;  3CWB D;  3V5B A;  3IF4 A;  2IYP A;  1BCC D;  1HH0 A;  3ITK A;  4HB1 A;  5GTH E;  3I5C A;  1RE4 C;  2P58 A;  2R5B A;  2POH A;  1AVO A;  3H1K E;  3PTZ A;  4N78 E;  4EI2 A;  3RBZ A;  5AW9 B;  2KLU A;  4OWF A;  1NTK J;  1X8Y A;  1YI2 P;  3AEA C;  3L73 G;  1FOS F;  3L35 A;  2Q1K A;  3CCL P;  1URQ C;  4PV1 B;  1NO4 A;  2ZYG A;  1P84 E;  3TGU E;  4GOD A;  1BE3 J;  2BCC J;  4YXD C;  5AVW B;  4WBA A;  1HVV A;  1U7M A;  1FS0 E;  1ZRT D;  2LXB A;  3CCJ P;  1HJB A;  5AW4 B;  1CW5 A;  1KB9 H;  1L4A C;  2N9B A;  2ZXE B;  2ZYA A;  3B5N D;  4JYB A;  3SFD C;  3TNU B;  3H1H J;  3K5B A;  3L70 E;  5C39 A;  2YKQ A;  2FYN C;  1KQF B;  3AE8 C;  1SQB G;  1ZW0 A;  4PD4 D;  1Q90 D;  4BWN A;  2FFD A;  1JY2 O;  1Q82 Q;  3BCC D;  4L76 A;  2FYU G;  3FXE A;  3HD7 B;  3USS A;  2RH0 A;  4C7N B;  3L71 E;  1FZG A;  3HE5 A;  4Y99 C;  3TGU G;  1KQG B;  2H89 C;  2O01 N;  2QVA A;  1HJ0 A;  3B5N B;  3G9R A;  2I8D A;  3LW5 J;  3NFQ A;  1JY3 N;  2OTJ P;  3H32 A;  1X79 B;  2UWJ E;  1T2K D;  1URQ B;  4IFF A;  4KT0 J;  4PV1 C;  1EDL A;  5APY A;  3BRV B;  2Z5I A;  2ZT9 D;  3H1H E;  1LWU B;  3GHG A;  1H8A A;  2GM4 A;  1RF0 A;  3H1L G;  4GIF A;  3L71 D;  2LR2 A;  3IR9 A;  4NPD A;  5B66 E;  1AJY A;  1SQB J;  2WPV B;  3C8V A;  1A02 J;  1ZME C;  1DEB A;  2IZ0 A;  1IFP A;  2JWA A;  4PD4 H;  4W7Y A;  2Q7C A;  3VP9 A;  4RJT A;  5KLV E;  1AQ5 A;  1FJK A;  1L0N G;  4W7Z A;  5GTH H;  1PFI A;  1AQT A;  1X0T A;  2FXO A;  4HJG H;  1Q81 Q;  1SQP K;  1SQQ G;  4GT1 A;  2SPZ A;  2YNY A;  1FZC A;  4RES B;  1E5W A;  1PP9 J;  2KZJ A;  3LID A;  3H25 A;  2ZXX A;  3OW2 O;  2HPC A;  2Q3I A;  1LP1 A;  1LWU C;  1KFN A;  2N9Y B;  3CXH D;  3N4X A;  4U3F E;  4WY4 D;  3V2N A;  5KTB A;  2WPQ A;  4A7P A;  4C7N A;  2KYV A;  2WSS H;  4KJM A;  1H0T B;  2OYO A;  3A7O A;  2YMK A;  2WSE H;  1T2K C;  1W2E A;  5H2F E;  3ZDM A;  2E43 A;  3EWK A;  2FFD C;  1LT1 A;  1NHL A;  1IFM A;  3AEE C;  2QE7 H;  1BGY D;  1DD3 A;  2AXT E;  1KYO E;  4H44 D;  1YHQ P;  1VQ7 P;  1VQK P;  4I6M C;  5BU8 B;  4WY4 B;  3H1K G;  4WWI A;  2FYZ A;  1SQV K;  2ZYD A;  3D70 A;  1X9V A;  2YKO A;  2FYU K;  3L75 J;  4D6T G;  2Q9I A;  1Y8A A;  3RGU A;  1D7M A;  1GZL A;  2KI7 B;  1NTM K;  5AW1 B;  1JUN A;  2XV5 A;  2WWW A;  2Y0E A;  1L4A D;  1OMI A;  4RO0 A;  3BVH A;  2N1T D;  1RHZ B;  1SLQ A;  2YMY A;  2A06 G;  3P8M C;  1EDK A;  1JY2 N;  5KLV J;  3L4F A;  2L91 A;  3H1J E;  1JB0 J;  3H1K D;  1ZLL A;  3A3Y B;  5AW2 B;  1VL2 A;  1USD A;  2BEZ F;  2FKW B;  1QVF O;  5KLV K;  4IFD K;  1NTZ E;  2ITA A;  2KZI A;  1OFC X;  1LTJ C;  2WZ7 A;  1VQ9 P;  1BSN A;  1QGK B;  2JP3 A;  4OH8 B;  1P84 I;  1JY2 P;  2C0X A;  2B87 A;  4AYC A;  1E79 H;  1L0L J;  2E76 C;  2KUB A;  5KLI B;  1KC8 Q;  2M5A B;  3MHV A;  4UB8 E;  3G4S P;  1SQV J;  3CL3 D;  4N78 D;  4NPF X;  2AEF A;  4I1L A;  4ZMD A;  5CCG D;  1BE3 D;  2BCC D;  4H0L B;  1N8R Q;  2OYH B;  3M06 A;  1NTZ J;  2JWD A;  4Y28 J;  1GMJ A;  1SVF A;  3AEB C;  3G71 P;  3TF5 A;  3PP5 A;  1S2E A;  1K9M Q;  1HGZ A;  2QJY B;  2QM8 A;  1ZRT E;  3O8Z A;  5CBO A;  1RQU A;  1NGM B;  1KYO H;  1LT9 B;  2E76 B;  1L0L G;  2W6J H;  3BCC G;  3IFM A;  2HPC B;  1HGV A;  2WSE J;  2Z4E A;  3PJS K;  5CJ4 A;  1UIX A;  1JTH B;  3CX5 D;  3SWY A;  4IOI H;  1FZC B;  1SQV G;  1QL2 A;  2G3A A;  2P7J A;  1JCD A;  2FYU E;  5EFW B;  1J1D B;  1NAY A;  2NPS C;  3L74 G;  5M1B A;  2QSI A;  1G1J A;  2FXP A;  1M8O B;  1NTM J;  3CCR P;  2YKP A;  3V4W A;  2FYU J;  4WB4 A;  2XU6 A;  3L70 G;  2G8Y A;  1DH3 A;  2KLV A;  2WPR A;  1AVY A;  5AW5 B;  2PRR A;  1NTK E;  1SFC C;  2KS1 B;  3PH0 A;  1Q86 Q;  3MTU E;  4PJ0 E;  1N86 A;  1R5L A;  3ABV C;  1URQ A;  4CPG A;  3IN6 A;  5CCH A;  3H1J G;  5B66 H;  1OWA A;  1QX8 A;  2ZT9 B;  3CC4 P;  5TIS E;  1GL2 B;  1NTK D;  5APW A;  1JY3 P;  2P67 A;  1K04 A;  3E1R A;  1ZV8 A;  2OQQ A;  3F89 A;  3OJA B;  1PGO A;  3H1I G;  5KJ7 A;  3L75 D;  1NU1 G;  3CI9 A;  3TNU A;  3M0D A;  2YIU B;  2J59 M;  1LTG C;  1PP9 G;  2V7Q J;  5AVS B;  3U1C A;  3SWF A;  3RK2 C;  3RK3 C;  2HYN A;  2NPS D;  1S9K D;  1GL2 D;  1LTT C;  2QJK B;  3HD7 A;  3H1J J;  3L75 E;  4H13 C;  2JO1 A;  5B5E H;  1DIP A;  2HG5 D;  1GU4 A;  2HLO A;  2CK3 H;  3AE2 C;  2C9L Y;  1PZQ A;  1G2C B;  1KN7 A;  4WVZ A;  1IK7 A;  2K9Y A;  2KS1 A;  1KIL A;  1M1J B;  1L0N K;  2Q3E A;  3HRN A;  1M90 Q;  2OYH A;  2IYO A;  4AUW A;  1NU1 J;  2FY8 A;  4N6J A;  3P8C D;  1PP9 D;  3B4S A;  3NXS A;  2V7Q H;  4H44 B;  1LJ2 A;  5AVT B;  3V2P A;  1LGH B;  1G1I A;  2QEX P;  4EOT A;  1XTC C;  2O01 J;  3UIA A;  1TU3 F;  2QA4 P;  1KOR A;  1N7S D;  3B8E B;  3CLQ A;  1KB9 E;  1LT9 C;  3G6E P;  1LTA C;  4N3Y B;  5APT A;  2IDB A;  4Y99 B;  1IZN B;  1N2D C;  5KLV G;  1NU1 E;  3F5H A;  3A5T A;  1OX3 A;  1SQQ D;  3AEF C;  4R4M A;  3II6 A;  3PRJ A;  4IL6 H;  1M56 D;  2LKM A;  2P10 A;  3P32 A;  3Q3D A;  1Q7Y Q;  1KB9 D;  1PPJ D;  4RKU J;  1BE3 E;  2BCC E;  2B9B A;  1FOS E;  1YYC A;  1PV3 A;  2R3S A;  2ZVO B;  3M0D C;  1IFN A;  3R2P A;  4IL6 X;  2XZR A;  1YJ9 P;  1JOC A;  1JY3 O;  2XKM A;  1FE6 A;  1YQ4 C;  1S4X A;  1NTK K;  3CD6 P;  1MFZ A;  1KV4 A;  3KZI E;  1EZV D;  3HE4 B;  2W8Z A;  1PPJ E;  3A2A A;  5APU A;  1FBM A;  2N1T A;  3U1A A;  1BDC A;  1L2P A;  2M5A A;  3L73 J;  2KP8 A;  3VYI A;  1PGQ A;  1SQB E;  2E74 C;  3BRT B;  1ZP0 C;  1DEE G;  1SQX K;  2RN0 A;  3AE4 C;  1FC2 C;  2W27 A;  3MGN A;  2KNC B;  2E42 A;  4YTP C;  3I55 P;  3H1H D;  1R5S A;  1FZB A;  3QWO C;  1VQ6 P;  1N7S C;  1PGP A;  2Q6Q A;  3TYY A;  4H0L D;  4H44 C;  1KQL A;  5CJ0 A;  5DJT B;  5CBN A;  4TLF A;  2WSF H;  2GUS A;  2J5U A;  3BCC J;  1IFI A;  3GW6 A;  3CME P;  1NKN A;  1NYH A;  1RF1 A;  3RK2 B;  3FX0 A;  2QM7 A;  1NTM D;  2D2C D;  1W5C E;  5AW6 B;  1DD4 A;  3L73 E;  4ZKP A;  2FYU D;  1SQV D;  1RE4 A;  3MP7 B;  2I1J A;  4WY4 C;  3WUT A;  1S5L E;  4LLH A;  3MUD C;  3T97 A;  1H89 A;  3L70 J;  1OVV A;  1Y9B A;  4KHX A;  1VF5 D;  4K35 A;  4K3A A;  2E75 B;  3RK2 D;  2PFX A;  1ZXG A;  1SQX J;  3CWB J;  1GW4 A;  1LP1 B;  3GHG C;  3D71 A;  1YTZ I;  1RF1 C;  1VF5 C;  2AXC A;  2OTK E;  3JCU E;  4GDO A;  2CPS A;  1VQP P;  1FZF A;  1LTS C;  3MD0 A;  4GOF A;  2NPS B;  1KIL C;  2FBW C;  1KYO D;  2KNC A;  3AEC C;  1BCC J;  2M0B A;  4YPC A;  2IFN A;  1N7L A;  2ZT9 C;  3C1L A;  2PAJ A;  1LWU A;  3GHG B;  3MIW A;  2D2C C;  3WU2 E;  4DZO A;  4EIJ A;  4YXW H;  3CCV P;  1BGY G;  5E79 H;  3SWK A;  3M91 A;  3V2R A;  4BRY B;  3CCU P;  2OYI C;  2NZ2 A;  4BXL A;  2E5T A;  2XDJ A;  5KKZ C;  2ZJS E;  4D6T D;  3CWB G;  1J1E B;  3HUS B;  2K1A A;  1SQB K;  1JTH A;  3L72 G;  1SFC D;  4H0L C;  1OVU A;  3JC2 2;  3W68 A;  1PP9 E;  1RE3 A;  2H88 C;  4IL6 E;  2KIK A;  1EQ7 A;  3B5N A;  3VMX A;  1NWQ A;  2W6B A;  3H1J D;  5GTI E;  2E74 D;  2WT7 A;  3S9O A;  1LNQ A;  1WRG A;  3L37 A;  4D6T E;  2JKV A;  2ZFC A;  4HKZ H;  4U3F J;  2P2U A;  3C9I A;  3HTK B;  5AVX B;  3RL0 C;  3TDK A;  3H6P A;  1AV1 A;  4QMA A;  4M3L A;  3VMZ A;  5TIS H;  3NTN A;  5KAI H;  3CPW O;  1NU1 D;  1N73 B;  2AEM A;  1KQS O;  1J1E C;  3HUS C;  3KHU A;  1JMM A;  2Q5U A;  3P8C E;  4I7Z B;  4PJ0 H;  3KDP B;  3CXH I;  3LW5 H;  4HYT B;  5KAF E;  2OGU A;  1VQ5 P;  2KK7 A;  2K88 A;  1VQN P;  2K9J B;  3OAK A;  1EDI A;  2WSC J;  1YBK A;  3BAT A;  1K73 Q;  3M9Q A;  2AEJ A;  2MKV A;  4L75 A;  5CCG C;  5KAI E;  3H1I D;  2BEQ D;  1SQQ E;  5AVQ B;  4C46 A;  3KPE A;  4R4L A;  1NVO A;  1QVG O;  2KSE A;  1L0N E;  3AE1 C;  3B71 A;  5AVZ B;  2Y9Z A;  2R5D A;  3FWN A;  2WT7 B;  4OGQ B;  3VTP C;  1P84 H;  3CX5 E;  1USE A;  1IFJ A;  2DW3 A;  2YXQ B;  3CCS P;  2XND H;  1RF0 C;  3H1I E;  3TSI A;  1JNM A;  4WY4 A;  2WSC H;  1T6A A;  1T8Z A;  4JPZ B;  4B86 A;  1EZV E;  3H1H G;  1MV8 A;  3O6Q A;  1EXJ A;  1T3U A;  3L72 E;  3A0H H;  2W83 C;  3BAS A;  2I1K A;  1WMK A;  5AVR B;  1IO4 A;  3FGA D;  1BCC E;  1NTM E;  1FZE A;  1NAF A;  1NTZ K;  3IAO A;  1S1C X;  4OGQ D;  5KLI C;  3CMA P;  2V4H A;  3M0A A;  1GL2 C;  4H13 B;  2OTL P;  3RL0 D;  2N1T C;  1ZR4 A;  1U57 A;  1AA0 A;  2A45 H;  3GLM A;  3H1I J;  2K9J A;  3TGU J;  3RK3 B;  1GU5 A;  5AW7 B;  4Z1M H;  3GF3 A;  3I56 P;  3HUS A;  4PD4 I;  1P84 D;  3TGU D;  3Q5P A;  2YIU C;  4L73 A;  3E7K A;  1S72 P;  1L0L K;  5K5G B;  1IFD A;  1SP4 A;  4W80 A;  3WU2 H;  2H43 A;  1EDJ A;  1OW8 A;  2NRG A;  2PP6 A;  2QJK C;  1LTJ B;  3M9H A;  2ZAE B;  4EDF A;  3RL0 B;  1OW6 A;  1Z56 A;  2OAR A;  1KIL E;  1NTM G;  5CMZ A;  1IK9 A;  1OVR A;  2HOD A;  3SFE C;  1GL2 A;  1FDO A;  1SQV E;  3GMA A;  3L70 D;  3AEG C;  3JCU H;  1NKZ B;  1HUC A;  4HH2 A;  4I7Z C;  1S5L H;  1VQ4 P;  1BE3 G;  2BCC G;  2R32 A;  1L0L E;  2C9N Y;  1RE3 C;  1OXZ A;  3M9B A;  1N73 C;  4UB6 H;  5L8R J;  2Y9Y A;  1YJN P;  1L4A B;  1RH5 B;  3H32 B;  1KIL D;  5APX A;  3V4Q A;  1S9K E;  1J2J B;  1NH4 A;  5CCH D;  1VF5 B;  2O01 H;  2LXC B;  1AFO A;  1FDM A;  2FYN B;  3GG2 A;  4DJG A;  2RMZ A;  4DOJ A;  3VMY A;  1KZU B;  1XTG B;  2YO3 A;  2A45 I;  4UB6 E;  1N7S A;  1YJW P;  2YXR B;  4C7R A;  2HR3 A;  2GA1 A;  4I2L C;  4LGD E;  1JCC A;  3G3Z A;  2B89 A;  2OYI B;  1JMB A;  5AVY B;  5AW3 B;  3CCM P;  5BU5 A;  2A06 D;  3H1K J;  1RF1 B;  1LTJ A;  1BDD A;  1PPJ G;  2ZVN B;  2B88 A;  3L72 J;  1PL5 A;  4PV1 D;  3VN0 A;  4BRY A;  1VQ8 P;  2HOD B;  2K37 A;  1KD1 Q;  3H1L J;  3VOP A;  2VRS A;  2J58 A;  2WTY A;  1VQL P;  1EC5 A;  1H88 A;  1DX7 A;  1RQV A;  1RY3 A;  3KYQ A;  3HD7 C;  3O6Q B;  2Y0D A;  3CXH E;  4U3F D;  2WMM A;  1ZN5 A;  5DJU B;  2QRX A;  1IJD B;  1MFT A;  1NU1 K;  2A06 E;  3E1I A;  1SQP J;  4L74 A;  3TK1 A;  1L0N J;  1L4A A;  4ASW A;  2E75 D;  2IBZ I;  2E74 B;  5CHX A;  4EYY Q;  1OIP A;  2E76 D;  4IFM A;  5KJ7 C;  2M3E A;  2M3B A;  4DCK A;  1M7L A;  3Q5S A;  2L5G B;  2K3R A;  3H1L E;  1SQQ K;  3VP8 A;  1R8E A;  1N73 A;  2FXM A;  3CWB E;  2R44 A;  2JEE A;  2WSF J;  4ZNC A;  2AXT H;  3HE4 A;  3S4R A;  4AQR D;  2IPP A;  2PGD A;  1SQB D;  3CX5 H;  3CX5 I;  3RBX A;  2KSJ A;  1URQ D;  3CC7 P;  3L71 G;  2R3C A;  5H2F H;  3EQ2 A;  2JR8 A;  3H1L D;  2OYI A;  1JO5 A;  1NTK G;  1GW3 A;  1SQX E;  1EZV I;  3V6I A;  1SFC B;  3EFG A;  4XE5 B;  1ZR2 A;  1HF9 A;  1UII A;  1LTI C;  1A02 F;  5B5E E;  1S3J A;  1OW7 A;  5KJ7 D;  5CCG A;  1QEX A;  1MUU A;  3L75 G;  4D6T J;  2KB7 P;  1G2C A;  2E75 C;  3P7K A;  1VQM P;  1SQX G;  3L74 E;  3WUU A;  3L73 D;  1NTZ D;  1MZ9 A;  1SQX D;  1YQ3 C;  2B87 B;  3N7N A;  4JQ0 D;  5KAF H;  1NJI Q;  1GDT A;  2JDI H;  3HD7 D;  3Q2Y A;  3WUV A;  3HTK A;  3L71 J;  2YO2 A;  1FU1 A;  4PD4 E;  1VPC A;  5AVU B;  1N7S B;  1BCC G;  2C0W A;  3BCC E;  1ZOY C;  3HE5 B;  2IX7 C;  3KXD A;  1GK6 A;  3L74 J;  5AW8 B;  2QG4 A;  3U59 A;  1HWT C;  3RK3 E;  3L74 D;  3S1K A;  1EZV G;  5APQ A;  3SSU A;  2JJL A;  3CXH H;  1S5L X;  3GF7 A;  3MZW B;  1J1D C;  1YTZ T;  1FZA A;  3CC2 P;  1CSB A; 
#chains in the Genus database with same CATH homology
 5BVZ A;  3RK3 D;  2CPB A;  2O1J A;  1CI6 A;  1M1J C;  2IFM A;  3OA7 A;  1CZQ A;  2Z5H A;  2P1J A;  5CCH C;  2H7H A;  5AVV B;  2OYH C;  4GKG A;  3LIE A;  1KFM A;  2MJZ A;  1CI6 B;  3NMD A;  1GTW A;  3WMM 0;  2O1K A;  1NOH A;  2HFE D;  1GK4 A;  4XA4 A;  1QL1 A;  1VDF A;  1KIL B;  1M1J A;  3L36 A;  5APS A;  2KOG A;  3KQG A;  2WPS A;  2XNX A;  1LTB C;  4LC1 A;  2BAS A;  1FAV A;  1SFC A;  3B5N C;  4O9B A;  3MUD A;  1WT6 A;  2H8P D;  1T3J A;  2M8R A;  2A45 G;  3V2Q A;  2N1T B;  1FZC C;  2GUV A;  4JF7 A;  1LT9 A;  1FJP A;  5APV A;  5AW0 B;  1HBW A;  4ZKU A;  1HTL C;  2FFD B;  2WIT A;  2NPS A;  1IC2 A;  4JYC A;  1GD2 E;  2W6A A;  3V5B A;  1HH0 A;  3I5C A;  1RE4 C;  2R5B A;  2POH A;  4N78 E;  5AW9 B;  1X8Y A;  3L35 A;  1URQ C;  1NO4 A;  5AVW B;  4WBA A;  1HVV A;  1HJB A;  1CW5 A;  5AW4 B;  1L4A C;  2N9B A;  2ZXE B;  4JYB A;  3B5N D;  3TNU B;  2YKQ A;  2FFD A;  1JY2 O;  3HD7 B;  4C7N B;  1FZG A;  3HE5 A;  4Y99 C;  3NFQ A;  3B5N B;  1JY3 N;  3H32 A;  1X79 B;  1T2K D;  1URQ B;  4IFF A;  5APY A;  3BRV B;  2Z5I A;  1LWU B;  3GHG A;  2GM4 A;  1RF0 A;  4GIF A;  3IR9 A;  1A02 J;  1DEB A;  2Q7C A;  4W7Y A;  3VP9 A;  1AQ5 A;  1FJK A;  4W7Z A;  1PFI A;  1SQP K;  4GT1 A;  2YNY A;  1FZC A;  4RES B;  1E5W A;  3LID A;  2HPC A;  2Q3I A;  1LWU C;  5KTB A;  1KFN A;  3N4X A;  4WY4 D;  3V2N A;  2WPQ A;  4C7N A;  2KYV A;  3A7O A;  2WSE H;  1T2K C;  1W2E A;  2FFD C;  1NHL A;  1IFM A;  4I6M C;  5BU8 B;  4WY4 B;  2FYZ A;  1SQV K;  1X9V A;  2YKO A;  2FYU K;  2Q9I A;  1GZL A;  1NTM K;  5AW1 B;  1JUN A;  2XV5 A;  2WWW A;  3BVH A;  1L4A D;  2N1T D;  2YMY A;  1SLQ A;  3P8M C;  1JY2 N;  3L4F A;  1ZLL A;  3A3Y B;  5AW2 B;  2FKW B;  5KLV K;  4IFD K;  1LTJ C;  2WZ7 A;  4OH8 B;  2C0X A;  1JY2 P;  4AYC A;  3CL3 D;  4N78 D;  5CCG D;  2OYH B;  3M06 A;  1SVF A;  3PP5 A;  1HGZ A;  3O8Z A;  2QM8 A;  2HPC B;  1LT9 B;  3IFM A;  1HGV A;  2Z4E A;  5CJ4 A;  1JTH B;  3SWY A;  1QL2 A;  2P7J A;  1JCD A;  1J1D B;  2NPS C;  1G1J A;  2YKP A;  3V4W A;  4WB4 A;  2XU6 A;  1DH3 A;  2KLV A;  2WPR A;  5AW5 B;  1SFC C;  3MTU E;  1N86 A;  1URQ A;  5CCH A;  1OWA A;  1GL2 B;  5APW A;  1JY3 P;  2P67 A;  1ZV8 A;  3OJA B;  5KJ7 A;  3CI9 A;  3TNU A;  3M0D A;  2J59 M;  1LTG C;  3U1C A;  5AVS B;  3SWF A;  3RK2 C;  3RK3 C;  2HYN A;  2NPS D;  1S9K D;  1GL2 D;  1LTT C;  3HD7 A;  2HG5 D;  1GU4 A;  2HLO A;  2C9L Y;  1G2C B;  1KIL A;  1M1J B;  1L0N K;  3HRN A;  2OYH A;  4AUW A;  4N6J A;  3P8C D;  3V2P A;  3NXS A;  5AVT B;  4EOT A;  1LGH B;  1G1I A;  1XTC C;  3UIA A;  3B8E B;  1N7S D;  3CLQ A;  1LT9 C;  1LTA C;  4N3Y B;  5APT A;  4Y99 B;  1N2D C;  3A5T A;  3II6 A;  2LKM A;  3P32 A;  1FOS E;  1YYC A;  3M0D C;  1IFN A;  3R2P A;  2XZR A;  1JOC A;  1JY3 O;  2XKM A;  1NTK K;  1MFZ A;  3HE4 B;  3A2A A;  5APU A;  3U1A A;  1FBM A;  2N1T A;  2KP8 A;  3VYI A;  3BRT B;  1SQX K;  2W27 A;  3MGN A;  2E42 A;  1FZB A;  1N7S C;  3TYY A;  1KQL A;  5CJ0 A;  2WSF H;  2GUS A;  1IFI A;  1NKN A;  1RF1 A;  3RK2 B;  2QM7 A;  5AW6 B;  4ZKP A;  1RE4 A;  4WY4 C;  2I1J A;  4LLH A;  3T97 A;  1H89 A;  4KHX A;  3RK2 D;  1GW4 A;  3GHG C;  1YTZ I;  1RF1 C;  1FZF A;  2CPS A;  1LTS C;  3MD0 A;  1KIL C;  2IFN A;  1N7L A;  2PAJ A;  1LWU A;  3GHG B;  3MIW A;  4DZO A;  4EIJ A;  3V2R A;  3M91 A;  2OYI C;  2XDJ A;  1J1E B;  3HUS B;  1SQB K;  1JTH A;  1SFC D;  1J1D C;  1RE3 A;  1EQ7 A;  3B5N A;  3VMX A;  1NWQ A;  2W6B A;  2WT7 A;  1WRG A;  3L37 A;  2ZFC A;  2P2U A;  3C9I A;  3HTK B;  5AVX B;  3RL0 C;  3H6P A;  4M3L A;  3VMZ A;  1N73 B;  3NTN A;  1J1E C;  3HUS C;  1JMM A;  2Q5U A;  3P8C E;  3KDP B;  3LW5 H;  4HYT B;  3OAK A;  3BAT A;  3M9Q A;  5CCG C;  5AVQ B;  4C46 A;  3KPE A;  5AVZ B;  2R5D A;  2WT7 B;  3VTP C;  1IFJ A;  1JNM A;  1RF0 C;  3TSI A;  4WY4 A;  2WSC H;  1T8Z A;  4B86 A;  1MV8 A;  1T3U A;  3BAS A;  2I1K A;  5AVR B;  1IO4 A;  1FZC B;  1FZE A;  1NAF A;  1NTZ K;  1FOS F;  3M0A A;  1GL2 C;  3RL0 D;  2N1T C;  1ZR4 A;  2A45 H;  1GU5 A;  3RK3 B;  5AW7 B;  3HUS A;  1L0L K;  1IFD A;  1SP4 A;  4W80 A;  2H43 A;  2PP6 A;  1H8A A;  1LTJ B;  3M9H A;  3RL0 B;  5CMZ A;  1Z56 A;  2OAR A;  2E43 A;  1DX7 A;  1IK9 A;  2HOD A;  1GL2 A;  4HH2 A;  1NKZ B;  1HUC A;  2C9N Y;  2R32 A;  1RE3 C;  1OXZ A;  3M9B A;  1N73 C;  1L4A B;  5APX A;  3H32 B;  1KIL D;  3V4Q A;  1S9K E;  1J2J B;  1NH4 A;  5CCH D;  2O01 H;  1AFO A;  1FDM A;  4DOJ A;  3VMY A;  1KZU B;  1XTG B;  2YO3 A;  2A45 I;  1N7S A;  4C7R A;  4LGD E;  4I2L C;  1JCC A;  3G3Z A;  2OYI B;  5AVY B;  5AW3 B;  5BU5 A;  1RF1 B;  1LTJ A;  3VN0 A;  2HOD B;  3VOP A;  2VRS A;  2J58 A;  2WTY A;  1H88 A;  1RY3 A;  3KYQ A;  3HD7 C;  1ZN5 A;  1IJD B;  1NU1 K;  3E1I A;  3TK1 A;  1L4A A;  5CHX A;  4IFM A;  5KJ7 C;  2M3B A;  1M7L A;  2L5G B;  1SQQ K;  3VP8 A;  1N73 A;  2FXM A;  2JEE A;  4AQR D;  3HE4 A;  1A02 F;  2IPP A;  2KSJ A;  1URQ D;  2R3C A;  2OYI A;  3EQ2 A;  1JO5 A;  1GW3 A;  1SFC B;  3EFG A;  4XE5 B;  1ZR2 A;  1LTI C;  5KJ7 D;  5CCG A;  1MUU A;  2KB7 P;  1G2C A;  3P7K A;  3N7N A;  1MZ9 A;  1GDT A;  3HD7 D;  3HTK A;  2YO2 A;  1FU1 A;  1VPC A;  5AVU B;  1N7S B;  2C0W A;  3HE5 B;  5AW8 B;  3U59 A;  1HWT C;  2IX7 C;  1GK6 A;  5APQ A;  2JJL A;  4I1L A;  2NPS B;  1YTZ T;  1FZA A;  1CSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...