3L35A

Pie12 d-peptide against hiv entry
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 21
structure length 45
sequence length 45
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l35A00
3VMZA 5AW7B 1OWAA 2BASA 1A02F 3HE4B 4AYCA 1A02J 2IPPA 2WPSA 4EOTA 1GU5A 3M91A 2VRSA 2ZFCA 3LIEA 2Q3IA 3V4QA 1HUCA 3NMDA 2R3CA 4AUWA 4GT1A 5APXA 5APQA 1YYCA 2YO3A 2XZRA 3MGNA 5AVVB 5AW6B 2WTYA 4C7NA 1CI6B 2ZXEB 1T2KD 1DH3A 1CI6A 3IR9A 1H88A 2QM7A 1GD2E 3TK1A 5AVTB 2WPQA 1H89A 1HBWA 5AVZB 1GU4A 2N9BA 2QM8A 2C9NY 5APUA 3M0DA 1JNMA 3L36A 2JJLA 5APWA 2Z5HA 4LC1A 5AVQB 3HTKA 3O8ZA 1T2KC 1GK4A 2Z5IA 2XV5A 2WPRA 4JYBA 5AVSB 5AW5B 4C7NB 3M9BA 1SP4A 4XE5B 1X8YA 3NXSA 5AW1B 3I5CA 1FOSE 1CSBA 5AVUB 5AW9B 1S9KE 3A2AA 5AVWB 2W27A 1NWQA 2WWWA 1JUNA 4JYCA 3V5BA 4KHXA 3HE5B 3VN0A 1J2JB 3L37A 4DZOA 1GZLA 3HE5A 2C9LY 2P67A 2Q5UA 3KDPB 3V4WA 4I6MC 5AVRB 2P2UA 3M06A 5AVYB 3B8EB 1MFZA 5AW2B 3TNUA 5AW3B 1S9KD 4M3LA 3A7OA 1MUUA 3L35A 3OAKA 3MD0A 1NAFA 5AW8B 3NTNA 3P8MC 2P7JA 2R5BA 3VMXA 5APYA 4GKGA 1OXZA 1FOSF 2W6AA 4I2LC 2H7HA 1FAVA 5APVA 4C46A 1IO4A 4B86A 2Q7CA 1GTWA 3M0AA 5AVXB 1G2CB 3HE4A 3SWFA 1H8AA 3NFQA 3M9HA 3LIDA 1HWTC 2E43A 2WT7B 2YO2A 3TYYA 3P7KA 1MV8A 3VMYA 2WT7A 5APTA 3P32A 4RESB 2E42A 3T97A 5AW4B 3TNUB 5AW0B 4HYTB 2R32A 1GK6A 2KP8A 1SLQA 3KQGA 3A3YB 3VYIA 3VTPC 2XU6A 4AQRD 3A5TA 1HJBA 1KQLA 2R5DA 2YNYA 5CMZA 5APSA 3UIAA 1CZQA
chains in the Genus database with same CATH superfamily
4DOJA 1YITP 1WMKA 3RL0D 1A02F 3OW2O 4OGQD 2IPPA 4EOTA 3AEAC 2YMYA 1LGHB 1SQBJ 1OVRA 2ZAEB 3OJAB 1HF9A 1DEEG 1MZ9A 1FZGA 2M3EA 1GU4A 2K37A 3D6ZA 5APUA 1SVFA 2JJLA 3CCQP 3HTKB 1SFCB 2E5TA 1SQPK 3AEBC 2O3JA 3O8ZA 3BVHA 5B5EE 2ZT9C 1QEXA 1DX7A 3U1AA 3EFFK 3H1IG 5KJ7A 1S4XA 3A0HH 1M90Q 4DJGA 1BE3D 1OZHA 2FYUJ 4OWFA 2V7QH 3H1HD 2RMZA 1OW8A 3OAKA 2WSFH 1IFMA 1L4AC 1BE3G 1JY3N 2B88A 2KZJA 3H1HG 2PFXA 1W2BO 2KZIA 3RL0g 4B86A 2M8RA 1BDDA 2Y9YA 2K1AA 5CCGC 4YTPC 1AA0A 2QIWA 2IZ0A 1N86A 5CCGA 3SWKA 2WITA 2V7QJ 2H88C 1Q81Q 1RF0A 3CCVP 2YNYA 1JY2N 2B87B 1RE3C 1GU5A 1ZR2A 4PJ0H 3PTZA 2KLVA 5CCHA 1JM0A 1LTJC 2FXOA 1PGPA 2YKOA 4W7ZA 3CX5E 4H0LC 3I56P 2OQQA 1NKZB 1GL2D 4ZMDA 3AE8C 1JTHB 4LC1A 1VQMP 1H0TB 2IBZI 4GOEA 1L4AB 2IYPA 5AW9B 3JSVC 1VQ7P 2Q9IA 2Y0EA 2FXPA 2WSCH 4DZOA 1YQ3C 2N1TC 1X9VA 3JCUH 1KILC 2OYOA 5AW3B 3AECC 3L71J 3MUDA 1QVGO 4PV1C 2KIKA 1G2CB 1KFNA 1HWTC 1SQQJ 3MHVA 5B66E 3R2PA 2R3SA 2WSCJ 2GM4A 1ZOYC 1HGVA 2JO1A 2L91A 4AQRD 1DIPA 2M5AB 3L74J 2J58A 2R5DA 1ZP0C 1CZQA 3BASA 3B5ND 4H0LB 4WY4D 2WZ7A 1ZRTD 2MJZA 1HGZA 1URQA 1M1KQ 2E75B 1SQBE 2CK3H 2OYIC 1YIJP 3AE2C 3WUUA 3F5HA 4Z1MH 4GDOA 1QLED 4JBZA 3B71A 2Z5HA 1NYHA 2A45H 1PIXA 3CX5D 3L73D 2N1TB 1KILB 3QH9A 2OTJP 2WPRA 2Y0CA 1SP4A 3GHGA 5AW1B 1WRGA 3CCMP 1Q2NA 3L73G 3H1KD 3AE6C 2O1KA 3AEFC 5L8RJ 1VPCA 4KHXA 1J2JB 2FYUE 3CLQA 3H1KG 2ZYGA 1MFZA 3II6A 3RK2D 1UIIA 1QL1A 2ITAA 3L75J 1LWUC 4GKGA 1EDJA 3H1HJ 2W90A 3CXHI 1FZEA 3A0HE 2E43A 1FU1A 4IFMA 5APTA 2QRXA 2R44A 5AW4B 3A5TA 3H1LD 1HTLC 2ZXXA 4NPFX 2NPSB 3RL0B 4OGQB 4ZKUA 1JMMA 2BASA 4AYCA 2WSEJ 3H1LG 2D2CD 1ZMEC 2UWJE 3M91A 3GW6A 3HRNA 5KLVJ 1RF1C 2YO3A 3MGNA 1KQSO 1T2KD 1ZV8A 3KZIH 3CCUP 1SQBD 5AVZB 1RY3A 2K9JA 4PJ0E 1SQBG 3M9QA 5B5EH 4JYBA 5CHXA 4L76A 4C7NB 2FFDC 1YBKA 1GL2C 1CSBA 4GODA 1LWUB 2XKMA 5KJ7D 5K5GB 1LTIC 3HE5B 3AE3C 3CC4P 2Q5UA 2YKQA 5AW2B 3A7OA 1JO5A 1HVVA 2FXMA 2FYUD 1FOSF 3Q5PA 3AEEC 5APVA 2BCCJ 2QJPC 1BGYE 1JY2O 4D6TJ 1SQQE 1T3UA 2FYUG 2OTKE 3WUVA 3P32A 2PRRA 2Y9ZA 1VQ4P 3JCUE 5CCGD 3L74E 1RF1B 4XA4A 1YTZI 3EQ2A 2FBWC 3HE4B 3D6YA 3FGAD 3C8VA 4H13D 3L70J 5BU5A 2QA4P 5CCHD 3CWBE 1JMBA 1CI6B 3D71A 1DH3A 2W83C 5KKZB 1SQVK 4WY4C 1GL2B 2HODA 2O01H 2QM8A 1IFIA 1RE4C 1KMIZ 3Q3DA 1YJNP 1N73C 1J1EB 1L0NK 2QEXP 1LJ2A 3KYQA 4RJTA 3EFGA 2FYNB 2PAJA 2WWWA 2K3RA 1M7LA 2O01J 1R5SA 2M3BA 1G1JA 1R8EA 1USDA 2NZ2A 4RKUJ 5AW8B 1N2DC 3L75E 4HH2A 1YQ4C 3O6QB 3H6PA 1NU1J 3M0AA 4PV1D 2YO2A 3TYYA 4L74A 1PP9J 3L71G 1LTSC 1S3JA 1T3JA 3LW5H 1BGYD 3V2PA 1OX3A 2OYHC 1SQQD 1KQFB 3RBXA 3B5NB 2G3AA 4WY4B 3VMAA 1OWAA 4N6JA 3HD7A 1SQQG 3L74D 1OVVA 4AUWA 2K88A 1X22A 5AW6B 1LT9B 2H8PD 2QG4A 4BXLA 3L74G 2KYVA 3LW5J 1FJKA 1FS0E 2D2CC 3CPWO 1IFJA 3TSIA 3ITKA 1EQ7A 3SSUA 1T2KC 3HUSB 2XDJA 1VQ9P 3CL3D 3A0BE 1NTKK 3KZIE 1Q86Q 1S5LX 3R4YA 3RK2B 1MUUA 1NAYA 5KJ7C 2OYHB 2BCCE 1PZQA 2Q7CA 4D6TE 1AVOA 2HLOA 1NKNA 3L75D 2A45G 2PGDA 3BRTB 1DD3A 1UIXA 4U3FJ 3KQGA 3VTPC 2WSSH 4Y99B 1EZVE 3L75G 3KXDA 3VMZA 4W80A 1NGMB 2D2CB 3PLNA 3GF7A 2ZFCA 3L70E 1JTHA 2E74C 2HPCB 1FJPA 1E5WA 1RF0C 3MIWA 1IK9A 5GTHH 1H0TA 1FE6A 1U7JA 5TISH 2FY8A 3BRVB 1E79H 2WSFJ 1PPJD 2E5YA 2YXQB 1H89A 4H13C 5KLVD 1AFOA 1MFTA 3M0DA 2QJYC 4N78E 5CCHC 1PPJG 3E1RA 5KLVG 5CBOA 3M9BA 4XE5B 1LTAC 2ZT9B 1DD4A 1S9KE 2AEJA 5AVWB 2W27A 3TGUJ 1EDKA 1FZCA 1NJIQ 1G2CA 3IFMA 4I6MC 3RK3E 2P1JA 3B8EB 2HFED 1PL5A 1NTZJ 1YTZT 2OARA 2M5AA 3VMXA 3H25A 1KORA 1Y47A 1NU1E 3CCJP 4C46A 2IYOA 1KB9H 2J59M 1PP9E 2E42A 3G71P 3TNUB 4HYTB 2R32A 3MUDC 2BCCD 2IZ1A 4D6TD 1S5LH 1Y8AA 4JF7A 1RQUA 2BCCG 3GF3A 1YJWP 1A02J 4D6TG 2WPSA 1BGYJ 3CCLP 3CCRP 4IFDK 1EZVD 5APXA 1LTJB 1EZVG 1H88A 3L70D 2QM7A 2YKPA 2JP3A 2C9NY 1URQC 5GTIH 2CPSA 4IOIH 2A45I 2WQYC 3L70G 1K8AQ 4LLHA 2QE7H 2GA1A 1ZXGA 1FDIA 5CJ4A 3CMAP 3CWBJ 1FOSE 5DJUB 4N78D 3AE4C 4BRYA 1EC5A 1JUNA 3VN0A 3TDKA 2H43A 2AEMA 2MKVA 3H32A 1S9KD 2HG5D 3GHGC 2LXBA 5KLIC 3L35A 4EYYQ 3NTNA 3E7KA 2NPSA 4IL6X 3RK3D 4I2LC 4PV1B 1NO4A 2NRGA 1H8AA 5AVXB 1L0LE 1AV1A 5AW0B 1NU1D 1IJDB 4U3FE 2RKLA 2W6JH 1USEA 4K35A 2YIUC 1NU1G 4PD4H 1OFCX 1PP9D 1SQVE 4MN4C 3CI9A 3U1CA 3HD7D 3AEDC 4TLFA 3WUTA 1HUCA 1PP9G 1YYCA 3S1KA 2XZRA 1NTME 3L72E 4C7NA 2OYIB 4WBAA 2JDIH 1D7MA 4EDFA 3H1JJ 3RBZA 3AE9C 2HYNA 3VOPA 1N8RQ 3ABVC 3TF5A 4HB1A 1MKMA 3A0BH 3NXSA 1PFIA 2C0WA 1GW4A 5GTHE 2KS1B 1L2PA 5DJTB 5TISE 3TGUE 3CXHH 4JYCA 2P67A 2QJKC 2LXCB 3M06A 3Q2YA 1N7SA 1NTZE 3BCCJ 1LP1B 1EZVI 1OXZA 2A06E 2KUBA 4R4MA 2ZVNB 1RQVA 1JY3O 3HE4A 1FZFA 2I1JA 1SQXE 2WT7A 5E79H 1KFMA 1VF5D 1M1JA 3W67A 3G4SP 1L0LD 2I1KA 1YJ9P 5KTBA 5APSA 3FX0A 1K73Q 3CC7P 4U3FD 1SQBK 1KB9E 1LTBC 4IL6H 1KC8Q 1IZNB 3NMDA 1KYOH 4H44C 4U3FG 2E74D 3CX5I 3PJSK 2BEQD 1ZLLA 2C0XA 3CMEP 2E76D 1S5LE 2Y0DA 1NTMD 1VQPP 5KAFH 1VQ6P 2QJKB 4IFFA 2Z5IA 1SQPE 4YPCA 5AVSB 5CBNA 2FFDB 2L5GB 2FYUK 2Q6QA 4WVZA 1P84H 1PGJA 3L37A 4EIJA 5GTIE 5EFWB 3V4WA 4KJMA 2W6BA 5AVRB 1JCDA 2B9BA 4UB8H 3TGUD 1WT6A 2K9YA 1IK7A 5APYA 1JB0J 1S72P 4U7JA 3B5NA 4QMAA 3TGUG 4GOFA 3SWFA 1NTZD 2QJPB 1M57D 2A06D 1NTZG 1LT9A 1VQ8P 1HJBA 1KQLA 2YMKA 3RK3C 3P8CE 1S2EA 3H1IE 4GIFA 1SQXD 3IF4A 1IC2A 2A06G 4R4LA 3IN6A 3CC2P 3V4QA 1Z56A 3PRJA 2O01N 4GT1A 1RH5B 2JR8A 3ZDMA 3HUSA 1SS1A 1OW7A 1KB9D 3IR9A 3AE1C 1GD2E 2HODB 3V2NA 3HD7C 3H1JE 4PD4E 4Y28J 3FXEA 1BGYG 2Z4EA 1URQD 3C1LA 3HTKA 5AVQB 1SFCA 1BDCA 3D70A 1N73B 2IDBA 1VQNP 3JC22 5AVUB 3A2AA 1K05A 4L73A 2Q1KA 1Q7YQ 3V5BA 1SQPD 1FZAA 3CWBD 1VQOP 1Q90D 2IX7C 3BCCE 1ZR4A 3S4RA 2P7JA 2R5BA 1LNQA 3BATA 3CWBG 3RK3B 3L4FA 1SQQK 1IO4A 1AQ5A 1GTWA 1KZUB 1HJ0A 3CXHE 2QVAA 1NVOA 2HPCA 1VQKP 2RH0A 2KNCB 4RO0A 1X0TA 3Q5SA 3C9IA 1AQTA 3HD7B 2B87A 3PH0A 4ZNCA 4UB6H 2LR2A 1L0LJ 3LIEA 1QVFO 1VF5C 4JPZB 3P8CD 1S1CX 3T97B 2R3CA 3H1ID 1VQLP 1M56D 2AXTH 2JKVA 1EXIA 5APQA 3FWNA 1FZBA 4XFJA 5E79E 2ZYAA 1BSNA 5KAIH 3KPEA 5AVTB 2WMMA 1LTTC 1GW3A 1SQVJ 3G6EP 1JNMA 5APWA 2SPZA 1KV4A 4HKZH 3OA7A 1EDLA 4IL6E 3Q1MA 2XV5A 5BU8B 3W68A 1KYOE 3H1JD 4LGDE 4PD4D 2E76C 1NTMJ 1X8YA 3L72J 3Q5RA 1L0NJ 1L4AA 3M0DC 3IAOA 3H1JG 1FC2C 1XTCC 1GZLA 2P2UA 2XNDH 4OH8B 5KAFE 3TNUA 2KLUA 1Q82Q 1FDOA 1ZRTE 2O1JA 1IFPA 2RN0A 1N7SD 1JCCA 1U57A 2GUSA 3CD6P 1QGKB 1FZCC 1KB9I 3NFQA 3M9HA 3BCCD 3V2QA 1MV8A 1RE3A 1P84E 2B89A 1VF5B 2FKWB 1GK6A 2KP8A 2AEFA 4NPDA 3A3YB 3VYIA 2KB7P 3BCCG 3WMM0 3U59A 4UB8E 1LTJA 2FYZA 3L73E 2KI7B 3CXHD 2M0BA 4EI2A 3PP5A 2E75C 4WWIA 5KLVK 3H1KE 1QL2A 1SQXJ 1EXJA 1Y9BA 2E74B 2OTLP 1RHZB 1BCCJ 1OVUA 2KK7A 4H44D 2E76B 3GG2A 2V4HA 3V2RA 2JWAA 2KSEA 3N4XA 4H13B 1J1DC 2PP6A 4JQ0D 2QJYB 1VQ5P 1JOCA 1GK4A 2N1TA 1KILA 3WU2H 1W5CE 4KT0J 3I5CA 1CW5A 2KOGA 1ZW0A 5TJHA 4K3AA 2JWDA 1FZCB 3H1LE 1NWQA 1TU3F 5H2FH 1KYOD 1NTKJ 5CJ0A 1U7MA 4HJGH 3P8MC 1SQPJ 1R5LA 3G9RA 2W6AA 3E1IA 1FAVA 1T8ZA 3LIDA 5BVZA 4CPGA 3N7NA 3EWKA 3F89A 2NPSC 2AXCA 4A7PA 2OYIA 3SFDC 3RL0C 4OGQC 1P84D 2KXPB 4PD4I 2POHA 3SFEC 2VRSA 2Q3IA 1KTMA 1LT1A 1J1DB 1DEBA 4C7RA 5AVVB 1IFNA 3G3ZA 2KS1A 3H1IJ 2OGUA 4ASWA 3B4SA 3L36A 4YXDC 1URQB 4OVNF 4UB6E 1X79B 1NH4A 1SFCD 2AXTE 3K5BA 1BE3J 1LP1A 1L0NE 3USSA 2WSEH 5KAIE 4BRYB 1LWUA 3HE5A 3SWYA 4I7ZC 2H89C 1XTGB 3H32B 3AE7C 1HH0A 5M1BA 2IFMA 1NAFA 3GHGB 1NU1K 5KLIB 1M8OB 4O9BA 2I8DA 1FBMA 2ZJSE 2IFNA 3P7KA 3VMYA 1N7LA 1N7SC 4RESB 1RF1A 1IFDA 4TT3H 2LKMA 4W7YA 1KN7A 1LTGC 2YIUB 1AVYA 1M1JC 1KYOI 1BCCE 2HR3A 5KKZC 3AE5C 1OIPA 1CI6A 1PGOA 2FFDA 2ZT9D 1KILE 1GL2A 1HBWA 2GUVA 2N9BA 4NPEA 1L0LG 1J1EC 1OMIA 4I7ZB 1ZN5A 3L71E 4YXWH 5AW5B 1SQVD 1K9MQ 2FYNC 1L4AD 4DCKA 2CPBA 2WVRA 2QSIA 1SQVG 2K9JB 3FWLA 1NTKE 3MP7B 1P84I 1KQGB 3QWOC 3L72D 1L0ND 5AVYB 3CCEP 1N7SB 4M3LA 1YHQP 4L75A 3MD0A 3VP9A 2ZVOB 1NTMG 2IBZE 3L72G 3WU2E 1L0NG 2XNXA 5C39A 3O6QA 1L0LK 2ZYDA 2W8ZA 1W2EA 5H2FE 2WT7B 3V6IA 3GLMA 3CCSP 1PV3A 1M1JB 2KSJA 2XU6A 3CX5H 1EDIA 1YI2P 3B5NC 4N3YB 3VP8A 3GMAA 5AW7B 2DW3A 4WY4A 4I1LA 4H0LD 3I55P 1RE4A 1LT9C 1NTMK 2E75D 4DT0A 1NOHA 1N73A 2Q3EA 4H44B 2WTYA 1JY3P 2P58A 1OW6A 2ZXEB 4ASVA 3L73J 2BEZF 3TK1A 3RGUA 2WPQA 1GMJA 1BCCD 1BSHA 1SQXG 3H1KJ 3HUSC 2N1TD 4WB4A 1KILD 1BE3E 1BCCG 4ZKPA 1FDMA 1K04A 1JY2P 3H1HE 1KD1Q 1QX8A 3L71D 3PHLA 5B66H 2JEEA 1VDFA 2C9LY 1SFCC 3RK2C 3KDPB 1AJYA 1NTZK 1JEKA 3FXDA 2YXRB 2KNCA 2WPVB 3MZWB 1NTKD 3S9OA 2OYHA 2H7HA 3AEGC 3KHUA 1SQXK 3H1LJ 1NTKG 1G1IA 1PPJE 1PGQA 2G8YA 2IBZD 1T6AA 5KLVE 3T97A 1VL2A 1GDTA 1SLQA 2J5UA 4Y99C 2N9YB 4BWNA 1NHLA 3MTUE 1SQPG 2P10A 2IBZG 2NPSD 3UIAA 5CMZA
chains in the Genus database with same CATH topology
4DOJA 3RL0D 3EQ2A 1A02F 3HE4B 3CI9A 3U1CA 3PP5A 2IPPA 4EOTA 3HD7D 5KLVK 2YMYA 1HUCA 1QL2A 1LGHB 5BU5A 5CCHD 1YYCA 2XZRA 4C7NA 3OJAB 2OYIB 1CI6B 4WBAA 1DH3A 1MZ9A 1SQVK 4WY4C 3V2RA 1GL2B 1FZGA 2HODA 2O01H 1GU4A 2QM8A 5APUA 1SVFA 1IFIA 1RE4C 2JJLA 3N4XA 1J1DC 2PP6A 3HTKB 1SFCB 1SQPK 2HYNA 1JOCA 3VOPA 1J1EB 1N73C 3O8ZA 1GK4A 2N1TA 1KILA 3BVHA 1L0NK 3KYQA 3NXSA 1PFIA 1DX7A 3I5CA 2C0WA 1GW4A 1CW5A 2KOGA 3U1AA 3EFGA 5KJ7A 1FZCB 1NWQA 2PAJA 2WWWA 4JYCA 1M7LA 2P67A 5CJ0A 3M06A 2M3BA 1G1JA 1N7SA 3OAKA 2WSFH 1IFMA 1L4AC 5AW8B 3P8MC 1JY3N 1N2DC 4HH2A 1OXZA 3H6PA 2W6AA 3E1IA 1FAVA 1JY3O 4B86A 2M8RA 1T8ZA 3M0AA 3HE4A 1FZFA 3LIDA 5BVZA 2I1JA 2YO2A 3TYYA 5CCGC 2WT7A 3N7NA 1KFMA 1N86A 1LTSC 1M1JA 5CCGA 1T3JA 2NPSC 3LW5H 2WITA 3V2PA 1RF0A 2OYIA 2OYHC 3RL0C 2I1KA 2YNYA 3B5NB 5APSA 5KTBA 1JY2N 4WY4B 2POHA 1OWAA 4N6JA 1RE3C 3HD7A 1SQBK 1GU5A 1ZR2A 2VRSA 2Q3IA 1LTBC 1J1DB 3NMDA 4AUWA 2KLVA 5CCHA 1LTJC 1DEBA 5AW6B 1LT9B 5AVVB 4C7RA 2H8PD 1IFNA 2KYVA 2YKOA 4W7ZA 1ZLLA 3G3ZA 1FJKA 2C0XA 1NKZB 1GL2D 1IFJA 3L36A 1URQB 1JTHB 3TSIA 4LC1A 1EQ7A 1X79B 1NH4A 4IFFA 1SFCD 1T2KC 2Z5IA 5AVSB 3HUSB 2XDJA 1L4AB 3CL3D 2WSEH 5AW9B 2FFDB 2L5GB 1LWUA 1NTKK 2FYUK 2Q9IA 2WSCH 3L37A 4DZOA 3HE5A 3SWYA 4EIJA 3V4WA 2N1TC 2W6BA 1X9VA 5AVRB 1KILC 1XTGB 3H32B 3RK2B 1JCDA 1HH0A 5AW3B 2IFMA 1MUUA 1NAFA 1WT6A 3GHGB 1NU1K 3MUDA 5KJ7C 4O9BA 5APYA 2OYHB 1FBMA 3B5NA 2Q7CA 1G2CB 3SWFA 1KFNA 2HLOA 1HWTC 2IFNA 1NKNA 3R2PA 3P7KA 3VMYA 1N7LA 1N7SC 4RESB 2GM4A 2A45G 1HGVA 3BRTB 3KQGA 3VTPC 4AQRD 1LT9A 1HJBA 1KQLA 4Y99B 1RF1A 3RK3C 2J58A 2R5DA 3P8CE 1IFDA 4GIFA 2LKMA 1CZQA 3BASA 1IC2A 4W7YA 3VMZA 3B5ND 4W80A 1LTGC 4WY4D 2WZ7A 2MJZA 2ZFCA 3V4QA 1HGZA 1URQA 1Z56A 1JTHA 1M1JC 2HPCB 4GT1A 1FJPA 1E5WA 1RF0C 2OYIC 3MIWA 1IK9A 3HUSA 1CI6A 3IR9A 3BRVB 2FFDA 1GD2E 2HODB 3V2NA 3HD7C 1GL2A 1H89A 1HBWA 1AFOA 2GUVA 2N9BA 3M0DA 2Z5HA 2A45H 4N78E 5CCHC 1J1EC 1ZN5A 2Z4EA 1URQD 3HTKA 5AVQB 2N1TB 1SFCA 1KILB 2WPRA 1N73B 5AW5B 3M9BA 3GHGA 1SP4A 4XE5B 5AW1B 1WRGA 1LTAC 5AVUB 1L4AD 1S9KE 2CPBA 3A2AA 5AVWB 2W27A 2O1KA 1FZCA 3V5BA 1VPCA 4KHXA 1G2CA 1J2JB 3CLQA 3IFMA 1FZAA 4I6MC 2P1JA 5AVYB 3B8EB 1MFZA 1N7SB 2HFED 3II6A 4M3LA 2IX7C 3RK2D 3MD0A 1YTZT 1ZR4A 3VP9A 2OARA 2P7JA 2R5BA 1QL1A 3VMXA 3BATA 1LWUC 2XNXA 3RK3B 4GKGA 3L4FA 1L0LK 1SQQK 4C46A 1IO4A 1W2EA 1AQ5A 1GTWA 1KZUB 1FZEA 2J59M 2E43A 2WT7B 1FU1A 4IFMA 5APTA 2E42A 5AW4B 3TNUB 4HYTB 2HPCA 1M1JB 2R32A 2KSJA 2XU6A 3A5TA 3B5NC 1HTLC 2NPSB 4N3YB 3VP8A 4JF7A 3C9IA 3RL0B 5AW7B 4ZKUA 4WY4A 1JMMA 2BASA 4AYCA 3HD7B 1A02J 4I1LA 2WPSA 3M91A 3LIEA 4IFDK 1RE4A 3P8CD 2R3CA 1LT9C 1NTMK 5APXA 3HRNA 5APQA 1RF1C 1NOHA 2YO3A 3MGNA 1FZBA 1N73A 2WTYA 1JY3P 1LTJB 2ZXEB 1T2KD 3KPEA 1H88A 1ZV8A 2QM7A 2YKPA 3TK1A 5AVTB 2WPQA 1LTTC 5AVZB 1GW3A 2C9NY 1RY3A 1URQC 1JNMA 5APWA 2CPSA 3OA7A 2A45I 4LLHA 3M9QA 2XV5A 3HUSC 5BU8B 2N1TD 4WB4A 1KILD 4JYBA 5CHXA 4LGDE 4C7NB 5CJ4A 2FFDC 1X8YA 1FOSE 1L4AA 1GL2C 4ZKPA 1CSBA 1FDMA 4N78D 1JY2P 1LWUB 3M0DC 2XKMA 5KJ7D 1LTIC 1XTCC 1JUNA 3HE5B 3VN0A 1GZLA 2JEEA 1VDFA 2C9LY 1SFCC 2Q5UA 3RK2C 2YKQA 3KDPB 2P2UA 2H43A 1NTZK 5AW2B 4OH8B 3H32A 3TNUA 1S9KD 2HG5D 2O1JA 3GHGC 3A7OA 1JO5A 3L35A 1N7SD 1HVVA 1JCCA 2FXMA 3NTNA 2NPSA 2GUSA 1FOSF 1FZCC 2OYHA 3RK3D 4I2LC 2H7HA 5APVA 1SQXK 1NO4A 5AVXB 1H8AA 3NFQA 1JY2O 3M9HA 3V2QA 1G1IA 1T3UA 1MV8A 1RE3A 3P32A 3T97A 2FKWB 5AW0B 1IJDB 1GDTA 1GK6A 2KP8A 1SLQA 4Y99C 3A3YB 3VYIA 5CCGD 2KB7P 1NHLA 3WMM0 3MTUE 3U59A 1RF1B 1LTJA 4XA4A 2FYZA 1YTZI 2NPSD 3UIAA 5CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMZ A;  5AW7 B;  1OWA A;  2BAS A;  1A02 F;  3HE4 B;  4AYC A;  1A02 J;  2IPP A;  2WPS A;  4EOT A;  1GU5 A;  3M91 A;  2VRS A;  2ZFC A;  3LIE A;  2Q3I A;  3V4Q A;  1HUC A;  3NMD A;  2R3C A;  4AUW A;  4GT1 A;  5APX A;  5APQ A;  1YYC A;  2YO3 A;  2XZR A;  3MGN A;  5AVV B;  5AW6 B;  2WTY A;  4C7N A;  1CI6 B;  2ZXE B;  1T2K D;  1DH3 A;  1CI6 A;  3IR9 A;  1H88 A;  2QM7 A;  1GD2 E;  3TK1 A;  5AVT B;  2WPQ A;  1H89 A;  1HBW A;  5AVZ B;  1GU4 A;  2N9B A;  2QM8 A;  2C9N Y;  5APU A;  3M0D A;  1JNM A;  3L36 A;  2JJL A;  5APW A;  2Z5H A;  4LC1 A;  5AVQ B;  3HTK A;  3O8Z A;  1T2K C;  1GK4 A;  2Z5I A;  2XV5 A;  2WPR A;  4JYB A;  5AVS B;  5AW5 B;  4C7N B;  3M9B A;  1SP4 A;  4XE5 B;  1X8Y A;  3NXS A;  5AW1 B;  3I5C A;  1FOS E;  1CSB A;  5AVU B;  5AW9 B;  1S9K E;  3A2A A;  5AVW B;  2W27 A;  1NWQ A;  2WWW A;  1JUN A;  4JYC A;  3V5B A;  4KHX A;  3HE5 B;  3VN0 A;  1J2J B;  3L37 A;  4DZO A;  1GZL A;  3HE5 A;  2C9L Y;  2P67 A;  2Q5U A;  3KDP B;  3V4W A;  4I6M C;  5AVR B;  2P2U A;  3M06 A;  5AVY B;  3B8E B;  1MFZ A;  5AW2 B;  3TNU A;  5AW3 B;  1S9K D;  4M3L A;  3A7O A;  1MUU A;  3L35 A;  3OAK A;  3MD0 A;  1NAF A;  5AW8 B;  3NTN A;  3P8M C;  2P7J A;  2R5B A;  3VMX A;  5APY A;  4GKG A;  1OXZ A;  1FOS F;  2W6A A;  4I2L C;  2H7H A;  1FAV A;  5APV A;  4C46 A;  1IO4 A;  4B86 A;  2Q7C A;  1GTW A;  3M0A A;  5AVX B;  1G2C B;  3HE4 A;  3SWF A;  1H8A A;  3NFQ A;  3M9H A;  3LID A;  1HWT C;  2E43 A;  2WT7 B;  2YO2 A;  3TYY A;  3P7K A;  1MV8 A;  3VMY A;  2WT7 A;  5APT A;  3P32 A;  4RES B;  2E42 A;  3T97 A;  5AW4 B;  3TNU B;  5AW0 B;  4HYT B;  2R32 A;  1GK6 A;  2KP8 A;  1SLQ A;  3KQG A;  3A3Y B;  3VYI A;  3VTP C;  2XU6 A;  4AQR D;  3A5T A;  1HJB A;  1KQL A;  2R5D A;  2YNY A;  5CMZ A;  5APS A;  3UIA A;  1CZQ A; 
#chains in the Genus database with same CATH topology
 4DOJ A;  1YIT P;  1WMK A;  3RL0 D;  1A02 F;  3OW2 O;  4OGQ D;  2IPP A;  4EOT A;  3AEA C;  2YMY A;  1LGH B;  1SQB J;  1OVR A;  2ZAE B;  3OJA B;  1HF9 A;  1DEE G;  1MZ9 A;  1FZG A;  2M3E A;  1GU4 A;  2K37 A;  3D6Z A;  5APU A;  1SVF A;  2JJL A;  3CCQ P;  3HTK B;  1SFC B;  2E5T A;  1SQP K;  3AEB C;  2O3J A;  3O8Z A;  3BVH A;  5B5E E;  2ZT9 C;  1QEX A;  1DX7 A;  3U1A A;  3EFF K;  3H1I G;  5KJ7 A;  1S4X A;  3A0H H;  1M90 Q;  4DJG A;  1BE3 D;  1OZH A;  2FYU J;  4OWF A;  2V7Q H;  3H1H D;  2RMZ A;  1OW8 A;  3OAK A;  2WSF H;  1IFM A;  1L4A C;  1BE3 G;  1JY3 N;  2B88 A;  2KZJ A;  3H1H G;  2PFX A;  1W2B O;  2KZI A;  3RL0 g;  4B86 A;  2M8R A;  1BDD A;  2Y9Y A;  2K1A A;  5CCG C;  4YTP C;  1AA0 A;  2QIW A;  2IZ0 A;  1N86 A;  5CCG A;  3SWK A;  2WIT A;  2V7Q J;  2H88 C;  1Q81 Q;  1RF0 A;  3CCV P;  2YNY A;  1JY2 N;  2B87 B;  1RE3 C;  1GU5 A;  1ZR2 A;  4PJ0 H;  3PTZ A;  2KLV A;  5CCH A;  1JM0 A;  1LTJ C;  2FXO A;  1PGP A;  2YKO A;  4W7Z A;  3CX5 E;  4H0L C;  3I56 P;  2OQQ A;  1NKZ B;  1GL2 D;  4ZMD A;  3AE8 C;  1JTH B;  4LC1 A;  1VQM P;  1H0T B;  2IBZ I;  4GOE A;  1L4A B;  2IYP A;  5AW9 B;  3JSV C;  1VQ7 P;  2Q9I A;  2Y0E A;  2FXP A;  2WSC H;  4DZO A;  1YQ3 C;  2N1T C;  1X9V A;  3JCU H;  1KIL C;  2OYO A;  5AW3 B;  3AEC C;  3L71 J;  3MUD A;  1QVG O;  4PV1 C;  2KIK A;  1G2C B;  1KFN A;  1HWT C;  1SQQ J;  3MHV A;  5B66 E;  3R2P A;  2R3S A;  2WSC J;  2GM4 A;  1ZOY C;  1HGV A;  2JO1 A;  2L91 A;  4AQR D;  1DIP A;  2M5A B;  3L74 J;  2J58 A;  2R5D A;  1ZP0 C;  1CZQ A;  3BAS A;  3B5N D;  4H0L B;  4WY4 D;  2WZ7 A;  1ZRT D;  2MJZ A;  1HGZ A;  1URQ A;  1M1K Q;  2E75 B;  1SQB E;  2CK3 H;  2OYI C;  1YIJ P;  3AE2 C;  3WUU A;  3F5H A;  4Z1M H;  4GDO A;  1QLE D;  4JBZ A;  3B71 A;  2Z5H A;  1NYH A;  2A45 H;  1PIX A;  3CX5 D;  3L73 D;  2N1T B;  1KIL B;  3QH9 A;  2OTJ P;  2WPR A;  2Y0C A;  1SP4 A;  3GHG A;  5AW1 B;  1WRG A;  3CCM P;  1Q2N A;  3L73 G;  3H1K D;  3AE6 C;  2O1K A;  3AEF C;  5L8R J;  1VPC A;  4KHX A;  1J2J B;  2FYU E;  3CLQ A;  3H1K G;  2ZYG A;  1MFZ A;  3II6 A;  3RK2 D;  1UII A;  1QL1 A;  2ITA A;  3L75 J;  1LWU C;  4GKG A;  1EDJ A;  3H1H J;  2W90 A;  3CXH I;  1FZE A;  3A0H E;  2E43 A;  1FU1 A;  4IFM A;  5APT A;  2QRX A;  2R44 A;  5AW4 B;  3A5T A;  3H1L D;  1HTL C;  2ZXX A;  4NPF X;  2NPS B;  3RL0 B;  4OGQ B;  4ZKU A;  1JMM A;  2BAS A;  4AYC A;  2WSE J;  3H1L G;  2D2C D;  1ZME C;  2UWJ E;  3M91 A;  3GW6 A;  3HRN A;  5KLV J;  1RF1 C;  2YO3 A;  3MGN A;  1KQS O;  1T2K D;  1ZV8 A;  3KZI H;  3CCU P;  1SQB D;  5AVZ B;  1RY3 A;  2K9J A;  4PJ0 E;  1SQB G;  3M9Q A;  5B5E H;  4JYB A;  5CHX A;  4L76 A;  4C7N B;  2FFD C;  1YBK A;  1GL2 C;  1CSB A;  4GOD A;  1LWU B;  2XKM A;  5KJ7 D;  5K5G B;  1LTI C;  3HE5 B;  3AE3 C;  3CC4 P;  2Q5U A;  2YKQ A;  5AW2 B;  3A7O A;  1JO5 A;  1HVV A;  2FXM A;  2FYU D;  1FOS F;  3Q5P A;  3AEE C;  5APV A;  2BCC J;  2QJP C;  1BGY E;  1JY2 O;  4D6T J;  1SQQ E;  1T3U A;  2FYU G;  2OTK E;  3WUV A;  3P32 A;  2PRR A;  2Y9Z A;  1VQ4 P;  3JCU E;  5CCG D;  3L74 E;  1RF1 B;  4XA4 A;  1YTZ I;  3EQ2 A;  2FBW C;  3HE4 B;  3D6Y A;  3FGA D;  3C8V A;  4H13 D;  3L70 J;  5BU5 A;  2QA4 P;  5CCH D;  3CWB E;  1JMB A;  1CI6 B;  3D71 A;  1DH3 A;  2W83 C;  5KKZ B;  1SQV K;  4WY4 C;  1GL2 B;  2HOD A;  2O01 H;  2QM8 A;  1IFI A;  1RE4 C;  1KMI Z;  3Q3D A;  1YJN P;  1N73 C;  1J1E B;  1L0N K;  2QEX P;  1LJ2 A;  3KYQ A;  4RJT A;  3EFG A;  2FYN B;  2PAJ A;  2WWW A;  2K3R A;  1M7L A;  2O01 J;  1R5S A;  2M3B A;  1G1J A;  1R8E A;  1USD A;  2NZ2 A;  4RKU J;  5AW8 B;  1N2D C;  3L75 E;  4HH2 A;  1YQ4 C;  3O6Q B;  3H6P A;  1NU1 J;  3M0A A;  4PV1 D;  2YO2 A;  3TYY A;  4L74 A;  1PP9 J;  3L71 G;  1LTS C;  1S3J A;  1T3J A;  3LW5 H;  1BGY D;  3V2P A;  1OX3 A;  2OYH C;  1SQQ D;  1KQF B;  3RBX A;  3B5N B;  2G3A A;  4WY4 B;  3VMA A;  1OWA A;  4N6J A;  3HD7 A;  1SQQ G;  3L74 D;  1OVV A;  4AUW A;  2K88 A;  1X22 A;  5AW6 B;  1LT9 B;  2H8P D;  2QG4 A;  4BXL A;  3L74 G;  2KYV A;  3LW5 J;  1FJK A;  1FS0 E;  2D2C C;  3CPW O;  1IFJ A;  3TSI A;  3ITK A;  1EQ7 A;  3SSU A;  1T2K C;  3HUS B;  2XDJ A;  1VQ9 P;  3CL3 D;  3A0B E;  1NTK K;  3KZI E;  1Q86 Q;  1S5L X;  3R4Y A;  3RK2 B;  1MUU A;  1NAY A;  5KJ7 C;  2OYH B;  2BCC E;  1PZQ A;  2Q7C A;  4D6T E;  1AVO A;  2HLO A;  1NKN A;  3L75 D;  2A45 G;  2PGD A;  3BRT B;  1DD3 A;  1UIX A;  4U3F J;  3KQG A;  3VTP C;  2WSS H;  4Y99 B;  1EZV E;  3L75 G;  3KXD A;  3VMZ A;  4W80 A;  1NGM B;  2D2C B;  3PLN A;  3GF7 A;  2ZFC A;  3L70 E;  1JTH A;  2E74 C;  2HPC B;  1FJP A;  1E5W A;  1RF0 C;  3MIW A;  1IK9 A;  5GTH H;  1H0T A;  1FE6 A;  1U7J A;  5TIS H;  2FY8 A;  3BRV B;  1E79 H;  2WSF J;  1PPJ D;  2E5Y A;  2YXQ B;  1H89 A;  4H13 C;  5KLV D;  1AFO A;  1MFT A;  3M0D A;  2QJY C;  4N78 E;  5CCH C;  1PPJ G;  3E1R A;  5KLV G;  5CBO A;  3M9B A;  4XE5 B;  1LTA C;  2ZT9 B;  1DD4 A;  1S9K E;  2AEJ A;  5AVW B;  2W27 A;  3TGU J;  1EDK A;  1FZC A;  1NJI Q;  1G2C A;  3IFM A;  4I6M C;  3RK3 E;  2P1J A;  3B8E B;  2HFE D;  1PL5 A;  1NTZ J;  1YTZ T;  2OAR A;  2M5A A;  3VMX A;  3H25 A;  1KOR A;  1Y47 A;  1NU1 E;  3CCJ P;  4C46 A;  2IYO A;  1KB9 H;  2J59 M;  1PP9 E;  2E42 A;  3G71 P;  3TNU B;  4HYT B;  2R32 A;  3MUD C;  2BCC D;  2IZ1 A;  4D6T D;  1S5L H;  1Y8A A;  4JF7 A;  1RQU A;  2BCC G;  3GF3 A;  1YJW P;  1A02 J;  4D6T G;  2WPS A;  1BGY J;  3CCL P;  3CCR P;  4IFD K;  1EZV D;  5APX A;  1LTJ B;  1EZV G;  1H88 A;  3L70 D;  2QM7 A;  2YKP A;  2JP3 A;  2C9N Y;  1URQ C;  5GTI H;  2CPS A;  4IOI H;  2A45 I;  2WQY C;  3L70 G;  1K8A Q;  4LLH A;  2QE7 H;  2GA1 A;  1ZXG A;  1FDI A;  5CJ4 A;  3CMA P;  3CWB J;  1FOS E;  5DJU B;  4N78 D;  3AE4 C;  4BRY A;  1EC5 A;  1JUN A;  3VN0 A;  3TDK A;  2H43 A;  2AEM A;  2MKV A;  3H32 A;  1S9K D;  2HG5 D;  3GHG C;  2LXB A;  5KLI C;  3L35 A;  4EYY Q;  3NTN A;  3E7K A;  2NPS A;  4IL6 X;  3RK3 D;  4I2L C;  4PV1 B;  1NO4 A;  2NRG A;  1H8A A;  5AVX B;  1L0L E;  1AV1 A;  5AW0 B;  1NU1 D;  1IJD B;  4U3F E;  2RKL A;  2W6J H;  1USE A;  4K35 A;  2YIU C;  1NU1 G;  4PD4 H;  1OFC X;  1PP9 D;  1SQV E;  4MN4 C;  3CI9 A;  3U1C A;  3HD7 D;  3AED C;  4TLF A;  3WUT A;  1HUC A;  1PP9 G;  1YYC A;  3S1K A;  2XZR A;  1NTM E;  3L72 E;  4C7N A;  2OYI B;  4WBA A;  2JDI H;  1D7M A;  4EDF A;  3H1J J;  3RBZ A;  3AE9 C;  2HYN A;  3VOP A;  1N8R Q;  3ABV C;  3TF5 A;  4HB1 A;  1MKM A;  3A0B H;  3NXS A;  1PFI A;  2C0W A;  1GW4 A;  5GTH E;  2KS1 B;  1L2P A;  5DJT B;  5TIS E;  3TGU E;  3CXH H;  4JYC A;  2P67 A;  2QJK C;  2LXC B;  3M06 A;  3Q2Y A;  1N7S A;  1NTZ E;  3BCC J;  1LP1 B;  1EZV I;  1OXZ A;  2A06 E;  2KUB A;  4R4M A;  2ZVN B;  1RQV A;  1JY3 O;  3HE4 A;  1FZF A;  2I1J A;  1SQX E;  2WT7 A;  5E79 H;  1KFM A;  1VF5 D;  1M1J A;  3W67 A;  3G4S P;  1L0L D;  2I1K A;  1YJ9 P;  5KTB A;  5APS A;  3FX0 A;  1K73 Q;  3CC7 P;  4U3F D;  1SQB K;  1KB9 E;  1LTB C;  4IL6 H;  1KC8 Q;  1IZN B;  3NMD A;  1KYO H;  4H44 C;  4U3F G;  2E74 D;  3CX5 I;  3PJS K;  2BEQ D;  1ZLL A;  2C0X A;  3CME P;  2E76 D;  1S5L E;  2Y0D A;  1NTM D;  1VQP P;  5KAF H;  1VQ6 P;  2QJK B;  4IFF A;  2Z5I A;  1SQP E;  4YPC A;  5AVS B;  5CBN A;  2FFD B;  2L5G B;  2FYU K;  2Q6Q A;  4WVZ A;  1P84 H;  1PGJ A;  3L37 A;  4EIJ A;  5GTI E;  5EFW B;  3V4W A;  4KJM A;  2W6B A;  5AVR B;  1JCD A;  2B9B A;  4UB8 H;  3TGU D;  1WT6 A;  2K9Y A;  1IK7 A;  5APY A;  1JB0 J;  1S72 P;  4U7J A;  3B5N A;  4QMA A;  3TGU G;  4GOF A;  3SWF A;  1NTZ D;  2QJP B;  1M57 D;  2A06 D;  1NTZ G;  1LT9 A;  1VQ8 P;  1HJB A;  1KQL A;  2YMK A;  3RK3 C;  3P8C E;  1S2E A;  3H1I E;  4GIF A;  1SQX D;  3IF4 A;  1IC2 A;  2A06 G;  4R4L A;  3IN6 A;  3CC2 P;  3V4Q A;  1Z56 A;  3PRJ A;  2O01 N;  4GT1 A;  1RH5 B;  2JR8 A;  3ZDM A;  3HUS A;  1SS1 A;  1OW7 A;  1KB9 D;  3IR9 A;  3AE1 C;  1GD2 E;  2HOD B;  3V2N A;  3HD7 C;  3H1J E;  4PD4 E;  4Y28 J;  3FXE A;  1BGY G;  2Z4E A;  1URQ D;  3C1L A;  3HTK A;  5AVQ B;  1SFC A;  1BDC A;  3D70 A;  1N73 B;  2IDB A;  1VQN P;  3JC2 2;  5AVU B;  3A2A A;  1K05 A;  4L73 A;  2Q1K A;  1Q7Y Q;  3V5B A;  1SQP D;  1FZA A;  3CWB D;  1VQO P;  1Q90 D;  2IX7 C;  3BCC E;  1ZR4 A;  3S4R A;  2P7J A;  2R5B A;  1LNQ A;  3BAT A;  3CWB G;  3RK3 B;  3L4F A;  1SQQ K;  1IO4 A;  1AQ5 A;  1GTW A;  1KZU B;  1HJ0 A;  3CXH E;  2QVA A;  1NVO A;  2HPC A;  1VQK P;  2RH0 A;  2KNC B;  4RO0 A;  1X0T A;  3Q5S A;  3C9I A;  1AQT A;  3HD7 B;  2B87 A;  3PH0 A;  4ZNC A;  4UB6 H;  2LR2 A;  1L0L J;  3LIE A;  1QVF O;  1VF5 C;  4JPZ B;  3P8C D;  1S1C X;  3T97 B;  2R3C A;  3H1I D;  1VQL P;  1M56 D;  2AXT H;  2JKV A;  1EXI A;  5APQ A;  3FWN A;  1FZB A;  4XFJ A;  5E79 E;  2ZYA A;  1BSN A;  5KAI H;  3KPE A;  5AVT B;  2WMM A;  1LTT C;  1GW3 A;  1SQV J;  3G6E P;  1JNM A;  5APW A;  2SPZ A;  1KV4 A;  4HKZ H;  3OA7 A;  1EDL A;  4IL6 E;  3Q1M A;  2XV5 A;  5BU8 B;  3W68 A;  1KYO E;  3H1J D;  4LGD E;  4PD4 D;  2E76 C;  1NTM J;  1X8Y A;  3L72 J;  3Q5R A;  1L0N J;  1L4A A;  3M0D C;  3IAO A;  3H1J G;  1FC2 C;  1XTC C;  1GZL A;  2P2U A;  2XND H;  4OH8 B;  5KAF E;  3TNU A;  2KLU A;  1Q82 Q;  1FDO A;  1ZRT E;  2O1J A;  1IFP A;  2RN0 A;  1N7S D;  1JCC A;  1U57 A;  2GUS A;  3CD6 P;  1QGK B;  1FZC C;  1KB9 I;  3NFQ A;  3M9H A;  3BCC D;  3V2Q A;  1MV8 A;  1RE3 A;  1P84 E;  2B89 A;  1VF5 B;  2FKW B;  1GK6 A;  2KP8 A;  2AEF A;  4NPD A;  3A3Y B;  3VYI A;  2KB7 P;  3BCC G;  3WMM 0;  3U59 A;  4UB8 E;  1LTJ A;  2FYZ A;  3L73 E;  2KI7 B;  3CXH D;  2M0B A;  4EI2 A;  3PP5 A;  2E75 C;  4WWI A;  5KLV K;  3H1K E;  1QL2 A;  1SQX J;  1EXJ A;  1Y9B A;  2E74 B;  2OTL P;  1RHZ B;  1BCC J;  1OVU A;  2KK7 A;  4H44 D;  2E76 B;  3GG2 A;  2V4H A;  3V2R A;  2JWA A;  2KSE A;  3N4X A;  4H13 B;  1J1D C;  2PP6 A;  4JQ0 D;  2QJY B;  1VQ5 P;  1JOC A;  1GK4 A;  2N1T A;  1KIL A;  3WU2 H;  1W5C E;  4KT0 J;  3I5C A;  1CW5 A;  2KOG A;  1ZW0 A;  5TJH A;  4K3A A;  2JWD A;  1FZC B;  3H1L E;  1NWQ A;  1TU3 F;  5H2F H;  1KYO D;  1NTK J;  5CJ0 A;  1U7M A;  4HJG H;  3P8M C;  1SQP J;  1R5L A;  3G9R A;  2W6A A;  3E1I A;  1FAV A;  1T8Z A;  3LID A;  5BVZ A;  4CPG A;  3N7N A;  3EWK A;  3F89 A;  2NPS C;  2AXC A;  4A7P A;  2OYI A;  3SFD C;  3RL0 C;  4OGQ C;  1P84 D;  2KXP B;  4PD4 I;  2POH A;  3SFE C;  2VRS A;  2Q3I A;  1KTM A;  1LT1 A;  1J1D B;  1DEB A;  4C7R A;  5AVV B;  1IFN A;  3G3Z A;  2KS1 A;  3H1I J;  2OGU A;  4ASW A;  3B4S A;  3L36 A;  4YXD C;  1URQ B;  4OVN F;  4UB6 E;  1X79 B;  1NH4 A;  1SFC D;  2AXT E;  3K5B A;  1BE3 J;  1LP1 A;  1L0N E;  3USS A;  2WSE H;  5KAI E;  4BRY B;  1LWU A;  3HE5 A;  3SWY A;  4I7Z C;  2H89 C;  1XTG B;  3H32 B;  3AE7 C;  1HH0 A;  5M1B A;  2IFM A;  1NAF A;  3GHG B;  1NU1 K;  5KLI B;  1M8O B;  4O9B A;  2I8D A;  1FBM A;  2ZJS E;  2IFN A;  3P7K A;  3VMY A;  1N7L A;  1N7S C;  4RES B;  1RF1 A;  1IFD A;  4TT3 H;  2LKM A;  4W7Y A;  1KN7 A;  1LTG C;  2YIU B;  1AVY A;  1M1J C;  1KYO I;  1BCC E;  2HR3 A;  5KKZ C;  3AE5 C;  1OIP A;  1CI6 A;  1PGO A;  2FFD A;  2ZT9 D;  1KIL E;  1GL2 A;  1HBW A;  2GUV A;  2N9B A;  4NPE A;  1L0L G;  1J1E C;  1OMI A;  4I7Z B;  1ZN5 A;  3L71 E;  4YXW H;  5AW5 B;  1SQV D;  1K9M Q;  2FYN C;  1L4A D;  4DCK A;  2CPB A;  2WVR A;  2QSI A;  1SQV G;  2K9J B;  3FWL A;  1NTK E;  3MP7 B;  1P84 I;  1KQG B;  3QWO C;  3L72 D;  1L0N D;  5AVY B;  3CCE P;  1N7S B;  4M3L A;  1YHQ P;  4L75 A;  3MD0 A;  3VP9 A;  2ZVO B;  1NTM G;  2IBZ E;  3L72 G;  3WU2 E;  1L0N G;  2XNX A;  5C39 A;  3O6Q A;  1L0L K;  2ZYD A;  2W8Z A;  1W2E A;  5H2F E;  2WT7 B;  3V6I A;  3GLM A;  3CCS P;  1PV3 A;  1M1J B;  2KSJ A;  2XU6 A;  3CX5 H;  1EDI A;  1YI2 P;  3B5N C;  4N3Y B;  3VP8 A;  3GMA A;  5AW7 B;  2DW3 A;  4WY4 A;  4I1L A;  4H0L D;  3I55 P;  1RE4 A;  1LT9 C;  1NTM K;  2E75 D;  4DT0 A;  1NOH A;  1N73 A;  2Q3E A;  4H44 B;  2WTY A;  1JY3 P;  2P58 A;  1OW6 A;  2ZXE B;  4ASV A;  3L73 J;  2BEZ F;  3TK1 A;  3RGU A;  2WPQ A;  1GMJ A;  1BCC D;  1BSH A;  1SQX G;  3H1K J;  3HUS C;  2N1T D;  4WB4 A;  1KIL D;  1BE3 E;  1BCC G;  4ZKP A;  1FDM A;  1K04 A;  1JY2 P;  3H1H E;  1KD1 Q;  1QX8 A;  3L71 D;  3PHL A;  5B66 H;  2JEE A;  1VDF A;  2C9L Y;  1SFC C;  3RK2 C;  3KDP B;  1AJY A;  1NTZ K;  1JEK A;  3FXD A;  2YXR B;  2KNC A;  2WPV B;  3MZW B;  1NTK D;  3S9O A;  2OYH A;  2H7H A;  3AEG C;  3KHU A;  1SQX K;  3H1L J;  1NTK G;  1G1I A;  1PPJ E;  1PGQ A;  2G8Y A;  2IBZ D;  1T6A A;  5KLV E;  3T97 A;  1VL2 A;  1GDT A;  1SLQ A;  2J5U A;  4Y99 C;  2N9Y B;  4BWN A;  1NHL A;  3MTU E;  1SQP G;  2P10 A;  2IBZ G;  2NPS D;  3UIA A;  5CMZ A; 
#chains in the Genus database with same CATH homology
 4DOJ A;  3RL0 D;  3EQ2 A;  1A02 F;  3HE4 B;  3CI9 A;  3U1C A;  3PP5 A;  2IPP A;  4EOT A;  3HD7 D;  5KLV K;  2YMY A;  1HUC A;  1QL2 A;  1LGH B;  5BU5 A;  5CCH D;  1YYC A;  2XZR A;  4C7N A;  3OJA B;  2OYI B;  1CI6 B;  4WBA A;  1DH3 A;  1MZ9 A;  1SQV K;  4WY4 C;  3V2R A;  1GL2 B;  1FZG A;  2HOD A;  2O01 H;  1GU4 A;  2QM8 A;  5APU A;  1SVF A;  1IFI A;  1RE4 C;  2JJL A;  3N4X A;  1J1D C;  2PP6 A;  3HTK B;  1SFC B;  1SQP K;  2HYN A;  1JOC A;  3VOP A;  1J1E B;  1N73 C;  3O8Z A;  1GK4 A;  2N1T A;  1KIL A;  3BVH A;  1L0N K;  3KYQ A;  3NXS A;  1PFI A;  1DX7 A;  3I5C A;  2C0W A;  1GW4 A;  1CW5 A;  2KOG A;  3U1A A;  3EFG A;  5KJ7 A;  1FZC B;  1NWQ A;  2PAJ A;  2WWW A;  4JYC A;  1M7L A;  2P67 A;  5CJ0 A;  3M06 A;  2M3B A;  1G1J A;  1N7S A;  3OAK A;  2WSF H;  1IFM A;  1L4A C;  5AW8 B;  3P8M C;  1JY3 N;  1N2D C;  4HH2 A;  1OXZ A;  3H6P A;  2W6A A;  3E1I A;  1FAV A;  1JY3 O;  4B86 A;  2M8R A;  1T8Z A;  3M0A A;  3HE4 A;  1FZF A;  3LID A;  5BVZ A;  2I1J A;  2YO2 A;  3TYY A;  5CCG C;  2WT7 A;  3N7N A;  1KFM A;  1N86 A;  1LTS C;  1M1J A;  5CCG A;  1T3J A;  2NPS C;  3LW5 H;  2WIT A;  3V2P A;  1RF0 A;  2OYI A;  2OYH C;  3RL0 C;  2I1K A;  2YNY A;  3B5N B;  5APS A;  5KTB A;  1JY2 N;  4WY4 B;  2POH A;  1OWA A;  4N6J A;  1RE3 C;  3HD7 A;  1SQB K;  1GU5 A;  1ZR2 A;  2VRS A;  2Q3I A;  1LTB C;  1J1D B;  3NMD A;  4AUW A;  2KLV A;  5CCH A;  1LTJ C;  1DEB A;  5AW6 B;  1LT9 B;  5AVV B;  4C7R A;  2H8P D;  1IFN A;  2KYV A;  2YKO A;  4W7Z A;  1ZLL A;  3G3Z A;  1FJK A;  2C0X A;  1NKZ B;  1GL2 D;  1IFJ A;  3L36 A;  1URQ B;  1JTH B;  3TSI A;  4LC1 A;  1EQ7 A;  1X79 B;  1NH4 A;  4IFF A;  1SFC D;  1T2K C;  2Z5I A;  5AVS B;  3HUS B;  2XDJ A;  1L4A B;  3CL3 D;  2WSE H;  5AW9 B;  2FFD B;  2L5G B;  1LWU A;  1NTK K;  2FYU K;  2Q9I A;  2WSC H;  3L37 A;  4DZO A;  3HE5 A;  3SWY A;  4EIJ A;  3V4W A;  2N1T C;  2W6B A;  1X9V A;  5AVR B;  1KIL C;  1XTG B;  3H32 B;  3RK2 B;  1JCD A;  1HH0 A;  5AW3 B;  2IFM A;  1MUU A;  1NAF A;  1WT6 A;  3GHG B;  1NU1 K;  3MUD A;  5KJ7 C;  4O9B A;  5APY A;  2OYH B;  1FBM A;  3B5N A;  2Q7C A;  1G2C B;  3SWF A;  1KFN A;  2HLO A;  1HWT C;  2IFN A;  1NKN A;  3R2P A;  3P7K A;  3VMY A;  1N7L A;  1N7S C;  4RES B;  2GM4 A;  2A45 G;  1HGV A;  3BRT B;  3KQG A;  3VTP C;  4AQR D;  1LT9 A;  1HJB A;  1KQL A;  4Y99 B;  1RF1 A;  3RK3 C;  2J58 A;  2R5D A;  3P8C E;  1IFD A;  4GIF A;  2LKM A;  1CZQ A;  3BAS A;  1IC2 A;  4W7Y A;  3VMZ A;  3B5N D;  4W80 A;  1LTG C;  4WY4 D;  2WZ7 A;  2MJZ A;  2ZFC A;  3V4Q A;  1HGZ A;  1URQ A;  1Z56 A;  1JTH A;  1M1J C;  2HPC B;  4GT1 A;  1FJP A;  1E5W A;  1RF0 C;  2OYI C;  3MIW A;  1IK9 A;  3HUS A;  1CI6 A;  3IR9 A;  3BRV B;  2FFD A;  1GD2 E;  2HOD B;  3V2N A;  3HD7 C;  1GL2 A;  1H89 A;  1HBW A;  1AFO A;  2GUV A;  2N9B A;  3M0D A;  2Z5H A;  2A45 H;  4N78 E;  5CCH C;  1J1E C;  1ZN5 A;  2Z4E A;  1URQ D;  3HTK A;  5AVQ B;  2N1T B;  1SFC A;  1KIL B;  2WPR A;  1N73 B;  5AW5 B;  3M9B A;  3GHG A;  1SP4 A;  4XE5 B;  5AW1 B;  1WRG A;  1LTA C;  5AVU B;  1L4A D;  1S9K E;  2CPB A;  3A2A A;  5AVW B;  2W27 A;  2O1K A;  1FZC A;  3V5B A;  1VPC A;  4KHX A;  1G2C A;  1J2J B;  3CLQ A;  3IFM A;  1FZA A;  4I6M C;  2P1J A;  5AVY B;  3B8E B;  1MFZ A;  1N7S B;  2HFE D;  3II6 A;  4M3L A;  2IX7 C;  3RK2 D;  3MD0 A;  1YTZ T;  1ZR4 A;  3VP9 A;  2OAR A;  2P7J A;  2R5B A;  1QL1 A;  3VMX A;  3BAT A;  1LWU C;  2XNX A;  3RK3 B;  4GKG A;  3L4F A;  1L0L K;  1SQQ K;  4C46 A;  1IO4 A;  1W2E A;  1AQ5 A;  1GTW A;  1KZU B;  1FZE A;  2J59 M;  2E43 A;  2WT7 B;  1FU1 A;  4IFM A;  5APT A;  2E42 A;  5AW4 B;  3TNU B;  4HYT B;  2HPC A;  1M1J B;  2R32 A;  2KSJ A;  2XU6 A;  3A5T A;  3B5N C;  1HTL C;  2NPS B;  4N3Y B;  3VP8 A;  4JF7 A;  3C9I A;  3RL0 B;  5AW7 B;  4ZKU A;  4WY4 A;  1JMM A;  2BAS A;  4AYC A;  3HD7 B;  1A02 J;  4I1L A;  2WPS A;  3M91 A;  3LIE A;  4IFD K;  1RE4 A;  3P8C D;  2R3C A;  1LT9 C;  1NTM K;  5APX A;  3HRN A;  5APQ A;  1RF1 C;  1NOH A;  2YO3 A;  3MGN A;  1FZB A;  1N73 A;  2WTY A;  1JY3 P;  1LTJ B;  2ZXE B;  1T2K D;  3KPE A;  1H88 A;  1ZV8 A;  2QM7 A;  2YKP A;  3TK1 A;  5AVT B;  2WPQ A;  1LTT C;  5AVZ B;  1GW3 A;  2C9N Y;  1RY3 A;  1URQ C;  1JNM A;  5APW A;  2CPS A;  3OA7 A;  2A45 I;  4LLH A;  3M9Q A;  2XV5 A;  3HUS C;  5BU8 B;  2N1T D;  4WB4 A;  1KIL D;  4JYB A;  5CHX A;  4LGD E;  4C7N B;  5CJ4 A;  2FFD C;  1X8Y A;  1FOS E;  1L4A A;  1GL2 C;  4ZKP A;  1CSB A;  1FDM A;  4N78 D;  1JY2 P;  1LWU B;  3M0D C;  2XKM A;  5KJ7 D;  1LTI C;  1XTC C;  1JUN A;  3HE5 B;  3VN0 A;  1GZL A;  2JEE A;  1VDF A;  2C9L Y;  1SFC C;  2Q5U A;  3RK2 C;  2YKQ A;  3KDP B;  2P2U A;  2H43 A;  1NTZ K;  5AW2 B;  4OH8 B;  3H32 A;  3TNU A;  1S9K D;  2HG5 D;  2O1J A;  3GHG C;  3A7O A;  1JO5 A;  3L35 A;  1N7S D;  1HVV A;  1JCC A;  2FXM A;  3NTN A;  2NPS A;  2GUS A;  1FOS F;  1FZC C;  2OYH A;  3RK3 D;  4I2L C;  2H7H A;  5APV A;  1SQX K;  1NO4 A;  5AVX B;  1H8A A;  3NFQ A;  1JY2 O;  3M9H A;  3V2Q A;  1G1I A;  1T3U A;  1MV8 A;  1RE3 A;  3P32 A;  3T97 A;  2FKW B;  5AW0 B;  1IJD B;  1GDT A;  1GK6 A;  2KP8 A;  1SLQ A;  4Y99 C;  3A3Y B;  3VYI A;  5CCG D;  2KB7 P;  1NHL A;  3WMM 0;  3MTU E;  3U59 A;  1RF1 B;  1LTJ A;  4XA4 A;  2FYZ A;  1YTZ I;  2NPS D;  3UIA A;  5CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...